1UT1A

Drae adhesin from escherichia coli
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
140
structure length
140
Chain Sequence
b'GSFTPSGTTGTTKLTVTEKCQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCDARQVALKADTDNFEQGKFFLISDNNRDKLYVNIRPTDNSAWTTDNGVFYKNDVGSWGGIIGIYVDGQQTNTPPGNYTLTLTGGYWAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DR HEMAGGLUTININ STRUCTURAL SUBUNIT
molecule tags Protein binding
source organism Escherichia coli
publication title High Resolution Studies of the Afa/Dr Adhesin Drae and its Interaction with Chloramphenicol
pubmed doi rcsb
total genus 27
structure length 140
sequence length 140
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2003-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04619 Adhesin_Dr Dr-family adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1570 Mainly Beta Sandwich Immunoglobulin-like Dr adhesin 1ut1A00
2IXQB 1UT2A 1RXLA 1UT1A 2JKNA 2BCMA 2W5PA 2JKJA 2JKLA 1USQA 1USZA 2VERA
chains in the Genus database with same CATH superfamily
2UVEA 1FJ1A 1CFTA 4I2XA 4AYBA 2R4RH 5FO9B 4GAYB 3PCYA 4NO0A 5CINL 1A25A 1XAUA 1QG3A 2GUYA 1MJJA 2HLAA 1NDGB 2E8ZA 1BQHB 2HVJA 1VADB 3WTSA 5LBVA 5IJKA 4KH2A 3ZRFC 3ARQA 5I28A 5CJOL 3E6FA 2F9BT 1WRFA 2FJSA 5F6IC 4YXHH 3B9KB 5E5RB 5C09E 4GB9A 3T2PA 3VI4E 4N8VG 2EADA 1ZVSA 3DNKA 4AITA 3RBGA 1YQVH 5KVGH 4NC1E 2AXGA 4NI3A 1PX4A 2Y1VA 2BSBA 1Q1JH 4UIMB 1FYTD 3RWFA 3CVBA 3S35H 2OV0A 3WXVL 1AI1L 1YYLL 3D0VA 2PYEB 1A6WH 2Q20A 3HZMB 3CLEH 3FQ2A 2VMEA 4IRJC 4L4JA 4U3SB 1XGQB 5EU4B 2RFXB 2XRAH 1DFBH 1QP1A 2ZJSH 1UXSA 2IH1A 1U4FA 4PP1D 4NO3B 2W92A 5DJ2B 3GJFK 1PLGL 3VMNA 5BZDA 4LVNB 2FL5B 5GS0L 5HDQL 5C7XL 4MD4A 4JG1H 5E2UH 5KG9B 4EXPX 4U1SA 4HS3A 2G3ZA 3DX3A 3W5MA 2FATH 3HUJE 4GO8A 3VQLA 5IB3B 4N26A 4R7VA 1A02N 1RLBA 4XP1L 3NFNB 2PCYA 5KSAD 2PO6A 4XN2A 5B8CC 4KMLB 3B3IB 1WQVT 4S2SB 4MXQD 4F7TA 1FZKA 4OFYA 5HYJA 3GXTA 1PMYA 2E6JA 1EO7A 4KH9A 5BOJA 3GSXB 3Q1SL 4Q9QL 3T65B 2YMXH 1EERB 4JJHA 2OX5A 2Y36H 5FECB 5GS0C 4HSQA 3Q5OA 3RUGE 3MRQA 5KWYC 1YNLH 4KBPA 3P3RA 2ZKHL 5AVYB 2AQRA 4HJGA 5DRWB 1INQB 4YDIH 2AQPA 5IROA 3IXAA 4GAYA 4KKLD 1DVQA 1YMME 4X4ME 3FCTA 1A6AA 3BP6B 4JPIA 4GW1B 5JPMA 3TJEL 2GITA 1KYFA 5F7EH 1CO1A 2DQ6A 4GUPB 2VISB 5EN2B 3VJ6A 3E6FB 2WGNB 3TF7C 4M7ZB 4IK7A 3CLEL 1NJ9A 4PJCE 3DIVA 4NPYB 1U8HA 1W72B 4YPJA 1ZCRA 5GJTH 5I6XB 3V9EA 4A67A 4M4RA 4CVZB 4F33B 2QZQA 2XWCA 4X4XB 5A43C 3RVWD 3WFZA 4AMXA 1RURH 3CDCA 4N2AA 4BJLA 5DYOA 2R69A 3QI9A 4DPRA 5GJTL 4YDVB 3DX8B 4XVJL 2R23B 3ROOB 4XC1H 1AKPA 4KQ3L 3B1TA 4XPHH 2AJZB 2F7IA 3CZFB 4KI1A 5FKAB 4I4WA 3N40F 1BXVA 1RLWA 5C0ND 3L3GB 3QQXA 4D9RE 4KUZL 1ORQA 3CDZB 3IK2A 4KJWC 4E9VA 1JN6B 4U1NA 1JF6A 1H3PL 2R1XB 3GD1C 1T1ZB 3QFJA 3AJ7A 5EORL 5F9AC 3H7BB 4KO5A 1ZXQA 5DS1A 3N9GH 2XZAH 1PNDA 1H6UA 1KJVA 4OFDA 4PV9B 1BVKB 1ZMYA 1LO3H 3SZKC 3PWJA 3RAJL 3VFPA 4JRXA 3HS0A 3SHSA 3BKCL 4PSPA 4Y19E 1ZLVH 3MJ9A 1JIBA 5GGVH 3A4EA 5D2NC 1IBHA 1VEMA 2JKTM 2VZUA 5MENE 4BHUI 2WUCH 4B7LA 2WW8A 4X6DB 5AW5B 1ETZB 4FEMA 4S1DC 4QYOA 3RLSA 4P2OC 4P5TD 2IMNA 2KL6A 3FCUB 1QFUL 4X7EC 2G2PA 4XP4H 3T2OA 5IB1B 5DQJA 5FHBL 2MCPH 3V0WL 3UGXA 5IV2A 1OGAB 3L81A 4PBXA 1LO0L 1DHKA 4QTIH 2VDRL 4ODTH 1PSKH 1ZT1B 3H2WA 3MJ6A 2JTDA 3HRPA 3VCLA 3K6FA 4R4NC 3EYVB 1JPFA 3Q7JA 2VLJD 3FQ1A 1UWEL 1ZOXA 4B9ZA 4HIJA 2EE6A 3R19A 4TL5A 4HWBA 1UENA 4YSQA 3QYMA 5K9OB 4W9IC 5AAWC 4L1SA 4ATTA 2VW4A 5DUBA 1DFBL 2C3WA 2Y7OA 3BMWA 4PP2B 5DF0A 4LSQL 1JFQH 2CBQA 2DN7A 5FCSH 3QIWB 4ODSH 2X5PA 1NCOA 3RL2B 4UAOB 5D8JL 3MXWL 4JFEE 1WLHA 5H35A 1PVHA 3A5VA 1DUYA 1JPEA 1YSOA 1CD1B 3D8MA 4G6MH 3AB0B 4LCIH 5IQLA 4Y8AA 1N2RA 1WS7A 3VFOB 3C6LA 1U41A 3GLAA 1QHQA 5C07E 1QSED 2P45B 4RDQF 2DQJL 5FUZL 5D1XA 3RWGA 4FQJH 2A3TA 4NQDA 1ZPLA 1ORSB 4YXHL 1SXCA 1X7QA 3LEXA 4OH2A 4U7SA 4AG4H 4HH8A 5CILL 3WFBH 3K0YA 1E8YA 3VGGA 3TIEB 5SWZE 2FT6A 4YHIB 1PAMA 3VRLE 4GSQA 3NTCL 1LEKA 4CNIB 1DL7L 1Q4NX 5CEYA 4HIHA 5C0BD 1KLUB 3S3BB 4BK4A 1MI5A 3HHRB 2ICWB 2TAAA 3HRZB 5KBPA 3OGCB 2N1TE 5BRQA 4L9DA 1CGWA 2HJKB 5CJ8A 3UGUA 2FSEA 3S36X 1E4XH 3FT4B 4NN5C 4AJ0A 1NGQH 1LWHA 3ZTDC 2O6EA 3E80A 3VWJD 3QSKB 3U1SL 4LDOB 1KGJA 1RUAH 5I8EA 5ICYB 4H0HB 3WMQA 3RE0A 4RFNC 5CR1A 3CHRA 5HHPB 4I87A 3P02A 3GHBL 5KZCB 4HEPG 4NBXB 5FFOA 4X5WA 1MHPL 2VDOL 4QHNB 1GXEA 2XICA 1GYWA 3O6ML 2F7PA 3NIGB 2NX5D 1UXMA 1U42A 1GZHA 3WJMB 1ZS8A 4G72B 1FO0A 3VXOB 4MA7H 3KNBA 4XI5C 2BPBA 2ZAIA 1ERNA 1NFDA 2WXPA 1OF2B 1MWOA 5E5MA 1C8PA 5TQ2L 4MAYC 4DNLA 1BVOA 3F7KA 2LHAA 1ZT4B 1FCCA 3DI2B 2P8LB 4H2CA 4OUUA 4UOZA 1I1RA 2AK1H 3QUZD 4NO2B 3NACL 1DBBH 1XSOA 2JKIS 3NN8B 3GO1L 3R8BB 1Z6JT 2XC8A 1OGSA 5IFHH 5D7HA 3MNWA 1NCHA 2X41A 3H1ZA 1JNLH 3RVVC 3OJ2C 4JQXA 4ES9A 5L6YH 1MIEL 4OZHA 3R1GL 3IFLH 1BOGA 3LN9A 5E2TH 1XCTA 3KPTA 2DWXA 4Z7OF 1XR9B 3MLZL 1YJDC 3BKML 3GJEA 2R0LH 4BGDA 2DY2A 4PAZA 5EFIB 3AACA 4A66A 4PJIF 4L5FE 2WLHA 2DEWX 1GGCH 4OJYA 4C4KO 3ARFD 4QRUB 1NBCA 5L2KE 4EDXB 2CIIA 4PJ8A 3OC8A 2EC9U 3PQYE 4HK0A 5DD3L 4FNLL 4O5LL 5FFLA 2ZX7A 3DVIA 1NGXB 3BUDA 5BZWB 1Q9KA 1I4FA 3K2KA 3M86A 4HUWA 3RIAF 4LSPH 4JQVC 3QWRD 2NY1C 4PJ5E 3MLPA 2F68X 2ZXBA 2ARJQ 3OR6B 1HXYA 