1UT1A

Drae adhesin from escherichia coli
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
140
structure length
140
Chain Sequence
GSFTPSGTTGTTKLTVTEKCQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCDARQVALKADTDNFEQGKFFLISDNNRDKLYVNIRPTDNSAWTTDNGVFYKNDVGSWGGIIGIYVDGQQTNTPPGNYTLTLTGGYWAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DR HEMAGGLUTININ STRUCTURAL SUBUNIT
publication title High Resolution Studies of the Afa/Dr Adhesin Drae and its Interaction with Chloramphenicol
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
total genus 27
structure length 140
sequence length 140
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2003-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04619 Adhesin_Dr Dr-family adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1570 Mainly Beta Sandwich Immunoglobulin-like Dr adhesin 1ut1A00
1USZA 1UT2A 2W5PA 2JKNA 1RXLA 1USQA 2VERA 2IXQB 1UT1A 2JKJA 2JKLA 2BCMA
chains in the Genus database with same CATH superfamily
3RI5K 1DLHA 1V7NL 3WTTA 4MCNA 5F1KC 1E4KC 5E2VL 4YHYC 4UOZA 4BHUI 3HHMA 3B5HA 4M8VA 2YUZA 1YCSA 2GBTA 3FU3A 3MACL 3SKOA 4FZ8H 3S2CA 5AB2A 4IBUA 4JO2L 3CMOL 3U1QA 3ZRFC 4FZEL 4JAMA 4M43H 2ZOUA 4JPKL 2B2XL 4PBDA 3HI5L 4F7PA 2AV1B 4HV8A 4TUOB 3T8VA 1U3JA 3V52H 5B39B 4P48A 4P2RB 4OZIE 1FHGA 4JHAH 2XG4A 2P8LA 5I1AB 4KH9A 3RWEB 1JVKA 3TWCH 3K2UL 5F3FA 1CGWA 2EEXA 2WD0A 1UWXH 5L7XL 3B2MA 3FQWA 4JM2A 4XMVA 4X4ME 1QATA 1Y7VA 2V9QA 3MRMB 2PYFA 4HUVB 3BVWA 3DUSB 3UABA 3T3PB 4JDTH 4YH6A 3H9SA 3ETTA 1U3HD 4FFZA 3S96B 3FU0A 1FJ1B 3GYRA 4UNTA 2C1PA 2PWGA 3WI9A 1N3NB 4WHCA 2F8IA 1O5DT 1V10A 3QEUA 3OKYA 3K7UA 4O02A 1A2YB 3BCDA 3QUZA 3VCLA 4NN6C 1XGQA 5DI8A 5T3XE 4YN3A 5DJ2B 2YPVH 4HDIA 1M6OB 5ANME 1UM5L 4L05A 1KB5L 4P2OA 3GSUB 3GM0A 4NCDA 1JPST 4PRPE 4DTGH 2H1XA 2NT0A 4UNUA 3NCJH 5CJXC 1CYWA 1QNIA 5BQDA 2ISDA 4XXDA 2ZG3A 5JXEC 4XMKH 3LKRB 3ZT6A 3T0BA 1UD3A 5EIIA 1NMAH 4MMZB 3MUZ1 5DA4A 4M1DL 3IJHA 4EEEA 4PLNC 1ET8A 4OZFH 4L18A 2CCWA 2VRAA 4E9VA 3MRPA 2D0FA 2MNUA 3HZMB 1QYGL 4ZDHB 1CDYA 5KBPA 4NQEB 5FA4A 2JKJA 4Z18A 1VGKA 4LEXL 3GUTB 5IIEA 1ACZA 4JHZA 1EANA 1OM3L 4UI2A 4YX2H 2GK0A 5T1LD 3OZKA 1KF9B 2R2EA 4KI1A 1BFVL 3TO4D 3TYGH 5KVEH 3L54A 3T65A 3VQLA 2B5IB 1CU4L 2W0FA 2JK5B 2YMOA 5MEOB 3BISA 2B59A 2B39A 3KCWA 3PGFL 2JIXB 4HUUB 3ARWA 1F1GA 3LH2H 4RLDA 1R75A 2X53A 4TVPD 4JFYA 3MGAA 4QNPF 3FU8A 5JUEH 3H7BA 3KCPB 2HJFA 2LOEA 3DJZA 2X4QB 3EGXA 1FZOA 2VZOA 4YGAB 7FABH 3S35X 3EH5B 2ORBH 1CGVA 1NDMB 5D1XA 4ENED 3ZE1B 3N1MC 5E6UB 3JV0A 5DEGA 3ECQA 2GSGB 1SM3H 4UU9B 4K94C 4OGQC 1W15A 1BJ8A 2B16A 3E0GA 3KPQB 4Y19E 2XTSA 1OSPH 3F84A 1EHLH 4LPYA 4PJDF 4XPTL 4MDJA 2R8SL 2J71A 2XA3A 5FO8A 2V9TA 2WIIB 1I1YB 2G9HB 4OM0L 4U7MA 1AS6A 4N2BA 1OAQL 1YY8A 1IBHA 5IMKB 5IQ7H 2XTLA 2OULB 2ZUSA 4P5RA 4ONFH 5GHWH 2IWGA 3TASA 4FDWA 5KZCD 3IJYB 3L4VA 4B0MB 2F1EA 1SXZA 1G1YA 1LO5A 3ZE2F 3RDTC 4GP4B 1MCLA 4R2GC 2F54D 4F7EA 3PWPE 1UT9A 4H8WC 5EV7A 4R7DA 5EU4B 2XY1A 4GI9A 4R4BA 5CCKH 2VJ8A 2VLKB 2HX7A 4KNQA 2MMXA 3G5YA 3B9EA 4OJEH 3CFCL 1G0YR 1R5VB 4MAYC 2D03L 2N1KA 1NMBH 1XL4A 3UIZA 3CFBB 1A64A 2VDMB 2IDQA 1KGCE 5KJRH 1GKOA 4L23A 4UILL 5T3ZE 2DH2A 1WZ1H 3MODL 5CHNA 1V7MH 2R4SH 3BPOC 2ITDB 4OZ4B 1ZA3A 2HFGH 1B9ZA 3G5ZB 3ALXA 1LEIB 2VDOB 4GQZA 2A1WL 2EICA 4JZOA 1YUHA 2P44B 5TDNB 2Q87A 5I1HL 3TF4A 4NRYB 3TA4D 3MXWH 4QYOA 2W60B 3VO0A 4Z8FH 1FPTH 3MV01 2GK2A 2X10A 4NC1E 1P84K 3CDZB 5D7IA 2A74B 4Q58C 1AJ7H 4FMVA 4HP5A 4DO4A 3UTZB 3U2JA 5L6YL 1NC4D 1NKGA 1QBAA 4YHLL 3R1GL 3DURA 2CIIA 1AO7E 2XT1B 5MI0B 4PJ8B 2HP4A 3QIBB 5JIMA 2YGNA 1GPOL 1OB1B 4FP8H 2N0KA 1AZRA 4HJJL 4A2GA 1I8IB 2WXMA 1JPTH 4FABH 4HLJA 4DUXA 2L8AA 4PBVC 4JM2C 3HHRB 4RA0C 4J39A 3GSNH 2BVQA 2GJ6D 3M7OA 4LIQH 4P2RE 4YE4H 1JNHB 5KYUB 2AAAA 3FO2A 3P9LA 1BQHG 3ZDYF 1SNRA 3I2CH 4TVPL 4CL7A 2FIKA 4ZG1A 3OHXB 5IHZB 4MNQD 4E41A 3HNVL 2BVTA 5HI3D 4HWEL 5I26A 3FFDB 3DJ9A 4XOAA 1XXDC 2H3NA 2VLME 1FFOA 2APSA 1VZIA 3EDEA 4AQAB 3L4YA 4OI8A 3QUZC 3T3PE 1O5PA 4GBXA 4OD1H 1NLDL 4PR5A 3T2OA 4YXLH 1NCIA 1U8HA 4P2OC 4AW4A 2B7DT 4GI6A 2XWJA 3UC0H 3Q9PA 3OL2A 3OXSB 5IUSA 3DO7A 1RULL 3GSVA 1QSEB 1UXSB 3TEXA 3G5VB 3S8FB 4YAQB 1N18A 4KNTA 3WG7B 4LOVA 2YLHA 5E56A 5FUZH 1E65A 5IHHA 3ALPA 4LLDB 4OZHE 3SGDH 3TTYA 1HFUA 4S1SL 1JTPA 2TSBA 2JF1A 2QT6A 4YQXH 4R96B 2F7QA 5KSBA 3PHSA 4J3OH 3SO3B 1ZCRA 4XAWH 2WYZA 2C4XA 2KDGA 5MHSD 1B0IA 1OAUL 4YSDA 3EXJA 2XFXA 4A1RA 1G7IB 5E0QA 5A2BA 5D1ZA 1BVKA 3VU1A 2R83A 3VXSA 1J12A 1S7TA 4BFBD 1X4ZA 4TNEA 1JWUB 2NNAB 1YY9D 3B9KB 3EUDA 4G6AD 2G5BA 2X7LB 1KIUB 1G6RA 2BNQA 4JLRA 1BD2D 4YXKH 4W9GC 2W5PA 3FF7A 5BV7H 5GZOD 2HVJB 4HCGA 5AD0A 2QQNL 2Z92A 1TKWA 3VM5A 4WU5B 4G59C 2CCLA 1WVZA 4OLVL 4TN9A 4FKKA 4YDLC 1HH9B 3ARGA 3H56A 1AQDB 3HBQA 4H25B 3L4ZA 4CSSA 5EOQL 4Z95H 3ML9A 3V5KA 2CMRL 3NJXA 3FT4A 2DIAA 4MZ3A 4YHKL 2IIJA 4UBDD 4XN1A 5EBWA 3PF2A 4BQ8A 1Z2KA 3MYJA 4FQIL 3F62A 4LMQI 5DJCB 3QUXB 1TG8A 4R7LA 1GGUA 4ZX5A 5D1XC 4FKHA 4DK6A 4NKDB 5FHBL 3WEXB 3VW3L 5ISZD 3BVVA 4LF3B 1E6JL 1JZJA 2DKMA 1HXMA 4U1LA 4EJ1C 2W59A 1OW0A 5IHUL 1K6QL 2NW2B 2Y1ZA 2HJLA 1TTGA 2BCKB 5B1KA 3GLAA 3W9DA 4BZYA 