1UT2A

Afae-3 adhesin from escherichia coli
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
139
structure length
138
Chain Sequence
b'GSFTPSGTTGTTKLTVTEECQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCNARQVALKADTDNFEQKFFLISDNNRDKLYVNIRPMDNSAWTTDNGVFYKNDVGSWGGTIGIYVDGQQTNTPPGNYTLTLTGGYWA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AFIMBRIAL ADHESIN AFA-III
publication title High Resolution Studies of the Afa/Dr Adhesin Drae and its Interaction with Chloramphenicol
pubmed doi rcsb
source organism Escherichia coli
molecule tags Adhesin
total genus 27
structure length 138
sequence length 139
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2003-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04619 Adhesin_Dr Dr-family adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1570 Mainly Beta Sandwich Immunoglobulin-like Dr adhesin 1ut2A00
1UT1A 2BCMA 2IXQB 2VERA 1USZA 1UT2A 2JKLA 1USQA 1RXLA 2JKJA 2W5PA 2JKNA
chains in the Genus database with same CATH superfamily
3MACL 1DQDH 2CLVA 4RWYL 2BOCA 4YSAA 3FB6B 3NCJH 4YQXH 5EU4A 1FNSH 1NANH 1MVYA 1UFUA 1FVCB 1T83A 3NVQA 1W8OA 2WBKA 4AY0A 5E6UB 3L6FA 3FCUB 5FFGA 5HYEA 1MVUB 5DUJA 1MFEH 5KYUB 5ELIA 2YMXH 4U1JB 4L4TA 1WTLA 3HS0B 1CGWA 2Q8BL 1Z3RA 4BH8B 3WV0A 3H4HA 3VG0H 3UPAA 3RPKA 2YBGA 2B16A 5TTRA 2ENPA 2ZQKA 4AKQA 3AS1A 1HIML 2NY4D 4FFYA 1F3RB 2ZTBA 1RKRA 4WJ5A 3VGDA 3JUYA 4KDWA 3DI2B 4LFHG 5DD1H 2VC2L 1T89C 1IGYB 1G7QA 4UZUA 5FM5M 3RWCB 4H0IA 2E6JA 4YC2C 3QSKB 2J6EH 4JM2A 4XN4A 2P5WE 3ZO9A 3CSYB 2ZX9A 5AAMA 4P5SA 5EEUA 5ETUA 5FB8A 3SKNB 4YHMH 3CSPA 2FH8A 3FRUB 3NAAH 2ISDA 4N86A 4DP7X 4ELKB 2KI6A 3DX1A 3FONA 4U6YB 4KTDL 2HFGH 1V3LA 3W3BA 4HK3N 1FPTH 4JHWH 4CDGC 4URKA 5C9JB 1T2JA 4LQ1A 1OP3K 2P45B 2WXNA 1WBYA 4HS6B 4XNQB 3LZOA 4P59H 2A4CA 2E7MA 3TVMB 3ECUA 4IRJD 4HUVA 2DLFH 1N68A 1OAYH 3KLSA 1BM3L 3QORD 4U3SB 4YDMA 3RNKA 5GGUA 2AF2A 1P84K 4OV6F 2EUZA 1NSNL 1S3KL 1VACB 1A7RH 1AZZC 4WIQA 5E6ID 1I4FA 3EO9L 2VDKB 1OXYA 3RI5K 5JPNC 2BNUA 4CU7A 3Q8FA 1IC4L 4FKKA 4FL4B 1IJNA 3WD5H 4XX1E 1RK1B 3HRPA 5D7LD 4WW1A 2EXTA 1ZS8B 4ZS7L 4M1DL 4AJWA 3QZBA 3QDGD 2V3DA 4KK5D 5HGDA 2VN3A 1E0OB 1NZRA 1ONQA 2PMZA 4AT6A 4TRPL 3NT0A 1U21A 3TTSA 5BVJB 3E1ZA 4P46D 2LFEA 4Z3HA 4IK7A 4F33A 4WUKH 1R5VA 3Q7JA 2BK8A 2UY6B 2MRYA 1MCBA 1EJFA 5D71L 2WYIA 5TH2B 1UGKA 4P2RD 4G70B 3SDDA 4C55A 3G04B 1BVNT 5FF6A 2AV1B 3VMOA 3QWOA 2Z91B 5DD0L 1RUML 4WU5B 1HHKA 3BAKA 5E8OA 3BRGC 3ULUC 4NO2A 3HUJA 3NYKA 1I7ZA 5B39B 2NY4B 4K3GA 2X88A 1A6VL 2UXVA 4XVJL 4FLHA 3O6FC 2P47B 5HHPB 7PAZA 4ANVA 3IB4A 4B3EA 1NCUA 5IHUL 3S4SA 1LK3L 1RXLA 2BP8A 5HJDA 2JCCA 3C8KA 3B5GA 5SWZE 3SDCA 5GS2D 1HXKA 2K1MA 2X2UA 3CZLA 2YZ8A 3N1GC 3UYOD 4ONGL 3UC0L 1ZV5A 3EUUA 2NZ9D 3Q05A 4ICXA 4TVPH 4IRZH 4OCRL 2YXVA 1ZLUK 1N5YH 2Y3AA 3KPLB 5IJCC 4M6OH 2DJUA 2D2CC 4OZHF 4P5TD 4X8GA 1T03H 5KBLA 5IF0A 4IRJB 1I7TA 4UT7H 5IMOB 1KB9K 1EXGA 3QORB 2JF1A 2OMZA 1U93A 2A74C 4WK2B 2QHRL 5FYKD 4Z7OB 2CUAA 4U1KA 1H8OA 3FQXA 2CO2A 2ZWZA 5E6IB 1DBJH 2BPBA 5DEFB 3RWGB 4NZRH 5KBMA 3Q2LA 3FTGB 3NJHA 2ALWA 3QUYC 1VZGA 4LSUL 1NWPA 3A67L 3SDXE 3L3DA 4XAWL 4AIZA 3PWVA 4S2SB 5D7LB 5KSBB 2I9TB 1JGVH 1SM3L 3WKQA 2C9XA 2FNWA 4YDLC 2XXFA 3CSGA 5D2LF 3SE3A 3KPNB 2AJ3A 3QDGB 1QR1A 4ANWA 4PWKA 3GK8L 1CDJA 3TBVA 5D93C 2O26U 4TUKH 3MLRL 3UYPA 3BCFA 1NA8A 4PHZA 5F7EH 3S48A 2CRYA 1NC4A 4P46B 1DDHA 1X7QA 4G6MH 4P9HC 5LJYH 2KLRA 3NFSL 3O4LD 4PYHA 4XMLH 2PCPB 3LIZL 3AJ7A 5D70L 1FA4A 3LV3B 4PJFE 3KBPA 4JLRB 3QE5A 4F2EA 3IVKA 1ECYA 5FYKU 3T08A 3N9GH 4K5MA 4O02B 2HVKB 4PJFF 1MF2H 2F19H 2ZUSA 1HKFA 3HE6C 1H5BC 1NMBH 5KAQF 4X6FA 3ARBA 1IGIL 1OAXH 3X3FH 5E9NA 4G8EB 4HP5A 2C3VB 4X98A 4LZKA 3QIBD 1KXVA 4HX1A 1O7VA 4OLYH 2VT0A 4NQCD 1QNZL 2ZJSL 1KBGH 3VFOB 4HAKA 3ZVVA 2DD8L 2UVEA 3BPNC 3BLBA 3HRZC 1MH5B 5BS0B 3KVPA 4NAMA 4PRID 4ABQA 3RLSA 1ZVHA 2HN7B 1CT8B 3ARYA 4JFEA 4PLJD 3TT1H 3CFCH 3FU5A 3U30C 4XOBA 5KVMC 2CHWA 2QBWA 4HWZB 2IPUK 1BJ8A 3BPCA 3B9KA 3F7KA 3GRBA 2ARJA 5IOKA 1TKWB 5G4MA 1O7SA 1PLGH 2C9SA 1A7QH 2DLGA 1A6TA 4M4PA 4F9LC 1CG9B 2K78A 3RUGF 4RLDA 2WYTA 3THML 4XMXA 2NY5L 1ILUA 1XEUA 4GMSL 3DRTA 4P5TB 1PIFA 5I71C 4OGYH 4OAWA 4QWWC 3VGEA 4U6HA 3I6SA 3QULA 5AVVB 3SKMA 1F3JB 4N2IA 2XWEA 5GRXG 1I8MB 1Y6NR 1T5XA 4L5FH 2XN9A 4FQ2H 1B0GA 4RMWA 4F80A 1N7ML 4HAGA 4GRWH 5CCJA 4EZMA 3AROA 1B0IA 1FNGB 2JNZA 2F2HA 3WOVA 2FK9A 5EOCJ 2OLDA 1U8JB 4KO5A 2BHUA 2CKNA 2Y7OA 1Q0XL 1B9ZA 2GIMA 2WTPA 4BRJA 3Q9PA 1MW3A 3CG8A 3PJSA 3NPSB 4X4KA 4NN5B 2DQUH 5T1DL 4AQAA 4Y2OA 3MJ6A 5IMLA 2Y1AA 1FYTA 3AY2A 3IF1A 4Z76B 2I60L 2QVKA 1G9ML 1QSFA 4G7YH 4Q9RL 1DANT 4WWKC 2AZAA 4PJDB 2FQDA 4HZAA 3IAPA 4B9CA 3B7RL 3O4LB 2QQNL 4MWFB 1Y7VA 4X7SH 1BPLB 1DQKA 1XAKA 2YC1B 3M1CA 4Y2DA 3JV6A 3RWEA 1F13A 4DP5X 1MLCB 3ARUA 5HDBB 5K9QI 1EZLA 4L3FA 1QO3A 3IDMB 1JV5A 3EGXA 2AJYH 3B7UX 4X6DE 3KPSB 1YEEH 3HPJA 5IWLA 2JK5B 3DX0A 2F7IA 5KUKA 3L7EA 5IK3A 3QIBB 5JIHA 4OCNC 4C59B 2QGBA 4NQCB 5ID1B 3DGDA 1FFQA 5IV2B 3QEGH 4N2AA 1BXUA 5C6TH 3VRJB 2J8UA 4PRIB 4KHXH 5HDQH 2A6JA 4MAZA 4BHUI 3AXIA 3ZKSD 4N2MA 3V52H 4Z7NB 3LKPA 4MA1C 1RI8A 2BVOB 4HUUA 1U58A 2EXYD 4PRBB 2AVFA 4GEJA 