4MJID 4WFGE 4EI6A 2VC2H 1KCBA 1DQLH 3L3HB 3LHAA 4NP4H 3MACH 2CNYA 2BRRL 4HOMA 4NBZB 4P46D 4QRRB 5E2JA 5CHNA 3FHEA 3T0EE 4AYFA 1XHHA 1NMCB 1Z9SB 3IMWA 5HGAB 2Y5QA 4J28A 2X4TB 2YD4A 1SMAA 4GXVL 3K46A 2GYSA 3C6LC 2YXMA 4MAUH 3KG5A 1UG9A 3QUYC 2WQVA 5D4QA 5KAQF 2DMHA 5J3HD 2J5LB 3KE0A 1EHLH 1OAJA 4OQTA 5AW4B 1QX1A 2TRHA 4N0CC 1OW0A 5IOKA 4I5BA 1S7QA 3FZUC 5F1KC 1M1XA 3U6RB 5JYMA 3RUGF 3N1PC 3BKJL 1ZANH 5JIQA 1CLZH 1BMZA 1HCFX 5HYSG 2EJ1A 2CJ3A 3CPUA 5F7KC 5LG6A 2LGNA 1Z9PA 3N6YA 2AK1L 1GPOH 2OFQA 2C9QA 5A6LA 3CXDH 2Z8SA 4XN4A 1F4YH 2BSRA 1MNUH 3WOVA 3RILA 3HS9A 2Q76B 3BZ5A 5FM8A 4IRJD 1ZANL 3RB7A 4CUCA 1ZGLB 4JCMA 4FCAA 2V2TA 4YHKL 1A9EB 3SDCB 1WV7T 3EDDA 2OL3H 1QNIA 3FK3A 4F7EB 4NAQA 3SE4A 1AO7E 4NKOA 4MMYB 1QTPA 5E8NA 5GZOC 1ZHLB 3QQ4B 3X13B 4UT6L 1UACL 3IU4L 2FK9A 1N67A 5E94B 1M57B 2IQAA 4HUVB 2NQCA 5E9NA 4GKOA 4OV5B 3IMSA 2Q7YA 1JZHA 4I88A 4LLDB 4WTZA 3QPQD 5I8KL 5SWZB 1VFBA 4JFPA 1XF4A 4M8UA 3SE6A 3UTQB 3C8HA 1AIZA 3WFCH 2DS4A 1OARH 5FLUA 1NAKH 3P73A 2V2WA 4IRSA 3TVMB 1QBAA 1U8MB 1KLGB 2IPUK 1CJYA 5EZOL 3NDZE 4W4OA 4F2EA 1I7RA 5ID0A 1JV5B 3QEGH 2H45A 2PTTB 2D4FA 5I8KH 1KLFB 1GMIA 3QUZA 5DR5H 2G5BB 2I9LA 3EDJA 1SFDA 5GS0H 1SY6H 2WUBH 3QXAB 2NYYD 1IBZA 3MRFA 4HLZH 3FH7A 4EZLA 4ZRGA 4J4PD 3E3QC 5K9JH 1N18A 4GLRI 4HIEB 4NIKB 5AALA 2EXWD 4LK4A 2ZOWA 4PRDB 3W56A 1XF3A 3QK0A 1TZ8A 4Z7IA 3BAKA 1W6WA 3NEOA 4RSVA 4WEMB 4I18B 4XBEL 4PJHE 5FWRA 3KPSB 2RCSH 1CR9H 1WVZA 4CADA 1OVZA 3WN5A 5JIIA 1WK0A 3F7YA 1J7VR 1TJMA 3ET9F 1XL4A 2YHGA 1KXTB 2J1KA 2P44B 1S78D 1LYQA 2C7FA 3OMIB 5JPMC 3O4LB 1FVEB 2NX5A 2J56A 1DE4B 1MCIA 4YHOL 1PLAA 2ADFH 1BZ9A 2HKHH 2Y25A 5DJZA 4ZO9A 3CN1A 1T7XA 4Q9RL 3QFDB 1MEXH 1TJHH 3KW8A 5I74B 1NLDL 4NEHB 2AQSA 2V5TA 3D30A 1BZEA 1U3NA 4Y4FC 4ZS7L 3C09C 1QFPA 5HGGS 3T4YA 4BH7B 3M8OL 5BMFH 4NN6C 4CILA 2MOVA 4PWIA 4MMXB 3RA7H 3TA3D 1AZBA 3STBA 3RKDC 3K2UL 2O1AA 2Q9OA 3MROB 4JO4H 3OV6A 5EBLA 1AG0A 1B0GA 2IDTA 5L2KB 1MPAL 3T09A 4P5TA 5T3XL 4DVRH 4WV1A 3DVGA 4X6CF 1JNHA 4L0YA 1CQKA 1I7TB 4G9FA 5D6DA 2IDSA 2LLLA 3FFCB 5LAPA 4EE2A 5C9JA 5GSRA 1FZJB 2KPNA 1RK0B 2B9AA 3RWIA 3S7GA 3O45B 2V5MA 4UT6A 1W16A 3DX9B 2QADB 2E9BA 2ZTBA 2ZXAA 3L8QA 2WLZA 3BVNB 4EI5D 5EO9B 3BI9X 3CZUB 3ULUL 3FB6B 4NZRL 5I5JA 2XKUA 1LGVA 4K5OA 3NABH 4F9PC 5GGUA 3CDFA 3LQZB 5E51A 2WWNA 4ZFGH 2BW4A 4Y2OA 3FUMA 3HKZA 4BSWA 4QOKD 1WAAE 1YUKB 4BKTC 3ZKQD 1FC2D 1KT2A 5T5FA 4OD2B 4FAAB 3O3BB 1N5YL 4AK1A 2BHZA 2XG4B 4PJFB 1Z3RA 1K6QL 1AMYA 4Y5XB 5HGDA 8PAZA 1AD9B 3KLDA 4GO9A 3O3UN 4MX7B 1T03L 1BIHA 2EO7A 1MCDA 3MX0A 2JKSA 2TSAA 2R15A 4BRVA 2ZXEB 2YN5A 3CC5B 3JV4A 5AKRA 3BAEH 3AQDA 4XZUB 1BX2A 4LLQA 3EOTL 3BW9A 4XHJC 5EBMB 1J05A 1VZIA 2R2BA 4FQLH 4LNRB 4DO4A 4KJYB 4Y16B 3JWDH 4FQPA 1AR2A 5FYJE 1Z9MA 3B34A 4KHTL 1G7QA 1RUKH 1NC4B 1LXMA 3OX8A 1AO7A 5D7KD 1WFJA 4RAUB 1YO4A 3ECBB 4QD2E 1GZPA 4R0LB 1IMHC 5C0NC 2RR3A 4NOFA 2GSIB 3I02B 3PGFL 1ONQB 3BPLC 4HZ1A 2HFGH 1WBZA 4GXUM 2Q8BH 2C3HA 4QRAA 4NUQA 4OFVA 1MHCB 3SDAB 1D5IH 1OK0A 2HJFB 1ZSHA 2VAJA 3BWUC 2VKXA 4U0RB 3P9WB 2OMZB 1UD5A 2NY3C 2HX7A 4IRJA 4R4FL 3NZHH 1VFOA 1N8ZA 1NCJA 4CBZA 1UM6H 1XD1A 3DMMA 5BOPA 3FTYA 1RI8A 2FGWL 3L45A 1D5IL 1IILE 4I0PD 1X9RA 4N85A 4QOKA 4ADIA 3S88L 4FYTA 1KPVA 2GJPA 4DKAA 2QSCL 2ZYSA 4BV1A 2B59B 1M71B 3U9PH 4NO0D 5D72L 2XOTA 5KVEH 1J1XH 5FDYA 3C9NA 1CLVA 3D25A 1SMDA 4P2QD 2QQNH 3MJGX 1FL3B 4GS7C 4JG1L 1MCWW 3AY4C 1OCRB 2A6IB 2GY7B 2CUAA 3QEQD 4IU3A 4OFPA 5EUKA 3VA2C 2BP0A 4ZQTA 5F7NC 1PY9A 4KUZH 3BAYA 3MLTA 5DHYB 1AS8A 4FHKA 5CN2A 1AD0A 3C5ZD 1ULVA 5A2KH 3SGKA 2A77H 1CE1H 2AV7A 3NSDA 4IRZL 4ZO8A 1AG6A 4Z76B 5EPMA 1L3NA 5I15H 1GOHA 1J5OL 2WAHA 2PCFA 2YRZA 4LCIL 4O4YL 4F9LA 5HHXH 3EH3B 4HXBH 1N6VA 4NBYB 4M1CD 3VVWA 1CXEA 1BGXH 3OGOE 1O5PA 2OQJB 3OC5A 3KHOA 2PPAA 1BXXA 1CD0A 4OM1L 4E41D 2R39A 3PAVA 3BT2L 3EO0B 1M2VB 4GI6A 1CPUA 4LLUB 2E59A 3CFQA 2V8MA 5AOIA 2A4CA 1QNZL 1NANI 1BVZA 1X6LA 2DQMA 3NSJA 2WNGA 2NZ1A 3VFSB 4U4IA 3REWB 4L1DA 2G3NA 3EO9L 4JFDD 1U3JA 1LJMA 1PSKL 5D7IF 5EWIL 5CFAA 4UQ3B 1QPXA 4OZGB 5DQDH 3GNMH 3BGMA 5AZ2L 1MRDL 4J3UA 1CDHA 4R97C 3B2MA 2L8AA 1JWUA 5SX4H 3RY6A 1AGEB 4OZHE 5B1AB 1BD2A 1P4IL 3LPFA 4UM8B 2WKOF 3VXTB 1RIHH 2DQDH 1F3JA 2OPCA 3C2SA 3NAAL 4NLAA 4XPAH 3QIUC 4QNPE 3IGUA 5SV3A 5AB1A 4KRMB 2UXVA 2XWEA 5KTEH 3CVCA 1JVLA 5DGRA 2IAMD 3ARXA 2L7JA 3BGFB 4PJAE 2BCKA 4UM9D 2ZSWB 4E42A 1TEGA 4OCSH 1QO3A 1HL5A 4J1UA 1WFOA 2B59A 2WOBA 5T3XH 4KHXL 4M4RB 4UINL 5IG7B 4K0OA 4G42B 1JFHA 2A9DA 3T0BA 4JHAL 1ETJA 3FQNB 4G6JL 5CLZA 3WN5C 3NIDB 4FQ1L 3ATDA 3WAJA 3FTVA 4NRZA 1GGCL 1JHLL 1I1YA 2BC4B 2BP0B 1JHKH 2AI0H 3VH8A 5BS0D 2CQVA 1QZ1A 5CP7A 2LU5A 2NY5H 5L9DL 5JDJA 4HPYH 4IS6A 3QJFB 4JPVH 1OGTB 2VDLB 2XSKA 1C08B 3L3OB 3QG7L 4ODVL 4PWGA 5HDBB 3WIHL 3TEUA 5IUSA 3ZTEA 3QISA 3FU7A 1EMTH 3TF4A 4Z7WF 4P9HC 2HG0A 3N41F 3VWJA 2G2NA 1F3DH 5DHVA 3H42L 3QDMB 1YPZF 4Z5RB 1INEH 3QUHA 1JYXA 1VESA 2RB8A 3TU6A 4TVPH 3UC0H 3DX6A 5FAAA 3UERA 1BEYL 1KB9J 2B2XH 2GB2A 4U1IA 4DSYA 1KGXA 3GSVB 4OLWH 3RDTD 5B38B 4EN3A 2NR6C 4U1JA 3RFZC 3WYRA 1Y18B 3A4AA 4UNUA 4X7CC 4UIMA 4HK3N 4KK8C 4WZ9A 4JGJA 4LLYB 2GJJA 3VDBA 1IRAY 1NINA 4GKZA 1J0KA 3NCFB 3WNKA 3SO3C 5C07A 