2V2TA 3IFOA 1JHLL 1QBBA 1U8QA 1INEL 3QFJA 1I1AB 4KAQL 5D7JD 5G4MA 3ZE1E 4ZXBA 4LLMB 3NQKA 1J0YA 1AHMA 4U2YA 3IDNB 2VR8A 4D9LL 1PS3A 2BHUA 1FGNH 5EOTA 3ZHDA 3OVUB 3QNXA 4BBWA 1C12A 4XGZB 4Z78A 2CRYA 4KTYA 3BAEH 4UWQB 3NGBB 3U9PL 3VJ6B 4MD5A 4ZFGL 3NSXA 1SEQL 4GY4A 4AE0A 2G5UA 4CNIB 3SE8H 2PABA 1CR9L 3SCMB 1BMWA 3GB7B 4NKIH 2V3DA 1OTTD 1UWXK 3QXVA 4EDWH 1BQLL 2RALA 3DRTA 4ZD3H 4HSCX 3OXRB 1NUFA 1JGVH 3U7WH 4KI5E 1RIHL 3LKNB 5FLVA 2BHZA 4WI0A 4FNSA 3H9ZA 1KJVB 2AK4A 4C57C 3IU4H 4L3EB 1GGBH 4E9YA 2WAQA 1AXTH 1D5XA 4HK0B 1FNEA 2GTZB 1MJJA 1EJ8A 1CVRA 4PJXB 5EC1A 5A16B 1GGCH 4Z3IA 1DE4B 2VH5L 4QPEA 1K5NB 5EU5A 1I3VA 4EI5A 4U0RB 1HWHB 3T1FA 4HQQL 3EHBC 1DQLL 3B2VL 1H3UA 1Q9LA 5E5MB 3CXDH 3L5WB 4X9IA 4ELMF 2R56L 1R4XA 3UFIA 1D9KD 1BEXA 2WUBH 3QIUD 1MFUA 3LIZH 2ODIA 1F6FB 5CD5C 5F89B 2X4NA 1OV8A 3ZTNH 3WEBA 1I9IH 1GGYA 3KYMB 3ZVVA 2C1OA 4P9HC 4H8HA 4OGZA 5I2IA 5I1IL 4HOWA 3RG1C 1N6VA 5KJ7E 1E4JA 2IAMD 2YMTA 1WA2X 1RK0B 3CH8A 3J07A 2PNDA 3KPSA 2OR8A 3AG1B 2DL9A 4HU8A 3WN5A 1TZIB 1KBGH 1DN0A 3K4ZA 1QQDA 1T20B 2BP0B 3NCMA 4NQSA 5F7KC 4TUUA 4HKBA 2PR4H 4HX1B 4KKNA 4Z7OF 1CUOA 1G87A 2BMKB 1UH4A 3B56A 3ZE0F 5D7EA 5TE4H 3TC9A 1PF3A 4PJHA 2H8PB 1ONQA 4PWFA 1IL1B 1LXMA 3CHPA 2YAEA 5BUPA 1SY6L 4FLOA 3BP5A 4KVNH 5C0NC 1VZGA 4HJSA 5KBMA 5DZLA 1T4KA 3HN3A 1UHVA 4FQQB 5E2TH 3HMXA 4GBXC 1KJ2A 3P0YL 5EEYA 1UB6B 4FXLA 3V6OE 4DZ8B 3MFGB 3QNYA 3DK2A 4K3DH 1TVBB 4XPAL 4X2UA 2XKUA 2CDGB 4Y1AD 1C7TA 1ZVHA 2VIRA 3VXMB 5IJKA 4WUUD 5TF1L 4RRPG 2AI0L 4NJAH 5HHMD 5CSZA 1BVZA 4G6ML 4JJ5A 3CH1A 4WU7B 4IKNA 1H9DA 1AI1L 2NX5B 3EYVB 4HHGA 3QR2A 1LQSR 3K8MA 2HFEA 4KKAD 4UM9B 3VFSA 3HR5A 4ZPVB 2CO7B 2JKIS 5D1ZC 1UJ3A 1NGXB 2VLJD 1KTRL 1Q9KA 3TYFA 1ZT4A 4A2HA 5CNHA 2EEAA 5KVDE 1PCXA 3OBAA 5MERB 1MFNA 3QWRD 2YPKB 1AD9B 3IMRA 1HQRB 2J20A 1MHHA 4NZ8A 5I0DA 1U8IB 1F3DJ 1KC5L 1LO3H 2FGWH 3EFDL 2XNAB 3VA2C 2YZ8A 4EOWH 2WXRA 5ICYA 4EVNA 1BMZA 2BC4B 3ARGC 4QJ4B 5I1JH 4WSKA 4L4VD 4HUWA 1KYFA 4GAJL 3FJTA 2FR4A 1E3FA 3QUGA 3SGEI 1UATA 3KPTA 1L6PA 4AEHH 2YBRB 3LQAL 1RPQA 4PRHD 4PJBA 1ZLSL 4E9XA 4JRXD 2DWTA 3SYOA 2CLZB 2X9XA 3L08A 4X4XB 1A1MB 3KWTA 3L2MA 4ZJ9A 1SYSA 4NERA 3MOAH 3K6OA 1XTMA 3DRQA 1OW0C 1JF1B 3NK3A 4HPOH 4XHJD 3ZKQD 4CC4A 4ZMQA 3EJPA 4PG9B 4GRLB 4FNLH 4G7VL 1B0GA 1U8LA 2JB6A 4Y2DD 2EEFA 4ZXBC 1NC2B 4U6XB 4CVWA 1F90L 3HZKA 1FL3A 1V3JA 4NDMB 5IGXL 1M05B 1C5DA 1QSFB 1KN2L 4KHTH 2Z35A 4HIEB 5FYJD 3WKMH 4MJIE 1YEFH 4ETYA 5C07A 5GS2D 4JKPL 3RURA 1H8OA 3RL1A 2K1MA 3DROA 1PGRB 2WQWA 2GSMB 5L2KA 2EE0A 2IV9A 5C0EA 3GK8H 4QWWD 2CDEA 3EZJB 1YECH 4R90H 2MCPL 5FWRA 5I0XA 3REWA 3K6FA 4FG2A 4JPIA 5HHPB 3UL4A 3EG9B 4YEFA 3G6JA 5D93B 1JNNL 4GRWB 2AQPA 4F1SA 4DP8X 3BUYA 3D85D 3GRGA 5BQ7B 1Z1WA 4JFOA 3BPNB 4PJCF 2XIDA 4NBXB 2F74B 4J3BA 4B60A 3CNKA 3EO1B 3HLKA 3EYOB 3LEVL 3V8OA 1L9TA 3TFKC 2EDHA 3JUZA 1OQOA 1Q72H 2A3TA 4D9RE 5L0QC 1O7VA 1T5XA 5B3JE 4LVNB 5D7KD 2BVEA 3Q6FA 4EKJA 3C75A 2FDBP 4DKAA 3P69A 1IQWH 5E9AA 5F88A 4EI5C 3DVIA 3KPOA 1AE6H 4KXDA 3MRGA 4L3EE 3VE0B 4IBTA 4KTDL 5E2WH 1TIUA 2X1PA 3MRDA 4KXAA 2HUEA 2J55A 1TJHL 4RX4A 4Y5XA 5FA3A 5FV1L 2EKJA 4TYUA 3UYPA 2ICWI 2OXHB 5TDOB 3FUJA 3LQZA 2YK1L 5CZXD 3VYNA 5J8OA 5F9WC 3FXIC 1QPXA 5EBLB 3LH9A 3X3FH 4MA8H 3FUHA 5E08L 3BQUA 4JFWA 2OJEA 1QLRB 1Y18A 3FFCD 2UZIL 2WXKA 5FKAA 3S0PA 3WN5C 4ZUSA 1DVTA 3O3EB 5LLIC 5CU9A 2B1AL 4BQCA 1BWMA 2ROYA 1TVDA 1NGQH 2XVGA 2XZAL 1J8KA 2UZPA 3Q8CA 3OC8A 3QWOA 1KFAL 3DX3A 4UTBH 2ATPA 4G7QB 1OP9A 6PCYA 1AG6A 2Z8WC 2P7TA 3F2LA 4P4RB 2V8LA 4R5XA 1R47A 1FV1B 3MCYA 2R51A 3LMJL 3VFWB 4AWJC 1U4FA 1BQUA 1YC8A 1RUMH 2Y06H 3VH8B 4DEPB 1ZD6A 3US9A 2BNUB 4MB5A 4U7KA 1K3IA 2HN7B 2ADGB 5E00B 1XBDA 2K0RA 5H35A 3DKHA 5KBLA 3VRLE 4P3CH 1D6VL 3BGFB 1P1ZA 1Z9SA 3HMWH 3MJGX 4GW1B 1ADQA 4PYGA 4ODHL 2VNCA 3SN6N 3UZVA 4B50A 3KHQA 5DK3A 4RDQG 1CF8L 2FD6L 3HKFA 4MQ7B 1ZTXE 1KLFA 1OO2A 5IJKC 1ND0A 4H8UA 3BWUF 5CLXA 5DLMH 3ESOA 4Q9CA 3B9DA 2FSEA 3IJ8A 5FYJL 5LG1A 3HI1B 1HC1A 2BLFA 3EO9H 1DLFH 3V6FA 2O5XL 1R3IL 5EU7E 1UJ3C 1MQKL 3G5WA 5CFAA 2OL3B 3BSZH 4N86A 4NAQA 2NX5E 5I66B 3C09C 2ZOLA 4LHUD 2ZUTA 4X6DB 4NI6A 1U92B 3U79A 4M1CC 4R0LB 2ZX9A 3LNIA 1ZT7A 4LL1A 5JIQA 2H0PA 1INQB 4O00A 3T4YB 3WIHA 3L1OL 1CXKA 1DEEB 5IESH 3U0PA 1NLBL 1A8JH 1XF4B 3LIUA 3FT3B 3DK0A 4WFEE 3POCA 4HJUA 5C0GB 2R2BA 2GJZB 4Y2OA 4ABUA 1KLGB 4DNLA 4MA1C 5MEPB 3QFDA 2LLNA 1UOVA 3D5OF 1U8OA 1IO4C 1COBA 5H37G 5SX5H 1KIQB 5F9JA 3MXVH 1ZEAL 3PWNA 5GSVB 4A66A 2BOBB 1WWWX 3KPPA 3DV6B 4C8XA 1XCQA 3NOIA 4JFDB 1EHAA 3FH8A 5IEKB 5LN4A 3K5SA 2OBGA 4IIQB 4CC4C 1UB5A 1X5KA 2ZP9A 1PJWA 3U1SH 4PUBL 4XPHH 3GMOB 1G7QA 1BWWA 3GXFA 2DJUA 1CL7L 4L5FH 4LEEA 4PBXA 4F20A 4YNYB 5LO7A 5T1MA 2EIJB 4NEHB 5B22A 4IS6A 2IGTA 5F3BA 1M2VB 4N0UB 1SJVA 3FTZA 4POZC 2BRQA 3NJKA 5F21B 4IIZA 1QSFE 4HJTA 3BMWA 1FVCA 5DK0A 3TA3A 4GO8A 1FDLL 3LH8A 4RWHA 1KELH 4XZ4A 5ALCL 2CSPA 2CR3A 3NZ8B 2NY3B 2BOCA 3NCXA 4LQFH 4H0LC 1E6OH 3PHQB 4YSRA 5E4EC 8CGTA 1FL5B 4JUSA 5SWZB 4WHTA 1OLLA 4BKTC 5IJBC 5KAQF 4WO4D 3CAFA 3WS3B 5I8EA 4XZUA 2NY5L 2XKNA 4KNUA 4BDVA 3MJ9A 1MHCB 1X5ZA 2BW4A 2HMIC 3A23A 3O2WL 2F5BL 3DETD 5ESQA 1SLWA 2Q6WA 4AVKA 4N2LA 5CR1A 3M1OA 5F72S 