1IFGA 2CGRL 5IFHH 2Q86B 1F6LL 1FFPB 2ZUQB 5DGRA 1FZJA 1JZEA 1UKQA 1C5BL 2AMUA 3BVUA 4BQ6A 5CZKA 4NZJA 2EDBA 3DX2A 3CU7A 2FJFB 3QRLA 2EE3A 4POZD 1KXQA 3JV4B 3V8CA 1BA9A 4XCCH 1KPUB 1A9BB 2HFFA 15C8L 4J28A 4L29A 5J7CC 4AGOA 4X2UA 4A6YB 3U25A 5BV7B 3D08A 3KPPB 3PUUA 5F7NC 1Q94B 2HVJA 3QEHB 3RWJA 5JPMC 1CDCA 4HIIA 2WCPA 2HA1A 5TQ0H 3VXPB 3QIWD 2Z92B 2L4OA 5I76A 1T89A 2Q20A 1UM6L 4MX7A 1WCBB 1A7PL 4NO5B 2R1XB 4LHUG 1HYSC 3HG3A 1TNMA 3E8VA 3PHAA 4GSDH 3PWJB 3CGTA 3LH8A 2BSSA 5F7HA 1G7JB 4LCCB 1LL1A 2A0LC 2EZ0C 2R1YA 3D6GA 1XF3A 4PR5B 1N2RA 1P6FA 1R3HA 2GUOA 3RX8A 4WFFD 3V6OC 1U95B 4KQ4H 5EUOE 1D3CA 2EXSA 3HC0B 2CRMA 1CBVL 2IDUA 3BUPA 3MRKB 1NBYA 4AUJA 1NM4A 3NSFA 4ZYKB 3AQYA 2R0ZH 2GFBB 1BIHA 4ZMLA 3GKWL 2I32A 5BW7C 3DGGA 1UURA 4PJBA 5IW1B 4PJGA 3TBSB 5JPNA 4XWOC 2HJFB 3C6LD 2ARWA 1TSHA 1UWEH 4LLVA 1X6LA 3IDIA 3LAFA 1FRGH 2BSED 3ZOAA 3E3QE 4X7TB 2P8PB 3LQMA 1E90A 1DBKH 3ARGC 4FQ1L 3H0TB 3JWDH 1DYZA 5JORB 4AG4H 2X7LA 1OQXA 2HKHL 4Q9QL 4JUSA 3FN3A 1BWWA 4PVMA 3MXVH 2O5YL 2E9BA 3A24A 4YHYC 5DK0A 4ADGA 1FQ9C 1IC7H 2V7HA 4JCMA 5D9SB 1M6OB 4KQ3H 4UILL 1A14H 3ELAT 5HHNB 4XVSL 4G6AD 2YARA 3CU1A 4XNYH 1LD9A 4JFDE 1C1EH 5D7JC 4YFLF 1SF5A 1PY0A 1R24B 4J27A 2HMID 1C5CL 4CVXA 4OCYH 2IIJA 4NPJA 1EVTC 2G2RA 4YBLB 3QARA 5HY9A 1UD3A 4XPTL 5DQJA 3Q9QA 1Y6KR 1A7OL 3FO9B 5GRUH 3T8XB 1YNLL 4P23C 3HCVA 1XZ0B 5IB5B 3L3KB 4PP2A 1JF5A 2M26A 5TE7H 2QGCA 4GNKB 3Q2NA 3BHBB 3P4NB 3SD2A 1RZIB 3CC5A 4RA3A 2X6AA 3X1EA 3DHUA 5AOMA 2WB7A 1OTSC 2DMKA 3U0PA 3GMRB 2FH6A 2DRUA 2FBRA 1DVFD 2Q7YA 3AT8A 3WNIA 3LNEA 3QIWB 4L0YA 5DZNA 2GHZA 3U83A 3WLWC 3O6FA 4PIBA 2NLJB 2C7FA 3WKYA 3WEOA 1EJOL 4N0RA 4DKFH 4JQXC 1INQB 4KROC 1SOQA 1GCYA 3VFMB 4OU3A 3WL9B 4KKRA 1DJYA 2C3WA 1T21B 3FBQA 3GJFK 3RTQC 2NNXA 3UDWC 2FJSA 3OAYH 3IJHB 4NN6C 4FULA 2FX7H 3WEMA 3INUL 5GGVY 3IGAA 43C9A 1NGPH 5GRJL 4PRHE 1K8IB 4RFEA 3H3PH 3CC1A 5J1SC 1Y0LA 2KHAA 1XGZA 4Z7WA 3ZIMA 4G1MB 1HHIB 4FFTA 1I53A 3MNWA 2Y2YA 2XRAH 4WEBL 4CVWA 3H7BA 2VLKA 2A74A 3P54A 3LN9A 3MV7A 4JJ5A 3IDYC 3EJYC 3P3UA 4PU2A 5EOCL 5B22A 5C08A 3VCLA 3V55A 2OZ4L 4PJHB 4W9LC 4Z95H 3SN6N 4ANKA 4FQCH 1Q9OA 2X4OA 5ESQA 4TNGA 3SYAA 1QLFA 3NFPA 2FL5B 1CF8H 1P7QA 1L6ZA 3FB5B 3QUYA 5F7DB 3C6LB 4I48B 3SGJC 2Y2TA 2GTZB 3BVXA 4AI7A 4BA8A 5GS0L 1C7TA 1RMFH 3FH5A 4UMGA 2FGZA 3TPKA 5J9PB 3PREA 3B2UD 2H32B 4DW2L 3A5VA 1M3IA 4UQ3A 5FO8B 4AMKH 2Y9RT 1A8ZA 3NJVA 2ED6A 4YSSA 1G7MA 4OZHB 3D85A 2BNRE 3LB6D 1F5WA 1TIUA 4DGWC 3NSDA 4NKDA 1MIMH 4Z5RB 4N8VB 4FTDA 1I9RH 1IBGH 3AFLA 5T3XL 1ID5I 1XD1A 1MFNA 2XPZA 3ARFB 5DJAA 4OI7A 5IGXL 4JG9A 3HE6A 3TNNB 1H5BA 2PTVA 4GO8A 4HFWA 1S9KC 3GRWL 4LVEA 4OKVA 5D1QD 5DRWB 4JPWL 3F8UB 5I5RA 2R2EA 3N0AA 2E6QA 1ZEAH 2DQGH 4XB7A 3FFOA 3HFFA 3II1A 4O02H 3VD4A 1DVFB 3B2XA 1QSEA 2E8YA 1FBIL 3HRZA 4NP4H 4CSPA 2C9PA 3JWOC 3F7YB 2BWDA 4LSSH 3BVWA 3G7TA 4NZ8A 1UM4H 5PAZA 3GUTB 3FH8A 3OJDA 5DCCA 3M8OH 1RAMA 3MV9E 3ZE1E 4ERSL 3FCBA 1XF4A 1I8KA 2YN5A 2R0WH 4ZXBD 4TSCH 3W38A 5IFJA 2PLTA 5F7MC 1CK0L 5J5EA 5FM5O 1JZ7A 3DA0A 5CD5C 1QBLL 4X7CC 1CFQA 3EYQC 1EVUA 2OMTB 3OKOB 3VFVB 2XICA 2V6HA 3LS5H 1J11A 3BP7A 3HMXL 1ADWA 3CBKB 4KK6C 4OT1L 5EU4B 3GSUB 1SVBA 5ADPH 1DO6A 2IBBA 5DHEA 4NQXA 1FNAA 3QQ4A 4UYQA 1F4XL 4NQQA 3IXTB 3L6FB 1SJEB 2AABL 1JTTA 2KZBA 1ZIAA 3K6IA 4J6RL 3SDDD 2B9BA 1Q4NX 4ACTA 4PJCB 5HP5A 4TVPE 5A2CA 4HOZA 5DHVA 1CDUA 4JRYA 1OGAA 5TE4L 5E6SB 3U7AA 4WW2C 2XXCB 5IBUB 1P4BH 3C08H 1JE6A 4WJ5B 5HVHC 1HINL 2IANA 1FL3A 3O2VL 5ACZA 3TYGL 2OXHB 3RVUD 5CBAA 1G7QB 3BKCL 5EEYA 3OLIA 2WWMD 4KUCF 1F02I 4ZMWA 1A3RH 3BP4B 4OIIL 4DOHB 3HBQA 4ZOCA 5ETUB 3IJSA 1ASPA 2E9WA 1O9WA 4X7EC 3SDCD 4AIEA 3T1FA 1I75A 2FCBA 4B95C 1EANA 3VM7A 4JQIA 4R26L 5K39A 3F6IA 4K3DH 1KCVH 3WFEL 3SGEH 3MA7A 1WBYB 3LEVH 4HALA 1F0LA 4KKLD 1OZUA 3FHEA 4AGMA 4JFFA 2D03H 4HUVB 1EAPA 4QXTA 3RNKB 2VQ1A 4RGND 5GGUB 2XWCA 1M71A 3K1DA 5D4IA 3MNMA 5C0IB 1BF2A 3I75B 3KCWA 4EZKA 4X9GA 3V9EA 3RY4A 4ZQTA 2R83A 4U6VL 4R7XA 1I4FB 3NA9H 5EU6E 1GJWA 3V4UL 2BNUB 1ZJAA 1JXDA 3UZEC 5A2AA 3EOTH 1UASA 4P3WA 4QF1B 5T33L 4BFEA 3HNSL 4NZUL 4ZXBB 3ZSTA 4K8RL 2DLHA 2HUEA 5D96C 2XWXA 7TAAA 4AQ1C 3TGXA 4FNQA 4HEMA 2EILB 3BT0A 2QPSA 5CJOH 5HGDB 2DQEL 5DJZB 2WTRB 2H45A 1ZANH 5C0AE 2ESVD 4AT6B 5H37A 3D4YA 1MI5E 2FUTA 1CGSH 1V5JA 1Q9LA 4H0HB 5DVPA 3KWXA 2Z0UA 4XNBA 4ATTA 3DK0A 3JTTA 3PAUA 2K7PA 4AVHA 4ZNEA 3MNZA 4HPHA 2CMRL 3NIDE 3W39A 3IU4H 1CXIA 2XG5B 1KY6A 2VDPL 2VDOH 5BMFL 3SDDB 3V0HA 2F58H 5JPMA 1SYSA 4MGXA 4B7LA 4IHOB 5FF6B 3VXOA 4BKTC 3QWOB 4OD2A 2HG5A 4PMEA 2Z0BA 1R0AL 2JKRM 2FT8A 3N5AA 5GJSH 2D73A 4UV7L 3CBRA 2EO1A 3MRPB 4NO2B 4GBXC 3HUJB 4A2EA 5DZJA 2DLFL 5BV7H 1A21A 1TJIL 4RVBA 1LP9A 3ZKMD 1KF9B 3MRRB 4GKSB 4HEPA 4L5FE 3X3GH 3IM1A 1F4HA 4L0ZA 4GRWE 1JZ8A 1CLYH 5IQLA 1P9MC 2W9EH 5SWSE 4APQC 3IS1X 1FAIL 1FSKC 2QL1A 2BP8B 2LAAA 3C8KB 4JO2L 3V6OA 1VGKA 4B9KC 3SDCB 2BJMH 1M42A 2DYRB 1J1PL 2DL2A 3PWPE 2YOAA 2C9RA 3MR9B 1W15A 3P11L 1AQDA 1WGVA 4LCUA 3LKRA 3TO2A 4B6ZA 4H8WL 1LO0H 3GIVA 5BW7A 5HYIA 3ZTCC 5BRQA 1IBBA 4FQHA 1BBJA 5LAPA 2P3YA 4HSAC 4MAUH 4N85A 3BGFB 5IF0B 1AGBA 2Y6SC 3OHMB 4HKJA 3TJEL 1JERA 2X4UA 4TYUA 5E1HB 2OMZB 4RGNB 1DJSA 1U93B 