1UT2A

Afae-3 adhesin from escherichia coli
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
139
structure length
138
Chain Sequence
GSFTPSGTTGTTKLTVTEECQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCNARQVALKADTDNFEQKFFLISDNNRDKLYVNIRPMDNSAWTTDNGVFYKNDVGSWGGTIGIYVDGQQTNTPPGNYTLTLTGGYWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AFIMBRIAL ADHESIN AFA-III
publication title High Resolution Studies of the Afa/Dr Adhesin Drae and its Interaction with Chloramphenicol
pubmed doi rcsb
source organism Escherichia coli
molecule tags Adhesin
total genus 27
structure length 138
sequence length 139
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2003-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04619 Adhesin_Dr Dr-family adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1570 Mainly Beta Sandwich Immunoglobulin-like Dr adhesin 1ut2A00
2BCMA 1USQA 1UT1A 1UT2A 2JKLA 2VERA 2W5PA 2IXQB 2JKJA 1USZA 1RXLA 2JKNA
chains in the Genus database with same CATH superfamily
2BVOA 2OI9B 5GZND 3FUFA 3NZHL 2EXWC 4HIEB 1R46A 1F4WH 1QACA 3GSOB 1IC7L 1S2EA 2X70B 3UBFA 5JDJA 4IBVA 3CHRA 3VWKD 4WU5A 5KN5A 4IOIA 3WMQA 1P1ZA 2P49B 4PGZA 4V1DD 5IBLD 5FA4B 1J8KA 1A9VA 1C5DB 4TUKL 5CSZA 4PV9A 5C0AE 3GEFA 3FB5A 2J2ZA 2MKWA 4PJGF 2PWGA 4MCYB 4DP0X 3HN8A 4P2QD 4MD4B 4FQXB 4WKZA 3TBCA 3O6KH 1ZGLA 2BW4A 4LKXA 3ARWA 3D0VB 3HN3A 3V4PA 4YFLF 4DF9A 3AUVA 4PR5A 2R9HD 3NESA 2AERT 3OAYK 4WFEE 4DK5A 2Y69B 1UCTA 3MLXH 1CXLA 3AU1A 1KBGL 3S5ZA 3DI2B 2VR8A 3RWEB 2AS5M 3ZQWA 1B4JL 1QSED 2O5XL 3HPLB 2R0KH 5FC9A 5HSFA 3WL9B 3VE0A 4ONGL 3QAZC 2CO3A 2NY7H 4WI4A 2BSSA 5AOLA 1VFBA 3IDMB 2NZIA 4IIQA 1XIWB 5FHBL 4ZFOB 3EOTL 1LEGB 1QA9B 1WT5C 3L9RA 3QCTL 3VH8G 5T3ZD 4JM0A 4H8WL 4NQDD 4DO4A 5TH2A 3PL6A 1K4CA 1YEHL 4GYBA 