1V27A 1JFQL 3SD5A 2C9UA 4X0NA 1AACA 1MH5A 4Y5XC 1O9VA 1A3QA 1KLUA 1EMTH 2Q86B 1JERA 3QZNA 1HEHC 4PRPD 4QHLA 4EDXA 5DHVA 5HDLA 2HG0A 5ABZA 1DFBH 25C8L 4WW2A 1YEGH 2WQ8A 2WBJD 1MAML 3WY4A 3BQUC 3H3PL 3SODB 2WBWB 2PWDA 3QPKA 4DGYH 3GBNL 4KUZL 3VXUD 4H44C 4L8CB 5FGSA 3C8HA 3FRUB 1J8HB 3O4OB 4HMEA 4WFFE 1W0WB 4MVBD 1HHKA 4AYFA 2Q2LA 1KCSL 4GG8A 2R0KL 1UWEH 2CBMA 2AQ1A 5I1GL 2VMCA 3O0RH 1B6DA 4OLUL 2QSCL 4GEJA 3VSQA 4HZAA 3DPBB 4HA1A 4MD4A 5IKCB 3FULA 4ZPTB 4BYHA 4DQOL 1QFUH 5E8OA 2MHAA 3RWFB 2XDHA 3TEYA 1IM3B 3UAJA 1QKZL 2B1HH 4P4KB 1YEEH 3TEUA 1WBZA 4FQHB 4KWUA 3SJVA 2R1WB 3UH8A 1HL8A 4XN9A 1P7QA 3HB3D 1BM3L 3GSNA 4Z0XB 4ZXBD 3VI3F 3FHEA 3GKWL 2Z1KA 4LKXB 1LEKB 2EEDA 1EO7A 4TSCH 1J1XH 4ZTOH 3EFFA 4OF6A 3C12A 4M93B 3FAWA 5HYSB 4DK5A 3NIGB 5DHMC 2BIOA 1P0SE 1ZANH 1KJ3H 1PYWB 2BP8B 5JIDA 1M7DA 1RXLA 5HHOD 1B0RA 4IBWA 3CHXA 4Y19D 5EC2B 3RHWF 1AHWA 3W2DH 1IGJA 3Q01A 4FQCH 1R3JA 2NQ3A 3RPKA 3S4SB 4LT7A 1MRCL 2F7PA 2XTJD 1FLRH 1WUZA 4TUKL 5TE7H 1P4LB 5C0BA 1J10A 1T89A 4LFHD 1N8ZB 4NT6B 2EVJA 3TBCA 3N06B 1UKQA 1ULVA 1JXFA 1XO8A 4NQTA 4KKLD 5J6GA 4E5XG 3PJLA 1S7QA 4MJ4A 3PWPD 1S3KL 1JHKH 4WEBH 5GS1A 5LN8A 2EXYC 1MCOL 3E7JA 4J1UB 1EV2E 4X6DE 1ASQA 5DF0A 2X4PB 3I74A 3OB0H 2GC4C 5EN3A 3OGCA 2VRKA 4JANA 1CD1A 5EZOH 5FB8B 1AR1C 2Y7OA 4NP4L 5FDWA 1KGCD 4DSYA 3VDBA 2F19H 1MSPA 1OPGH 1T21A 3MLYL 5HI5D 3EH1A 5T3ZD 5DJ0B 2NY4C 3OSKA 3NQIA 1FSKB 2QTEA 1NGPL 4K3JL 4H20L 4MYPA 9PCYA 1UUNA 5AW3B 3MRFB 1NCAH 2YFOA 3W5MA 5DHXB 4AIZB 3QEQB 1RIVL 4XP6L 3KLDA 4JG1L 3L4UA 5A6IA 4K7PH 2H6OA 5CXPA 3EF7A 4GG6E 5DRWB 5GISL 5ID1B 1VRSA 4GUPA 4DKEL 1I7UA 1C5CH 1TQBC 3T71A 5IEHB 4LCYB 2FQFA 2P5WA 2JCCB 4L8BB 2YKLL 3PUCA 1UD6A 4A7VA 3H2PA 3RVWD 3BC9A 3IU3A 4X7CC 2R29A 3WUWA 1IKFH 1TJMA 2MOGA 3IVKA 4A68A 3WXWL 6FABL 3AQZA 3ZYIA 3SDCB 3MGOB 3OAYK 4LLQA 5AYTA 3TA3C 2ZUWA 1LP9E 1E9QA 1WFTA 4KQ4H 1G5AA 2I5YL 2UWEF 1JZEA 5CLTA 3VFNB 2YXMA 3IDXH 3TCXA 3RWJA 4ODBD 4Z7VA 5GS0C 3KMDA 2EQDA 4UDUA 1CT8B 1WF5A 5D2LB 1CWVA 2DWEB 2A77H 3S88H 4P2RD 3IFLL 3V0IA 5B4MC 1OGPA 4KXBA 3MUY1 2VW6A 4WO0A 3CLFH 5CEXA 1LMIA 1PY9A 1R0AH 5TD4A 3BJ91 2N7AA 1I7ZB 3CX2A 1GS8A 4BKSC 5T1KB 1TQWA 4LPXA 3VVVA 5IROD 5CUSL 2J43A 1VEOA 3E3QE 3BHBB 4KK6C 3K6IA 1A6VL 3WV0A 4JQXA 4XWOD 1R3HA 5B38A 4N8CH 3KS0J 3LN4B 5A2AA 3KL5A 2ESVA 1TFPA 1KGJA 3HZYA 4TNVF 3CZEA 3W9EB 4Y8DC 3QJTB 2WQRA 5DUBA 3TV3H 2WVUA 1RJLA 3DWTA 3KPNA 4U1KB 4XP4H 4WW2C 4XPFH 1F4HA 3L4TA 4F9LA 4H26B 4HOMA 1FCCA 1MNUL 1IBZA 4NUQA 5KSAB 1H3PL 4K15A 1U8KA 2DYPA 4RAHA 3VXOB 1X6NA 1X5MA 4HLZH 1AMYA 4LP5A 2ZP8A 2G75B 5DD1L 1A4KB 1F3DH 4Q7DA 4YO0A 4OVVA 5KANG 3RBSA 2NCEA 3QDGA 1NA8A 1P6AB 1TTUA 5ID0B 3LPFA 3JTTB 4EQ2A 5J12C 5D9SA 2VYRE 2YEZA 2EKSA 3C60B 3IPFA 1IGFH 2VN3A 2Z0BA 3MKKA 2WVVA 1W0YT 5EFIB 3RWCB 5B21A 2WXFA 4NQED 4A7TA 4LLWB 3T6QC 4GSXA 1CXHA 2VR4A 5E1AB 3FB8A 1BVNP 3CSPA 3UAJC 4G6KL 1O7SA 1XGUA 3KH4A 3O4LB 3CVIL 5DQ9A 2JE8A 1IQDA 4A7UA 3TBBA 2IPUG 1FAIL 1OCWH 4G9DB 5MP6H 3QR1A 12E8H 3QBTB 5E6YA 5IVZA 3S35L 5JNYA 4HEPA 2YOCA 4E9RA 1O6SB 1RQ5A 4NRXB 3AXLB 2Y5QA 2AQSA 4EE2A 4AC4A 2JIXD 3FMGH 3GZQA 5CGBA 3HPJB 1D5RA 3MV7B 2FWOB 4S2SB 1L7IL 4HHAA 3SDAB 3EYQD 4FYSA 3WFCH 2FEEI 2NY7H 4JW3A 3PABB 2ZCHH 1OF0A 1N0LA 4KGJA 4HCRA 4M1GH 2F5AL 2XZQL 4M8RA 2ZG2A 4XNDA 1AHWC 1IC7L 4E9TA 1AYOA 4HLEA 1QR1B 5EIIG 3QHZL 5FFLA 1T22B 3ZX1A 4CC0A 4GKSB 4M48L 1XZ0A 2GPZA 4ZUVB 1W0VA 2BFGA 3NIGE 4RGOH 4GAGL 2HH0H 4WJ5A 3P2BA 4ZOEA 3WIFA 2Q76B 3LB6D 3RNQB 1T89C 1DQJB 3CZNA 1T1WA 4J7RA 3RB5A 5BRZE 1JPGA 3D9AL 3JWDH 4UV7H 1GIGH 3FHQA 1YJDH 3JVFC 2KZ1B 3CQFA 5HGHB 5GS1C 1M71B 3VG9B 4X6CF 2HVKB 1BZDA 1LM8V 8FABB 3GTNA 3IJSB 1L9SA 2OZNA 2DEYX 3IKCB 4HPYH 2ZYSA 3QZOA 4LSSH 1X5LA 1RK1A 1S7WB 1V05A 3FTWA 2OM5A 1PLGH 1NBYA 3CMGA 4EIUA 1NBVH 2NUTB 2VLKD 4JFZH 5A2CA 1A3RH 4N26A 4AYSA 4Z7QF 4HS3B 2YC1A 3FU6A 1BEYL 2X6MA 5DVLA 1CI3M 5I15H 4R8WL 2G2PA 1OGAB 3B3IB 3DUUA 1TO4A 5F96L 1MOEA 4YDNA 2AMUA 1H3TA 1RIUL 2DI9A 4QCIA 1SDAB 4TVSa 3V4UL 5IFHL 3D4YA 2ICEA 4K5MA 5M94B 5C0RL 1TSRA 4NGHH 3TIDA 1CXLA 3C6SB 5GGTL 1DUZA 1RJCA 1XL6A 1NEZA 4BHUA 2QPFA 5FW7A 5C0AA 2GAZA 3PDGA 5F71A 2XN9B 4I3SL 4UZGA 4KJQC 3CFMA 3QEQE 1R34A 3CV5A 3UJJL 1NPJA 3BO8A 4RMVA 4TLTA 2AITA 4Y5VB 5F7AA 3QEHA 3A4FA 3P77A 4O2EA 4HT1H 2FJGB 1QAWA 1RLBA 5A2IH 1LK2B 3UO1L 1YAZA 5IB4B 2QQLH 4ANKA 3IGLA 2AF2A 2VN4A 3H2WA 3B7TA 3CPLB 1AOHA 1RUPL 4NQCB 2WZPA 5BV7B 2VUOA 1KCLA 3F04A 4S11A 3LVEA 1NL0H 1JYVA 4PJ8D 1OF2A 1PZ5B 3FB5B 4I4WB 4YC2C 3PGCA 3QIBD 5DA0B 2OJZL 1XZWA 2APWA 2J88H 4C58B 5L2JA 5CEZE 5J4MA 4AI7A 4K71B 2XWBA 1NBZB 3QUKA 5AW6B 5I82A 2FECI 4QRRA 4N1EA 5IVXF 3VFVB 4I1PA 4I89A 4LDCA 3H0TB 3PDOA 4LSVL 1BGXL 4JQXC 4R5TA 3UBXA 2YD1A 3RDJA 3OSVA 2VXQA 1OHQA 4G8GB 1SJXA 3EAKA 4AL8L 4JRYE 4QGYA 1MJ8L 5IY5B 4JFXB 5IB1A 5H4ZA 1BFOB 1FG9C 2HSIA 3RAJH 2OV0A 2WLIA 4LOUC 4F9LC 3MUGB 3UIYA 4WNJA 3FW6A 2L7QA 5L4FA 2FATL 4QOKA 1SJEB 3GWJA 5AVRB 1BF2A 3MU3A 2NR6A 3AGVA 43C9A 2P5EB 2DN7A 1QSED 4AQ1A 1MZZA 2GJRA 3M17B 5TFSH 3P4NB 4A2DA 2VAAB 2QVFB 4G1MB 1F6AB 3VQ2C 3MRLA 1KPRB 2HCZX 3DXAB 3QXAA 3GMPA 4FHJA 4HCIA 4IRZL 3UZQA 1QO3A 1MFAL 4NM8L 3CSBA 1NAKL 4CDHA 4CJ1A 