2X53A 3ARGA 1IGTA 1ZY9A 1H9DA 3VXQA 2DMCA 1G7IA 2VDRH 1UM5L 3BWUC 4XO3A 2G5UA 1HKLH 2PCXA 4F2FA 1PLCA 4IKKA 3AG4B 1PZ3A 1XMWA 5ESVA 3L3DB 4L8BB 5E08H 4AIZB 4YWGL 3ZDZF 4XNUH 4OJCA 2MQCA 1NGQH 5D7JA 4L48A 2VSCA 1J7VR 2AJ3B 3HTLX 1MFAH 4MD4A 2P5ED 3TBVB 3CFJA 3L2LA 2EVIA 3EYVA 4UT9L 5B7FA 5F70A 2CNZA 2ESVB 1UD4A 3PP3K 1PCXA 4Q9BA 3DVIA 1KJ2A 1DDHB 3VFRA 1QKZH 1T2QH 4P23A 2DQTH 2F8OA 3UEQA 1IAKA 3QJZA 2ENSA 4GG6A 3KWVA 1FP5A 3AREC 3IVKB 3Q1SH 4G1EB 1N6VA 4KXCA 1RH8A 3KEHA 3BPOC 1TQSA 4HS8L 5JQIB 3NN8B 4HWNA 3GWJA 4HMDA 4RSVA 3SZ6A 2ED7A 3B8SA 1NICA 1DQQA 3O41A 4X6FB 5TD4A 5DI8B 3NTCH 1E50A 4QHNA 3VWKC 3ZYZA 4JQXA 5E2UL 3WUZA 2EUVA 1EDQA 1L9RA 4UWQB 1T6BX 4X98B 5CUSH 5L0QC 5LGJA 4JO3H 3TFKC 4LF3A 4NKMA 4DGVH 4XPBL 3CWGA 1J5OL 4HUNB 1S5IL 1PCSA 3RTQA 1TUPA 3UDWA 4JG5A 1EGJL 2EP6A 1ZJBA 2E8ZA 3DWTA 5KVFH 3DTDA 1O0VA 1RZJL 3TESA 4K2UL 1ZPUA 3TONA 1XH0A 1J9CT 1JPTL 2WQ8A 4Y1SA 1F8TH 4G6JL 5CNHA 2XOTA 2YPLA 3BPCB 1MFDL 4OVUA 5JR1H 4XMVA 1BAFL 3WU1A 1JYXA 1DQJA 1WQVT 4FABH 1A6TB 3CQPA 1M7IA 3BQUC 4NC1E 3VFWA 2YAFA 2DH3A 4OJFH 3DRTB 4CN4A 3PAVA 5FO9A 4OV5A 4OAWB 4G6ML 3SGJA 1SOSA 1IIKA 1OSPH 2ORBL 4YSUA 3SKMB 4JGMA 1IEBB 3R0NA 3DX9A 1T5XB 2XN9B 1V3MA 3OG6B 2ATPB 4HSCX 2A2QT 1KYOJ 4HWBL 4ZD3H 3NSJA 4X4ZA 4UZGA 3UTTA 4N25A 3RWFA 3WNMA 3BW9B 3WSQH 1JPSL 5AW2B 1SBSH 3O2WL 3LCYA 4E9VA 5KW9H 4TSBH 2IG2H 3SKJH 3MTRA 3G5ZA 2H32H 2IGFL 2P5EB 1L9MA 3C2AL 3D39E 5GRVK 3S2CA 4M03A 1D5IH 5CP3H 1CE6A 5IMLB 1F3DJ 2QQLH 1ZT7A 1XO8A 2B2XH 2KMWA 2OMNA 4DZBA 1U3JA 1KTRL 4ZUSA 2IQAB 2YXMA 2LT9A 4B96A 3Q2WA 4KV5F 4NKQB 1VAHA 3NK4A 4TVUA 3TFBA 3HHSA 4M6NH 1BG9A 4PY8I 1J18A 1YJDC 2IAMC 5HHXL 4Y2DB 3JV6B 1B2WH 3NPZB 4EUPA 1T3FA 4YE4L 3GJFA 5ADOL 1QO3B 1L9PA 1WUZA 3EGXB 3QJUB 3LQAL 3HZKB 3HPJB 4D0CB 4MLSA 2DQIL 2ICES 3PJNA 3P0YH 3Q6FB 3FSOA 3MFFB 1THAA 1UXMA 1BQHA 3AMLA 5HYJA 4TULL 1FVEA 4QXUH 4U1MA 4Y5VC 2FSEA 3H9SA 5I9QB 12E8L 3AVEA 1QMUA 4NDMB 4K9JA 1ZV2A 3IMUA 4E9LA 4HHWA 2J8UB 1VCBC 3CXHJ 4RGOL 1WAAF 3ES6A 5CGYD 2MOVA 1JNNL 3LKPB 4O51A 1JPGA 5C07D 1MY5A 5C3LD 1DBMH 2CM6A 4FQJL 4HUUB 2QPEB 1U58B 3PYCA 4XN5A 1ERNA 1WYJA 3BIBX 4HC1A 1TCRB 3T6WA 4OF3A 5TDPA 3BCDA 3L4XA 3F7RA 3AUVA 3QK0A 3UAFA 4Z0XB 2MPAH 4RX4A 1Z7JA 1FZJB 4GO9A 4K9EL 5C09D 4QRAA 1ZS2A 1TNNA 4ZX3A 1R34A 5CXPA 5FO2A 1JGLH 1WVZA 3GSWA 1ZXQA 2OKMA 5CILL 3TCTA 5E94A 1YNTF 2HJKB 1SJXA 1QG3A 5JZ7C 4JFUA 3D34A 2H3XC 2AJSL 3QEQE 1E27B 3FL7A 5GQBA 1HSBB 1M9SA 2MMXA 5GXBB 1QLEH 4NN7B 4O00A 3ZYOA 1GS7A 3GLZA 4WW2A 1YEEL 3EO0A 3RWJB 4HIIB 1DBBH 2WKGA 4OZFA 2XKUA 4L23A 2WC7A 3O6FD 4LSQL 4N1HB 2ZUVA 3GPSA 1UWYA 1E28A 4FNLL 2UY7B 5E4EB 4Z3GA 4XPGL 1H6FA 4MDJA 2AK4E 1FF5A 2F74B 4Y5YC 2HTLC 2X1WL 4JDEB 4YDVA 4E9WA 4NHUA 3GD1C 3NIGF 4UANA 5D6DC 3RILA 4FFYH 4S0TD 1KDIA 4Z7OE 4AV5A 2R0KL 5K69A 1G6RA 4U33A 3UBGA 2Q9OA 4XMKH 3LS4H 1XF3B 4LO9A 2CHZA 1A65A 4OCSL 4JEGB 4QYOA 5AKTA 3B2MA 2EDEA 4KFMA 4OLVL 1PD6A 5ILTH 1MW2A 1BXVA 3FU7A 4GQ9H 4YIQB 3AG1B 3OLEA 2V2TA 2X9XA 3MV7D 2E3VA 3K6DA 4Z8FL 2QR0A 3MLYH 5C08D 3QDGE 4NO0A 2VR8A 2I69A 3WNLA 3N0PB 1P6AB 4PJBB 5D1XE 5J4MA 2IDSA 1Z3GH 3UZEA 4OM1H 4LLVB 1U42A 1NWOA 4MSWA 3V8OA 3HJ0A 3L45A 5IJBC 2CNYA 3LQZA 3QAQA 4AQ1A 5C07B 4NZTL 2X7LB 4XC3H 2NXYD 1ANUA 4YLQT 4NJAH 5ISZD 3OGOE 2X0VA 2H0PA 2G75B 1ECZA 4PS7A 5DK0B 4GUOA 3M7FB 1FNLA 4WNJA 3T2PA 3GXDA 2PPEA 3L5IA 4NQVB 1RSFA 2FWOA 5C09B 1IAII 1LD9B 2ZYRA 1T22A 4AVKA 3MZGB 3VDAA 3QHZH 4GUQA 4ODXB 4CVXB 4NWUH 3SYCA 3GSNA 1KCRH 2EIMB 3TX4A 5BS0E 3HE6D 1MOEA 1H9VA 1K3ZA 2AQQA 1D7DA 5E1QA 4NEHB 1DDTA 3HCVB 4ELDA 1E4JA 4JNXA 1E7UA 4GP5B 3CVDA 2QQKL 4GBXA 3D87B 1MREH 3CC5B 1U8NA 3EYUH 1XV8A 1B4JH 3I2CH 3R0MA 4I88A 3U0PB 2BZCA 5CEZD 4WFHE 3L1EA 4QYAA 4Y16C 4LP4A 1DUZA 1QSED 2VQTA 3HI6H 4A2LA 5MENE 4WWNA 5ITFA 3O6FB 1UZ6E 3P30L 4XVUC 3CIAA 2LTQB 5EV7A 3K6OA 3WTTA 3OWEA 3V95A 2X3CA 5H2BA 2NUPA 4PIRF 1UWEL 1P9MA 4APQA 3P2DA 1FRGL 4PG9B 3SY6A 2J5LC 3GMNB 3L5WB 4M61B 3LZPA 1OB0A 1HOCA 4AG4L 4JRXA 1PX4A 4DUXA 5L8KB 3CNKA 1TLMA 3IGAB 43C9B 5SX5K 1VPOL 2VDKL 3SGDI 4HOWA 2IFGA 2X2JA 1Y0LB 3PWNA 3VFSA 1KCUH 2KLTA 2IWKA 3GSXA 4FG4A 4FXKB 2WP3T 2HKFL 3H7BB 4BELD 4Q2ZA 4LDCA 4ZI8A 4IBVA 2A74B 5FKPA 5FOJA 1YYML 2MHAA 3MV7B 4JJ5B 4N8VG 3V0VA 5I73C 5D7IF 4KY1H 5C08B 3VCLB 3FJTA 5MEOB 4PV9B 2X4OB 3KPMA 3NFPB 4OZIE 3KJ4C 2WBXA 4HPYL 1ZHKB 1JIBA 2QVIA 3HG1D 3W11C 2DWEB 1MHPL 4UAOC 5GRUL 4KOCA 2A1WH 3F00A 4IQHA 1E3FA 2VCOA 3O4LE 5EC1A 4ZMAT 3CSBA 2WLIA 1BP3B 2D7QA 2X4RA 5SWQA 1YPZA 4YDLB 2NXYB 4J4PC 2H7WA 5ISZB 2AQTA 2AQ2A 3WCYA 1SHSA 2BLFA 3H6AA 4XP5L 5GS1B 3QGVA 5LXGH 1G7MB 1U3YA 4HWEH 1GOGA 3KPSE 3D85B 1W91A 2DBLL 1GZPA 4NKDB 4N6RB 4OSUH 3CJJA 4DN3L 4L9LB 3MLSH 3HOGA 3AREA 2DV6A 1K4CA 3LN5A 2ZCKL 4NFBA 2X40A 5DJAB 4PY8J 4JQVC 3K80A 3HE6B 1FVDB 4RZCA 4HFWB 1YEIL 5MEQB 3SYQA 3QBTB 2EDTA 5E2TL 3WKML 4HF5H 3VWKA 4OKVB 4QLWA 4XO8A 3ZDZB 4LVHB 1USQA 4TS6A 1E4WH 1RZPA 2R2EB 2XRAL 3M46A 1D7BA 1QX1A 4L1SA 1XGPB 1Z5YD 4XBEL 1QSEB 4GKLA 4JFFD 4JHVA 1ZK5A 3ZL2A 2XXGA 2ZX8A 1NDMA 1NIAA 2OR9H 1EHKB 3QC6X 1EHAA 4LSPL 2WINA 2E9GA 3QR0A 2NUTA 3U30B 1YQVH 1HK6A 5DD5L 1ZLVK 4Z7UA 1K5WA 5D2NC 4AEIH 1O6TA 4F5CA 4FYSA 