3SKJH 1JD7A 5I6KA 4NQSB 4PJBF 3ZE2B 3QUXC 3VFPA 2R2BB 4MB3A 3QS3A 3PHQA 4BK5C 1NAKH 1ORQB 1X7TA 2OL3A 5BZZA 5SX4I 2FIKB 4GY4A 2Y7SA 1W8OA 5IHZA 2GY5A 2YUXA 2AGJL 3MLXL 4L4VE 5JR1L 1J8HA 5M94B 1UB6B 4OF6A 3O2VH 4TVSa 1JHTB 3EHBB 4F33A 5BRZE 2GI0A 3DX6A 3FT2B 5DC2A 4ODBD 1I3UA 1L7IH 2HJLB 2R0KL 2TRYA 3D3VB 4GKLA 3FB7A 4JZOB 5TFSH 3WEOA 4UYQA 1H6FA 5C0DA 4TSCL 3VYPA 1LP9B 3GEWB 1TJGH 3FO0H 1MG2C 2NY7L 1X9LA 1XL4A 4MA7H 3ZY7A 1IVLA 1IAII 3GSNB 3T4YB 4IRSD 4YZFE 1D7BA 5LGYA 1CGYA 3HZKA 1S5HB 1T20A 4OTXH 3SKJL 1I8LC 1NCJA 1J87A 4G6JH 2HJFA 3LHPL 1I7UB 2DLFH 3HE6D 3QYMA 4UNIA 5AVRB 4IJTA 5EWIH 4TYUA 5EULV 5EU6A 2PYFB 3IFLL 1KJMB 1CDHA 1AI1L 1HHHA 3VXPB 3V7AG 4PJEE 4AQ1A 2E7LA 1F3JA 5LNDA 2KS0A 2PTTA 4MQXC 4TQHA 1EHNA 3C12A 4ZO9A 3W9DA 3D7PA 4UM9B 1I7TA 3DX7A 4P5TD 3QAZB 2GG1A 2G0LA 1JUFB 3UTSA 4JRXB 2Y24A 4Z7WA 2I9LB 2F7PA 1R3IH 2EE2A 4B9GA 2FYYA 4P2AA 3J27A 3TN0D 5FLUA 3WV0A 4OAWB 4DP1X 5AAPA 2CA3A 2E7MA 2YD8A 3FO0L 1F4XH 2VJXA 3BZ4A 4MA7L 3GZKA 3EFDH 3OGCB 4JFQA 1GJIA 3PGDA 1CGSL 1K6QL 3F6LA 1V3KA 3QUXB 4YR6B 5CGYC 5K1VA 4EUPB 2DD8H 2DM4A 4WEBH 3DVIA 4AV0A 3W82A 4U05A 3Q43A 5D9SB 5HJGA 4CNIB 3G6AA 1KBKA 4IK6A 4UZGA 3B5TA 2C9RA 4MWFB 1N26A 1WZKA 2F2HA 3DI3B 1EFXD 3VXRA 5ICYB 1SJXA 3OX8A 1U3YA 4PCKA 3PFUA 1UEMA 3TVMA 2WUBH 4NLAA 2YQBA 4R5XA 4BQ6A 5ICZA 4KO7A 1KPUA 2X3CA 4YSPA 2EUVA 4KV5E 1TTFA 3MRPB 4LPYA 1SOKA 2NY0D 2ZXBA 3FSWA 3QIWA 4MS8C 3RPKA 4JHBA 4UINH 3OKDA 3L4ZA 4JPQA 4FZ8L 3V4PH 3VRIB 2WY3B 4WRLA 1RJYB 2N56A 5IEKA 4JM4H 2G9HA 2O6PA 3C6SB 4ZW3A 1KLUA 1Q0YL 4D3CH 4U1HB 2E74C 2VDOB 5J3HD 1FHGA 2VRQA 3HC4H 3BN9D 2OS7A 3F8UB 4OCYH 5INCB 1PLGL 4C56B 2CSPA 4N0FB 4GPVA 5DRNB 4UQBA 9PCYA 1V7NL 2P9RA 2WANA 4GQZA 4I3RH 2J57A 1RZJH 3GSWA 3BUBA 2OZ4A 3RWCA 3E1F1 3KJ6H 3SE9L 1JXKA 3RBGA 4FA6A 3N43F 5DO8A 