2J1ZA 3NJJA 5I75C 3KEHA 2W81C 2P28B 5LAXB 1CLZL 3NPSB 5C0IA 4H5SA 3IDJA 1J11A 1AC0A 3U4EA 5EZJB 2BP3A 3B9KD 1UCBL 3V4PA 3K2IA 1WHOA 5EMYA 1VACA 1AP2A 1URZA 1HH6B 1IVTA 2DKUA 5TDPA 2W9DL 4HKZB 5GIRA 3BX7C 1VADA 1FHNA 4K94L 1TVHA 4YLQT 1UYWH 4U31A 4AMXA 3OV6A 5F8RC 3WJMB 4QRSB 2QFPA 5BXFA 1XV8A 1G7LA 1F42A 3JZ7A 4IOFC 4S1DC 3NIDF 3ECWA 5LGJB 5EOCJ 3T0VA 2P80D 3BP6B 5HYQA 2PCPA 3CIAA 5F1IA 2VDOL 1MKFA 4IHOB 5H8DA 1BXXA 2HFFA 3V55A 3KWUA 3MV7E 1EEZB 3QUXD 4GSUA 1NMCB 3GSRB 5DJYA 2GY5A 3H3BC 3CLEL 3BVTA 2BFVL 2YMXL 1LNUB 2VERN 3MLWH 3N9GL 3U6RA 3MUUA 4JFFB 3X11A 3LTVA 4LSTL 3V6ZA 4P07A 4CMHB 2XVKA 4A7SA 1ECYA 4Z7UB 4ELKA 5IMLA 4TTDC 5IB5A 4YHYB 4OFKA 2VERA 1C08A 4M3HA 4OJAA 1I1AD 4PLKC 1HNFA 3OZ9H 2OTWA 4F7MB 3PJSA 4DKTA 2UXVA 5GRUH 2OFQA 1EBAA 3WKNA 2NTFB 1HSBA 3VXPB 2IF7A 3KNBA 1A6ZA 3D08A 5I8CA 6CGTA 3WKPA 1BFVH 2YFNA 3BH9A 3O45A 1TQCC 2BWDA 3RVVD 2W07B 5GSRA 1IAIL 3VI4B 4C55A 2V7HA 5J7CC 3SCMD 2ENYA 3BRGC 3KM2A 1FYTB 1GW6A 3OWEA 5JHDB 1SRDA 4N0YH 1VESA 1BV8A 3B2XA 3D2UA 2MQ3A 1TCMA 4HKJA 3CK0L 3KYKL 1N7MH 3QI9A 4D9RD 1VGEH 2Y72A 3UJTL 3W0WA 5AW0B 4IDJL 4P9MH 5BZZA 4BELD 2ICEC 3V0WL 2YXVA 1RFDH 2FQEA 4PJ7F 4E0RA 1ACCA 3IDMA 4OBRA 4LLUB 4F57H 4L3ED 3OB8A 3HNTL 3FOMA 5C70A 3GMLB 2BIPA 2YD5A 4GOSA 1OGAE 5CIPA 1VLXA 5CZVL 3CXFA 3RFRA 3JWNH 3L3IA 4ENZA 2DQTH 2AJZB 3QHFH 4BRVA 4L0YA 2Y1VA 3AG2B 5BZWB 5EO0A 1I8UA 3ILEA 1KG0B 3KGRA 1T7YA 4AEFA 3CZFA 2BIHA 3FB6A 3GC3A 4YFLF 1PCSA 3HUJE 3J8F7 2R4RL 2ZAGA 5C2UB 2W65B 1VPOH 3HFML 5DWUL 1ICTA 1XD1A 1JOIA 4GMTL 3AG3B 3K2KA 5LCVL 2B3IA 1A9BB 4DQAA 1WV7T 1G4RA 3LKQB 4IBLT 2NTSP 2CLVB 1FH5H 1GZPB 2R69A 4N0CC 4NQCE 1EAQA 5DD6A 4PTTB 3W38A 4Y16A 1PQZB 1U2CA 4D0CB 2DI8A 1IBDA 5C0FA 4L1DA 3ARDA 1TCRB 1T2QL 2EDXA 5F1SA 4Q6YA 1E90A 2CXGA 5LBGA 4PV9B 3JV6A 4EZMA 5FO9A 2FX9H 4O58H 2O5YL 2E9IA 5K9JH 3F7KA 3L3HB 2QMKA 2AJ3A 3ARXA 3B6SB 3I6GA 2WHVA 4XPBL 2CQVA 2VLLA 3NFSH 1S7RA 4HFWA 4KRNA 3T4AB 2DD8L 4PRAA 3MRKA 4M62H 4G8GE 5CKAA 5DR5L 3II1A 2V5SA 2O26U 3SPCA 3HC3L 3H4FA 1BVLA 2AEQL 2IH3B 2J8UF 1E4HA 3MR9A 4NZUL 4UAHA 4XMLH 2NR6C 1EDHA 1UC6A 1Q4NX 3HE6A 4AQ1C 1C1EL 1I1CA 1OCZB 4L29B 4C54A 4GAYB 3KLHC 3UXFA 4KK5D 5EWIL 1BZEA 3VXMD 1ZLDA 1EGJL 43CAB 1JGUL 2B4CH 1JWMA 3O3AB 3M88A 3AREA 2AEPL 4KZEH 2GITA 3CVHL 1Q9OA 4WHDA 4PY8J 2NX5D 4J3VA 5FYLE 1HXYB 4PQXA 4YHNB 3HNSL 3RNKA 4M7LL 1A7PH 1NJ9B 4UM9D 1ZVNA 3GI9L 5IG7A 4PJDA 2VOTA 2XV6B 2ZOKA 1ROWA 3KWVA 1IGYB 2LAAA 1J1PL 2FEDD 4RNRB 2Q8AL 5IREA 4KTEL 2X12A 2O61A 3MRIB 2D7OA 4C59B 2OR7A 3L3DB 4HPHA 4GKZA 1JPFA 5F44A 4NFBA 4TPRL 4ORGA 5JLZB 3E6FB 3ME0B 5ACZB 5I18L 1RZIB 5ITFA 2AJXH 4XNXL 5I17B 2HX8A 1G9EA 2XJLA 3OKDA 2JQAA 2WYHA 5M7QA 2DMCA 1H15A 3VFMA 1ODAA 4MAYB 3ETBF 1G6VK 1WZKA 4RAUB 2NUPB 1OP5H 5D6CA 4KZDH 3QJOA 5A1AA 2DQHH 3QUYB 5AWNL 2VE6A 4NYLB 2OYLA 5GGUB 4KTGA 1YA5A 1T03L 3A67H 1OK0A 4MJHA 1JZIA 5EUOB 2C34A 4M29A 2Y3NA 5BOJA 3RGHA 4MASA 4XMUA 3ZRSA 2OMVA 1FYHB 4N2KA 3WCYA 1I3GH 2H5UA 1RHHB 4A6YL 5T5FL 1E4WH 2V7NB 4WNQA 2PCYA 3RWDA 3PJNA 4OW6A 4FC3E 3MLVH 4GRLD 4IU3A 1MCWM 2EIEA 4QRUA 1BZ9B 2EDEA 1NC2D 2A6JA 4JAMB 1QSFD 1Q0XL 1Q9WB 1R24B 2B0SL 2FHCA 4Z7UE 3SDDB 5AL0A 5DJDB 3CZUB 4F7PB 1OM9A 4HV8B 4XO5A 3L3OA 4HJGA 2ED7A 3LZRA 1OD7A 4XN5A 4FFVD 4J3WA 4LRNL 3ZZSA 5LBSL 3M1BA 3FQRA 3KS0H 2P8LB 2Y6TE 4BQ9A 4EKXA 2F8VA 3JWOL 3RE0A 2BY3A 4YFLI 4QXTB 3DGGB 4Z3HA 2WB7A 4HF5H 4H0HB 1S7UA 3D39A 4AVIA 3QI9C 2VQ1A 4PJEF 4PWIA 2WO4A 5JPNA 1Q1JH 5SWSA 1NOFA 1U8PB 4F7TA 1RUKH 2J4WL 3BEWA 1E8YA 1FYTE 4HIIA 1S7VB 4ZQKA 4C4KT 2C1PB 1WFMA 4JG0L 5D8JL 3ZU8A 1RZJL 2NY2C 2FL5A 3BD3A 3MRQA 3ULUD 1OZUA 2D3VA 3EBIA 2DIBA 1ITBB 2FUTA 4R26H 3HVNA 3CFTA 3QUZB 3BAJA 4CSZA 3P3RA 5DI8B 3PNWA 1E6JH 1KJMB 1M7IA 3SHSA 3MRCB 5I16A 5DUJA 2A4EA 5L9DL 4GAFB 4JPWL 2YA1A 4P2QE 5AVYB 4ZNEE 1NCBL 3FU7B 3NZHL 2IH8A 4N2EA 3DIVA 3V0DA 3U6XS 3VWKB 4QHMA 3HS0A 4NHCH 1A1OA 1BIIB 2VMFA 5HPMA 1YN7B 4G43A 4WFFD 5EU3A 4Y4FB 3W39A 5AOZA 4UAOB 2NPLX 1MIML 3U9PH 3ARQA 4KMTL 5E4AA 4XNYH 4I3RL 4CBZA 1N6UA 5AOIA 4KKRA 5FA4B 2AEOA 1CR9H 3OD3A 3MLPA 3PWVA 3LZLA 3DMMB 1YHPA 5DD3H 5IIEB 5JW4M 4N3TA 2PLTA 5D5MF 1E5YA 2PTVA 4Y16C 4MXQC 3K5RA 3MOBH 3HRZB 2I26N 4RQQA 3FSWA 3NDYE 1OIOA 3ARDC 2R2EB 3DSFH 5JHLH 5F8QC 3EOBB 3S5ZA 4BZ1L 3BUDA 1DBJL 4HUXA 3IK2A 1Q8MA 5C0CA 4KKBD 4HXBH 3BKMH 2K9UA 1A14L 3WMSA 3NZUA 2OP4L 3K91A 3SKNB 4K9JA 4ZFZB 3WD5H 5JOFB 4NM4L 1AMXA 1TNMA 1SVZA 3O81A 2I7OA 3KAAA 3ELAT 5CMAB 2P42B 1GS7A 1H5BA 1X7TA 4YDKH 4W4NA 1FZOB 3WKQA 4NBZB 5AVQB 2RR3A 2QTVA 4N22A 1NINA 3HE6C 3M7FB 1MCJA 2ZZUT 4HMCA 3CJJA 3SQBA 4OGXL 2HTLD 6TAAA 5DZNA 4S0SD 1JPEA 3P4LA 3AREC 4XRCA 1NFIB 3EKCA 3ETBJ 4L4TA 4XMPL 1CC3A 4MDJB 2AABL 3JYCA 3WTXA 4HAFA 4XCYA 3MNMA 2JTYA 4FQ2H 4LOEA 1MEXL 1S9VA 5GGQL 3TBYA 4OKDA 1F45A 4TRPH 5FF6B 1NANI 4MB1A 2ARJA 4HSAC 1IIIA 1UA6L 3OKMB 2Y25A 2DQJL 5D96B 1GR7A 3GPEA 3WFHB 4YHML 3TGXA 4PAZA 4XCNA 2PCFA 3GNMH 3OZLA 1FI8C 3P11L 2UVEA 2AXFA 3I50H 3JUYA 1LO5B 5IFAL 1V54B 2AJVH 1PL3A 3LD8C 2IFFL 2PETA 2UZYB 1AKJB 5DO2C 2P24A 5KSVB 4R7DB 1P4BH 3A6CL 1BBJA 2GKIA 3G5YB 3IGAA 3PL6B 1TTCA 1PZ3A 1Z6JT 1AZCA 2ZXEB 1OCOB 1YMHA 3ZHLA 1ZDQA 5FYKE 1IGCL 