5GRYA 4EBQH 4RZCA 1XBRA 5F9JA 5FA4A 2RQ8A 4P4KD 3Q3GA 4PVMA 8FABB 3HN3A 1ADQA 3IAQA 4NO3A 4WI8A 1A7BA 4NS0A 3S8GB 1EDQA 3EFDH 5F6HI 5IMKA 4J4PA 5KYWA 4S10A 4XX1G 4LCWD 2NYKA 2VXSL 1T2QL 3QQDB 1D9KA 1CLCA 2RBLA 1ZLWK 4L3AA 3RY4A 3U4EA 1I3GL 4IDJH 3U46B 2VWEC 2YBRA 4WW1A 5EF1A 1NCDH 3M8OH 4UOW1 1EJFA 1YYML 4TNFA 2FUTA 3ELQA 2A0LC 2BHYA 5B38G 3LN5B 4MA8L 4NKDA 1E43A 1JZDC 1MCKA 1MEXL 1TJHL 3FOMA 4S0HA 1KGYE 1XAKA 3RWJB 3LIZH 4G6KH 4LL9A 2NY6C 2VOTA 5DURB 4ODWA 4W4OC 4WHYH 4IS6B 1PLGH 3V5HB 3H0TA 4GQPH 1QFOA 4PJAA 1XQ4A 1V8HA 2VW6A 3PGDB 1NCGA 5FV1L 1CLOH 1KMGA 3J8F7 4AMKH 2DMGA 4BFNA 5CF3A 1U8IA 4AGQA 2YAFA 2Q6WB 1G6VK 2WY3B 2Y9RT 3C6LD 1PDKB 3IAPA 3MUGA 1Q1JL 2VERN 4PRIE 1GYAA 3SKJH 3FSOA 4ZFZA 1KLUA 3SE8L 1ZIBA 5BRPA 3HRZA 4RDQG 2PPEA 5EULV 1TTUA 1F45A 4V2BA 3QEQA 3BSGA 3IGAA 2VDPL 2X87A 1JSYA 1CFVL 4NZUH 5EO1B 4OTXH 3ZGIA 5HI3C 1MW2A 3S36L 3MRMB 4QTIL 5CGYC 5CD3B 4NZ8A 5ADOL 1AJ7H 1BFSA 2Z93B 4LOUD 4MAYD 4K94C 4JLRA 3UG4A 3DX1A 5KN5A 5F3BB 3LHPL 4NUGH 4XP4L 1TSRA 3A47A 1PL3A 2EKSA 4PJDF 1IAII 2DL2A 4UILL 3P3UA 3BT0A 1S5IL 1K3ZA 2V4LA 3B7TA 3D18B 3EF7A 5H37H 2EDMA 1RU9L 5F93C 1P84J 3CMGA 3BWUF 1UXLA 2OMTB 3I9GL 4MWFA 1J9QA 1GGBL 3QAZB 4AW4A 3ARFC 1HK6A 4U1LA 1TZOA 1ZDSA 5LGHH 1KBKA 1IC5L 4W9GC 4OUUB 4N2GA 1AVAA 4Z77A 4BFFA 3NCMA 1OCCB 3TT1H 2RJMA 4AM0B 4JL1A 4F7KA 3EYOB 1LHZA 2VDMH 2YC1B 5JIMA 1UOLA 2Q3ZA 4UOW0 4WI0B 1D2OA 1I82A 4AT6B 1EAOA 5TK2A 4K8RH 3JWDL 4UUJA 3ZBMA 5I1KL 2ARJA 4GRMA 5HYQB 2D8KA 2WANA 1EO8L 3DJSA 3KYMA 4Z9KB 5I2IB 3IE4A 4KQ3H 4POZC 4JFEB 2KBGA 3HR5B 3MRQB 1IBGL 3HB3B 1YMHB 4KFMA 1OAZH 4X6DA 3RUGA 3FONB 3MAWA 3PP4H 2PLTA 1A22B 3NZSA 4QOKE 4X6EA 1T5XA 1SMOA 2V33A 3NJMA 4YR6A 3OKDA 3V5KA 4GXFA 3LZFH 3B7YA 1WWWX 3PF2A 2H8PB 3GMOA 5IREA 5DWPA 1KJ2H 1WAPA 3U79A 4JKWA 3KDMA 4G43B 1H9DA 3TBBA 4FXGB 3DGGA 3FFDB 1C16B 4KKCC 4PRHD 2D7NA 4L5FL 4J39A 4HS3B 4FLOA 4OCWL 3M45A 4L4TD 4TPRL 2NSMA 1I8IA 1IC0A 3MLWL 1ZHNB 3FTWA 3QCTH 3VXRE 3T04D 4DERA 1N8OE 4KQ0A 1PZDA 3FN0L 4I0PA 4YAQB 5CCKL 2R56L 1YQ2A 4D3CL 1WWAX 1LP9E 5KSBA 4S2SA 4MS8D 2ZKXA 1HINL 4RH4A 1ES0B 1U8OB 4XO5A 3GSNH 4OF8A 4QHMB 4L1TA 4U05A 4XPGL 1I8KA 5IR1A 3DGDA 3UPAA 1H6TA 3EZ8A 3RWHB 1XZ0B 2VSMB 4UTCA 4G8FB 3NJNA 4NQUA 1MFCL 5GZND 2XVGA 1W72L 5A2LH 4ATWA 4KKNA 3C5ZA 3O3AA 4KZEH 5HJBA 3KYOA 4M6OL 1PLCA 2AJVL 2H47C 3O0RL 4JM2D 3NA4A 5D5MF 1D5BA 5B1JA 4ABUA 4ES8A 4PW4A 1HEHC 5ADOH 1OT2A 4S1QH 4XNAA 3UP6A 2GG1A 1DZ0A 1Q0EA 3G08A 4NENA 5AW0B 3B4NA 3SJVA 3VJ6B 3K4DA 3WIIH 4DQOH 3NN8A 1NGZA 1WA1X 5KOMC 1CC3A 2C34A 1QR4A 3T3MB 3QUMH 3MNZB 2VLLA 4E68A 4EIGB 3IWVA 3ZR5A 3BPCB 3IU3A 1S7VA 3HEIB 2LE9A 1BBJB 3NCXA 5DMIL 4W9JC 4NRXB 3B43A 4S1SL 3K6IA 3TO4B 1A6TB 4WSGA 3LPGA 2Z91B 3IFPA 5D6DC 3L5JA 4OCXH 4E0RA 4ZW6A 5EC1B 3FW6A 4OJFH 3QPXL 5I16B 1OTTD 3VUAA 1OP3K 1OM3L 1PX8A 5FOBB 3RWCA 3MV7A 3B7RL 5D7JC 5SV4A 4AV5A 1NOAA 3BQVA 2P24A 1G1OA 4TUJA 4RWYH 1QSVA 3GEWB 5JOPE 1CTMA 3L7EB 4QRSA 4ANWA 1A14H 3W5NA 1BPLB 3IJ8A 4AENA 2X3BA 4ABWA 2NNRA 4UNVA 3F7VB 3NSFA 5D72H 5HSFA 3O2DH 2ZXQA 3WEOA 2IFGA 5BJTA 5GHWH 4NO2A 2K70A 2AQQA 5JHLL 1O6VA 4WTXA 3VXSA 5IHLB 2VDRB 2ITDA 2NSQA 1ZWIA 2OK0L 3FFCE 3BD5A 3CVHA 2WZ6A 3ESOA 4AW7A 4IRSC 3N85H 5B7EA 3IVKA 2MCPL 2W07B 4LSSH 3WXWH 4KO7A 3CV5A 5J6HA 4XHQA 3RGBA 2V0AA 4ZW3A 3RU8L 4URKA 2OK0H 3QZMA 4PJHF 2D03L 3PJSA 2RGSA 3UTPE 1JDAA 5FF6B 2K4WA 3HC3H 2PP8A 4BZYA 3U4KA 4X0NA 1U30A 2O30A 3BWAB 3W81A 2EECA 2HG5B 1DVZA 1IAOA 5IQ7L 5JQ6H 4ZFZB 4CN4A 1M56B 5BV7H 4DK5A 1NGZB 4RMBA 2F7OA 2NUPA 2R29L 3DA0A 5K9QI 1NJ9B 4HPOL 3ZYJA 5DGQA 1BGXL 7TAAA 2OL3L 4BWWA 1INEL 1MCPL 1OP9A 5I1DA 1N6QL 1KG0B 3QJRB 3ZSTA 4OY9A 2J21A 4FXKB 1DSFL 5I8EB 1N4XL 5AVVB 1NCWL 3PP3H 3U36B 4DGIL 3DOSA 4S1DD 5C0IB 3HTLX 4M8RA 3L3JA 1QWHA 4IKIA 5DEZA 5EZIH 4M9PA 1ETA1 3NH7L 3G6DH 4G70B 5IVZB 3LN4A 2W9LA 2QPSA 3DSFH 1Q38A 4JO8A 2UZIL 3F04A 3VI3E 2PW2A 3QQNA 4AK2A 4GJTB 1IB5A 2IQAB 3FJTA 3KS0J 2XQBH 2A6DB 1W0VA 4KXCA 2CDGA 5BXFA 1HILB 1UQSB 1J5HA 3O9WB 5JORB 1H5BB 4PJ9C 2EO1A 4XVUC 3S3DB 2FGWH 4G6JH 3ULUH 4OAWA 4PJ5D 2YFNA 4KJWD 3UBXA 5G5DA 2H5UA 5KANG 5DEGB 4Z95L 1OAXL 1S9KC 3L9EA 4HDIB 4CSTA 4WEBH 4OCYL 1SJVA 3QJVB 3DX7A 5IB5B 2ESVA 4L9LB 4ZX4A 1XCTB 3CFCL 2TSBA 4PRID 3Q6GH 3N43B 2M26A 4PHXA 4D8PA 5CS7A 1OL0A 1GYCA 2DLGA 3QUXB 4ODHH 4ANKA 4U3SA 2NY2B 5IB1A 4JUSA 1CIUA 3EHBB 1DQML 3WN6A 3WUWG 1YNTA 4B6ZA 4X4YB 3SPIA 3GSUB 1ZEAH 1ZVNA 2VERA 1K5NA 3Q6GL 2VXTH 4UTAH 3FH8A 4OD2A 5ENWB 4JQIA 5C0DA 4KK9D 5IB4B 2FL5A 3LPOA 3ZL1A 3ZKXB 3MUHL 1N64L 2IGLA 4TPRH 1NFDB 4DP9X 1FORH 5T1LB 4N2MA 1FNEA 4QTHA 2ZSVB 2I60L 5D6CB 4HKBB 3V4LA 4F2MB 3QGVA 4EUPA 4MAYB 3WTXA 1KPUB 2AK4A 3T71A 3GK8H 4WCYL 5IFAH 1NSNL 2EEDA 4LHJB 1D5ZB 5ERWB 5D2LA 3P54A 5C7XH 5KYYB 5I0XA 4HH9A 4NC0B 3MA7B 3SPJA 1HN1A 4LKCA 4R7LA 1C5DB 2HLEB 5EO0A 4K9EL 1VHPA 1A21A 3VXPB 4LCWE 1Q94B 1OTUD 3MBEC 1BCIA 1IGIL 3GIVB 1UM4H 5DSCA 4X6BB 3I6SA 5EU5B 3EFFB 4KK5D 4XGZB 4PTUB 4QRUA 3ZHFA 4MB4A 2DTSA 3MROA 1D5MB 4X7FC 3ECUA 2Y7QA 5IY5B 4C83A 4MNGB 2AGJH 2XA8H 2X9ZA 3QWRA 4PJ5A 3NP4A 4GMSH 3QULB 4GT0A 4ZS6D 4XXCA 4P06A 2A38A 2D7PA 2XWDA 4MA7L 5EU6A 5HDBF 1FGVH 4B60A 4ZMTA 4OCLC 