3MV9E 3ZRCC 1WJ3A 1QLEH 2WUBL 2HJKB 1E9OB 5FX3A 4XB8A 2WNKA 4DWHA 3MOBL 3IMBA 1MFNA 4HLJA 5A2JH 4YHZH 4GJTB 4G8GD 4LQFL 3SDCA 4UIMA 4WWKC 3EO0A 4MFHA 1D6VH 5IREA 4Z5RB 1YEJL 4Z9KB 2EE3A 4K23L 5A7BA 4XPGH 4IBLT 2OL3H 4U1MB 2AQ2A 4WFED 2IH1B 4H7VA 2EVGA 2R8SL 2IDTA 5HI3D 4HSAC 2FSEA 5KS9F 4JGNA 3LRKA 1WBXA 5BW7A 4ZX3A 4D3CL 1NFIA 2P28B 5KZCB 2BJMH 3X13A 1FPTH 2Z93A 2J1YA 1XXDC 2WWNA 4J3OF 4JY5H 2QV4A 4DW2H 2W9EH 4X8XA 2Q2LA 4PJ7A 4XN7A 4B3EA 3FFDB 3HE7C 3TL5A 4LLMB 1J8HE 4IBUA 1EXUB 4I3RL 6PCYA 4C83A 3STLA 5CD3A 4FYQA 1IGTA 1BFVH 5CJOH 4M8VA 3G6JE 1BJ1J 1JF1B 1KGIA 3PWLA 1H3XA 4OCNC 2GBVA 2XRAH 3NVQA 4TSBH 3TXAA 3VWJD 5FM5O 4HT1L 3FN9A 3LRSB 3NCWA 4AGOA 4AYSA 3L95B 3UYRL 1JZ6A 2VMEA 1KLFB 1T1YA 4S11A 2ZCHH 1DVUA 2J7LA 4RA3A 5HPMB 5J4MA 32C2B 4XPGL 5AVXB 4J3VA 5HJ3B 3HAEG 5JW4N 3ZSSA 2OSXA 1HOEA 3KLLA 4WI8A 5KTEH 3RZCD 4B50A 2EIZB 3D2TA 4PYGA 5EG6C 1D5XA 1RZPA 7FABH 1FFRA 4KI5E 4UF7C 5DA4A 5BRZD 3PQYB 3C5JB 2A9NL 3OLGA 3S34L 4LAJH 2BJML 4WHYG 1FPTL 1MZYA 5EU6E 4XP9H 5GJTH 2CBMA 2F6AA 4JY5L 4DW2L 2EVIA 2W9EL 4FC3E 2E0PA 3M1BA 5GGRY 4FXKA 4LFHG 5JZ7C 3FL7A 2GC4C 3F7RA 4G80B 3FH8A 3UTZB 1NGZB 2XDHA 3ZMNA 5CJOL 2XX1A 4DP2X 4K5MA 3UTSE 1RZKH 4RH4A 3D87B 3II2A 1S9WB 3MJWA 3GMRB 3SDXE 2EVFA 4TSBL 5DJYB 3QJOA 1NCGA 1L4IA 3NMEA 4X7TB 3HG5A 2DYSB 5SWZA 1CBJA 2QVKA 3L2NA 1AGDA 3DMMA 4ODXB 4PREB 4MAZA 4OM1L 4Z76B 2RAMA 1U3HD 5F3HB 5JW5A 2X09A 1KXTA 5K9KB 4R4BA 2Q6WB 2XXFA 1R33A 5KTEL 1O6TA 4JRFA 3GXNA 1J0HA 4Z78B 4FQHA 2BIIA 4WUKH 7FABL 5E8PA 1P4IH 2VQ4A 4GH7B 1PDKB 4W4NA 2EZ0C 4YGAB 3HE7B 1CIDA 4A7GA 3ZDXF 4O2CB 1JZIA 3QJFA 3VXRE 2V37A 2FHCA 2PWDA 2OV0A 5B1BB 3VI3F 3F7KA 4JN2B 4ISVB 1CE1L 3CDCA 3O6FC 4TPRL 4P5MA 5FHAH 3DUSB 4NUMA 1JPSL 4KK6D 4X8JB 1JYXA 3PWJB 2ED7A 1OHZA 1PU0A 1NCWH 1UA6H 3C60C 4LBAA 4FHBD 