2NYZA 4LARH 1XF4B 2X10A 1I8KB 5DD3L 4WV1B 3NG5A 1AMXA 2P26A 4XMPH 5IFJB 1MELA 3BQUA 1HSAA 3DPBA 4TNEA 4IJ3B 3U1SL 4F15B 4FZEH 2WXQA 1QBML 3GMPA 2GUYA 2OP4H 3NQKA 1D9KA 4WY7L 4YS4A 5A1AA 5I71B 5IBUG 2IDCA 3C9NA 5E70A 3W0WA 2NY2C 2XVGA 3TH4T 5CSBA 3BP7B 1DANU 4AXWB 4EI6A 4G5ZH 4X6EA 3P4MA 4TOYH 3V5DA 4RBPK 4OGQC 1JHLH 4EIBA 5KWYC 4PAZA 3HG1B 3S8WA 2JXMA 2P8MB 4FTVD 2AXFA 4J5VA 2QVTA 4UDTB 1V54B 2N0MA 3RKDD 3LPOA 2NXZD 5CN1A 1ZTXL 3QZWA 2FEDC 1XH1A 2XN2A 4TNVF 4KX8A 4G8FB 4Q4EA 4ABWA 1CGUA 3GTVA 5AL0A 5CLTA 5EEWA 3WS3A 1KGWA 1NAMB 1HYSD 2UVFA 2X44D 4C56E 4LPXA 4BFRA 4DVBA 1JBJA 2Y4SA 2E7DA 4A7VA 2L0DA 4G59C 1FL3B 2XSKA 5ACZB 3PQYA 4TTDC 2EZ0D 2AGJL 3S36X 5CBAB 4FYRA 5CJBA 2IAMA 2M8XA 3FT3B 2P49B 5DUPL 4KO7A 43CAB 4DP0X 5L7XH 2EE6A 1IBFA 5EN2B 3D5OF 3IJSB 3VW3L 2N01B 3QDMA 1U3ZA 3IMBA 1ZVNA 3QJSB 1YEKH 5IKCA 4PJIE 1NOFA 2W5PA 5I23A 4MCMA 2YPVA 4Y5VA 4PJIF 4W81A 4WEUD 4DHLA 3VQMA 4LPCA 5C0CD 3VFGL 1R3KB 1U91A 3ROLA 4XWOD 4JFFB 1TQBC 2Z31D 3AABA 1EAPB 3PFQA 4X9HA 3EDDA 3OMNB 4Z7VF 2VQ1B 5TF1L 1ID2A 1VFOA 4NXKA 1M71B 4X4MA 3ARGD 5IQ7H 4M9PA 4TQEL 3O3BA 2WXJA 1WISA 2ATAA 3D09A 1NTDA 4Y1AE 3V4VB 1YA5A 5IJVA 5HJBA 5LNEA 2EIKB 4Y89A 5LB1A 2IC2A 4J8RA 2IJ0C 5FYKL 5KJ4A 5I66B 5JW5B 1R6VA 1UCBH 4KXDA 2RCSH 1YDPB 3ESNA 4HUWA 3HHRB 4UTBL 2V5YA 3MKGA 4AUUA 2C4XA 2KZ1B 1C12A 5D7JD 5FK9A 1N26A 4DP8X 5DJ8B 9PCYA 3MOAH 3PXHA 1OL0A 1T0PB 3EFOA 4DP1X 4NQDA 4BFKA 1CURA 5KVFE 5AKSA 3GMOA 1Q9LB 3S4SG 3O6ML 4Q6YA 3U36B 3I85A 2CLRA 1LJMA 4S1SH 4EN3C 3MRGB 1DSFH 3MNZB 4JGUA 4LVNB 4HZLA 4FTVB 2E7HA 1J5DA 4JL1A 1OARH 5E51A 3Q06A 5TQ2H 5KYYA 1OTSD 1NLBL 4XBMA 2NXZB 5JPMB 3KGTA 3UH8A 3VXOB 4OD2B 3WLWD 4OD1L 5HDLA 4A7TA 5AFAA 3OF6A 4KROD 4KX7A 2ZWKA 4HLJA 1MZYA 4WFFE 3G08A 4AL8L 4Y5YA 2CA4A 5DU7A 2WKOF 1I9EA 3STLA 1DN2A 1LP9B 2BWQA 5DJDB 5DHMC 1YNTB 4QAMB 5FW6A 3QH3A 5HYSA 4PJHE 4X6CA 3QZMA 3HC4H 2ZAIA 4Q8BA 1KT2A 4WDIA 3GGWB 2VZ1A 4N1CA 2VE6B 4EKXA 3F58H 3WXVL 3O3DA 3P4OA 4GS7B 5E9DA 3S2AA 1VGKB 1QHQA 2YPLD 1EHLL 4PQXA 5DJXB 3I6KA 5LBSA 5TJWK 3IKKA 4KX9A 3MNVA 2YIHA 5AOIA 2QLYA 4UQBA 2R4RH 1V8HA 3EJYD 2MPVA 4LCUB 1AQDB 4NJ9L 3SJVE 3LKRB 3TO2B 3ML8A 1SRDA 1A2YA 1WS8A 3ESUF 4FQHB 1BF8A 5JUEL 1BBJB 1YEGH 2HLAA 3G5XA 5C0CB 4IU3A 4YFLI 1TQWA 2Z31B 1QW8A 2NY5C 4YX2L 2X4UB 1DN0A 1G5GA 4MJ6B 3V9CA 1YEHL 3ARGB 4ETYA 2WQUA 4JUTA 2VN4A 1G7IB 1S7WA 2IWGA 3HFML 4Q58C 5FLVA 2VM4A 4RAUB 2F54D 1QI4A 1KOAA 4ZMXA 2DLEA 5ESVB 5EHFA 4N2BA 3VXUE 5FM4A 5CHNA 4W6WB 1S9WB 3TS8A 1KELL 4A6YL 5IHBA 3ZRCC 2KPWA 5D7JB 3BVNB 3PPEA 1GZHC 1VFAA 4FHKA 1PG7H 3V79C 4MD4B 3OKDA 3EYVB 4G8GE 4DGYL 1JNHA 2ZWSA 1RZFH 1CLYL 1KJ2B 2B7DT 3VFRB 1NLDL 1PNDA 3L3OC 3QFGA 4PJ7E 4OLXH 1G9MC 3F04A 2IQ9L 2YAEA 5I1DA 4TM9A 1J87A 2A77L 4PJ7F 1SFHA 2ZT9C 3DX8A 2XZQH 1PTZA 4Y16A 2C1OA 1ADQA 1Z5LA 1JHTA 1DQQB 3O41B 3EF7A 4R7LA 3ZXAC 3V7AG 4JO1H 2BVEA 3NGBC 5AL8A 5E5RB 1OP9A 4KROB 1FH5L 3ULUH 4KMLB 2V8LA 2O61A 5HYJD 4OW6A 4L8DA 4OCXH 5EIVA 4LF3B 1JZ3A 1TEFA 5CZVL 3IFOA 3QI9A 1ZT4A 2VRAA 2HVBA 4NN6B 2VIRA 1AOZA 2Y6TE 3QO0A 1YY8A 3FQ1A 3ZDXF 2MCPH 4JFPA 5IP4A 2PPDA 3ZQXA 1EJ6A 3EGDB 4I77L 4MCZA 4WWOA 5EZIL 1OP3H 2P46B 2MSPA 1F2QA 3MV8A 4ZUWA 1TZHA 4YSCA 2YPLB 3II2A 3K8KA 4L4TE 4R96A 1JFHA 1YUHB 2YAMA 1DQJB 1M7IB 4RX4D 4AYMC 3VFWB 3BC9A 1MAML 2X2YA 2FX9L 2BZDA 1U36A 2R1WA 1QRNA 4OV5B 4J3OC 5FKAA 1XZWA 1B4RA 1HE8A 2GAZB 1G94A 2N3JA 2OZNA 4IIZA 4PVLA 2HYMA 5INDA 4UBDD 3RP1A 2AK1L 3IAQA 5IZ7A 3BGMA 3OKEA 1UJTA 3MGTA 4HXAH 4YO0A 3I9GH 5B1CA 1L0PA 1IKFL 4J4PA 1L5GB 4LHQB 1PD1A 3DLQR 2F54B 1RVFH 4DOHE 2Y72A 1U8PA 4GKNA 4XP9H 1OKEA 2WHVA 3GSRA 5FV1L 2CO6A 3HPLA 2GK0A 3KLAA 1XT5A 4JM2F 5DFAA 3SE8L 1MCSA 2ZCLH 2CWRA 5F6HI 4H20L 1ZLEA 2DJ4A 1WWCA 3UZQB 1QFUH 4BDVA 5C0NC 2NY1C 4APXB 4ENZA 1IC5H 1OHZA 5D7IB 2MQ0A 4M3KB 1CE6B 3JV5A 2YD0A 3V6FA 1MFUA 3F5WA 4JY6A 4JQVA 2N0KA 2E47A 4DZBB 4L3EA 3LNHA 4ZUSB 1NC2D 2Y7QA 4EXKA 4P9HH 3TEZA 3DBXB 5CIPH 1X5AA 1MCPH 2BNQD 2F5BH 2C1PA 3V5HB 4KGJA 4S11A 2ADIA 1T3FB 4D9RE 4DPAX 2FD6H 4P2AA 2PF6A 3CXFA 1VFBB 2JQMA 3GJFB 1CO1A 2F1BA 1UQSB 1XFPA 1RURL 2XQ0A 4TUOB 4ABUA 4UDUA 5E8DH 4KKNA 2EDQA 3N91A 2YEQA 1G7LA 4P06A 3BPLB 4NO0D 1BQHB 2D0FA 5HYJB 1FVEB 4KJPC 3LZNA 4H25A 4U1MB 5D2NA 5EZOL 3VDCA 4HVBA 3H9SB 5CEZH 2ZG1A 4L0PB 1IAIL 1CFSA 1TVHB 1CR9H 3FSZA 4NQSA 2YQ3A 3ASOB 1HT6A 2WVUA 3QO1A 4BGLA 3ES6B 4DP9X 1HDMA 2YAHA 4HIHB 2BSTA 4UOJA 4O51B 2B0SL 2GSGA 1JPGB 3SPJA 5I1IL 1ZLUH 3WG7B 1D5ZA 5AOZA 2GC7C 3WSQL 3EFDH 5DMIL 4CRPA 4EDWH 5DQDH 2WYHA 3E8UL 2CLZA 2IV8A 2V37A 3PDGA 3SKJL 1I1RA 1OLLA 2X87A 4Q0XL 3MUZ1 4HIEA 1ZGLA 4KJYA 1D5IL 5HDRA 5GHWH 3V4LA 1H3UA 9CGTA 2WYZA 5FS5A 3HUJE 3LPWA 2IOMA 2XWTB 2EH8L 2XN0A 3B5HA 3GSWB 1PKQB 3D4GA 3SPVB 5HJ3A 4OF7A 5AZEH 3BYYA 4LLDA 4M6NL 2E86A 4M7JH 4LNVA 1RFDH 1TZIB 3WEAA 1ETZA 2XKNB 4BZ2L 1U6AH 2QKIC 5F9OH 5DK3A 1F4WL 4UV4H 1KTJA 1DHKA 1JGEB 4GBXD 1PQZB 4RMTA 2JCCE 4AMXA 4JFOA 4BH7A 1A9EA 4KI5E 3UYRH 4K3JH 2JCCF 1CDGA 2HG0A 4OZFB 4KI5F 5CZXD 4LDEB 3VVVA 4JN1H 4YDJB 1E28B 5DHVH 2HX8A 4U1GB 4MDJB 3RVXC 4YE0A 4APQD 5B3SB 1LO2H 1S78D 2UX6A 5FIEA 4HJ0C 4YDVB 3WEBA 4NHUB 5ECJE 4IU2A 4RGNE 2HWZL 5L4IA 4Y19D 5GRYA 