5G5DB 2QSCH 4Y4KC 2FQDA 2NLJB 3OKKB 2ALAA 3CFBA 2IDCA 1GKOA 4PJXE 4JCLA 1HXYB 2ITFA 2NX5E 4MDJB 4F80A 2EKJA 5CAYB 5L7XH 4IGBA 2DQTH 5B7FA 5EB9A 4X4XA 3FRUA 1KWGA 3QJZA 4HIXL 3D2UA 2DEXX 3FT9A 4OLXH 1BWWA 4PJ9A 1FAIH 2BIOA 3CLFH 3GLEA 4BZ1L 3IDGB 4QNPF 5EC1A 1J87A 3KH3A 4XAWL 5DK0A 1A4AA 2D4DA 4UDTA 4K7PL 4XMZA 5D7LD 4HUNB 3OQ3B 2OJEB 2WCSA 5HY9A 1RZ7L 2A9BA 2XWBB 4WNQA 1KIQB 2MTAA 5AYQA 4XPGH 3MLTB 1IBYA 3E1ZA 2EH8H 3ILEA 5IEHA 1XGUB 4FQHA 2XG5A 2X9WA 3LDBB 4ELME 1NLDH 4OZHF 4N2FA 3QNYA 3BAIA 2G30A 1HQ4B 4G8EB 5D96C 4WFEE 3KGTA 1TMQA 1BLIA 1CE6B 4FNUA 1QVOB 2LVEA 5CZXC 2P42B 1JI2A 1RK1B 4V1DE 5LO7A 5IOPA 2H32A 4XMKL 1B0RA 3D0LA 5CEXB 4MAZA 3UAAA 2ZXWB 4MASA 1SDYA 3ARDC 3NOIA 2FNWA 3OZKA 2F54E 4MTMA 4KGLA 4N2IA 1B4TA 1UFGA 3B3IA 3JYCA 3TJHC 3LPWA 3CSBA 1TQVA 4AEFA 3HAEB 4H8WL 1MFAH 1AQDB 1R3KB 4JM2F 2EAEA 4QXUH 5DZJA 3IF1B 4PV1C 2DJUA 2BNQA 5HDWA 3HI1B 3LRKA 1IAOB 1ZTXL 3L3KB 2FR4A 1BQHG 3RVVD 3PWLB 3IMRA 4IJ3B 4LL4A 3OXSA 5L4MA 4AIZB 3ZDWA 2BMKA 2VDML 4X80H 2HVKA 5GS2H 1T2QH 5HI5D 3UTTB 3KPOB 2AEPH 1IGFL 5EZOH 5J1AA 4LIQL 2MKLC 3BFWA 1T22B 4PJ7A 3HCVB 4HCIA 2BO0A 3QCVH 3QIWA 4ZXBB 2H41A 4DT2A 2NQDA 3O4LA 4NZRH 1CF1A 3H9YA 1L7IH 3R7QA 1BFTA 4CA4A 3DTXA 2PTVA 4YSAA 1TQCC 2WC7A 2VTFA 2J2ZA 4HT1L 1SXSA 3VGFA 1KYAA 5JNYB 1HJCA 4DN4L 1MCHA 2ERJB 2UWEF 1ZVSB 5CGTA 2YAOA 4G3YL 1WA2X 2FTAA 3EH5B 4D2NA 5DMGD 3P4OA 4MJHA 3T4YB 4F33A 3QYNA 4DKFH 1H9VA 4LCCC 3S96B 3ULVL 3SB3A 1MFEH 2YMTA 3FBQA 4ZFOA 5EU4A 5DYOB 5F1SA 1UOKA 3BZFB 5GZNC 3WNMA 3VO0A 5A6MA 5B39A 4TVSa 3BRDA 3MRRA 4G8EA 5HHQA 3BKYL 1DQDL 2JELL 1UC6A 1ZHKB 3BP7A 4YHPB 3F12A 3DUSB 3PP3K 5F3FA 1E4HA 2VR3A 2IIJA 2K6WA 4OCWH 4XO3A 1W15A 5SX5K 4CKVX 4KMTL 4L37A 4WNSA 3ISYA 3K4ZA 3HBQA 1ZD6A 4OZFH 4JPVL 1VADA 2EIBA 3KPSE 4AE1A 1OSPH 5DMGC 4JZNB 1RJLA 1X5KA 4IIQA 2YAHA 2ZX9A 1KCKA 5GISL 3ZZSA 5C6TH 5HYJB 4ZMNA 5K1VA 1M2OA 3AVEA 1LO4L 5TE4L 3QQ3A 3ZTNL 2FQEA 3VFSA 5E8DH 1SHSA 1I8UA 5I74C 2H6UA 3REWA 4ERSH 1ZV9A 1KTLA 2FH6A 2VQ1B 1SOQA 4W1TA 4YLBA 4N6RA 4PJ6A 1JMXA 1DYZA 3KL5A 1SN0A 3U2IA 4BWTA 4EI5B 5C3IA 3TBWA 4ZMYA 1SUHA 3ULSA 2PP9A 5F7HA 3B5TA 3Q3GB 1DBAH 2H2SD 2CJSA 3QIWD 8FABA 3UTTA 5G2NA 1PZUB 4G9DB 4JRYA 1G0XA 4LSTL 3SE9H 4CDHA 3QPQC 1MHHB 3K6DA 1BLNA 4YDNA 4Z76A 5FYKH 1PY4A 1EJOL 1CVSC 3MRDA 3AU0A 5F7LB 3QUKA 3ES6A 1ZJAA 5LGKA 1YECL 3US9A 3AQZA 4OIIL 3ARDA 3U30B 1I9JL 5I30H 2CUHA 3M1OA 1ACZA 1E9PA 2J6EH 3I9PA 2XNAA 3GI9L 4NKMA 1XCQB 4KTYA 4V2CB 1WEJL 3CZGA 5FO7A 3V8OA 4B5EA 1AO7B 2D3VA 4PJ8C 5EU6D 3O4OC 1IL1A 3BSHA 2WLIB 1TIUA 2FQGA 3TH2T 4TYUA 1AFVH 3GMRB 2FHBA 3SQBA 4MDIA 2C7UB 2X40A 4BFEA 3VDCA 2HRPH 3H9HA 4FERA 4AG4L 5IROC 2VABA 4X6FB 3CGTA 4XNMA 2H26B 1OT4A 2PPFA 4XNQA 4LASH 3RJOA 4O4YH 3VFMA 3N42F 3D69A 4XCYB 1CYXA 3X3FL 4FKHA 4LOUC 2OSLA 3BP6A 4WU7A 4OQTH 4XVTL 2P28B 4TUOB 3L6FA 3CSGA 1KEGH 2GJZB 1CFQA 3RBSA 1A7PH 3QS2A 4XCNB 5KSAA 4QOKB 2R1WB 3THMH 3HG1A 5K93A 2JKRM 5JQHC 2KC0A 1G6RA 5AVQB 4FQ2L 4HHAB 4ADJA 3I9AA 5T3XE 1XX9C 4UV7H 4RFOH 1R0AL 4R7NB 2FH8A 3DOHA 5AOMA 5EIIA 5IJKC 2XYCA 3WY2A 4KUCF 1Z5HA 2CGRH 2OMNA 2BS8A 3RWEB 5IW3A 4GRWB 1EHLL 3SE3C 2IADA 3QT2A 4NZDA 2AKRA 5AB2A 3V0WH 1PEWA 2IF7A 2XTJD 2EZ0D 4G7QB 4HFWA 1F1DA 1KENH 5E2WH 3U6XA 4AYMC 4U6HA 4GPVA 1NUGA 2H0JA 4I3GA 3VFVA 3US0A 5E1AB 4U33A 1Z5LA 3TBVB 5H8DA 4Y16D 5FGRA 3VXQB 2H1XA 4QRFA 1UYWL 4TNGA 4UIKH 4D0CA 1J8HA 2CM5A 4LU5H 5AW7B 2W65A 2YK1H 5ABAA 2YD1A 4F92B 3MRHB 4BZ2H 3DV4A 1RZIB 4HS6A 4LVEA 5AQ0A 5DS2A 2MOGA 4QPEA 5D1ZD 3GJFH 4JQXC 5D7IB 3WUWA 2F1AA 4EI0A 1UWGL 1QHPA 2GEQA 4APQA 4KJPC 5ELIA 1RIVL 4ZFFB 1BOGB 3RX8A 3P77A 5JLZB 2IBZX 4QRPB 4YQXL 1IAKA 1IV8A 3JUZA 2ZKMX 1I3RB 2VRQA 2LFGA 1FVCA 3POHA 4F93B 1G9MH 4QYOB 2IV9A 1JPGB 2XG4A 4Y5XA 1RUQH 3MBXH 4YDJB 2HCZX 4LFHD 4OCRL 3SSGA 2XJLA 4ALAC 2N3JA 2GHZA 4FTDA 2WSKA 3W57A 1RAMA 1JPFB 4P46B 4QRRD 2YPLA 3SYOA 5D2LF 1VRSA 4O02H 3QWOB 3OKEB 5FUOL 3BUQA 1KTBA 3OKMB 2GBUA 4XP5H 2CBMA 3AXLA 2WBJB 4J6RL 4H40A 1WHPA 4FL4B 1MVYA 3QJSB 1IKNC 2GUOA 3V4VA 1R3IL 2E7DA 1ZLWH 3MRMA 3PPEA 5A7EA 1TVBA 2VO8A 1KTCA 3C2AH 4JM2C 1IGYB 2H7WA 4WY7H 3MHZA 2HFFB 3H4HA 3W0WE 4UT9A 1KGCE 1M9WA 4AYFB 3Q13A 1SGKA 3BZFA 1L5GA 3GXPA 4DGUA 1BFVH 3BVWA 4JY4B 5EV7A 1ORSA 1W91A 1AZNA 3KPRA 3SDAA 1SJMA 1JGLL 1OB0A 1KN4H 4FFWC 3FQXB 1MFAL 4EVNB 4KX7A 3LMJL 4D0CB 2ZNXA 5C0CE 1KXTA 4DN4H 2V3EA 1BAWA 5IHUL 1BF5A 1OK8A 1FLTX 4R6UA 1G7PB 2TRYA 4ZMZA 4EO5A 3EJUA 2JI2A 4PB9L 3F01A 1EHKB 2AEIT 3TWYA 2QVTA 4RESB 1HEZA 3SPVA 2AAVA 32C2B 3RIFK 3UYPB 3V55A 3II1A 5BMFL 2P3YA 3KJ6L 2E7LC 4YBLC 2P80A 5MP6L 3N43F 5D7IE 5JO5B 1ZTXH 3ECQA 3V2AR 3DO7A 1G94A 4IU3B 2HWZH 3P69A 4CBPA 1I1YB 3S5ZA 4P5SA 2CBPA 1QNZH 1T5XB 2IXQB 4QXTB 3MRPA 4OFIA 4QLWA 3C6SA 3BYYA 5EU7E 1F2XK 4ZUSB 4WKXA 1JGUH 1ZV5A 2DTML 5E9DB 1R5WB 4HWUA 1HL9A 3DGCR 3O6KL 3AWEA 2IFFL 4G7VH 3QPKA 2JVUA 2J57A 5G4MA 3NIFF 2CD0A 1WD9A 1G7JB 3QHZH 2FJUB 3QEUA 3BP4B 4YHLH 4M03A 4DKEH 1RVFL 3VI4B 4L1BA 3QRFM 4HIJB 2DWEB 1AY1H 1FBIL 4HUVA 4GAFB 1Y1DA 3FKUS 4PIRF 3U46A 1WIUA 4OV5A 2OLDA 3DX4A 1E3FA 4UILH 2MCMA 3NFNA 5FM5M 3L3IB 3BVNA 2NCMA 5LKNA 1U8KA 3IPFA 3V9CA 4HKJA 3FSAA 4G1EA 4M1CC 4NQEE 4Q52A 