5C0RH 4GSDH 3T08A 5C9JB 5DHVA 1T1XB 3BVDB 3WSQL 4HC1A 5KSBF 3P3SA 1BFSA 3TLRA 1TQBC 1XEUA 3QEHB 1N9PA 1ZK5A 2ZOTA 5DF0A 1AZNA 1MEXL 5DVOA 1YMMA 4N22A 5KVFE 5HY9A 4HK3N 5GS3A 1YQ2A 2OZ4H 8CGTA 3QIUA 4TMPA 1Z9SB 3FUJA 2DWEB 3QARA 4GRWF 4XCCH 2ZOOA 3PREA 3BAEL 4NNYA 1P4IL 2OJ1A 2CRYA 4WUKL 3TWCH 3VFUB 3QWOB 3DOIA 1V5JA 1H8LA 4TLSA 1AQMA 2QPUA 2XG4B 1RL1A 5KYXB 5IJVB 5KBMA 4F7KA 3TS8A 2ZYSA 3NIGE 1O6VA 1QEWA 3L7FA 4OV5B 1PNCA 3BAJA 1HL8A 3BAYA 3BAIA 3T3PB 3U2SB 1ZA6B 4XXWA 1KYDA 2VDMH 5DJXA 3JWDC 2P5EE 4PP2A 3U1PA 4D7PA 2BSTB 2HH0H 3EO1B 3MCLL 1UA6L 2GBUA 5BVJB 1H9VA 1JDCA 3CXFA 5DJ8B 1FNFA 1S8DB 1T7WA 1M71A 1VADA 4L9LA 2OX5B 1X44A 1K8IA 4OCXL 3ZL2A 4GAFB 2WBWB 1T3FA 5IJCC 1FRGH 5FYJD 5HYFA 1O5PA 1XCTA 3SDAD 1BQHG 4EDWH 2P80A 4C58B 3DTUB 2OZ4L 3MV9D 4GQ9L 3REWB 3ZBMA 4PJ7E 1M6OA 4XCCL 3IDNB 4G8AC 4HIXH 5EU3B 2XQBL 1F58H 1C12A 2E4FA 4H8PA 1TTAA 5GRXG 3OXSB 4PGDA 5B3SB 3O6FB 4OD3L 1CG9B 4KY1L 1CFSA 3FT3A 5IESH 1UWXH 2K4WA 4M7JH 1UHVA 2VXVH 3C60B 2VE6B 3D07A 1DQDL 2XUWA 3HG3A 4PTUB 1U41A 2ARJA 5LCVA 4HIPA 3Q01A 3M46A 3FW6A 4KMTH 2QADD 4NC1C 2XA8H 2OSWA 2HH0L 2CRMA 1GRWA 4WK0B 2YS4A 3SQOH 3T4AB 2BO0A 3EYSH 1I85C 4FD0A 4HCGA 5GRJL 2VLJA 2P24A 1DFXA 1FRGL 1QQDA 5E1QA 4TNVF 4GSRA 4KKLD 5T5NG 4XMUA 1B3JA 2JVUA 4NO0D 3WEBA 2ZXCA 4HUWA 3HNVL 2FWLB 5JO5B 2QLVB 4HIXL 3LEXB 3T8XB 4PRNA 1XH2A 1WD9A 1YUHB 3UBGA 3C8HA 2NXZD 1CICA 4JFSA 3IPFA 3D50A 3EYVA 2DB8A 7PCYA 3B56A 3W9EA 4YDIH 2WBJC 3MUGA 4M7JL 5BS0E 2VXVL 2H4EA 4LFHD 3HZMA 5L4FA 1TFHA 2VDLH 5KYYB 4KMTL 3B2PA 4NFDA 1U36A 1AR1D 2XA8L 3H7BB 4HFUH 4KI5D 4WFHE 3ZZSA 1N0LA 1JZHA 1MCRA 1YNTB 1Z9MA 3ROOA 3FO9B 4PP1C 3SSGA 2VERN 5DHEA 1IKFH 4WW1B 5I28A 1UWFA 3EYSL 3GUTA 5DT1H 3B9KD 3VRJB 4DNLA 3QQDB 3BZFB 1NPNA 2YD7A 4RRPG 2O6CA 3ZE0F 3C5ZA 4LARH 3TO2A 3QDAA 3EKCA 