4JRXD 4PRAA 4PV8A 2JELH 4GAAA 2EADA 3F12A 1G6RB 4U1HA 1A4AA 2CH8A 1GXEA 2I5YL 1NCWL 3GXUB 3M1OA 3PG2A 1ZLSH 3FU7B 2ITEA 5JHMA 1CUOA 5KVDL 2V2TB 1NEUA 4FMVA 4JQIH 1FL5B 3HC2A 4NO0B 3OLGA 2JKIS 4M1GL 3H4FA 1N8OE 2WB1A 4X0KA 2XX1A 5FA3A 3RG1C 4XOCA 2GCYA 4MRCA 5E4IA 3IYLW 4JE4B 5DEGA 1GGIL 4OLUL 4MS8D 4YHNB 4MSWB 1OHQA 2PTTA 5ITBL 1RZGA 5C0EA 3LQZB 4AQ1B 3DUUB 3P9WB 2ZNWA 2B59A 3QFJA 4X5WA 4XI5D 4LIQL 2X4NA 5K5YA 5I74B 1JCVA 1NKGA 4M7ZB 4Y4FD 4GJTB 4UCFA 4DQOL 4KNQA 3T0VA 1S7VA 3DRQA 1MXDA 3HN3A 2FWOB 1XH2A 3DX7B 4Z7VB 2LU4A 1DFBL 5BOJA 1ZGLP 3IBOA 4IKNA 1T22B 1MXGA 5LKNA 4EN3A 3ARED 5L4JA 3QG7H 3LIZA 3KGSA 4F2MA 1RK0B 2ZOLA 3GSNB 2CJUH 5FCSH 4BUHA 4ZW5A 1AGEA 5H37H 4JFEE 1IQWH 2VITA 1VESA 5JQ6L 1FFOB 4JFZH 2DTSA 3DSFH 2IGTA 4GBXB 4J3BA 3K74B 2B14A 1RJZA 3KJ6H 4MZ2A 1E65A 4BK4A 4C57C 1IGFL 1TF4A 5BQ7A 5GSVA 1A4JA 1DUZB 1TDQA 2GT9B 3LEXA 5TFSH 3UAJC 5IUSA 5ITFB 4QRRA 4XP1H 3V7AE 4HJTA 2DQCH 1TJHL 2XWRA 4MB3A 5B8CC 2DI7A 5H2BB 2H2PD 1NCIA 4APQB 5JMRA 1ND0A 3UO1L 1AFVL 1HFUA 4MLIA 3S34L 4AEHH 4KO9A 4Y19B 1FFNA 4JRXB 3B2DC 1U3HD 3QJQB 3GJEA 2XN9E 3GBEA 5IIEB 4M02A 2YO3A 2BW4A 2RQEA 3BQUD 1CLVA 5A6MA 4HIJA 2OSXA 3MRIA 3U46B 3WIFB 5HBBA 5HXMA 3MUHL 1YQ2A 1BBDL 1D9KD 3VFSB 1NFIA 1D5RA 4H88L 3GSXB 4KO6A 3FOMB 3W0WD 4YOKA 1EEZA 2VXQL 4Q2ZB 5FUCE 3MA9H 5JNYB 5FKPB 3V0VB 2YMTA 4UTCA 2MHAB 3GB7B 3MCKB 1LEKB 2RB8A 3BKML 4E9RA 5HVFB 2BFVH 2JQZA 4BV1A 4UMSA 1FYTE 1WZ1H 2NY3C 3GHBH 1QSFE 1ORSA 1ZPLA 1HH6A 1RZKL 3WBDA 1BOYA 2F7QA 2A99A 2WLIB 2Z65C 3IFPB 4YSEA 4DTGL 2H0FA 4R9HA 5F6HJ 2EDDA 1GZHA 1L9OA 4UT6L 2XV3A 1A6UH 1RJYA 4Y4FB 2XKSA 1MCJA 3BP6A 2C9AA 2R9HC 3UTPE 5D8JH 3KDMB 3L3OA 3QPXL 4K15A 3W56A 1GZPB 3ZKNC 3K2IA 4C4BA 2JI2A 3PQYD 2A4ZA 2P43B 2JB5H 3HG2A 1KIQB 5FDYA 3AREB 3HE7D 5KYXB 4KKAC 5IB4A 4UQCA 3LN5B 1WAPA 3BSHA 4D7BA 3WNPA 2IBZY 1DLHA 3G6JF 2J8UE 3WEXB 4HIXL 3US0A 3DHMA 1UH4A 1KJ2H 2ZONA 2P1YA 3VD7A 3R7RA 2O93L 4D9LH 1QSZA 3VWKB 4F7TB 1FORH 3V0FA 3EJPA 3O8XD 4H26A 5F97E 3BN9D 4KITB 3RY6C 4ONFL 5F1KC 3KLQA 1BHGA 2JWYA 2DQJL 2QPFA 5BNXD 3VXMD 5EBGA 2H0EA 2MEJB 1NDGA 2B9AA 3VTTA 2J88L 3U6XS 2WINB 2NUTB 2OCJA 3RGBA 1UHVA 4Z7UB 5CEYA 5FYJD 1X6NA 4JFHD 1KXQE 3GS0A 3NJMA 5DC0A 4HBQA 3EGSA 4GUPA 4PRDA 3PXLA 3FT0A 1U3HB 3IU3A 3RIAK 2GW5A 4ZOBA 1WD9A 3BQUB 3DPBB 4P2QA 1XF5A 4K8RC 3GMPB 4YHLL 5LXGL 4S0SD 4HWEL 1D9KB 4N9GA 3CZNA 2NW2A 3HZMA 4MJJA 5F6IC 5EBMA 1RPKA 1XL4A 3W0WB 4HGWB 1FO0B 3WFDL 5BVPL 4KBPA 5IMMA 4QDGA 1XMEB 4PP1C 4MBOA 1AANA 3T6VA 5J56B 1E9QB 3H2PA 2FYYA 4QY8B 1IM9D 2UWEA 3HNTH 1SEBB 2WPGA 3P4MB 1A22B 1X7TA 3TNMB 4ODTH 4I0KA 4MHHG 4AGLA 4NUPA 5I5JA 3GNML 2AXFB 4I3SL 1GYUA 1KFAH 2VABB 5DDHA 2GBUA 4KI1A 5ANMA 4BXSV 4ZO7A 1Z32X 1ED3B 4YDIH 3GUFA 2IPUG 4MCNA 5A2JH 1A6WL 2HRPH 3S5ZA 1AQKH 2C3GA 2JJTC 3ZX1A 1AI1L 1BJ1J 2A6DA 1VA9A 2CUHA 4MB1A 4WHDA 2HTLD 2OR9L 2Q2EB 2MTPA 3BYTA 4DVBB 5LQBL 4F57H 2IAAC 3ZDYE 5K9OA 5I5IA 1AXSA 3VGBA 4OKDA 3PQYB 4QNPE 2PR9A 1C5DA 3HS9A 3HE7B 4IDJH 4R2GD 5FR3A 3FMGL 4PJBE 1KCBA 1SLUA 3FO1B 4N90D 4PJGE 3FCGA 3W37A 4QNPF 4JR9L 4MJHA 4ZOEA 5DJ2A 3NFNA 3DIDA 3CN3A 2IXQB 1OTTC 5IKCB 1EZUA 2OP4L 1MQKH 4YDNA 3O8XB 4I4WA 4NUJB 1UXSA 4EI5C 5FEBA 4RNRB 2AERT 3GSOA 1E5UI 2AQPA 4KVCH 3T4YA 4EUPH 4WU7A 5H37G 1AGFB 3ROLB 4H8WC 3VXMB 1YN6B 3GJFH 3B37A 3DXAA 1P4IL 3JWOH 1J9TA 1NFDA 1AKJA 4G82A 3TZVC 1OPGH 2ZICA 1NPJA 4IGBC 2Q8AH 3SYPA 1LK2A 4RMUA 4L37A 3GM8A 2V17L 4J8RB 3WO4C 5MEPA 1MWAL 4EBQH 2AV7A 3PP4H 1W8EA 4HUWB 4Q74A 3KPQA 3D3VD 1BZ7A 5AEAA 3ULUE 1C12B 1KBPA 3NJJA 1KLFA 3LNFA 4TLSA 1SN0A 5ESAA 5FK9B 5I26A 5KN5A 1QPKA 1TZGH 1KEML 2CJSA 4HEPG 1QLRA 4HC1H 3VWJD 3ATDA 3TH3T 4C47A 3FFDA 2E75C 3A3YB 1HH9A 1IM9B 2E74C 2P8LA 1NIEA 2ADYA 2QKIA 4XN1A 4M5ZL 1F2XK 1OSZA 4JM0A 1AKPA 4PJAB 1H3VA 1TQUA 2P52A 3X1NA 2Y7LA 5E5MA 1YEKL 2C3HA 5KYYB 4FQPA 1X5LA 4KKBD 4KZ0A 1SDAB 3CMOH 2GY7B 3E6FA 3SCMC 3CFEA 3S37L 4KJQC 3HC3L 4HHAA 4Z7WE 4JG0L 4NGHH 1FLTX 1AE6L 2ZKHH 4LPWA 4Y5YB 3PWUA 3LHPL 4UOW1 2B77A 4DAGH 3STLB 3NESA 2VLKE 1LQBC 3U2SA 4Z7WF 5FPIA 5G4NA 3MV7E 3MJ7B 3QI9D 3JWNC 4QD2E 4F8OA 5C08E 5HYSB 4GQPH 4OZFH 5F9WB 4XO5A 4Q97A 4R2GB 1NEZA 3IJYA 3C09B 4WDIB 3G9AB 1A02N 3APFA 1KSRA 1YCSA 3KMDA 2RCSL 1FC1A 1J8HA 2F5AH 2RIKA 3NP4A 3O3DB 1RIHL 3SE4A 5LDUA 3CVIL 1N0XL 1RZJC 1V05A 3GXMA 5DFVC 4FHBD 4JN2B 4YDKL 3MNVB 1O75A 1B9KA 1MCEA 4JAMA 3CV5A 4ODSL 2GIYA 5I8KH 2PR4H 4O4YH 5FXCH 1G6RH 1CI3M 1V7MH 1E6JH 2HLAB 3G5XB 4IU3B 2JTDA 2OZ4A 2DM4A 3OZ9L 2AJZA 2AC0A 3UABA 1OM9A 1M1SA 3PL6D 1DN0B 4EVNA 1FIEA 3GMMA 2WVVA 4XN8A 4J12A 3L9EA 1ZSHA 2NYYD 1S7WB 3J27A 4J7RA 1QPXA 2O5XL 2QZ5A 5TQ2L 4C4KO 2VXTH 1QWUA 2ZXCA 5EF0A 4LEXH 2OR7A 5I6OA 1N64H 3FU0A 4E41A 3KLKA 3GRGA 2JH2A 2VM9A 1O5DT 2D7MA 1KG0B 5BRZD 1VFAB 5CEZE 1NCGA 4KMQA 3WFHB 3BP5A 3JVFC 3VWJB 1QSEE 3RA7L 4MA8H 5GGTA 4FCAA 1TSRA 1UOWA 2WWOA 1J1OH 2Q3AA 3PNWA 5AB9A 4LB8A 5F9JA 2AJUH 4LGRB 2APWA 4J1UA 2IO5A 2EYSA 3ZTJH 5I1DB 3MRHB 2GSIA 2LGNA 4HS3A 4MQTB 3B83A 1WV7T 3FPYA 1X5KA 3PHSA 3ZYJA 3FO0H 2ZKYA 3GRWA 4RH4A 4Z0BL 2Z8WC 4UINH 4JO4H 3GSNH 2AJVH 2AMGA 3C5ZC 3ZKQD 1MRDH 1Z5LB 4NKIH 1S9YB 1L3WA 3H54A 4X8JB 4ZTPH 3UAJA 5KS9A 3ZHDA 1CB4A 