4AQOA 3ULUL 3KYOA 2XV2A 4MFHA 1JGDB 1EJOL 2JKLA 4G9FA 1UEMA 4ALAC 4JZJB 1MF2L 3VGEA 1NCDH 4R4FL 2EDJA 5CHNB 4FNPA 1JI2A 2DQDH 1KPVB 3F05A 3CCHA 3HI6L 3KBEA 4FG6D 5J57B 4ZUWA 1DL7H 1W72H 1SBSH 4N8VG 1IU1A 4N2FA 1YUHB 2WSKA 4JFDD 3U7YH 1ET7A 2UXFA 4QTIL 5EUOE 2HWZH 4RISL 3CDFA 4LGRB 5AUMB 3EHBB 3WHXB 2C7FA 1XAUA 2L7EA 2YD4A 4QYOB 3DOHA 3EGDB 5I1LB 5E24E 2V9RA 2Z9TA 3MLRL 4B41A 3CN4A 4FFYH 5DJ8B 4D3CH 4Z6AT 4PJIB 1K85A 4I5BA 3UAFA 3FPXA 4FLQA 4OZFG 3L3OC 3Q1SL 3HC0B 4ELMA 3X3GH 1G9HA 2VMJA 2JKXA 2ZX6A 2ZUYA 1KTDB 1WD9A 3WOVA 1G84A 3DVNB 4YXHL 3HZ3A 2EH7H 1XCWA 1D7FA 5DFVD 3LV3B 3FTGA 5FEBA 4AQ8A 1TEFA 4HISA 4XB8A 1QHOA 5CS7A 1F8TL 1RP9A 2NY3D 4XP1H 1TTBA 2BVQB 1KULA 3QZPA 4ZNCD 3UO8B 5JPNC 3P9LB 5AOMA 15C8L 1WGOA 4KKQA 5SWZD 4JPQA 1M56B 4PS3A 1LILA 4E41B 2ZYRA 3FN3A 2AZAA 4PP2A 4AK2A 2H3NB 3L9YA 1FFOB 2G4GA 2HLFC 4YDJA 5CN3A 3CBRA 1J5OH 3OJDB 4GBXB 3H9SE 5IK3B 4YSQA 3VG0H 3Q5OA 3NABH 4QRBA 5TGBA 2CKNA 3MLZL 2ICWA 1GYUA 1PDKA 1RL1A 2Y5TA 4FHBD 4OB5H 2FNBA 2H32H 3LEXA 5I1CH 3QRFM 1U3ZA 4JHWH 3DO7B 1HI6B 2KZWA 2WWKO 1WITA 3GSVB 3QZMA 3FUNA 3V0JA 4UQCA 1TTFA 1F90H 4RBPK 3HS0C 1EO8L 5D7LD 4ZAKA 3PP3H 2WJ5A 3B7YA 3Q6GH 2YPLB 3MNWA 1XSJA 3N1PC 4ETQA 4MQXC 1SHWA 2EIKB 2OW7A 3GIZL 1NGYA 4ZMTA 4EN3A 4ZW5A 1U6AL 3KVQA 1MCIA 2DMGA 3ARUA 1E5CA 4JDVA 1RSYA 4AYID 1Z66A 2XPGA 3ZL1A 3T0DA 2E6QA 2XFXB 1J8HD 1MFEH 1BVKB 5D1ZB 4OV5A 4BH7A 2PR9A 4F37F 5I30L 1II4E 2YEQA 2ZCLL 2CJUL 1JNNH 4JFUA 3DYMA 4HAKA 4V1DA 4YSEA 3ZMRA 1ZV2A 1G6RB 3P30H 3Q2VA 5EOCH 2J6EA 3HZVA 4H88H 3C8KA 2HG5A 2E0PA 2DTML 2YAPA 3QJHA 2WSDA 3NG5A 4J3SA 1JE6A 2EVFA 4XMXA 1IM3D 4H4NA 1BFSA 3ARGB 2MQ0A 4NZDA 1A47A 2VZTA 1H8LA 3CSYB 4I0PB 1H5BC 4P4KD 2V3EA 3B9VA 1PLAA 1E9OB 4DVRH 1E9PB 1YEJL 4GQ9H 3VTMA 1ETB1 2HRPL 5EBWB 3Q8BA 1BXAA 3DX7A 2X0VA 2K70A 3N50A 4BUQA 4NZTH 5JXAH 5HYJA 3W3BA 5DJXB 2YK1H 1GHFL 1PMYA 3PAUA 3N04A 4XCEB 4YL9A 2HJLB 5MENA 4X9HA 3UC2A 3QFJB 1VEMA 5D1XE 3X12B 1WQVT 1RU9H 1A02N 1JN6A 1U8NA 4LVHC 1QI5A 4YFDB 2HT3D 4IOSA 5KVMC 2A6KB 3W56A 4WY7H 4Z78B 1Q0YL 3EYSH 4PS8A 1MRDL 1MCKA 3LN9A 3OJMB 3EXLA 3LRSA 4P5KB 3HC4H 4TQHA 1YMMB 2QDVA 3FQUA 2X44D 1VIWA 3UP1A 3SY6A 1DQQA 1LE9A 5CR8A 3QUMH 5I1KH 3HE7A 3LMJH 4QTHB 5I6MA 1MCNA 1Z0NA 4V11A 3DRTB 5HDQH 4RFNC 1T0OA 4ZBJA 4JKMA 2GBUA 4JFHE 1U2YA 4WI0B 2DLFH 2NXYC 2MRYA 2ADIA 4YLBA 3SE9L 2BSBA 1JCKA 2X6AA 3D25A 4J4PD 4M8QA 3N1GC 4PJGF 1G9MH 4KJPC 1FNEB 2BVPA 1MW0A 5L0QB 2F7IA 4UTAH 5EC1B 3CSFA 4I18A 4PJCA 1SN2A 5EU5B 1CLCA 4UT7H 3BFQG 4EI5B 5FYJH 4LL4A 4PGBA 1J05A 1N2RB 3BP7A 1SUJA 1ZA6A 3DVGA 3WFDL 3RHWK 3MVSA 3QEQD 1NSNH 2XA8H 3OF6D 5F7NC 5FHAL 4HU2A 2E75C 1O9ZA 1KB5A 1BYPA 3ECVA 4GSQA 5C1MB 3OX8A 3H9HA 1YEKH 2YEVB 3TCTA 4FULA 4XWGL 4PV8B 1MAKA 3L4XA 2DQEL 5EF1A 3ARBB 5K9KA 3ZQXA 3VGAC 3CTTA 4KKCC 4KV5E 2AJUL 2C1OB 2B77A 4NWTL 3CZGA 5I2IB 2QV4A 1E3XA 1XR8B 4OUUA 5D7IE 4EXPX 2H1LM 2IDUA 2WXPA 2G2RA 5IF0A 3GSXA 3SDCD 1FZMB 4K3EH 2LAGB 2Q7NA 5T1DH 1DN0B 5A40E 1PKQA 1CE1L 4NQSB 4AQ8C 2YUVA 2F61A 4LAJH 4NKMB 4QHNA 4WVRA 3RB7A 4LL9A 2OMYA 5CEZD 4G42B 2GCYB 4NFDA 3TESA 1GZHA 5LXVA 3P4MB 4PJHB 1XGYH 3L5XL 1ONQB 1HESA 3V4VH 1WICA 3TJHD 1P5VA 2CUHA 3BP5B 1QZNA 4WZ9A 1KEML 1A4AA 2XETA 3F7RA 3LOWA 3NSCA 4U1IB 3V5DB 3KYNA 1P7HL 1HCZA 2CHNA 1UKTA 1KJ2B 5T1KD 3O11A 1GMIA 2QPSA 2UX6A 3BH8A 3IDGB 1DVFA 3QNYB 1B3IA 4E41E 3QQ9D 1XF1A 2BY2A 4M61B 5ICXB 4FZ8L 3FO1A 5GGRA 3TBWA 2KBGA 3WHE0 4BK4A 2PP7A 1GOFA 4M6NH 1U36A 4LSRH 3S7GA 3N43B 4B5ZA 4ZAKC 4M43L 4K7PX 1YDPA 5T5NG 5ICZA 3MO1B 4JFQA 4BFNA 2WLYA 1TQTA 1RZGA 4KKZA 2IMNA 2YD3A 4JJ5B 3SGKA 3PQYB 4MYWB 3V52L 4EN3C 2QELA 5KSAD 3QULA 4JHAL 5CP3A 2J12B 2L7UA 3IKKA 5C6PB 3TWCL 1E5ZA 1G7MA 1XB6A 5AVTB 1Q9KB 1ZT4B 2XG5B 1D7CA 2BVOA 4M8UA 5KSBE 1VAHA 4PGEB 5CLZA 1TDQA 2XHNA 3C60D 3OR6B 2LT9A 2Q7YB 4JDTL 5E23A 4RZCA 1ACYH 5GRWA 4QF1B 3TONA 2KLRA 3QO1A 2AS5M 5F0MB 1MWAB 3B2PA 4EVNB 3O4LD 3LRMA 5B38G 2BNQE 1U3HA 4X80H 3P9MA 3CFKA 2YPVL 1AGDB 3FU5A 4GKOA 4MA1B 3BIKB 4PJXF 3MBEA 2WQVA 3MREA 2ADYA 1K72A 1X3DA 4B7LA 4O51A 2E4TA 3L45A 3WNIA 1IAII 1MI5D 4DTGL 3GMMA 2QDWA 4RIRA 3AZUA 4PJBB 1LL1A 5F7EH 3VFOA 4UQ3A 4B96A 3RY4A 4QRAA 3NCJL 4TNVK 4BGDA 4XMKL 1EXHA 1SYSB 3MV7D 1I4FA 2D3LA 4N2GA 3FKUS 4YGVB 3SDAD 3P02A 2I85A 4RGNC 4QMEA 3VFUA 3DRQB 3HG0A 3ATDA 3BUTA 3TOPA 1B0GB 1U8LB 2JB6B 1MCDA 3KPRA 3D87B 4BZ2H 1FCGA 3HZKB 5FLUA 5B8CA 4HH9A 1FL3B 4XVOA 2X0UA 1NFDF 3B43A 3FQXB 4NNYA 5D71H 3SPIA 1E67A 4UT9L 3MJ8B 5F7LB 1CYXA 5C07B 3IFNH 3K4AA 1PZAA 1JZ7A 4YX2L 1XEUA 3QFJE 1KIPB 3TYGL 5KVEL 4N20A 3JV5A 3PWUA 2YARA 1OE1A 3IMUA 4MB3A 1VHPA 2QL1A 5C0EB 2CDEB 1IGMH 1JWSA 3HE7C 4WIQA 2L04A 3GEWB 4Z5RB 1URLA 5T1LA 2RA1A 1FN4A 4HYTB 1DBAH 3ESPA 1VFMA 1XF5A 4GXVH 4XNZC 3G6JB 3D4GA 4HEPG 2CBPA 5EBGA 3ZGHA 3BUYB 3RTQA 5JUEL 2ZQKA 4WJKB 2ZONA 4H1LB 3C9NB 4P06A 2FO4A 3U48A 3QCTH 4Y1TA 7FABL 1UA7A 2ITCA 1DQDL 1XF3A 4X42A 2ORBL 5DUML 4P2YA 3LRLA 5FKPA 4I2XA 1FO0B 1L0PA 1SM3L 4NO2A 2OMXA 1CE6B 1K3ZA 1IEAA 3ARFA 3INOA 3KLAA 3Q6FB 1OSPL 3FCTA 4FQXA 4I18C 1EHLL 2VDQH 4A2EA 5F88B 1OGAD 3EJCA 1FH2A 2AK4E 3MRGB 3L1GA 3MRDB 3CBJB 5IQ7L 4MMYA 5FA3B 1ZV5A 2GVYA 1FZKB 3WIAA 3NJFA 