5EIIB 1BYPA 3R7RA 5I16A 3JV6A 4M03A 1AHKA 5D96C 4P5KB 4P57A 3EYQC 4W9CC 5DHVH 4X4XB 3KH4A 4X80H 4HC1H 4I3GA 3ARBD 3K6SB 4EVNB 4GQRA 2ZONA 5T1KB 4KUCF 1UD5A 3O9WA 3TNNB 5D7LB 5LXGH 4MXQC 3GPEA 2VDLL 1P5UC 2WQWA 4S1RH 5F7NC 3SGDI 1DN0A 4QXTB 1U33A 2OW6A 3FO1B 4CJ1A 5HHPA 1YMME 1IKFL 2LVEA 4ZMZA 4ZUSB 3DIFB 3T0WA 1A64A 2EH8H 4GRLC 4IOFD 5ECGA 2GJ6E 3JVFC 1GOHA 1UXLA 2IAAC 1FBIL 3BUPA 5FGRA 4WNJA 1AO7B 3FONA 4LCWA 5H2BB 1A5FH 1J5IA 4OGAC 5L2JB 4B9CA 2NX5A 4N5ED 5EU4A 2PP8A 3CZUB 1Q9OB 3NCJH 4LEEA 2VJ0A 3HB3B 5D4IA 2MPAH 2WQVA 4MSWA 4ZODA 2AV7B 1KIUA 4BUGA 2WBJB 3T65A 2D4DA 2XCMC 3V52H 5G55A 2GIXA 4XT1C 3UYOD 2NY4C 4UI2A 1H15A 3B9AA 1GGIL 4G7RB 4BYHA 1OAQH 3PGCA 4HBCL 1AXTL 1SBSH 2DQHL 5LXGL 3H0TB 5E2WL 3N40P 3L1GA 3QXWA 4IGBA 4U1JA 2F74B 4WAFA 2ALWA 4O2FB 4CGUB 5DD6B 4KKAC 4ETYA 4FNPA 3CXDH 4GQQA 5D7JD 5FKPB 5HHMB 2FR4A 2YLHA 1ZHNA 3JWOL 2VH5H 4NCC1 4JFVA 4BUHA 4HIJA 1P4LB 3VQ2C 3PWPB 5D96B 2PWFA 1A5FL 1E5CA 3ENEA 4LGRB 1KEGH 3BHBB 3IETB 1CT8A 3T0XA 4OBSA 3VX0A 4YSEA 2GCYA 3QUMB 2FTAA 3S3JA 4XBMA 1T04B 3TC9A 2IFFH 4RGOL 3FYIB 3V52L 1XR8B 1EDQA 4JJHA 1P5UB 2ZXWB 1GYWA 4NUPA 4DAGL 4KBPA 3CHPA 1DANU 2JIXB 2ICCA 2C34A 2VLJE 4PVBA 2VIRA 3ZDWA 2CBTA 3SY0B 3MJ6A 1T0NB 1DVZA 1BOGB 3D0LA 3VXME 3LEYH 4OT1H 1D9KD 1UZ8B 2VH5L 3ZHFA 3LV3B 3PV7A 43CAB 1CK0H 2V9RA 2E9GA 3IJHA 3REVA 3TJHC 3V5HB 5KSAA 4ZRGA 1T0PB 1KB5A 3S3DB 1EUTA 1PJ9A 3NJJA 4QAWA 1DSYA 4U3XA 5D4HA 2WLHA 4HK0A 1GGYA 5DJDA 1GGBH 1RUKL 4AJVA 5IVNA 3IE9A 5MP6H 1EVTC 4YZFF 4E36A 5KUKA 4QPEA 2NY4B 1RK0B 5J6GB 3FN0H 1EJ8A 1KCLA 2R1XB 1ZKAA 4XOEA 5ICXA 3WNOA 3WEMA 2IFFL 1OANA 3F84A 2VRAA 5JW3H 3OD3A 5MENE 4WJ5A 3PS6A 2XT1B 5E94B 3MRQA 3KH3A 5IIEB 1W0WA 1RU9L 4M02A 5AENA 3HAEB 1CN4A 4JDEA 4PMEA 4O58H 4PJEF 4KXDA 3CVBA 3MHZA 4HWEH 5GSRA 4CJ0A 2CR6A 4RX4D 