3D25A 4TXVB 4ZMQA 1I3GL 3EZJB 5B8CA 2FBJH 2YR3A 3LQAC 3N85L 2O61B 4AVJA 3KXFA 4JZJC 3KGRA 2OTUA 4OFKA 2OJZH 4X80H 3QI9B 1ZT4B 1RU9H 2DLIA 4JZNA 3WE6A 1MQ8A 3N1PC 4LCWD 1WS7A 2YJLA 3AITA 3R1GL 1YY8B 2YXFA 1I1YA 4P2YA 4TV3A 1OGTA 2BOBA 5CGTA 2A3TA 2D3NA 4MCZB 5T1MA 4Y0GA 4ODVH 1GAFL 3UCQA 2FIKA 4ZUWB 1TZHB 1L7TH 2AITA 3VFNA 5C0RH 4NCC2 5JDSA 1YEFH 3C75A 5I73B 2ZKMX 4AENA 1U8HA 3OXSA 4JRYE 4QRTA 1OGAE 5SV3A 4CJ0A 5E95B 4R3SB 1VB9A 1A1OA 3HMXA 2IALB 3KJ4B 4UAHA 1RHHA 4C83A 4K9EC 2R2HA 4UAOB 1IFRA 5INDB 2ZXQA 1TMCB 1GMEA 4LKXA 4YXKL 1LNUA 3PL6B 2IANE 3OKEB 4Z3IA 3MGTB 5IBTH 4XWGL 4YO0B 3QG6A 3X2QB 2FEDD 1IB5A 4W93A 4ZT1A 1ZAGA 4EUPG 4EZLA 4FS0A 2XZQL 2NTFB 4MDIB 4XE5B 2FO4A 4GKNB 1U8PB 4DSYA 3BSGA 3GSRB 2CO6B 2GK0B 2EDFA 3NA4A 2L7JA 4LESA 4PLNC 3WUWA 4A7GA 1N18A 3FB8A 3FOLA 4P2OC 3RTLA 2ALAA 4JFYA 4OIBA 4OCXL 5AVUB 4BDVB 5HI3C 3TWCH 5BRZB 2AKRA 1DVUA 3ZRFC 5BRPA 3KBEA 3V6FB 3GSVA 4BA0A 4FZ8L 3F5WB 4JFFE 4JY6B 2BSCA 2BVUA 1K5NA 5E1GA 3HEIB 1WA0X 4XNXH 1BFVH 2AAAA 2Y7QB 4M8RA 3JYBA 4ODWA 5I0XA 5ICYA 2A7BA 1G4RA 2C1PB 5AVQB 5I0DA 3FU6A 2ADIB 3RY6A 4GAJL 4NPYB 1T0MA 3EZ8A 2VDLH 2FGWH 2YUWA 1A47A 4QI3A 4QOKD 4UDUB 4OVVA 4JDTH 3G6DL 1G7LB 1XTMA 1A3LH 4HEME 1QUNA 1JK9B 1TETH 4POUB 3ZL4H 3KYNA 3R7QA 1HL5A 4H25B 4F20A 4M4RA 4FJ6A 3FUHA 3ILDA 5I2IA 3QXAB 1KN2L 2BWIA 4NQSB 3T9WA 3QISA 4CC4C 2ED8A 3V9FA 1R3IH 1KYOK 4LCWB 1T1XA 3HMWL 1XH3A 1JG9A 2H3NA 4NS0A 3D69A 2WCGA 3EJTA 4ZNEE 1VGEL 2GSGB 2QTEA 4UTAL 4MQ7A 5IG7B 1DEDA 2OR8A 2X1OA 2IBGA 1P53A 4OZFG 1DJIA 2VQUA 5JOPE 3OKKA 2O6DA 4S1DC 3IKCB 3HS0C 3MRBA 4KJYB 4QJ3B 4NM4H 1FV1A 2HLEB 2KS0A 3FQWB 5J3HC 3UG3A 1Q0YL 1AIZA 1CZ8L 4PGEB 4EN3D 2HH0H 2B1AH 1LP9E 5HJ3B 4LLDB 4N0UA 1XB3A 3LY6A 3IDXH 1RULH 2WNWA 4OB5L 3PGDA 4UI2A 5KJ7E 3LNIA 1PAMA 2FWUA 1ETZB 4I5BA 3QXUA 4X8XA 1GKOA 1MIEH 2JJTA 1LGVA 5IBLC 3RIFF 3U9PL 1ZDQA 3V6OE 5A7BA 1XDTT 4JFOB 1AG0A 1NCCL 3PP3H 4GRLD 1E7VA 3HBPA 2YS4A 3ELQA 2A9BA 1BF5A 1P5VB 3EH5B 5GGRA 4QRRD 3T3PF 1CGYA 3V0IA 1I9IL 1I8IB 3VI4A 5DVNA 1IFHH 2AEQH 3HVNA 4JPVL 1SNRA 3CXHK 1AO7D 3L95A 1FAKT 4IU2B 5HVGB 2ZYIA 3CZJA 3EDEA 3TVMC 1FNHA 3I50L 3MX0B 4N26A 4XMWA 3WS6C 5IR1A 3VX1A 4MXVE 5EA0L 4EI5A 5IVXA 1CLZL 2IDTA 5DA0B 1YJDH 3ARXA 3VXTB 3TOPA 1HJCA 5D1ZI 3QQXA 1EXHA 1TQBB 1OK0A 4QKTA 1RQ5A 4QOKB 3ZTJG 4D3CL 3D52A 3GI8H 4IYKA 1G4MA 1FZKA 2VM3A 3GBNH 1KN4L 3MOBH 4IBZA 3TZVA 4O9HH 4HUXB 4IGBA 2QJDA 4RMSA 2YPVH 3P40A 1DLFL 1JVKA 4X0KB 2GCYB 5IFAL 4DEWA 1X7SA 4KQ0A 1XHHA 3SY0A 3VI3F 1MFVA 4Z3FA 4XPAH 5FFOA 1M2VB 4LEOA 5EORH 4KUZH 4XC1L 4M7LT 3NJGA 5DS8A 3VFUB 1CIUA 3MRJB 1PZ5A 4CL7A 5IT2H 4GG6E 3FT9A 4X5WB 2B59B 2VDQH 3D2UA 1A1MB 3IAGC 5FYJH 3N1QC 4GG6F 3NSCA 1JWMB 2WM0A 5T5NG 4U4BA 4DQAA 2GPZA 1KZQA 4JN1L 1S7VB 3DO4A 5E24E 1GZQB 3PWLA 4AJYV 3N41F 3HG4A 4UT9A 4PUBH 4BRVA 25C8H 4NQEA 1NAML 1ZSDA 2DF3A 2PYED 4EN3B 1FGVH 4ES8A 1ZV9A 2NSMA 4ZO8A 3V0JA 3FTUA 3REWA 1QR4A 1JYVA 2ZOLB 2NY4C 1JDCA 4BHUA 1AGEB 5K33A 4NM8H 1G6VK 2F61A 3SCMA 2WMPA 3KPOA 4LMQI 5ID0A 3QS2A 2HX7A 4QHMB 2ZOOA 5KZCD 1GPOL 3ZE2B 4JVWA 2XXMB 3C8DA 1MDTA 1RJZB 4NLHA 3OR7A 2YPLE 4RA0C 4P4KC 2DWSA 3FRPA 3OJMB 5GSVB 4U05A 3LKNA 4D0BA 3FQTA 4ZSOB 1KC5L 1LTXA 1EZVY 4JKKA 4KAQL 3S96B 5C2UB 5I1AA 4NRXA 2OSLA 4J23A 4QRRB 2BX5A 4FLQA 2Y1YA 3MOQA 3CN1A 1HEZA 3MJ9L 1J0JA 3MLUH 1EGJA 2PXYC 1ND0B 4HT1L 3O11B 5E6RB 2FLBT 4J6IA 2FEEI 3QA3A 2IFFL 4KXZH 1FFNB 2PETA 3QORC 3V4VL 1XGRA 1M7DA 1AJ7L 4TQIA 3ZHNA 1CLOH 3UTTE 4HUCA 4KMTH 1CFNA 3MRMB 1DBAL 3CK0H 3S37X 3CVHA 1JZIA 1NFIB 4FNTA 1RZ7L 1E4XH 3KL0A 1EEZB 2BM3A 3TA3D 3ZTDC 5LBSH 1B90A 4UM9D 1DVYA 4PJEA 3U6RA 2AVGA 1IMHC 2D0GA 1EX0A 4ZMNA 1BEXA 3ESOA 5ALCL 5AG9A 4HETA 3POHA 5E2WH 2CJUL 4XN2A 5DT1L 3VYOA 2OI9B 1ORSB 5DR5L 4FQQA 2YLKA 3BD3A 4M5YH 1JMXA 3CLWA 4HWBA 3IETB 4QRSA 5CJXC 5I8OL 5C7XH 1U8QB 5FHAL 1ORQB 1Q9WA 2CDEA 2BIHA 3BE1H 5C0ND 2DQDH 4HU8A 2FT7A 1WFNA 2Q76B 5CZRA 1A1NA 2OTWB 1KGUA 1EFXA 3TBYA 2BINA 2AHIA 3WJMA 1RJYB 4XMZA 3ARDD 3P9MA 3BP6B 3WFCL 3L3OB 3SPIA 3NCWA 4H0LC 4XP4L 1UB6A 5AVZB 1DVXA 2C4FT 4M7LH 5BZWA 5HYJE 1PGRB 2PYEB 2HT3D 1PX8A 2H8PA 3H9SE 4K7PL 2A9CA 3HI1B 2QKSA 3RPIA 5F1NA 1B88A 1XIWD 4MB4A 5I16A 3C5ZA 3V5KB 5FGCB 5KZCB 3NGBB 2BVPB 5F96H 3O0RL 2JKNA 5E4OA 3T65A 3ILQD 2QSQA 3MUGA 3HZ3A 4JZJA 2EH7H 3WGVB 2KQMA 4EPSA 2A38A 3RZCD 1FG2B 1B4LA 1XVSA 1P0SE 1ADQH 2FQEA 2XWJA 1NDGB 3DXAD 3ZMRA 1KCWA 4LAQH 2DAVA 4ECNA 1L0XA 1XGYL 5IB2A 1PEZA 3Q2CA 4HHGA 4KY2A 3DPDA 1AHKA 2NZ9C 4YXHH 2EDYA 4FYTA 1SJMA 3T5WA 4U3HA 4P5TC 1FE8L 3ETSA 1WO2A 4ZPTA 3JBG7 3QZWG 5E8EA 4WCYL 4GUPB 1AYOA 3IU3B 1AGDB 2XLLA 2KT6A 2LAGB 2C9QA 2E46A 3MYZA 3BXNA 4NYLA 1W0WB 4X9YA 4IOSA 1GTNA 2L7UA 3TU6A 3T77B 5F3HB 2APXA 4K23L 3HZMB 1KIPA 4ZUTA 4GSUA 5EBMB 3FTXA 5DMKB 3BKYL 5AW4B 1DQIA 1ODAA 1SXBA 3GS7A 4WW2F 3TA3B 1BSIA 1JVLA 35C8L 3DDGA 2JB5L 4WGVB 1NMAH 1K72A 2FE0A 4DWHA 4AC4A 2VXVH 2FYYB 4F8TA 2OK0H 5F89B 5I18H 3MACH 4RWYH 3NPSC 3U4BL 4NN5C 4OFPA 4AK1A 1PZAA 3KWUA 4JPKL 5DDHB 2BSBA 5AOLA 1FORL 2JKWA 1QABA 2G3ZA 3L3HB 4U1IA 2EIBA 1QFWI 3GEFA 2LV4A 4GH7B 3BAEL 5AZ2H 4CC1A 2WXMA 2ICEC 1WE5A 2Q8BH 2XX0A 2ATKA 2A6DB 2B15A 3ARDB 1OZTG 2DN7A 1BQKA 