3UTSE 3WS6A 1I1CA 4ZYKA 5CN1A 1ZT7A 2WZPD 2J71A 1I8KB 4DK6A 5IR1B 2F8XC 5A3IC 5TD4A 3O6FA 2XWJA 1N2RB 4AIXA 3BEWB 1FWXA 3EOBB 2NW2B 1KTDA 4JFYB 5LDUA 1DDTA 3RFRA 5IBUB 1T1WB 2J6WA 2NXZB 4DQOL 4JE4B 2EDLA 5TDNB 2ENJA 1SBBA 1RZFH 3PJSB 1XB8A 4MCNA 2KQNA 2OMVA 3CSFA 3KEHA 2IANE 4I0PC 3VXTA 1VB9A 1X5AA 5FHBH 5EEVA 5B8CA 4G43A 5LCVA 3S0PA 1S7XA 3IJYB 3V0EA 5CU5A 2ZWNA 4DOHB 1A5FH 2C9RA 1HT6A 3JQOB 4PJIB 3OMAB 3ZTNH 1DN2A 4EDWL 2JMRA 3ABKB 1IQWH 2WP3T 1H3XA 2BERA 2NZ9C 3R4DA 4G8IA 2GJ6B 3AGVA 1RQ5A 4X7TA 1MF2L 4M93C 1XMEB 3DVNB 4X8XA 2FEEL 1FNGB 2JLLA 2R0ZH 2UWEE 4PJDB 1ZLSL 5EF3A 5E1HB 5FDWB 4TQEH 5DC2A 1U95B 2W60B 4XNBA 4B95C 3QRBA 4NM8L 2BSTB 3LRSB 2NW3A 4QF1A 4MGXA 1UJ3C 4PRPE 4NZJA 1NL0H 5KS9B 3T0DA 4QRPE 3CFDA 3LQAC 4FC3E 4ZAKD 2GI7A 3VFNB 4IGBC 1LNUA 3KYNA 5PCYA 4HXAH 1R3HA 4WO0A 5HDOA 1VCAA 1M7XA 3ILPB 2LQRA 4PJCB 1P5VB 1NCCH 3WY4A 1NEZB 3LNGA 3OF6D 4Y1AA 3RWDB 4JPIB 1NKGA 4OJEH 5JPMB 2Y5TB 3KPLA 1VEPA 2HJLB 3V6ZA 2Q7YB 4JDTH 1WFTA 3WTTA 1I1FA 4JM4L 1JV2A 3M1CA 1K2DA 1OAZL 3TYGH 4K07A 1DVSA 1JK9A 1F6FB 1SPDA 1ACXA 1C1EL 1U8MA 4HA1A 2EUZA 2F53E 1OOWA 1OGPA 3N0PB 4PCYA 1ACYL 4RMSA 3VG9C 5D5MA 4K55A 1U58B 1J9RA 1SJEA 3MXVH 1WAEA 4M7JH 4DGWC 4D8PB 2GJRA 4K5NA 2PO6C 2P43B 2VRKA 4HGMA 2QQNL 4MB3A 2D0HA 4U3XA 3NABL 2ICEB 3CH1A 5D71H 1K8DB 2Y6TE 1BVNP 4XVSH 3OBAA 5TH2B 5MI0C 2AABH 3ETBF 4F37K 1Z3GL 2CR0A 2XTLA 2PTUA 3O6MH 4DP6X 4WJG3 1HHKA 1KCRH 4ODVH 3WIHH 2FBJL 3NJVA 2KLRA 3L7EA 4RETB 2JH2A 3X1BA 3R06B 3RFZA 3VI3F 5IK3B 1ZT4A 2V2XB 1QEWB 3SDXE 4IBWA 4YAQA 2IPTH 3GMQA 2EXWC 4LESA 5I0ZA 2NXYB 1HSBA 1D6VH 2X4NB 1F0LA 3QS3A 3MNWB 1G4MA 2EE2A 4NM4H 4L8DB 1AXSB 2NYYC 5JHMA 2HMIC 1QASA 1QPKA 1ZHBA 2UWEB 4PJDE 4UQCA 5CBEA 3WJLC 3CIQA 3T65A 1TLMA 3VFOA 1XR8B 3GIVA 4MNGE 1SLVA 4RMUA 1BJMA 5T1MB 1BM7A 3U1QA 1H15B 3MLYH 1YUHA 5E2TL 3HBGA 3V5HA 1JGVH 3QHTC 2DD8L 4XE5B 1Y7VA 3IJSB 4N0YL 4JK0D 1A2YA 4J8RB 1CG9A 3CBJB 5FGCB 5IV2B 4UM8A 4Y4HC 2X6VA 3G7TA 2B4CH 4LT7A 4NHUA 5C09B 3CVHL 5GZNA 4P57A 3QNZA 4CAGA 1MRDH 1NCBL 3L54A 4JREB 5LXGH 1Q9KB 3V52L 4AXWB 3BIBX 3CAFA 4Y16C 2W59A 1RHFA 1HSAA 3MFFB 4XNXH 2IDFA 2WB7A 5TTRA 1FO0L 5I8OH 32C2A 1RXLA 2IFFH 3ARWA 5CM1A 4QY8B 3GWJA 5CO1A 3W2DH 4GFXA 3I6LD 3MGOA 4B9CA 3FB6A 1T83C 4TQPA 5CJOH 4MNQE 4PR5B 2UXGA 4OGYL 5D1QA 3S97C 1A7RH 1VGKA 5C3LD 4FLQA 5IBLD 2Z31A 4F7EA 1J88A 2G2RB 3SGEI 5F8RC 4BH7A 1MI5E 2DICA 2KH2B 3D18A 3I50H 5FO8A 4PGDB 3DPBB 2DWDA 4DQAA 4AQOA 4Z78A 5EZJB 5HHOE 1HOCA 2WN2A 3LD8B 5IBLC 2EP6A 1CGXA 2JF1A 3OPZL 3WJJA 5D70L 1L9PA 4N2OA 3IFOB 4IKKA 2CDGB 1R24A 1CB4A 1JWMA 4HGKC 3U1PA 4AUYA 3O6FD 1I9RH 2P8LA 2EO9A 2Y0SA 4Z5RA 4XBPA 5TFSL 4RVBA 3HLAA 1URIA 1NMBL 3WHE0 1MAKA 1B0RB 3IDJA 4X42A 4YXLH 4F57H 4NQTA 3BZEB 3FPXA 3FB7B 2XKNB 3EO0A 1OIOA 1J86A 2NNCA 3N2JA 2GFBA 4X4ZA 2IALA 4DTGL 4R5XA 1KCSL 2YPVH 3SDXF 3E8VA 3UTTD 5IZ7A 1VF5C 1C5CH 2FHCA 5EOTB 4JRYD 4YN3A 3FQRB 4XPFH 3OTTA 4HWBH 4KY1H 3BVXA 1PIFA 2WVVA 4NHUB 1X6NA 2SEBA 2ZPKH 5T33L 1I85A 3SY0A 1OTTC 3JVFC 3PABA 2JFCA 1MCWM 2WQ8A 3T1FA 1G9NH 1FFOB 2A83B 4K3EH 4I85A 4A39A 4LU5L 4FADA 2LU4A 1NFIA 2F74B 2N7SA 2PYFB 4WJKB 2HB0A 3W3BA 2VLRD 4U3CA 5IVOA 2VDRH 3CFCH 4JKLA 1QRNA 5KSAC 2AV1B 4FI8A 1EXGA 2QHRL 3ECWA 4MB1A 1XTLA 3SY6A 3VXSB 1GW0A 4ORZC 3ESMA 4LP8A 1VENA 3MLRH 4PJEF 4LNRA 3UC2A 4YSEA 1MWAA 1JZ7A 5E1GA 2W07A 5E00B 4G1MA 4MDRA 2BY1A 1XD0A 5ANMA 4N0RA 4PRBB 4YQXH 4BRJA 2D7OA 2VM4A 4RNRB 2XX1A 3QFJE 3IBEA 1IKNA 2FLRT 4I3SH 2I9TA 3KXFD 4Z78B 3RHWK 2DLIA 3MKGA 2OL3B 1MWAH 4IRSD 3AG4B 3B7SA 4YXKL 1ZSDB 3QNXA 1SXNA 2Y7QB 1UT2A 4Y5YA 2V6HA 3QEQE 4XC3H 1IARB 2C4FT 4HK0B 2DV6A 2FJGB 5I82A 3W0WA 2LW3A 5FYKU 1DJGA 3PFUA 4JRXD 2B5IC 2GPZA 4LGPB 5T1KD 3X1GA 5K9KB 3QUYB 1BQKA 1YPZA 3KPRD 2JIXB 2NOYA 3TBCA 3BPNC 2EEAA 4JZJB 2DQGL 4ONGH 5GIRA 4W9KC 5EOCH 3K74B 5I1DB 5IP4A 1B90A 3Q43A 2ATKA 4X50A 5FGBC 3T2NL 3LRHA 3N06B 3C5ZC 2BNRD 3RGVA 5E08H 4YK4B 1GOGA 1X44A 3ZL2A 4O51A 1RZJL 4TNEA 3DOSB 1R3KA 1O6SB 4N5UA 3RIKA 1QRKA 2CKBA 1ZE3C 1RSYA 5I1IL 5IQ9B 1M6OA 2LU7A 2BS9A 3NVQA 1B0IA 3ESPA 3HMXL 4Q6YA 2QSTA 3ARPA 1BMWA 2QGDA 1JS4A 1YMMA 4HWNA 2R59A 5EBLB 2VLKE 1IM3D 1XWVA 2ILLA 4QXGH 4XNYH 1NM4A 3QDJE 3ZK0A 4F2MA 2YKLL 4LBEB 5F7EL 5LAXA 1R19A 1GC1C 5I5IA 1BQRA 5J1SC 3UTQA 4OGXH 3TT1L 2JI1A 3EFOB 1RMFH 4PJGF 1FZJA 4BWUA 3IBOA 4H88L 2E9IA 2KERA 3L13A 4Z7QB 3BPOB 1LK2B 4P3WA 3JT2A 4NQCA 2LOEA 5LGHL 1CLYL 4F20A 2MPVA 2ZOLB 4HJJH 1BQLH 3GM8A 4J27A 3WTYA 3ZUCA 4L9LC 2HKHL 2DLHA 3FRPG 3UIYA 1FCGA 4YHOH 1N3NA 3FQUB 3OG6B 3PWUB 4LARH 3FUKA 1BVNT 4IIZA 3V10A 1GZPB 4R0LA 5D1XE 4YHYC 2CA3A 2RQEA 3X3GH 2CUMA 4XOAA 3MODL 4CGUB 3HNTH 4ODWB 4PGBB 1UCTA 4PJ5B 5DZVA 3QNFA 3DK2A 5JDSA 5I71B 3A4FA 1AHWB 4J7RA 4LCCA 3Q8CA 5IHZB 1VEOA 4NFCA 1KBVA 4AVIA 4MX7A 1RZJH 3CN2A 5HVWA 2NLJA 3OKKA 3PGFH 3Q2NA 5GGQL 2VDPH 4Z7AA 2QQQA 3FOLB 3BFOA 4ONFH 4CVWA 3NTCH 2XZCL 2X4RB 4LCUA 1G7MA 4ENZA 1P4UA 2WZ0A 4PMFA 2CHNA 3DKHA 1VERA 3GXDA 4QJ4B 1QHOA 3QDJA 4F2ME 3PDGA 1WYJA 3FUDA 2FX9L 1KELL 2EDKA 4PR5A 4NPYA 3HG1B 3U82B 3ARSA 3NJHA 3UOAB 2CPUA 3FL7A 5BS0A 1ROWA 1QLFB 4YOKA 1M71A 3RB5A 3GI8H 4FQLL 3DO4A 3BYTA 2BXZA 2OZ4A 1JGEA 4NT6A 4X6BA 3CU1A 