1ZK9A 3IM1A 2HLFC 3EXLA 4R83A 1S3KH 5SX5H 1CK0L 3BSZA 5BS0D 3B43A 4F8NA 2OKMA 1B0RB 4XN8A 2H9GB 2V3DA 3NJGA 2RA1A 5EMYA 4CC1A 1YNKH 2QQLH 1WPCA 2KPWA 1JZFA 2R56L 1DVXA 1HILA 2BZDA 2IF7A 3MX0A 2PCPA 4WFHD 5HHVH 2Q76B 5DVPA 1AGFB 1H3TA 1RJLB 2DQEL 4HIEA 4YAQB 3GK8H 4NQCE 2X70A 3IDIB 4N2OA 1FG9C 1I1CA 4ZD3H 4XB3A 5JW3L 5FA4A 1A3QA 2HT2C 1C5DA 4QTFA 4LDLB 5A40E 3KPSA 4U6XB 1UENA 2N0KA 3UEZA 3CAFA 3WD5H 2B1OA 4MD4A 4FQXA 4DUVA 4ENZA 1HJCA 4IKKA 4UT6A 4UQDA 4O58L 3D0VA 3TX4A 5L6YH 3SEPA 3QDHA 2QR0B 3BDXA 1NGPH 1QPXA 1R3JB 4LCWE 2YC1B 1NAMB 2NX5E 2V8MA 4KV5F 1LTXA 4YC2C 1PQZB 4ODHL 5AB9A 1YNKL 4P3DB 1UUSA 3HPLA 1ZD6A 1URLA 3WL9A 1CFBA 5DJ0A 1XAKA 5GGSY 2NR6A 3GK8L 3L4WA 3IDMA 1XIWA 1CI3M 4HJJH 3K6IA 1G94A 1LEGA 1QA9A 4ZD3L 2GJ6D 2VO8A 2BK8A 1H9DA 3G04A 4RGND 1YEKH 4NQSA 3WD5L 2R2BA 3TTYA 3FT1A 3JV0A 3T8MA 3K91A 5DU7A 2FIKA 4V2BA 3IGFA 3EBHA 2ICEB 1NGPL 4PLKD 4UOZA 1MXDA 2H2SC 1UB6A 1NC4B 5A2FA 1G7MB 1OAKL 1JHTA 1LQSR 4PRPB 5KOMC 4BQCA 4DP4X 3TFKD 5KBNC 2XPGB 4N0UA 2HJLA 3GJFK 5EDXA 3BP7A 3D3VA 4JZOA 4PEEA 4P5SA 3ARDD 2IBZY 5I6XC 5D1ZD 1BW8A 1A7PH 1LP9A 1NC2B 2VW6A 3ZR5A 3HBGA 5KVDH 4P4KD 1U8JB 5LWYH 4Z18A 3NUKA 3I9GH 2WWKT 4HJJL 5FUOH 3T4YA 4YX2H 4F2FA 1DDHB 4KKNA 4P49A 2UZYB 1RIHH 1S5HA 5CZKA 5CCHE 3SCMD 1KB5H 1YEKL 1YY8A 3IXAB 4AT6A 5FR3A 1BQHB 2V4LA 3IU4H 3LZLA 4R26H 3G6JF 3NAAH 2EEXA 2PYFA 1XAUA 4OJFH 1KJMA 1CD1A 3VXPA 4YC2B 1WVZA 3EW3B 4K8RL 1U21A 4L3AA 4L23A 1SDYA 5CZXC 2ICES 1N18A 2UX7A 1CTOA 3LH9A 1OTSC 2XTSA 4I2XA 5D2NC 1ZANL 1JUFA 3M6DA 4PSRA 4JRXA 3THMH 2I9LA 2BINA 3VXMD 4H88H 2VLRB 2HTKD 1IIIA 3GTTA 2DIAA 4KI5F 4R7DB 1TNNA 1WT5A 4OAWA 1FC2D 4YMPA 4PRDB 5KVDL 4YO0A 4WO4C 1FZKB 3KLQA 3I9GL 2DWTA 2LTQC 3AS3A 3FTWA 3QUXA 4GP8B 3DWTA 4HK3J 5H37G 4YR6A 1D5IL 3V0JA 3ZTEA 3CBJB 3BSZH 4EUPA 1RIHL 