4AXWA 4ONFL 5GHWL 3V2AR 1IJNA 1A7BA 1CQKA 3U30B 5CJ8A 4W93A 3LQZB 3T09A 3QPQD 3GBMH 2XN9D 1SOSA 2BH0A 5KUKA 1AH1A 1HSAA 1MRFH 2R2CA 2CXKA 1PNDA 1XGTB 2P8PB 4N1HB 2XWTA 1PLBA 3WFBH 1CZ8H 2RFXA 2FT8A 2OJEB 2C5DC 1Y18B 5IBLD 5FKAB 1OWRM 2H6PB 4ZUSB 5AVXB 1WPCA 5JW3H 4MX7A 2D9CA 4YDVB 3QDJA 2F54A 3E38A 2DJSA 2EDOA 1NMBL 3VMNA 5F7YC 4NQCD 3LKPA 1VF5C 1O75A 3AMKA 4ZOCA 5I6KA 1GZHC 2VN6A 1AFVH 3BFOA 2ATPB 5KJRL 4Q89A 3KPSE 4U3SA 1EA9C 2Y2YA 3HG5A 1H0DB 4GQQA 5JW4N 4NP4H 5L8JB 2OCCB 3AG4B 1WZ1L 1V7ML 2R4SL 3RU8H 3DX9A 1BCIA 3LDBC 2Y1YA 5AVVB 1KY6A 1ZGLB 5DC0A 2YQ2A 5T3XH 4OQTH 5FPIA 4TTGA 3T6WA 1P6FA 2YAHA 5FK9A 3RWHB 1N4XL 4PJHE 1DDTA 1TNNA 4YHOH 1DVFC 2D3JA 4UZUA 5C08B 1NEZG 3S37H 3MXWL 4G8GD 1WH0A 3V95A 4Z8FL 1KGYE 1FPTL 1ZRUA 5KSUA 1KLFB 1AJ7L 1ZPLA 3VI3A 1DUYA 2GYSA 4I48B 3BZFA 5KN5B 4P5MB 4K5OA 4DESA 3SGKC 4TLKA 2ZX7A 1HQ4A 4EO5A 3BWUC 5H94B 2D3NA 3RJQB 4FP8L 5DCCA 1IRAY 2H1PL 5F7UA 1NC4A 2P5ED 2WB1A 5MEQA 3QEGH 2F08A 4FABL 1JPTL 5I5MA 2I5YH 3EFOA 3FTYA 4OZGF 2ZOLB 4LIQL 5J1TC 4DCQA 2HTKC 1VJSA 4GRWF 5CU5A 3DXAD 4P23B 5ECGA 3I2CL 4X6FB 1U8MA 2H2SD 2QR0B 4P99A 4U6YA 1M1XA 3G6DH 4KQ0A 3EJRA 4LBEA 4NWUH 2UV3A 4PSRA 5E99H 3CHRA 3TO2A 2YRLA 4AQEA 3DPDA 1ZIAA 2TRYA 2X4SA 2X09A 3JV4B 3ZJAA 3NIFB 5DD0H 3ULUF 2R2BB 2ZAHA 1U3HC 2OSLA 4OD1L 5JQHC 5CSBA 1GY1A 4NO3A 5CUSH 4YXLL 3MBEC 4MNQA 1B2WL 5DC4B 3UC0L 3AB0C 5J6HA 4KY2A 1F11A 1RMFH 2DQCH 3NEEA 3OKEB 4YK4C 4UQAA 4XBPA 5GS3A 1JYXA 5FUZL 3RVXD 2AXGA 2NY4B 3GBLA 5CEYB 3L7FA 1XCQB 5TTRA 5E8NA 1HNGA 1M1SA 3N42F 4YQXL 2ZJSH 4ODWB 4OTXL 1E28B 1UB5B 4YEEA 4PJBE 5IQLA 4UINH 1XEDA 2EZ0D 1QTPA 4XAWL 5B8CC 3QA3B 2ROXA 4ZMYA 1KTLA 5T1MB 1DP0A 4IS6B 4ZSOA 5F3BB 4JFFD 2X87A 1E42A 3OKNB 1DJYA 5CWSA 4DZBA 4YXKL 5BV7L 3ULVE 2A99A 3K72B 3TVMA 2CK0H 5AZ2H 4CADA 5DMIH 1FVCB 5C07E 1I82A 3T2LA 1MFVA 5DK0B 4F58H 3TA3B 1PEWA 1BQ5A 1NUNB 4OCYH 4HK3J 3TXAA 2I9TA 3TO4C 1QD0A 2XQBH 2XYBA 2BIMA 5FCSH 3TJEH 5L2KE 5GZOA 3RTQC 5T3ZH 2BSSB 4Z95L 4BA8A 3WL9B 3T0EA 2A7BA 1G1CA 2UWEA 4MXWH 3ASWA 1O6VA 5I8EB 3G6JE 4XZUB 1FYTD 1WCBA 2VQUA 2XKNB 4L3FA 5JHDD 3OJVC 3V6BR 1SY6A 2ZOWA 3ARFC 4MA7H 4MD0B 3I6KB 4FQXC 2Y24A 3S6CA 2Q6WB 4XPGH 4X7TA 1CB4A 2UUDK 4PRNA 4ENEC 3MKGA 4X4ZA 4ZMPA 1L0XA 2W9EH 2LLLA 3X2QB 3NFNA 1FGNL 2WMPA 4EDXB 1TZHB 5DGRA 5DVOA 1N0XH 5DHVB 1T83A 5K59F 1DQVA 4L1HA 4XI5D 3TNNB 1I8AA 1U91A 1M7XA 2RJMA 4JN2A 2I9LA 3PWJA 3SE8L 3F7VB 4AGPA 2I07A 4HOZA 4NKIL 2DYSB 3AY4A 2OYMA 2VZ3A 4EDWL 1I8KB 1J48A 2PMZA 4ZD3L 5DQJA 4AYFB 3PV6B 2DQGH 3MHZA 2DBLH 2ZX8A 5J12B 4IBVA 3MV9A 1JGVL 3U7WL 4FA8A 3I9AA 5G5DB 3QJRB 2PWFA 4LHJB 1BSIA 5BNXD 1IC4H 4KJYB 5IQ9B 4PGZA 2OZ4L 6PAZA 5I23A 3IU4L 1GGBL 5E8OB 4E9QA 3MRBB 1AXTL 1HWGB 2YSSA 1RUQL 4XO9A 5DDHA 4BCZA 3CFDA 3LPGA 4RA3A 4ANWA 1BEYH 1WBZB 1GGCL 1QMUA 2CO4A 2EO9A 1HYSD 1G1OA 4CVZA 2A4ZA 5DEZA 1P2CB 3IYLW 4ABVA 3DX6A 1WYJA 1XH0A 3CXDL 1EK3A 3S34H 4LSQH 5DYFA 2IO5A 4HD9A 1S9XB 2WUBL 4RMBA 4O2CA 4KDTA 5B1JA 3LIZL 1UZ6F 4JPVL 1OE3A 4PVNA 3H8NA 3VFRA 1G94A 5DJAA 3ZTNL 1I9IL 4LDEB 1GC1H 3O2DL 3GXUB 1I1FA 1D9KA 2HXAA 1IGJB 3QIUA 4LKCA 5HI4D 4FYTA 1GH7A 1PW3A 2VKXA 4QD2E 1KBGL 4UOW0 2F7RA 5JORA 2PR4L 3LN5A 1UH3A 3ATBA 3GEFA 4NC2B 2IAMA 3RGVB 1P4IH 4MA3A 1T7XA 5TE4L 5IHLB 2V5MA 5I1DA 1O7DC 2ARWA 3GMRA 4KVNL 1SEBB 2QQKL 2OJZH 5DRZB 5GS1B 1ZLUK 1XCTB 5ECJE 3BZ4B 3P73A 4YDZA 3ZK0A 1X5XA 5LGHH 1ZK9A 1E4XI 2K8QA 5E2TL 4QHKI 1H6EA 3ARRA 3OGCB 4QHKJ 4HS6A 3HW7A 3L3GB 5E8PA 5HI3C 2R2HB 4X6CA 2OTUB 4K3DL 5FYKD 4ONHB 3VSTA 1BBDH 4AZ8B 2EXWD 1XCXA 3NIFE 4AL8H 1T21B 1TZOA 2ZICA 3RWIA 3LKOB 4PJ9B 1RZKH 4HXAH 4AKOA 1IFGA 2WIMA 4AUUA 4X9GA 5ALBH 4AV0A 4MAYD 4NJAL 3VGGA 1M7UA 2VISA 4TQEH 5L8KB 2XV0A 2X2JA 2W1NA 1CDCA 2Q8BH 3QUYD 3LX9A 1YN6A 5CCHE 1X7SA 4LBAA 3I6SA 3Q5YA 4AJWA 4O4YH 2IPKA 3LJ3A 4ZFFA 4CMMA 2A6DA 5EU6A 1I7UB 1QFOA 2WZ0A 1JV2A 4TUJA 3ISRA 4RH4A 2DOCA 2KDYA 2EVHA 4PWJA 2N56A 3IU3B 3WUWB 2Z31B 4UNIA 3FRPA 5GXBB 3TVMC 3FB7A 2W92A 1NAKH 1YY9C 2FGWL 3ASNB 2DQMA 3LZOA 3QWRA 4AJVA 4EOWL 5CCJA 3BSGA 4KXCA 1CTMA 1IC0A 1SZNA 2HT2C 3SDDD 4JHUA 3RWJB 5GZOC 5I1JL 2FQDA 3HAEH 4NHUA 4Z7VB 3X1BA 3MNVA 4UDUB 4MS8D 3ZRCC 2V5YA 3KDMA 1UCBH 1J88A 4JFEA 3T0EC 4AEHL 4PS4H 4Y4HA 4E68A 4CSPA 5DRXA 2VDLH 2VDMH 3R06A 1A22B 2E4FA 4L4VA 5I5RA 1LD9B 4ODUB 4Z23A 1W8NA 3MOAL 3QIWB 4PS7A 4HPOL 1MCCA 4JRXA 1G7HB 4OV6F 3TH3T 4JKLA 4AV4A 4FNLL 4EIZC 2ITEA 1IAKB 2OI9B 1CYGA 1XF2A 3ZDZB 3HZYB 4MJ6B 3RX7A 5IVXA 1N26A 5DUBB 2MTPA 5EZIH 5HJ3A 4KHTL 4HKXA 3WKML 4HJ0C 1RJLB 2EECA 1YEFL 3APMA 3E80A 1T83C 3QUZD 2GUOA 1T7WA 4Y2DA 4LSTH 4XMTA 4PJ6A 5D4HA 1CXIA 4Q6IA 3I6LE 5HDBB 1FORH 4R90L 1YECL 3AY4C 1DHKA 4YO0B 1UGNA 3LPWA 3TPKA 3VWKD 3MJ7B 1UTDA 3BPCB 1CFTB 3CHOA 4XP9H 5D9SB 3NDZE 2CZNA 1LYQA 2YEZB 4Y4FD 4B6ZA 3ZQ9A 1OTTC 2ZXGA 3LSOA 2WVVB 5IMMA 1DJHA 4XNMA 4E9LA 1CDHA 3PLYA 1XH1A 3ESNA 3FB8B 5I75B 2DQUH 2Z8RA 3DMMD 1QUPA 4M3JA 1XGUB 2ZAIA 3D85A 5DQ9B 1IQDB 4LB8A 5TE6H 1U8JA 2R0ZH 1IQWL 5IVZB 1AE6L 3IEAA 1MXDA 4O2FA 4AM0Q 5DFAA 1N5AB 4IDJH 5E2WL 2Q0ZX 1TEYA 2VABB 5L4MA 3V4VA 5JTWA 1NDTA 3ALWA 3O41A 3SKJH 3LQAC 4KDTC 5B1JC 3SJVE 4FL4B 1RVFH 1NBCA 5LHDA 2C9VA 3UROR 2E27H 2EVGA 