4KXAA 1LL1A 1XCWA 3ORJA 3BJ91 3K72A 3QXAA 1DN0B 2UZPA 4XP6H 3AU1B 3O3AB 4OKVB 2J1WA 3CFEA 2ENSA 3TIDB 2NXZD 1KCVL 1XGUA 2UYLA 4N8UA 4YZWA 2C9UA 3RL1B 4M7LH 4WV1B 3PV7A 2J8UB 1QA9A 4HJJL 4N0UE 4KOBA 4YEEA 3IDYB 3U0WH 4NN6B 3T9WA 4XH2B 4LL1A 2WVTA 3G6JB 4HUCA 1SHMA 2YD0A 1J8HB 3E1F1 4OM0L 4P5RA 2ITEA 1EZVX 2OAAA 1SM3L 3UAJA 5FUCE 1QW8A 2H0EA 3FMGH 2YIHA 2ZCLL 1NM9A 3QFDA 5IKCB 1XB6A 3VRJA 2H1LM 4KVNL 4NJ9L 2VZOA 1HAWA 1MCFA 4UDUA 1G9EA 3UBXG 3KPPA 2QKIA 1TZIA 4N0YH 2HKFH 4X9IA 5DJAB 1LO2H 3L3KA 3UTZB 4FCHA 3IDNA 3EYFA 1UXSB 5IW1B 3UYOD 2WXFA 4WUKL 3IRCA 1A7QH 3UAJC 1P6AB 3QCVL 3OQRA 2MPAH 5DRNA 4G8AC 3VE0B 2E7HA 1F11B 1IFGA 1OAUL 4JKKA 4K73A 1U6AL 4F9PA 4K5MA 3VGDA 2ZP8A 3BUYA 4IKJA 4AI7A 3MMEB 3V0DA 3LV3B 2WD0A 3BE1H 4XN7A 1Y0LB 2XQYK 4LKCB 5IB2A 1W0YT 1E5YA 3VRIA 3NCEB 2VZSA 3WE6B 3WHE1 2DYPD 2VDMB 4J3OH 3ARED 2AXHA 1G1YA 1WT5C 3QARA 5DO8A 2XWTB 4JR9H 4PJBA 2HT3C 3HN8A 5DMKA 2WLIA 1JF5A 5LQBH 4AE0A 2H3NB 1AE6L 1FV1B 4B9IA 3IYLW 3KPNB 1RU9H 2J3SA 3TYFA 1RIUH 4M8QB 2XHNA 4Y2LA 1A8ZA 3DBXA 4TM9A 4O9HH 3ZE1E 4PJCF 3Q8AA 3VWKA 1PD0A 1QSEA 1T1XB 4HCFA 1MRCL 2X1WL 2DIEA 4UT9L 3TJEH 2ATKB 4HIHB 2X12A 4A2EA 3QIUA 4CC0A 4ABQA 1PG7H 3MNMA 4B50A 2E6PA 1W6LA 3AG1B 5F2FA 3FT0A 1TTBA 2IWFA 4HIIB 1V7NL 1G5AA 2NY3B 4O2CA 5AUMA 2EVIA 4PJXF 3V5DA 1JRHI 4OZ4A 4GSDH 3SYCA 1BXUA 4CVXA 5C0BA 3MLSH 5LXVA 4KV5E 4MS6A 3PDDA 1Z0MA 2D0FA 5F96H 4ZUTA 3MR9A 2ZKWA 1JK8A 4LPVA 1JYWA 2Z4TA 2VH5H 4NX0A 2EDFA 5E8OB 1VFUA 4PLOB 3UO1H 2A74A 2JWYA 1CXHA 3CZFA 3VFVB 5I17A 5MEPA 4I4WB 4UT6H 3WFHB 1WTLA 1F13A 4CN6A 3UYRH 4MRBA 1LEIB 1IT9L 1DSYA 1F90L 2QFRA 4HSCX 3JWDC 3J7HA 4JDEA 4AENB 1P0SE 3OKEA 4ZAKC 1N8ZB 1G4RA 3ZKMC 3LS4H 2J7LA 2K0RA 4G11A 3C2AL 4BFBD 2VLRA 4IRZH 5I15L 2WPGA 4A37A 1ZT7B 2ZWLT 3RWHA 4M43L 5EBWA 5D7JB 3VFTB 1TETL 1YY9D 1GS7A 1DQMH 1QBBA 1ROCA 1JD9A 1TENA 4MDIB 3DV6A 1IAKB 5DLLA 1IIIA 3SGDI 3S35X 3UAJD 2NY1D 1MKFA 1WICA 3FB5A 5K1NA 3VXRD 2GKIA 4MZIA 3RJDA 1U8NB 2EDNA 5DD6A 3T77B 1LO5A 3A24A 4K23H 5FF6A 5JHDA 4PRAB 3SCMC 2HT4D 4NQXB 1TJIL 1G43A 3P4MB 5ICXB 3PHQA 5EUOA 2ZUTA 5KSUB 3FSVA 4F58L 2BIPA 4LVOB 3G04B 4U6TA 5GS1B 2PN5A 5F7WC 4TUKH 4M5YL 2QGCA 4U1HA 2CRYA 1AC6A 4PJGA 1OSYA 2XQ0A 4CSSA 4OLVL 2AVFA 5GISH 1B9KA 1Q90A 3ZYOA 3QH3A 4XWOC 5FOJA 2GI0A 2AS5M 1CFSA 2WXRA 5F9OL 1KJ3L 2F53B 2XTSA 4Z7WB 2HX9A 3C6LB 4KI5D 2WOYA 1OD9A 1BFOA 1SLXA 1A9BB 1F02I 2B0SL 2QQLL 5I6NA 5IJVA 3MV7B 4DP7X 2J5LC 2KZWA 4IHOA 2EACA 3KYAA 3LN4B 1G7JA 4ZTOH 4NHCH 4XNQB 5C0CD 3FQXA 5D5ME 3MJ9L 4DZ8B 2NSXA 4BINA 5ACLA 1BYOA 4U1LB 1QUPA 3C09B 2D31B 4FXKC 1Q9OB 1UVQA 2VW7A 4M1DL 4PS8A 2EILB 5BCAA 4EJ1C 3O9WA 3MV9A 5JORA 2NMSA 2NY2D 3ZL4L 5KOVC 4ZTOL 2OJZH 2R0LL 3SBWA 3TCLB 2DAVA 3F3HA 1JK9B 2VLRB 1DBMH 3BN9D 2DWYA 4UZUA 1OHQA 2FHFA 4KAQL 3MLXH 3EH1A 2F15A 4L0ZA 4JFOB 1SEQL 5F7BA 1ACCA 2ZJSL 3JWNH 5BO0D 4H20L 1MCRA 4I0KA 5E4OA 2BJML 3D25B 2IOOA 2CCLA 3FFOA 4KTEL 2Z93A 3FBKA 3CQFA 4A2HA 5I0WA 3QIBB 2K3TA 2IVFC 5HGBB 2VT0A 2PCPB 5D70H 1G7LB 1QATA 4LEOB 5T3ZE 4APQD 3LQAH 2APVA 3EYFB 2BNRE 3ENEA 4RAHA 3DUUB 3ZKSD 4ZQKB 4MA3A 3BWAA 3KPSD 4YLQT 1F4HA 1YDPB 4OZGF 2OCFD 3LKNA 2JB6B 1NIAA 4YHML 1M3JA 2EVFA 4M6NH 5SWSB 3GS7A 2FO8A 2IANB 3D4ZA 5D7JD 3BT2H 2X6CA 3JWOH 4Z0XA 3CPLB 5KSBB 4Z3IA 4UU9A 2X4OB 2ZOKA 1TVBB 3PWPD 3BHBA 3GQFA 3QIWC 4L8SC 4MJIA 3ZW3A 1L6ZA 4JO1L 4P99A 4JVPA 1KCSH 2KLTA 4DTGH 4DKEL 2XZQL 1E4XL 4L4TB 3EJZD 1FPTL 4PD4K 5IJDC 4OJFL 2ADJB 4PD4J 1JPSH 3DLQR 5GJSH 2WSPA 3PV6B 4PCKA 3RZCB 1R75A 5BRZB 2EIJB 5C08E 1MFMA 3QJUB 4AVKA 4XXDB 2I32A 1PG7W 2D3NA 1CQYA 1M7DA 4AIZA 4ZMWA 2HVKB 1UA6L 5L4FA 4P5KB 2AEOA 4KO6A 2PW1A 4PRPB 3ZE1F 3MTXA 4X9BA 4UYPA 4E2OA 5D1ZB 2Z1PA 5F21B 5GHWL 3ZIMA 5KBKA 1OT1A 3GMNA 2BOLA 2OZNA 4FQJL 4F91B 1UWXK 4WKZB 1WISA 3IDIB 3QRGL 4IM8A 4FMKA 2BVOA 4I9XA 4ILDA 3IU3B 2R0WH 3IGKA 4L4VB 3QZNA 1MH5B 1WZKA 2VITB 4HG4K 5ETUB 2KQMA 3DRTA 3W1ZA 4NCDA 3GMPA 5JHAA 1U95A 2XXGA 3MJ8B 3D85B 1C5BH 4PY8J 4FA6A 1JRHH 1MJUL 1VIWA 2W60A 5C0RL 1DO6A 2HZHA 2QHLA 1R1CA 5I1LA 2IO5A 1RZFL 2ZICA 4ZBJA 3KLAA 4I48B 7PAZA 4HGWB 5BUGA 5DMIH 1YYMH 2XT1B 3TPUA 1UXWA 5EZJA 1RMFL 4N24A 1UT1A 3MOQA 5T8IA 4NNXB 4GW5B 2BVQA 5E1AA 2JELH 1V3KA 3JZ7A 1A4CA 3GLZA 3QUML 4G5ZL 4LPXA 1IBBA 3MNVA 3FHQA 3MZTA 1JWMB 4J3SA 3TO2B 5T1LD 3RDJA 3VTTA 5E6IC 1UQSA 3RGVD 4JHWH 4YE4L 4G82A 4Q2ZA 1KWKA 3QFJB 4L5FH 4PQXA 1KEGL 3BZ4B 3AS1A 1N70A 2JCWA 5FUOH 3T0EB 1LP9F 3QAZC 1ZWIB 3AFLA 3ARFB 5HHOD 4GKSA 4K9EH 1B3IA 3X17A 3DV6B 2K9UA 3TBYA 3MV9D 1SVCP 4OJAA 3GMMA 3L9RB 4LLWB 2QDVA 4PW9A 1L0PA 2OXHA 5IGXL 3UZVA 4P04A 3NIGF 2P7TB 1NKOA 2CHDA 5EUOF 4D9QE 3IF1A 2AEPL 5KYXB 4JVUA 5F0MB 4ZW5A 4YHKH 4NQXA 4K8RL 5IHHA 4WENB 4GW1A 4LXFA 4G9DA 1OSZA 2FRGP 1OTUC 3DSNA 2KUTA 3GKWL 4CW1A 3BP4A 2DH3A 2XJKA 3NCJH 3H3PL 4HWZB 4MQ7A 1RUPL 1ZY9A 2XWXA 4NM8H 1ZA6B 3JTBA 3V4UL 4WIQA 4K4KA 1Z5YD 1XH0A 3CHXA 2GJ6E 3MNDA 1B3JA 1P7BA 5IIEA 4M4PA 4GIOA 4BZ2L 5FYJD 5CXPA 4AQ1C 3L3IA 1OV8A 1FDLL 2XTJC 4HCGA 3KWUA 1EJOH 1BX2B 1J9TA 4N8VA 3MJ8A 4ELMF 2LLGA 4ZOAA 5KS9F 1F4WL 3ZHKA 5JW4R 4AUJA 3MODH 1RZKL 3MOAL 4QO1A 1JV5A 3LEVH 4QYAA 2P8PB 4K3HA 3TN0B 3DXAE 3FCSB 2AEQH 4K94H 5DD3H 