3CDFA 4I1PA 4HJ0D 4Q6IC 4XVOA 2XQBL 5C97A 1VEOA 4AL8C 2WXLA 2PYFA 4BCXA 5K9OB 2F08A 4Q14A 2C26A 1PFOA 4J8QA 3MRQA 1HIMH 1C5DB 4YK4B 3ILPB 3NRQA 3TPUB 3WY4A 5C0FA 3RFRA 5CSGA 1TU2A 3PGFL 1VHPA 5C0BA 1XIWB 4H4NA 2VC2H 4G71B 5DJ2B 4XAKD 2E7CA 3AU1A 2A5UA 5D6CB 3IT8D 4XCNB 4I4WB 3WHE1 1UXSB 1GC1L 3B9EA 4FFZL 3N44F 4N2FA 3RNQB 4EIGB 5BOPA 5LN8A 3GSOB 5DTFA 3P3YA 3EFFA 3STBA 4E0RA 4KTDH 2EDMA 4ZS6D 3HN8A 4CC4A 3DXAB 5AUMB 1UOLA 2GJPA 3FF8A 1DSWA 1NFDB 2YD4A 2ZUQC 3AGWA 3QHFL 5EO0B 5SX5H 1QFPA 1MLBA 5F7AA 4HJEA 4HUKB 2YSTA 2Q6WB 3H3BC 1BM3H 3MCLH 4AYDC 2EVFA 3KR3L 1NSNH 2W8CA 4PRPD 1S3KH 2VLLA 4MB5A 5KYUA 3VNYA 5ICZA 5MEPB 3QDJD 4U1JA 4HJUA 2ZIDA 3KPQB 3TCLB 4E41D 5D7KE 2BDNH 4QO1A 2OMVB 4BH8A 1IC4H 4YN3A 4KKCD 3V6ZA 3ZTNL 3MU3A 4Z7QF 3WIIL 2EINB 3L9RA 3CFTA 5JHLA 1QLRB 3H56A 1AS6A 4ZS7H 4M1DH 5HYSG 1HH9B 3P69A 4ADIA 1JAEA 1N0LA 5T3XD 2P8LB 4YXLL 3ABZA 5EU3B 2QKIB 2VZ3A 4F8NA 3OVUB 1EERB 2G3NA 1S7UB 4TRPH 1QWHA 2DMBA 2Z7ZA 3FZUC 1EHNA 1UA7A 4JRXE 5BUPA 4XGZB 2K6YA 3E6FB 1KBVA 5AWNL 1UJ3C 4CNIA 3SKNA 2KLSA 1HU8A 3FS9A 5D71H 2BIQA 4OI8A 4LCCC 1JRHI 4ELKA 4U6YA 2CCWA 1AH1A 1TITA 4JFVA 1LYQA 1XBRA 4GB9A 1F18A 4JREB 5DJYA 4N28A 5AD0B 5C9JA 1U0QA 2E9IA 5DD0H 2G60L 1RUMH 3KXFD 3GHPA 3HVDA 4HS6A 4XNQA 2J20A 3I02A 1C16A 2XJKA 4PJ9A 4QHKI 4LHJB 1SQ2N 1SHXA 3B9AA 4LPTA 4WI3A 3TVMA 3TH2T 4DNLA 3WS6A 3DKHA 4U3SA 3RKPA 3QRGL 2IMMA 3D30A 1NEZB 3IJYB 4FQXD 2W95A 4H1LA 1A6VH 1VACA 2GJ6A 1JXKA 1OY3B 5PCYA 4XVJH 3T09A 3IN0A 3U9UA 2X6BA 4QXGH 2BS8A 3UPCA 4LMQE 4IRSD 5IVZB 5IHUH 1I9JL 1U8LA 1LK3H 1YPZE 3MLZL 5K59E 1ZS8A 4K3EL 4MTMA 3UX9B 1HI6A 1ZLVH 3QC5X 3BAIA 4ONGH 4M8VA 3UC0H 2EXYC 1G0XA 4W9IC 1TPXC 4KU1A 1T2XA 2AJZB 4POYA 2FATL 3PDOB 4OCRH 3NSXA 4U0RB 5TK2A 1EO5A 4EVNB 3GMMB 5BVJA 1VZHA 2WXPA 2WVVB 3WNNA 4U0QB 1NCOA 2WVTA 3OB8A 4Z78B 5K9JL 2VL5A 2QHRH 4G11A 4ELMF 4PRPB 1G1KA 4OR1A 2B3RA 1AZUA 2NDGA 4N0YL 3QDJB 5TH2A 1BPVA 1OAZL 2VJ8A 4FI7A 2V7NA 3BH9B 4E41B 4LLMB 2Z4QB 5DUBA 3IJEA 3SKOA 4FHJA 4LSUH 3TEUA 3A67H 4WU5A 4NUGL 4XAWH 4RBPH 4ZBJA 3DOSB 1KUMA 1Q38A 4KKAD 2TRYA 5SV4A 1SM3H 2XN1A 2QSCL 3MMEB 5DRNA 2GITA 3RIKA 2IPTL 3GFUA 2NQDA 3C5JB 1D7FA 5B39A 2CK0L 5KBDA 1MY7A 3PNWB 3GK8H 2Q7AA 1KB3A 3DYOA 3QIWC 4J1UB 3MLRH 2QPUA 2EYSB 4QHUA 4Z7UE 5HHPA 3QS3A 4F5CE 1X5GA 4X5QA 3K6NA 3VD3A 4IIQC 3NFSH 3LIZH 4P4KA 1I8AA 5D70H 2DIAA 3GBML 4BK8A 5BZDB 3W5MA 3NCYP 1BX2B 3AG2B 4N20A 2XCMC 5KS9B 4IBLT 4LVOC 1UFGA 3BWAA 3CXDL 3D25B 1QP1A 4NERA 5IEKA 3UPRB 1I3UA 3ZMNA 2PXYA 3W0WE 1IGIH 1L7IL 3KXFB 4YSPA 3IDGA 1G1OA 3CH1A 3N55A 5F0LB 3WTVA 4E42B 4UU9A 4QRUA 2ADFL 4D7PA 3DJRA 4QT5A 4MJ5A 1QNZH 2ZJSH 3QORA 2OS7A 4BUGA 1IBDA 2UX7A 1TVDA 4FQXB 2YQBA 3OG4B 2DD8H 3OGCB 4GXUN 4D8PA 5T1MB 4AW4A 3QPQD 2FIKB 5DEFA 2ZXAA 1FH2A 2Y5TB 4Y1TA 3FTGA 3C6LC 3NCMA 5JDSB 1E30A 5KSBA 3OC8A 1U8HB 1MJ7L 4S2SA 3CLFL 5D7LA 5AW5B 4QRTB 4Y88A 1A0QL 4BXVA 1ASQA 1RHHB 1RUQL 4WI9A 2NY3B 4C83B 2R2HB 4JMXA 3THMH 1LNUB 2NY5H 3OB0K 4G8IB 4GMSH 5CJXA 3ASNB 3PQYE 4QIRA 5MERA 4G6AC 2YD7A 3HBZA 1YC7A 2DM7A 2EO9A 3TN0D 1WTGT 1MCKA 2CM5A 3GSNL 2DIBA 3LV3A 4TMPA 5CS7A 5ABAA 4X5XB 1MRDL 2HMIC 1BVOA 4HJJL 3PIQB 2Z4TA 3A6CL 3JXAA 3QDME 4P2RA 2HVKA 1N7MH 3SD5A 3WUWB 1GW0A 3FB7A 1J48A 4MA3A 4M43L 4HISA 4JFYB 4Q56A 2ZSWB 3B1UA 2AKRB 3SE9L 1VENA 1GGCH 4I9XA 4P99A 4NWTL 4QRBA 2OQJB 3N50A 1Q0XH 3AM8C 3IDJA 2DWXA 4CADA 1K5NB 5JO5B 1DVFC 4YUEL 3ALXA 5T1DH 4IKIA 5L88L 2WLJA 1HAWA 2I60H 4ODWB 5ICYB 1G9MH 5FYJE 3W9EA 3QPKA 4Q9RH 3CFUA 2ZWLT 2HFEB 4H2CA 3VFPA 2QQNH 5J6SA 4PJXA 4TUUA 4HWZA 4YSTA 1FN4A 1F6FB 5CBEA 1MRFL 1TKWA 1SVZA 2XZZA 2DIEA 3KCPB 3IRPX 3MRFA 1T7ZA 1DUYA 1MCQA 3TZVD 3WAJA 3GPEA 2E27L 4OGZA 3KYNB 1M56B 4HG4K 2ETWA 3UTOA 4CVZA 1AACA 4P5TA 1AOHA 4NQDE 3RRQA 5I2IB 5LDSA 1JZ5A 4KK9D 3JT0A 1GGBL 3LD8B 1KJVA 4D9QD 2XPGB 5B3NA 3NCCB 1T1XB 2YGNA 1XH3B 1F3JA 4JKPL 1CGXA 1NFKA 5ECGA 1QHPA 3D2UD 4UTBA 4JRFA 5F6IB 4Y9EA 2WLHA 3ZE0F 1FNGA 1DQML 4ES9A 4YJZL 5K1JA 2FHCA 4MZ3A 5J8OA 4PS8A 3OKKB 3RBGA 3X13B 2WY3B 1BZ8A 3MRBB 1LWHA 1X5XA 2BERA 1U8JA 2YAOA 4FKHA 5AAPA 2IH3A 3S88L 2ZUXA 2XTSA 5B4MC 2CGRH 3QXVA 3B2UC 1CICD 3CVCA 3D4ZA 1CXKA 1RLBA 3R4RA 4NQED 4PCSA 2R51A 3NH7L 2FB4L 4J3OH 1C5BH 1HWWA 2V2XB 3T0EC 2WUBL 3AW5A 3DDFA 4O2EB 2XY2A 5FUZL 1VLXA 3AG3B 3QQNA 4GI9A 3LB6C 4X6CE 3PGDB 4PJDA 1UUNA 3LZRA 5F7WC 5LXVA 4JDZB 2IPKA 2FEEL 2YD2A 2ICEA 2YC1A 4RMRA 5E9DE 5EIIB 1L4IA 1MCIA 15C8H 3IDUA 5AYTA 4JDTL 3B8YA 2F7OA 4Q6IA 4LKCA 1MLCA 3VSTA 5F9DC 1A7BA 1XR8B 4QHKJ 1YMHA 4P9ML 4DVRH 3UTSA 4NNXB 5D1QC 2JK5A 3ZKXC 3FPXA 3VI4B 1JFQL 3ESVF 3KYAA 4NQCA 5ID1A 4LRNL 5JW4Q 5IV2A 1UM6H 3WAKA 4AYEC 4WSGA 4ZTOL 3IRCA 1A7PH 3DTXA 2XV2A 1KDJA 4W9DC 4PRIA 1R5IB 3V0GA 3BEVB 2Y07H 1KCKA 3IPFA 1NIFA 3REVA 5I6XC 2BVOA 1FDLL 3NACL 3E80A 3L4YA 4FXLA 4LNRA 3OPUA 4OBRA 4BZ1L 5HYQA 1RD6A 1N6UA 3AY4C 4ZXBC 1G9HA 1QD0A 1HL9A 1FFPA 5AVXB 2J21A 3TZVB 1CBVH 3T2QA 4DT2A 1NCBL 1FO0L 3M7OA 1BG1A 1YUKB 3WO4B 2ZX6A 3GKWH 5IQNA 1CD9B 2ZSVA 2VDMB 3NJLA 5DS8B 1KLUA 1KPUA 1RZKC 4ZNCD 1A9BA 2GIXA 3QUKB 5JIMA 3RFZC 3N40F 3D2UB 3O3EB 1QA9A 4FQ1H 4A6YA 4DEPC 5A43C 2ZAHA 1EFXD 1WZLA 3D12B 2GBVA 2HKHH 1X4YA 3C6EA 