3RPIB 5JYMA 1N0LB 1JF6A 3G04A 4FQPA 3X3FL 4MA8L 2JCCF 1D9KC 4BWTA 2FAUA 3QIUC 2DRUA 1XT5A 3CGTA 4B27A 4IRJA 1F4XH 1QVOA 5IQNA 5JA9A 4J3TA 3MFFB 1XZ0B 4FTVB 5ESVA 1W0VB 2R27A 2YGVA 2OYKA 1SLUA 1F97A 5KVDH 5C8JB 2UXTA 4OU3A 1THAA 4QHPA 3WIFB 1FP5A 3QCVH 1NGQL 4TVUA 2EAEA 4NENA 4F3FA 4YFEA 1ZS2A 2IAMC 3K0YA 3LZNA 1T1WB 4UTBL 1JPGB 3FFCA 3IMVA 1GAFH 4J6IA 5BJTB 5D2LF 1ZWIB 3IAQA 2FHFA 2X70B 3BYTA 4LGPB 4X99A 1RUML 2QHRH 2Y06L 1IAIM 2XYCA 3RFZA 3AS1A 4PRDA 1CD8A 1I3UA 1F56A 5C0BE 2AGJH 1MG3C 1J8RA 4P57A 4DEWA 4P3CL 3WJJA 1K4DA 3BZDA 1RERA 3CFEA 5E70A 3HMWL 4YMPA 4QT5B 2KQMA 1F1AA 1NCCH 3GINA 3SZ6A 5IV2A 1IZKA 2ZF8A 1AKJD 5BOZG 4AYDC 4GSDH 3T0AA 1YPZF 3QB7C 4JFHD 2QPEB 5AZEH 3GJFA 3PL6D 4K8RH 5DLML 3UPCA 2G60H 3GS7A 3KGUA 3ZDXB 4AGOA 2A83A 2VQ4A 1ZLWH 4UANA 3EO9L 4QCIB 3GIVB 4GJTB 3RIFF 3STLB 4AENA 1J9CT 2ICEB 4R97C 3OKKA 3DIDA 3TIDB 1IARB 4WGWB 3B5GA 3EOTH 3HA0A 4F80A 1C1EH 1LEGA 4EUPA 1NEZB 2DH3A 3MV8B 4YIQB 4F2MA 2GAZB 3BSZL 3IF1A 1HIMH 4PJ7A 1HEZA 3TT3H 1HHHB 1E2ZA 3LPOA 3QAZB 3R7RA 4FCAA 1ZLVK 1J87A 4O9HH 3QEHB 4YJZL 2J5LC 3EHBD 1MUJA 2EVIA 3P77B 5IESL 4MNGB 4H8VA 2F53A 1PVHA 2GIXA 3RY5A 2CALA 4LHUA 2O93L 2P5WE 1DO6A 2LVEA 3D30A 4RWYH 4UM8A 1J1PH 4YHIA 5DVNA 3KLKA 2WAHA 3N91A 4N0FA 5GRZA 2R0WH 4UUJA 3AROA 3ILQC 4Y4HC 3NJLA 5I19H 2Z8VC 5L2JB 5I18H 3MXVL 3FOLB 3FQ1A 1KB3A 4OLXL 1UFGA 4DGVH 4Q9BA 4Z7VE 3QUKB 3TWYA 1KXVA 1S9YA 5CBEB 2CDFB 4YUEH 5BZXA 1AIFA 1KWGA 3UBXB 3U1SL 4F91B 4XPHL 3MNDA 4ZO8A 3GXDA 3T8MA 1MQ8A 3BVNB 4D8OA 4NUJB 4L5FL 5C0ND 2MJWA 3G6AA 4E41D 5KYXA 3HHSA 4HUCA 4HW6A 3GGWA 1O9WA 3ECBA 4XHJC 2WLIB 2BNRB 3FCGA 5E03A 2QSVA 4GBXD 2FT6A 4Y2DC 1XIWB 3MROA 3V7AG 5FUOH 4Q6IC 4DAGH 4FA6A 4LNVA 4KQ3H 1K9TA 3MQIA 4G3YH 5CD3A 2WGNB 3EOAB 4XNQB 4AQ1B 1EHXA 3ZQWA 1JMXA 1NCHA 3V79C 4JRFA 1KELL 2DWDA 1SJMA 5C0DA 2J8UA 3IE4A 3SO5A 1T04A 4LQFL 2DV6A 2YPLD 4QWWC 1AAJA 1GZQA 2GG1A 1E6OL 3QXAB 3ROLB 5C0JA 3QP3A 2HA1A 2Z64C 1REIA 2NZIA 5EORH 4XHQA 3QDGE 1F1DA 3WXVH 2AJYH 5DJ6B 5D1ZD 3OR7A 5C0IB 1T7VA 3CE1A 4H5SB 1I1RA 4FG4A 2EC9U 2OMNA 3IETB 4WO4A 4H8QA 1VACB 2H9GA 3GF8A 3QDAA 1MN4A 5TDPB 2VL4A 1ZTXH 3K6DA 4ZS6C 1EMTL 3K6SA 1N59A 2YBGA 5D8JH 1JTTA 1FUNA 4CJ0A 5JW4Q 1EBPA 3ARGD 3DDGA 4NN5C 1YEGL 4X8XA 4I0PD 1G7LB 3UGUA 3BP4B 4HJ1A 4J3OF 4OY9A 1E30A 5HYQB 5F1IB 4LCWA 5M95B 1MNNA 3CC5B 4IRJC 4R3SA 3TEWA 1S7SA 2VR9A 2WO2B 4DGYL 2W88A 1NCBH 1A5FH 5CZXC 3N2JA 3L4WA 3ZHFA 5B3NA 5HSFA 4U49A 1KXHA 2ADFH 2UY6A 4GAAA 3U6RB 3NFPB 1UWEL 3X11B 4OJDH 4LLVA 2CO2A 3VGFA 3O0RL 3VXUA 4ELKB 3DBXA 4UIKH 4FTVE 4KMTH 1HEJC 1C08B 3QFJD 1KYOJ 4I3RH 3HG1B 1QFUL 2OTWB 2NXZB 3RFZC 3PJSB 5EB9A 2B1HL 1I8MB 1JI1A 3AAZA 3WJJC 3DX2A 1YEEL 4FNRA 4RAVA 5I8CB 4IBSA 4MMXA 3V0AC 1MCQA 4V2BA 5EO9A 3TNMA 2DBJA 1KGIA 3STZB 3BH9B 4AIEA 1YMMD 4I9XA 1R5IA 5E5RB 3MCG1 2APBA 2R1YA 2W8CA 4OSUH 5FIEA 5GSRB 4ZMOA 4TSCL 1J1XL 4ZTOL 5FFGA 3TURA 1RZFH 1LO0H 3TLRA 3L95B 4UT6H 2XZCH 4WV1A 3D0LB 2RAMA 2NY5C 2V2XA 1ZANL 5LGYA 1KJ3L 3EJJX 3MRHA 3CDGB 2JKRM 3KXFB 1AS8A 3RVTD 1IX2A 2WWMC 3AU1B 4PD4K 3EBHA 2NY1B 2VDNB 4APQB 4EZLA 4FQCL 2WTRB 4PJEA 3PE9A 3D18A 2NY2B 1DSWA 4PJFF 5DMJB 1CICB 1FZJA 1KBKA 5CIPB 1FLRL 1TLKA 1Z5HA 3ZTJH 3H6JA 4BE6A 4HWZA 1RZQA 2DF3A 1ZKAA 2BP5M 2AABH 4EI5D 1S9KC 3B83A 3PUUA 1QSZA 1MEXH 9CGTA 1ZE3C 2BIIA 2EE2A 3WO4B 1W91A 1PY4A 3CZFB 5C0AE 4WEBL 1MAJA 1JHKL 4GPVA 5K39B 4DFHA 3L1FA 4HWBH 3QDMB 1DTUA 1Z3GL 4YHMH 3ARBD 1T3FA 4F24A 4ILDA 3U4BH 4HJIA 5EZOL 5IW6A 2PYEB 4ZFOB 4MNGE 5CGTA 3V0HA 1XGRA 2EYRA 1Z32X 2YGQA 4FXKA 1P53A 2F19L 5AFAA 5C92A 4PSPA 5I5IA 1OPGL 4NNXA 3VSUA 3EO0A 1QA9B 1V3KA 3OWRA 3NCBB 1KXVC 5E4OA 3QJFB 4Y16B 3Q2WA 4RGMC 3D0VA 4PCTA 4AYEC 3B7RL 3ARDB 4WLCA 1T0MA 4L4JA 5D5MA 3VD3A 3M8OH 3MLUL 3CXHK 3DX8B 4PY7A 1WBXB 4K7PL 4R4FH 3GJEA 3QYNA 5HY9A 3NYKA 4QRRE 5HGBB 2XRAH 1AZVA 2AJ3B 1LJMA 3I6GB 5I71C 1C5CL 4HFWB 3EJTA 2P9RA 1V3MA 4WUKH 2P43B 3MRNA 4PRAB 1B2YA 3H9YA 3DIFA 3R0NA 2IWEA 4TNGA 1OSYA 3B5TA 3MR9B 1IKFL 4QTIH 4XH2B 1CD0A 1UWGL 1BFTA 3HE6B 3BGMA 4FXGA 2BSCA 1B9KA 4IRSB 3CUPA 4KQ4L 3SGDI 1KDIA 4U3XA 4UV4H 3ZYJA 5J3HD 2VO8A 3IDXL 1JWMB 4CKQA 1E4XH 5AKTA 2ZPKH 2GITB 3PQYD 4QUOA 2A77L 3S88L 1G9NH 2PP9A 3RNKB 1L9QA 2ATKB 1R0AL 3CLFL 2VN7A 3SDYH 3VI4F 3S3PA 3U9UA 4ZYKA 5EIVA 1LHZA 4TUOA 1QACA 4XCCH 4R7VA 5B39A 5DMYA 4HWNA 4LAQH 4OCRH 1IT9L 1J9QA 2RB8A 3AT0A 4WO4C 1JPFB 5I1AA 2FYYA 4M1CD 5HDOA 4N8CL 5J9PB 4ORGB 1Z9PA 4GKLA 4NQDA 3MA7A 1NICA 5ITFB 3ML8A 1DFXA 3CU1A 3DETC 4XR8C 2O5NA 3OKDB 2VDQB 1H15B 3MRMA 3O9WB 4XN7A 3TFBA 3VFMB 4N9OB 3QDHA 3ROOA 4XPFL 1ZLWK 1SBBA 3WGVB 1WBYB 1QBLH 3C5ZA 4KROB 1W6WA 2Q3XA 1FJ1A 4E36A 4OFPA 1IAOB 1KWKA 1TJXA 3QHTC 4OCWH 1A9VA 4ECNA 2WXQA 2VW7A 3G9AB 3VYPA 3FU9A 3Q2LA 4PCYA 5DJ2A 3MAWA 2R15A 5GGTA 1H3XA 1ES0B 1IGFL 2OL3H 3RWDB 1ZHLB 3QPXH 3T2QA 4L48A 5AALA 2L0DA 1JG9A 2Y9RT 5AL8A 3VNYA 3CX5K 3ESMA 4MMZA 1GRWA 3BWZA 2A6JB 4U4BA 4MDRA 4W6XB 3ES6B 3ULVD 3AU0A 5HYEA 5C07D 5I30H 1PTZA 3L3OB 4MMXC 1OCWL 5BO1L 5MP6L 2JI2A 12E8L 4ZDHA 1CFBA 4NQEA 2XU9A 4LOFA 3TN0A 3L5HA 3HG1E 5AW4B 3M1BB 3LZFH 3HEIB 5ANMB 4TQPA 4P46A 3C08H 4D2NA 1YNLL 3G3LA 2GSIB 5F6HJ 3FMGL 1JD7A 1D5BB 2DLHA 