4IJ3C 5GS0D 4MHHG 3U48A 5HP5A 5H2BA 5DWUH 3NJJA 3UG3A 2H3XC 1ZSDA 4HMEA 4LPCA 4N8CH 1KC5H 3LEVL 1RFDL 3IRPX 1OTSC 3MOAH 5H94B 3ZE2F 5C0EB 4BYHA 1NMAL 3SE3A 5AVXB 4HZAA 3B1UA 3TX4A 2DMCA 2FEDD 3W0WB 2AJUL 3RDTC 4A2DA 1RZKC 4AL8L 2VQ4A 5F0LB 4C47A 1DQQA 2ETWA 4L8BA 4PBWD 1XGTA 1U8QB 1VFAA 4JKMA 3RVWC 2ZUWA 4PS7A 4KMTH 5EO1A 1YEHL 2BLFA 2V17L 2ESVB 4KY1L 4RISL 4F7CA 2F0CA 4GSUA 4PG2C 5KSVA 3P3SA 5D1QB 3ZLQC 5C0FA 1A4KA 3MRGB 1QUNA 3U9UB 1ND0B 3JV6A 4ZNEA 1F18A 8CGTA 4GS7B 2W88A 4HLEA 4BK5A 1KCUL 4JJ5A 4Y4FA 3CFDB 1HOCB 3G5YB 3FH5A 3CCHB 3WUZA 5JTWA 3CN3A 3GHBH 3ME0B 5TQ0H 2EYRB 2PW2B 3M7OA 1OF2A 2DWEA 3TP4A 3HG1E 4N2NA 2CZNA 3TEWA 1JNLL 1NFIB 1UUSA 4K3GA 1AOZA 1GCYA 3GSOA 3FULA 4JPKL 4Z0BL 1FNSL 1T0PB 2APWA 3CX5K 3GPEA 4HJIA 1SHWA 2OXGA 5DD1L 3SDAD 3M07A 3HZKA 3NZ8B 4RCAA 4WI0A 1B6DA 4JFQB 4P9MH 2FEJA 2WXNA 3KL3A 4YSDA 5LGJB 1U93A 4L9LA 5A40E 5F9WB 1KFAL 5MENA 4AEEA 2X0VA 4TTDC 2Z35B 4G71B 1KBGL 2J8OA 3ZSSA 3S37X 3MLVH 2NT0A 3C8DA 4UCFA 1E5BA 1HXKA 1T4WA 3L4VA 3VI4F 1UM6L 1EO5A 3W2DL 5KBNC 2J4WL 3VFUA 4DOHE 1S7RA 1R3JB 2V37A 4L1HA 2GABA 1AHKA 4LP4A 4RIRB 4M62H 4G6ML 1MCJA 4C57C 1PKQE 1YEJH 5SWSE 4Z7VE 4XNDA 1MQ8A 3ASWA 3OHMB 5A2IH 35C8H 4N0FA 2DQHL 2CM6A 5BJTB 1F3DJ 5F88B 4XO4A 4QY8A 1SHXA 4OQTL 1HCVA 1HH6A 1HSBB 4RZKA 1GAFL 3T4AB 1IEBB 3O11B 4F1SA 1HNYA 2DD8H 3AM8A 4HIQA 3K80A 1IBFA 4JFUA 3CVHB 4RBPK 4OCYH 4BD4A 2E76C 4YGAB 3WKPA 2VGLM 2Z31B 2O72A 1DQDH 3CU7A 3T0AA 4FFYL 2I9TB 4FXTA 3TPUB 1NBZB 4IQHA 5JPNC 4WI4A 4N6RB 4H4NA 1AQ8A 5E8PA 1FO0B 5F0JB 3VXOA 4GG6B 3A22A 1D7DA 1P5UC 4HUKB 3F7PC 2UYLB 3U2SA 2VKWA 4LHUA 2UX6A 3RL1A 2XG5B 4JN1H 3TGXA 5HHQB 3WKYA 1RK7A 2FBJH 4PGCB 5D4JA 4FNRA 3U4AA 2YRPA 4XMXA 4PTTA 3KPSA 3LIZA 4E5XG 2AEWA 4Q58C 5HI5C 4W9DC 4JX0A 5L4IA 1SLWA 1U8JB 1WA0X 5IMMA 1IGCL 2R1YA 1RIHL 5I1JL 3PWPA 3OLDA 2YOCA 3WU1A 3DX0A 4AX3A 4JKPH 3MYJA 1KJ2A 3SKUD 3D2UB 2BK8A 3MUZ1 3O9WC 3U36A 3WJJC 3DO7B 2XN9D 4PJ9B 2Y1YA 4XMUA 3HNSL 5ACZB 5CMAB 5T5NG 2EDQA 4WEUD 4K2UL 3CJJA 2EABA 2VL5A 5EZLA 4UDUB 4HX1A 1GGUA 1EZLA 3ETBJ 4AGMA 2YKKA 4HQQL 4KI5C 2CLVB 4I3RH 1VKXB 1FVCB 2NY4D 4XPTL 4HBCL 5JDSB 3D9AL 4A6YH 1Y1UA 1L4IA 3OKLB 1F4WH 4TNVK 1MFBL 1TYEB 3IDNB 1U2YA 2EUXA 4U1GB 3GXUB 1KJ2L 4ZDHA 2WB1A 4MS8C 4X4KA 4DP2X 1MIML 4JRYB 2R8SH 1FDLH 3D3VA 4P0DA 4ANUA 1OSPL 4PJEB 1SOKA 2C5DC 2ZAGA 5EPMB 3D12B 2H0FA 4PB0L 2OJZL 5K33A 2EH7H 3F6IA 1BZOA 4JO3H 5F89A 2ENPA 3V0JA 3TLRA 4ENEC 2OQJA 3GRWL 4KKCD 1SF5A 2WXIA 2I60H 2NY5C 1XIWB 2JJSA 4MJIE 1UWXH 4UMSA 2NW2A 4JFYA 3ZYIA 2P8MA 2HT4C 5TDOA 2UZXB 2FWOA 3QXDA 2HTKD 5D2NA 4OZIF 4YX2L 1GJWA 1CGUA 4PLJD 1J1XL 5KYNA 4ZSOA 4HIEA 3PS6A 4O2FA 2UV3A 2APBA 4GG6E 3OXRB 3O3BA 2J8UA 1CYWA 2SODB 1RY7B 1YLBB 2F54A 2XA3A 1TO4A 2CGZA 4TNWK 3U6RA 3V6FA 5ID1A 4XCEA 3BFQG 3QUYA 5HPOA 5DJCB 2PWGA 4HD9A 3T0XA 1EFXB 3BIKA 4M5YH 2H9GA 5TGBB 3TNMA 3SPHA 3STZA 4CDGC 1ZA3B 3ARDD 1NIDA 2GJZA 1OHZA 4NCC1 5KSAB 3VXNB 4ORGB 5DS8A 3GSWA 2V2TB 2AF2A 3ZHNA 3Q48A 4ZMPA 2A73B 5CZVH 1FL6A 1TZHA 2VLJA 3GUTA 2Y07H 1A65A 1NDMB 3RDTA 4BSJA 4PGEA 3S5LA 1D3CA 2VLKD 2OJEA 4Z3JA 4KJPD 3RNQA 1GYUA 2IADB 4Y5YB 4NP9A 1MNNA 4PRNA 3MJWA 1ONQA 5E2VH 4R4BA 5FPIA 4JPKH 1MDAA 1WBZB 4ZT1A 3VXSD 1M53A 3P4NA 4FMVA 4WW2C 4XVTH 4BE5A 4WF7A 1VFBB 5DT1L 5AOJA 5DHMC 1EGJA 3V0AC 5I6PA 1BV8A 1MFCH 3TYGL 1AY1L 1FBIH 1I9EA 4AKPA 4YSOA 5A16B 2YEVB 1DTUA 1SN2A 4OB5L 4QRQB 2MNUA 4Z7NF 1JF1B 1EGJH 1B0WA 4YWGH 1B9ZA 2DIBA 2JJUA 1Y6MR 3ROLA 4U1MB 2IMMA 1KOAA 2NT1A 4JFVA 1QRNE 2WNWA 1HINH 2B77A 4PY7A 4X5XB 4KVPA 2YC1A 2VIRB 3HAEA 2FIRT 3NG5A 3QQ3B 1B2YA 3I3DA 4XPBH 1T4KB 4E9QA 1NCDL 3EGXA 3GRWH 3MREB 3LS5H 5CSZA 2YD8A 3LTVA 5IW6B 4LIQE 4HUXB 3OXRA 4NUJA 3HI1A 4Q9BA 3QORB 3KPRB 3LZPA 1A7NL 5BUPA 1BIIA 1BQSA 2FJHA 3ZQXA 3GRWA 3SY0B 1FLRH 3TESA 2CLZB 4ODUA 4PJFA 3K6OA 2P52A 2X2HA 4QTHB 4UM9B 3MRKA 1BPVA 5CLYA 2OSLB 1ZGLM 3QNYB 1KB9K 5FA3B 1N59B 3LH2L 1NUFA 4LCUB 3VFRA 1MY7A 3BUYB 3P11H 1KCRL 5ESVA 3BVDB 1MCNA 4Z3FA 2HRLA 1O7VA 4I1RA 4L8DA 1EPFA 3L95B 2P5EE 5BS0B 2WXGA 4G8IB 5I23A 3WIFB 5I1KH 1A3RH 4M5SA 2GCYB 1XCXA 4LZKA 4LGRB 4LSRL 5DVPA 1ZTMA 5TE4H 1IM3B 1U2HA 2E7BA 3O4LE 2GSMB 4H5SB 4MBRA 1JK8B 1IC4L 2BM3A 2K6YA 5GRVL 2CO7B 4ZS7H 5DMYA 2RA1A 3QPXH 4WFHD 4YEFA 1OF0A 4YHYB 3DVGB 3L48A 4JY4A 3VW3H 4LHUG 4AV0A 5MEPB 4GXUN 1U3HB 4WO4B 4LCCB 3BH8B 2VDKL 5E70A 1Z5LB 3TBVA 3MLXL 4KV5F 3LZLA 4FFYA 4KJQC 3RWIB 5CN3A 3GGWA 2D3LA 1ZK5A 1NOLA 4YNYB 1TZGL 2ADIB 1NCCL 3OAUL 1VPOL 4XCCH 1CFMA 3DV4B 3B9KA 1SYSB 1ADQL 4HKJB 3ZT5A 2G60H 1U92A 1XXFC 4G8GA 5FYKD 2X4QA 3WG7B 2R29H 1TF4A 1TZGH 1KULA 2AHIA 1IKOP 1S7VB 2AXGB 3D3VE 3IS1X 5K5YA 5GXBB 2CR3A 2DMBA 3TWCL 3E8UL 2O5YL 4HSAC 3I9IA 1KTDB 1KDJA 2G5RA 4WAFA 5J9PA 4TQIA 4WK2B 1OPGH 5T5FH 1G7LA 1M42A 4CC4A 2AZAA 3TJPA 1JGDA 4F8QA 3WL9A 2Z34A 4IK6A 2YUWA 2AKRB 2Z7YA 3KL0A 4YDJA 5EEYA 1BYPA 5GS3A 3HG4A 4YE4H 1BZ7B 1WAAA 1IM9A 2R7EA 4H1LH 4GP4B 4HKXA 4IBZA 4WV1C 3MCKB 1DR9A 5J13B 4P46A 1F2QA 1UD2A 3FO2B 2YPLB 2IPKA 4NLHA 5AENA 5I1EH 2B4CC 3MMEA 3UO8B 4PJFE 4QXWA 4Z3EA 2PO6B 2BS71 3JBG7 4KRNA 5BUAA 2XKNA 3MGTB 5E2WL 1XZWA 1NGYB 5JOFA 4Z23A 3MQIA 4NPKA 2NRDA 1SDDA 2KZ1B 3JV0A 4PYHA 