3KPPA 4PB9H 4Q9QH 5TK4A 4NRYB 3DX6A 1Q94A 3KPRD 2O5YH 4KDTC 3QEHA 3PWLB 5C8JA 5IHLB 3WI9A 1OTUD 3FSWA 1XCQA 2PO6A 1B0RA 3VXPA 2Z92A 4YSDA 1CICB 4QGYA 4NQEB 3D8MA 4UILH 5L8JB 1CGVA 4XVSH 3TV3L 1NCNA 1UT1A 1XGUB 4NO5A 2R1XA 4GSXA 5EOTA 2EJ1A 1RZ8A 1UJ3A 2LVEA 1C5CH 5INCB 4DKDC 3PWJA 1YJDL 3OAUL 1F6AA 1UZ8A 1Q9KA 2TRHA 2WMPB 1G7JA 4LCCA 4EMZA 4F27A 2TAAA 1F1DA 1IUZA 4XPTH 1TR7A 4NNYB 4YGVB 3N42F 4WK0B 2EXWD 3MV8E 4Z3EA 3FCTB 4FMFA 1A7OH 2WWMC 1AC0A 3OR7B 1SQMA 1YNLH 4FI8A 4J3XA 5CWSB 2Z34A 1ZTMA 3UTZB 4FADA 3FRPB 4Z7QB 4D0BB 3FQTB 3HC0A 2JJVA 2ZXGA 3MRKA 5E0QA 4CKVX 4NRXB 1J10A 3CN4A 2Z1PA 4ZYKA 3DECA 3H9ZA 4GP4B 1QRNE 2GFBA 4NO3A 1HEHC 4XN7A 3C60C 4XPAL 5A2BA 4MVBD 1N3NA 1EJOH 5IW1A 4IM8A 3OZKA 3VRIB 4KKLC 5IT2L 3QA3B 3TTYA 2HJFA 3BGFC 5DRZA 3D0AA 1JXJA 1EQWA 4LEBA 4LOUD 2WQWA 2P8PA 4X7TA 5JORA 5D4QA 3H0TA 3BVDB 1XL6A 2DW5A 4IOSD 2HT4D 1CFNB 3HG5A 1GJIA 2EIZA 1VIWA 3INUH 4WI0A 3ZLQC 3CVHB 1QFWL 1X5HA 1CBJA 5GRJH 3ALWA 1NIBA 3E7JA 5E5UB 1PLAA 4PJEB 3VD0A 3U6RB 4HULB 2Y22A 3UMTA 3VH8A 5KANI 1J86A 4PM1A 5EOCH 1R24A 4N24A 4N3UA 2OZ4H 2NCEA 4L3EE 4GXVL 4YR6A 1GKEA 3EH1A 3LN4A 4JE0A 4AIOA 3ZYIA 1AG6A 3HLAB 2CDEB 2MQ3A 2VSKB 2PPAA 4MMXC 5IB5A 1L6XA 4NC0B 4OFYD 4OGXL 4N0FB 4PEEA 7CGTA 3MLPA 3BHBA 1EFXB 3TBYB 5BXFB 3WJMB 4BQ9A 1E6OH 4WUUD 4DW2H 3KPRB 3P0VL 4L8SB 3NEOA 1U9KA 4LPUA 1O9ZA 3QIWA 3ZR6A 4PGBA 4MJID 5TGBA 5DHYA 3T3ME 5BZWB 5D2NE 3MUUA 2H8PB 3BGAA 4N8UA 5AKVA 1ITCA 3ZHKA 3VNZA 4IIQA 3RPIB 5F1NB 3VFMA 4ELMB 5EBWA 2DQHL 4NOBA 2NNAB 5GGTH 1T21A 1GHFL 5T3XH 1ET7A 2VN5A 3IJHA 5IGXH 4XXWC 4J3OG 4DO6A 2PWHA 2ZWYA 2J57A 4WI8A 3IK2A 4UM8A 2YA0A 4JHUA 4OCWL 1FZOB 4Z3TA 1J8RA 5JXAL 2HAZA 2OCCB 3GRWH 4YSQA 3MRNB 3GLAA 1HHIA 4G1MA 1NUFA 4JPWH 1MFBL 1BYNA 4PWGA 2Q3XA 3VQ2C 4W9EC 5EH1A 2X3AA 1FBIH 1FUNA 2Z1KA 5C9KA 5IOPB 1LO5B 1KJ3L 5DJ0B 5TDNB 2FL5A 5I1CL 4AYFA 2CO3A 2PUQT 4ZPTB 1YO4A 3C6LA 5E8EB 2WBJC 4S1DD 3ZHLA 2BSEA 4GEIA 1TYRA 4ERSH 2J1YA 1UGNA 4NYLB 1JN6A 5F0PB 3LXUX 4AITA 1KIPB 5I15L 3PABB 3FFCD 5DZLA 1JRHL 2YKLL 1KYUA 1KV3A 1CK0H 1KYDA 4OZHA 4XB3A 3QUZC 1QBLH 2XVBA 1PYWA 3RQ3A 4FFWD 5T8IA 1NJ9A 3W2DL 2V3FA 3HMXH 4N4YB 5A2FA 1P7BA 4OT1H 5IBLD 1JYWA 4N2EA 4BZ2A 1M6UA 4IEFB 5DUML 5HI5C 4FNSA 1TTGA 1F4XH 3TNNA 1A9VA 2VLJD 3FNKA 3GBLA 1LDPL 5C70A 2AABH 1OAKL 2VDNB 4NI6A 2NMSA 4J6RH 2YN3A 1HZHL 3MJ8B 4JKNA 5HGHA 2ATKB 5D2LA 3OMZA 3AM8A 4WUUB 2V0AA 4CMHB 1CD8A 4PJ9D 1DVFA 5GISL 1TTFA 2HLFD 5TE4H 2PYFB 4MRBA 4ZRGA 1A4BA 3AXLA 2NOYA 3MRQB 3QCVL 2O6PA 5C0FB 5AYUL 5GGQL 2BIIA 4QTHB 3GUTA 2GJ6D 4W6XB 5T1KA 1HINH 1MCDA 1KJMA 3O2VH 3MCYA 3ATEA 3TYGH 4QTFA 2FSDA 4G5AA 5I9QC 1AZNA 5G5DA 1YEDA 2CRZA 5E6YA 1DL7L 3Q8EA 3VXNA 1M9WA 1SN5A 2X05A 2MH4A 3QFJE 4OIIH 3O3AA 1WD8A 5BPPA 3S3DB 4GAFB 2J73A 2PWEA 1QBBA 3EFFB 3WY1A 4E0RB 2QFPA 4R26H 5DWUL 2M83A 3EOBB 3P2BA 5DC9B 2V5TA 4KZDL 3WFEH 1TJMA 3OKOA 3WJJC 3F83A 3C2SA 4IBSA 1HL4A 4BEIA 3GSUA 1MLBB 4BJLA 4ZZFA 5L9DL 4OM0L 4R6UA 3P4LA 4F2ME 2B08A 4OZGB 4ZMPA 2F15A 3IXTA 5C1MB 1SJEA 2VLLB 4QJ5B 5ICZB 1KCSL 2J8HA 4DESA 1ZVSA 4U6VH 5AZ2L 3V4UH 4QO1B 5G55A 4PJCA 1EAOA 1N59B 4K7FA 4CILA 3EHBD 3ZE2E 5T33H 1XGQA 1XSIA 3V6ZB 2RGSA 3B56A 3HNSH 4NZUH 4K8RH 3RUGA 4XNZB 4NN7C 2J2ZA 3FFCB 3L9RB 5JOFA 1KLGB 1OCCB 3T0EA 4WAFA 2E4FA 1RUAH 3QNFA 1N0LB 4ODHH 1NEZG 4PBXA 2DQEH 4BFJA 4QRRE 2Z3FA 4RFOL 3F2LA 4ZFGL 5IQMA 1JNLL 4JG1L 4YAQB 2FQGA 2OXHA 1QNIA 3HR5B 1HE7A 2W07B 5E4EC 1AQ8A 2W92A 3BP4A 4P4KD 2BY2A 3QQDB 2COVD 2I7SA 4LU5L 2VLJB 4CNIB 2CMRH 5FM8A 2VDPH 4UIMA 3WENA 5BMFH 5D1QA 4WKZA 2LVCA 5DJYB 4CBPA 1Z9NA 4TN9A 4O58L 1BD2A 2PXYD 4ETQB 1R0AH 3K72A 3I02B 1C16B 2XETA 4PJ9B 4UV7H 3EJUA 2MCMA 1CXHA 5I1GH 3WELA 4HPOL 1TJIH 3MCLL 4OIAA 2BVQA 5C0IA 1MCHA 2RALA 4H1LB 1WIOA 2GJ6B 2W65B 3I75A 1PG7W 3H9HA 4GLRI 3U9UB 3ORJA 5FW8A 2BDNL 3TT3H 4MZIA 1AQMA 1DCLA 3VE0B 5F0JB 4QF1A 1U8LB 3AY4A 3UJIL 4ZXBA 3QQ3A 1FAIH 4UQ9A 4YPGB 3RZWA 4E68A 1JZ2A 4JO2H 5CGYC 4IOFD 4FOMA 1BYPA 2VXQA 3RVVD 1HI6B 2BP5M 4L4JA 1J1PH 1SZNA 4M1CD 3P11H 2R0LL 5DJZA 2WTRA 4H8WH 5FYLD 4NIKB 5EF1A 4YHKL 3VU2A 1EDYA 2ZPKL 1JPST 2IADA 3K8MA 3CHSA 4MXWL 1R5WA 3RFZA 2D31A 3TJEH 4U49A 2VL5B 4MZRA 3OD3A 3MGOB 3HJEA 3MLXL 1CGTA 2XG5A 1KTDA 4NZDA 4OLZL 2APFA 1UM5H 4UT6A 3DJSA 4IDLA 4KDTA 2V7NB 4XCFL 2VDMH 5FGCE 3T2NL 1OCWL 1MUJB 1X9QA 2R2BA 3IJEB 4IHOA 5DUBB 3SKOB 3U0WL 5CF3A 2VJXA 3EHBB 1HXYB 1PAZA 3K4ZA 1PZ2A 5JYMA 5E99L 2JKXA 2I9LB 1KB5A 1WH0A 1E9OA 4U4IA 3EH2A 2DICA 3MRPA 1RIVL 1YVLA 1SY6L 3OMAB 4HCRL 1QRKA 3BDYL 4YWGH 3O9WD 2NT1A 5DRNB 2GITB 2YAPA 5I8CB 1D2OA 4PREA 4LSVL 1HXMB 4V1DD 2XVKA 1WRFA 1FC2D 3MRRA 1IU1A 4GKSA 4UT9H 5HD8D 4QXWA 3DTUB 4QHUB 2LTQC 2LFGA 4QXGL 1INEL 3Q5TA 4LOFA 4P4KB 3WYRA 2WSPA 1R19A 1T1WA 4PPTA 2ZCHL 4P2QE 4HS8H 1NMCB 1S46A 3BWAB 4NIYE 4PJ5D 1E4KC 2O6EA 3BN3B 3IMSA 1W8NA 3MR9A 5IEKB 2MFNA 3BZFB 3PU7A 3C60A 3SBWA 2PXYB 3NZHL 1Z66A 5IM7B 3IDGB 3CH1B 5F8QC 5E2UH 2IBZX 5CLYA 1T4KB 3ULVD 4UU9B 4QRUB 2MOGA 4FXKC 4QT5B 3JWNH 1I85C 2C8NA 4MJ5B 2UWEE 4XPBH 5IVOA 4MKTA 1J5OH 4GAGL 4D8PB 1S5IH 2XFXB 4QAWA 1SUJA 5DJCA 5F44A 2R69L 2WXIA 3L8QA 5C0JB 1UVQA 1EGJH 4RSYA 3WUWG 5KVEL 4MYPA 2GJJA 1J0HA 5ANME