2IBBA 3DA0A 4WV1C 3HB3C 4JFSA 3ZDWA 2FX7H 3WFCL 1S7UB 2ZCHL 2DWSA 4M1GL 5MEOA 2JK5A 5F7WC 5I76B 1AQ8A 2PW1A 3TP4A 4F7TB 2AK1H 3M07A 2EDDA 5K1VA 2NZ1A 3OLDA 2JIXA 3T3MF 4HIIB 4F8TA 4M3KB 5ESAB 2WNGA 3ORJA 1UURA 2PO6A 2FL5B 4JMXA 3SDXF 4FKEA 2A9DA 4NZRH 4RGOL 2HH0L 3UTSA 5BZDA 3ZDYB 1S5IH 5JOPD 1ODUA 4PVMA 3W0WE 2PN5A 2R7EB 3PNWB 4LASH 4N4YB 3MOQA 4KRMB 4NXKA 3OAUH 4M7JH 2MKLC 3JWDL 2Z7YA 4UV7L 3X14A 1GIGL 5C7XH 1NDMA 1YJDL 2XTJC 2H0JA 4M7LT 4HZLA 1GL4B 3PFQA 4GXFA 4QHMB 3SGJA 1Y1DA 5I73C 2CNZA 4K23H 4AT6A 4BD4A 4UIMB 1XD0A 4HPYL 5HPMB 1JZ2A 5EU3B 2G9HA 2QLYA 3QZWB 3W39B 4XVSH 2V5RA 4KKLC 4LSSL 3MBXH 4RMUA 3KPLA 1PLGL 4N85A 4FXKC 4TM9A 3PXLA 4UOQA 1NBVL 4BWUA 4K5LA 4JFZL 2EDQA 4IRZA 4IMKA 1A3RL 3U82B 1NCNA 3GRWL 2CIKA 2PYEE 4KX9A 4JK0D 5I15L 2WOBA 1ETZA 5EU4A 5L88H 3V5HA 3DVFA 2EYTB 1MWAL 2VLKA 2RBLA 5HI5C 3KJ4C 5DO8A 5HVGB 4HUXB 3QO0A 5INCA 3HPLB 5B7MA 1QABA 4W9IC 1R5VA 2FJFB 4NGHL 5KAQG 1AGEA 2EUWA 5EUOF 3CFBA 3ZOAA 1PJ9A 3AACA 4XX5A 1CPUA 4X6BA 3DTXA 5HHVH 1H5BB 1A1NA 1UZ8B 3QGVA 5D1QA 1IM9A 2QPDB 5C08D 4LQ1A 2ITDA 5TK2A 3Q8FA 4HT1L 1MY5A 4NC1C 4FXGC 1LEIA 1KBPA 2VMEA 1ZY9A 3SQBB 4U6VH 2QQLL 3RVWC 5TDNA 1NCWH 4BFGA 1QHPA 4L4TB 4U4IA 3BQVA 1NL0L 4YLCA 2W60A 4JY5H 3SYPA 4QNPE 2FE0A 3CDZA 2A74A 2J88L 1A4JB 2WLJA 5IQOA 3UTZA 4FNUA 1E27A 4OF0A 3POHA 2GUYA 4XC3H 2D31A 3VX0A 4KJWD 2AXFB 4DT2A 4PFEA 1CBVH 4P23D 2ITFA 4PJDE 1I8IA 3MGTB 1A6PA 1XDTT 1QWHA 3QG6B 5KW9H 3IGAB 4F33B 5KYUA 1JNHA 3RAJL 4XWOC 1YMHB 2VITB 4RFNB 2EE6A 4DIXA 5JHAA 4JX0A 4X5QA 3ZW3A 3C5ZC 1HVXA 2NZ9C 5IHZA 1DJZA 4B7IA 3BLBA 1CFSA 1ML0A 1QTSA 2HPTA 5BO0D 3ZE2E 2QBWA 4ZO7A 1JUFA 1AO7B 3IJ7A 4AMWA 4AQAA 3S37X 2XY2A 4LMQE 1MFBH 3CCHB 4QIRA 5TFSL 4ZUWB 1PZDA 1UASA 2NY4D 2A9NH 3OLGA 3WAKA 1YYML 5EPMA 4APXB 1CF1A 2R1XB 2NY6B 1G1KA 4LESA 4ABWA 1EWHA 1QSEA 4PJGA 3G5VA 4ZO9A 4YAQA 3HJEA 1KV3A 2X2IA 4XNUH 4K2UH 1J0ZA 2N3JA 3MRJB 4MMZC 4B9GA 4LLDA 3N3EA 1THCA 1O0VA 2WLMA 5G2NA 4I5BB 3S9DB 2XBDA 3W37A 4OCLC 1PBYA 1OAYH 4ELMB 3WMPA 1JZ3A 4IKLA 3TN0C 1L0YA 5E6IB 1XHHA 5C9JB 4P46C 5LCVA 4I77H 4HC1L 4W1TA 5E95B 1JWUA 1PKOA 1X5JA 2O4EA 3B9KA 4U33A 1UYWL 4WCYH 3PY9A 4IDLA 2X7LA 3AITA 1KIUA 3MUJA 1BLNB 2B5IC 2WQXA 3EH4B 4LPWA 3BT2H 3INUH 3L7EA 1JGLH 5FHBH 4OZHB 4NIKB 1HKLH 5HYIA 1BXVA 5DFWH 1U8CB 3ESUF 4XBGB 5CP7B 1U30A 5IM7B 4Z7OB 1PZCA 4TL4A 1OXYA 4QJ5B 5DHDA 3EYQC 2PO6C 2N1TE 3UX9B 3COOA 4PP2B 4D7BA 1YEIH 2HFTA 3D39E 5CO1A 1KCVH 4AL8C 2ATAA 4YDJB 1EZUA 3MLWL 1U93B 5SWSE 2MQGA 1J9SA 4LPTA 3CDCA 3O2VH 1RZ7H 1PDKB 3VNZA 5DJCA 3QUXA 2QADB 4WGVB 1DJWA 4DETA 4TOYH 4YSPA 3OZ9L 3LB6C 3ATAA 4JVPA 5F9OH 3WEXA 3ZDYE 5IJVA 3I6LD 3SGJC 4LF3A 3PP4H 5GRUL 1CTNA 3LAFA 3D09A 4ZAKB 4PJAB 3ET9F 4UT9H 4D0DB 1YQVL 5CJOH 3QNZA 2QGCA 3RTLA 2BCKA 1NGYB 1F5WA 4N2HA 1EGJA 5FOBA 3VFTA 5AYUL 3IDNA 4Q74A 2FRGP 5CEZH 5AW9B 5E9DA 3CVHA 4IMKC 4RMQA 3TIEA 4OV5B 4N0YL 1G7JA 4HIJA 4UQ9A 2XWRA 3VJ6A 4BH7B 4JO1H 4DKFH 3E9TA 1INDH 1N7ML 4CNIA 1S8DB 1VGEL 3BUPA 2WLHA 4L0PB 2X4UB 4OJYA 3SCMA 3GB7A 3QQNA 2N59A 4P9ML 4Q14A 4WEUD 3LS5H 1RFDL 3PHOB 2HG5B 2A73A 3AWGA 3ATFA 1ZMYA 2YOAA 3CVCA 3OXRA 4GO9A 4F57L 4NO5B 1DQDH 3PGDB 5DUMH 3V0FA 1WHPA 2Y36H 3GMQA 5C86A 3VD4A 4GP8B 3RWGB 2EINB 1XB3A 4WW1A 5C0CE 1QFWI 3VGDA 2OK0H 1D3CA 1MLCB 2ALWA 5D1QC 5F0PB 2DQTL 1KJVA 1UQSA 1TQUA 3QHFL 3A4EA 1QEWA 3VTAA 2VW4A 4KV5F 4HK0A 5I9QC 2DM7A 1SVCP 4W9EC 4WDIB 1HDMB 1J86A 3GDCA 3MYZA 4PJXA 4LSUL 3Q5TA 1DE4A 3BKCH 1K5NA 4PJIF 2CA3A 1G7PB 1VPOL 4RGNB 5TPWL 4NZJA 1R3LA 3E6HA 5E5MA 4HIXH 5MENB 3RIKA 2A74C 5IBUG 5LWYH 4A6YA 5T5FA 1U41A 2AVGA 3GHBH 2WCSA 1FH5L 4L9LB 3D0AA 3HAEB 4CVXB 5LNGA 4L4TE 3TBSA 2X4TA 5KVGE 3NT0A 4IGBA 2VDLB 3RGVD 3G08B 1GGTA 1YG9A 2D2CC 1NFDA 3ABZA 3LRSB 3EH3B 2HKAA 3FQUB 2EE3A 1TZIA 1UEYA 1EVUA 2BP0A 3L48A 4FX5A 4N6QA 1LWRA 1BOYA 2FX9L 3EDDA 4GKNA 4O58L 4WSGA 4DO5A 4HX1A 4EAEA 5K9JL 5LBSA 5DUPH 3RKDC 4YR6A 2PTTA 3NFSL 4KNSA 3IJ9A 1M9WA 5IHWA 2H8PA 4TL5A 1N4XH 2IFGA 4M62L 1IL1A 1JVOA 1U9KA 4FCHA 1HK6A 3U36A 4XMLL 2VT0A 4FI7A 3MI6A 1GA2A 3KD4A 3D25B 4ZUUB 1SUHA 4M8QB 2VSMB 2XXFA 4PJ9D 1UB6A 2BVPB 5IMOA 4BINA 4YSSA 2GTQA 2D7NA 4G9FE 1KT2A 2B4CL 2CNYA 4I18B 4NBYB 4PRIA 3VRJA 4XCFH 1F4YL 4QI3A 4KZEL 4PGBB 2JLLA 2I25N 3F58H 3BP7B 2WZ6A 3DVGB 2CDGA 4FAAB 1PD0A 1A7PL 3VXMA 1KB5B 2DLIA 2H1PH 2OX5A 3UGXA 1MW3A 5J11B 4S1QH 4WU7A 5B1BB 3SQRA 3EYVA 1MVUB 4WI6A 1SJHA 5F1NB 4JEGB 3GXMA 3V7AE 2SODB 4ZPVA 2CO7A 1DJSA 1TFHA 2Z31D 4NQVB 5FO7A 5ABDE 3A6BH 1NGXA 2G2RB 2AJXL 4RMTA 3AGWA 3RIAK 5MERA 1JV5B 2J7LA 3B9KC 3PNRB 4ELME 2YPKA 5BW7A 5EEUA 1AD9A 4IHBA 1PY0A 1LWHA 1HQRA 2ZUVA 3FCUB 1JVLA 4KZDL 1PPIA 2DQHL 2KT6A 4WENB 1U8IA 1B2WH 3BWAB 4AM0B 2IGFH 3UYRH 5AVZB 2ICCA 3A67L 1L5GA 1P5VB 4KOBA 3SPJA 4BZ1A 2NY0B 2BC4A 3LDBB 4W6WB 3KYNB 4JMNA 1I3GL 4CDGC 1NZRA 5JZ7D 3U0TB 5IOPB 1EAPB 4YL4A 2YBRA 3O8XA 3QIWD 1E4WL 1WFOA 3BH8B 2M83A 4M4PA 4X50A 4E42B 4JY4B 5C3LD 3QUXC 3D51A 4OTXH 4Z7OE 1JZHA 3MLVL 4X4XA 2DLEA 1A1MA 1EAOA 2VXSH 5IHBA 3V0VB 4HG4J 5ICZB 1BDYA 4JFQB 1NWPA 2EUXA 5LG6A 1JF1A 3FRPG 4LDOB 3LXUX 4AGQA 2BZDA 3DHMA 3P54A 2HB0A 5ADOH 1T1ZA 4R4ND 1AY1H 4HIEA 4PJAE 4ATTA 4Z77B 3B2DC 1OD9A