1XGZA 1OKEA 4MJ5A 1NIEA 2E46A 4ZFFA 3PNWB 1UCBL 4ZO6A 3P77B 2MCAA 4AY0A 5JLZA 1I3GH 4P9ML 3D39B 1SEBA 4H25B 4HK3J 3WKQA 4B7IA 5L8LB 5IQOA 3QEHB 1GZQB 1X5GA 3ULUE 2EZ0C 2GTWB 4OGAC 4XP6L 1WPCA 3TBWB 4IOFD 1FNHA 1WJ3A 1U0QA 2FYYB 4OLEA 2YRBA 3NK4A 1MAML 4DPAX 4L2LA 3GMOB 1D6EA 3LXAA 2VLJE 1ZVHA 3N1FC 3G6JE 4RDBA 4YNYA 1DBJL 2NXYC 3WS3B 5ESAB 3BUBA 4Y4HA 1BLNB 5L88L 4NJAH 2Y22A 3MUJA 2ZF9A 4Q56A 4QHLB 2XACC 4AXWA 3G04A 4FQQB 5AW8B 5GS1A 2C4XA 4BKLA 1U8HB 1RERA 1W72A 2CU9A 4HC1H 4I8DA 2WSDA 4NQVA 5GPRA 1T0MA 3TEXA 3X12A 5E24E 4OCRH 4JQIH 1R17A 2PCXA 4U3HA 1SJXA 3O3DA 2P46B 2Y7MA 3FRPA 3S88H 2IJ0C 1J1OH 5EIIB 5HHME 1OZTG 2IAAC 3LVTA 1TUPA 5CINH 4A04A 3MO1B 5IQNA 3CFEB 4R26H 3NZHL 3X3GL 3GDBA 4MCMA 3F85A 4KX9A 5IM7A 2DYRB 4NQCD 2B7DT 2VABB 2JCCA 1QAWA 2VSCA 4FQIL 2AJUH 3L3OA 5D2NE 3VA6A 4QHUB 3QE5A 2C26A 2MKWA 2XV0A 3LMJH 2GC4C 3KJ4B 3PL6D 3QO1B 4HUMB 1QLEH 6FABL 1NAMH 1HZKA 2DWTA 5ITBH 1MSPA 3SJVE 3TCLA 2XBDA 4X5XA 1YEDA 4IKNA 5L8JB 4YJZL 5A6IA 5KVFE 2BDNL 2Y1ZA 1AXSA 4RGMC 4FKKA 1VJSA 4FNQA 5T1KB 2IBGA 1E28A 5IW6A 3EOBA 4WK0B 3O2VH 2G5UA 4OZGA 3HMXH 4K5LA 1LO4H 3HJEA 3KYKL 5FYKE 1G9NL 2ITCA 4KY2A 5H4YA 5C6WH 5C6TL 2Z7UA 3DSFL 3WAKA 5KYXA 3DO3A 5DA0B 2R9HD 1F3JB 1XF2A 2ZPKL 3MKKA 4E9XA 2NNAA 3F65A 1K4CA 3P30H 5AW3B 2A6JB 1J8HE 4M1DH 2QVFB 3I3BA 3MI6A 3MUUA 4MXWL 5JQIB 1LEGA 2BRQA 4QRSB 2FEEI 2XXCB 1IC7L 1AZUA 4PN6A 1Y07A 2J1YA 4XWOD 2RMNA 5DUJA 1UWYA 1QOKA 1BDYA 2X4PA 1U8LA 1TSHA 1YYCA 3UTSA 1HE7A 2QSQA 4NN7B 4CVZA 4JFFE 1U8KB 2I27N 4IEFB 3UJIL 3L1OH 4GEJA 2RHEA 4M29A 4NKDB 4HPOH 4RX4D 5DZOA 3O81A 25C8L 5I1LB 4OQ1A 1OAKH 4NKQB 2CO7A 1QTSA 1KIRB 3U7YL 5LBSA 4Y1TA 4DKFL 4TRPL 3ULVH 2EC8A 5FO2A 4Q6KA 1IGTA 3KPNA 1UXWB 3UROR 4FLSA 2QVIA 4MD5B 5FGBA 2WQUA 5EA0L 3P9LB 5ISZE 2WN3A 1GMEA 1OAXH 4NC2B 2ERJC 1EZUA 4YHMH 4AWJC 2LT9A 2MQ3A 2DQHH 5DFVC 4V33A 2WKLA 3DXAA 2HLAB 3FCGA 4UWQB 5HDBE 4WU7B 2NTSP 3QQ9C 1YCSA 1EJ6A 4UTBL 1FHGA 2J20A 5DHVH 3VSTA 2Z0BA 4XBPB 2VR8A 2YXWA 3WMPA 5K9KA 2BP8B 4TSBL 1YPZB 3VQ1C 4OU3A 1BVKA 3MJ7A 5GS1C 5KJRL 2Z65C 1E27B 4AEHH 5JA9A 5BQDA 1Q9LA 1UGNA 3P30L 3DHUA 4M3HA 3RWFB 1U8OA 1OB1A 2CK0H 4JFDA 1DSWA 4QHMA 1K72A 3MRGA 4S11A 4Z7UE 5JUEH 3IDGA 4F8LA 2IV8A 4WJ5B 2XY1A 1NFAA 5F9JB 3D4GA 1PYWB 4FQ2H 3SYPA 2IH1B 4L48A 3ZXAC 2MFNA 5DTFA 1T89A 4ZS6C 3ZZLA 4BCYA 2X7LA 1N6QH 2AJZA 4W9CC 5TDPB 3L3DB 1HKFA 4HW6A 5HY9B 1RHHA 4XBEH 1X4ZA 4OLUL 2AP2A 1BYNA 4FQCL 5JXEC 1FVDA 5SWSA 4L0PB 2Z8WC 3HHMA 1W0VB 1DLFL 1W0WA 3MRCB 1JAEA 1J0IA 4MQSB 1W2KT 2XCMC 3UBHA 1I1FB 4I9WE 2O5ZH 4ALAL 5IBTH 2IC2A 3RTQC 4JN2B 43CAA 3CDGB 2DDQH 2PUQT 4N22A 5H35B 4N2DA 3NSYA 1SDDB 3REVB 2C4FU 3BEVB 4K7PX 1Z1WA 2WXMA 3NIGE 2DQDL 2F5AL 5BPPA 3VRJB 4DGVL 3N44F 4J3OG 5D7JA 1PW3A 2K9FB 1IEHA 3KYMB 3ZMNA 3FCSA 1BVLB 4XCCL 3LNHA 1A7OL 4R90L 1JTOA 4Y4HD 3P2BA 2EDOA 4F8TA 5DT1H 1MFEL 4QXTA 5I1HH 3S2CA 2EXSA 1XO8A 4H8UA 3HKFA 3HG2A 3DMMD 5L0QB 3GXIA 2P9RA 4E5XA 1TJXA 3ALPA 1SBSH 2EYSA 1AXTH 5CJXC 1FSKC 4GUPA 1AHWA 2VR4A 5EN2A 3BPOC 1N5YH 4HHGA 1FGNL 4JJOA 4X5RA 2EXTA 3MLUL 5T1LA 3ZYZA 4B53A 3QWOA 4ZUVA 1LK3L 2ZSVA 5K9OA 3WTVA 3I2CL 3IS0X 4KDTC 4Y2DA 2L4OA 1GA2A 1QEWA 4N9GB 4FZEL 3OKOA 3A67H 2XPYA 2WBKA 5H37G 1NCBH 2AQTA 4HJ1A 1YEKH 4PP1C 4C4UA 2CHWA 3CHPA 1IFHL 2DQIH 2EXYD 5GGVY 4UQ2A 1EMTL 3FO9A 4NQSA 3I6GB 4L8SB 4A7GF 4UI2A 3S3JA 4L4TA 4JFFA 1OZUA 1AC0A 4JO5A 3NJGA 1T5WA 3RVTD 4QXUL 1L5GB 2G2RA 1T6BX 1QPPA 1AHWC 3S96A 5IJVB 2X44D 4KC3B 1UEYA 5SWSD 5DRXA 2LR4A 1DDHA 4IDLA 4R3SA 1JGVL 5MERB 3PUCA 3B8YA 4BZ2A 2Q3XA 4PG9A 3TURA 4CVUA 3L5IA 3RZWA 2XVKA 2W91A 4JDZB 4JQVA 4N20A 1NCTA 3TFKD 3L4UA 1QSEB 1TKWB 1H3PH 1CU4L 3QVAA 4XN1A 2CHXA 3HUJB 2H0PA 5F3HA 4S0TD 4KKLC 2AANA 4XPBL 1HFUA 4BDVA 4UQIM 3WNPA 4JHBA 1QKZL 1MUJA 4B27A 2VJ0A 5ISZB 2QKSA 2JXMB 3MCG1 4DK3A 1JVKA 4FG2A 4GSDL 1MZZA 1CD8A 1MF2H 1PZ3A 2DPKA 3QUMB 4XC1L 5SX5H 4ZG1A 1URZA 3ESUF 4HOZA 5KS9E 1I1AB 1R9FA 4BE6A 4OLVH 2R2HA 1NH6A 4PJBF 1A3ZA 3HPLA 5DXWA 3APMA 5DMJB 3SKOB 2ZCLH 3MRPB 3S5YA 2EVJA 4WI6A 3VSVA 4YGVA 3BESR 3FB8A 4N9OB 4N8CL 4PI2A 2H8PA 2Q2EB 4FLRA 1KY7A 2VMCA 5DUMH 2IH9A 5FYLE 2DRUA 3KZ8A 2ZCHH 3II3A 2PWHA 1F00I 3QEUB 1F1GA 2CWRA 3FYEB 1UM5L 4M7LT 1LEIA 1AH1A 1MLBB 2A1WL 4JDEB 1U8PB 5IW1A 2D7MA 3JV5A 4IOSA 4WDIB 1E4WH 3ZTJH 2DBLH 3H9ZA 5ECJE 3GSOB 1MHHA 1FFTB 2CALA 1NGPH 3B9EA 4JFPB 3NUKA 5CD5C 5IESH 4Z7OE 4LDEB 5DR5L 3GZQA 5DI8A 4BIKA 4DFIA 4HDIA 3NEEA 1HI6B 3N3EA 2NY6B 1HYSD 4KPHH 2XA8L 1E9PB 4YE0A 3FB7A 4L05A 1MN4A 2WJ7A 2AJ3B 1IE4A 3MBWA 1THCA 1F1AA 2FWLB 1OARL 3GMMB 3H3KA 4HWBL 4N3TA 4DGYH 2Y1AA 1TDQA 1CICB 3ARYA 2FWOB 3BQUA 4BSVA 5FCUL 3IFNL 2HMID 2NUTA 2ICEA 2IWKA 3CFJA 3KM2A 3MV8D 5DD6B 4FL4C 5JHDB 1OAYH 2F2HA 2GAZB 1NBYB 3ZZQA 1G0DA 1L0QA 4CJ0A 1XGPB 2Q7AA 4KMQA 4R7DB 4Y5VC 1MFDH 1HHKB 2GK2A 1Q1PA 2NR6D 5D1XD 1JXJA 1P1ZA 5GS2D 3Q5YA 2NY3D 4EN3D 5EU6E 5JR1H 3C5SA 3ZJAA 2Y7LA 2AXJA 3MFFA 3GDCA 3BPCA 5G4NA 3FU0A 1FC1A 4L4VA 1KNOB 1X9LA 3PUUA 5E6ID 4XMWA 2VITA 3CBKB 4NYLB 2EEBA 2EQDA 2X1OA 5AB9A 2J8UF 4OFQA 2YD2A 3QUYD 4ZJ9A 5ADPH 1YEJL 2Q8BL 4N5ED 5EWIH 1F3RB 2WYZA 4XT1C 5JMRA 3ISWA 5E5UB 3HE7B 4NI6A 1PKOA 3IJSA 4U6XA 2DQTL 3UBGA 2BX5A