5IMMA 4WWID 4BK5A 1C7SA 2IPTH 5D9SA 5GS0D 3X3GL 2YD6A 1J9RA 2AQNA 4JPIB 1WSST 4MWFA 1KTKE 4R26L 1BQKA 3NAAL 1E6JH 4P46D 3B7RL 4Z7WF 1X9UA 3AXIA 1OV8A 4OJFL 3SDXF 3UDWA 5ICYA 2EYSB 2BP5M 1F2XK 3P30H 3TOPA 1NBYA 1TTRA 1KGXA 3KL0A 4OIIH 4HUXB 4JDZB 2DQUH 1QFHA 2UXTA 3LRLA 1MCPH 4XC3H 5AZEH 5FWRA 3ZTJG 5T1JA 2P5WD 5ACMA 4V11A 3GJFB 4KK8D 3QJXA 3TPUB 3MRPA 1AYOA 2XN9B 3THML 3T8VA 1J9CT 3MRDB 3G9AB 3OAZK 2OR9H 1JHLH 2WLZA 1NBQA 2CHNA 4GT0A 2YMXH 1RJYA 5DO2D 3V0DA 4UT7H 3DUUB 3UJTL 3C6SA 3WJJC 3NEOA 3QDJA 5H4YA 1EQWA 2Q9OA 4OFQA 2K6YA 3BSZL 4JPVL 2QHRH 1OCOB 4N6RB 4C56A 4AQ8C 2DOCA 4LL9A 5DRNA 5DUBB 4XBPB 3L8QA 4Y7OC 3QNFA 5C0FA 4NQCD 5JUEL 4OFPA 1AKPA 4YXKH 4DVRH 4XPTL 5BMFH 3D9AH 3IJEB 3RILA 5D2NB 1E40A 2YFOA 2GJRA 2HJKA 2DQUL 2JI3A 4F5CE 4X0NA 5ALCL 1PF3A 2VN7A 4LSVL 5DHYB 4AM0B 4XC3L 5GQBA 4E41B 3QDMB 1ZLVH 3OV6A 4P2YA 3CHOA 3F7VB 4X6CE 2HX9A 4WO4B 5TPWL 3FQNB 1A6VH 4GXFA 2LTQB 2NY5C 2YD4A 1HDMB 4HWZB 2IH1A 4J3XA 2Z64C 4FCHA 3ZE2E 1R5VA 4DKFH 5C07B 4GKOA 1DL7L 4MTMA 3QJZA 1G7PB 3NIGF 2AQTA 2J6EA 4OZFA 1FFQA 4HPYH 4JKNA 3DROB 3D2UB 2VDQL 3D5OF 3X11A 15C8H 4OVUA 4NM8L 1EXUA 2BRQA 4WI9A 3WNMA 2QDVA 1OD7A 4GG8B 1ORSA 4YXKL 1N59A 4NZFA 5E8NB 5DSCA 3V4VB 3PRZA 5B8CC 2Q8BL 3QA3B 1JF1A 4FKKA 1ETZA 3QEGH 5DI8B 1IGCH 2M83A 3LRSA 1LP9E 4ZTOH 3L95A 4HIQA 4M3HA 1TCRA 1KLFA 4PS7A 4JRYD 2AJVH 1YN7B 1G9HA 3LDBB 1AP2B 1KB9J 1X9QA 2OP4H 4PJ7F 4GG6B 4F1ZA 1H5BB 1UCBH 5HJ3A 4JM2D 4E2OA 5F21B 3L9BA 5D1QC 5H35A 2EIZA 3OAYH 2VZOA 1ZVHA 5E7FA 1A9EA 4DKFL 3VFSB 3HMXA 2O61B 3PDDA 4KXZH 3C5JA 4QYAA 4HPYL 4UQEA 3VSUA 3F64A 1BP3B 1VACA 2DYPA 2HT4C 4D9LH 2XWZA 15C8L 1OGAB 1YNLL 5T1LD 1CBVL 3S37H 4JKMA 3UAJD 4F37K 1EGJL 4G80A 3U9UB 2IC2A 2WZAA 3UTZA 1NGZA 4P9HH 4DGVL 5HI4C 1IM3D 4JNXA 3VX1A 3K2KA 4JRXE 4FEIA 2CE6A 1S9WA 4ZFFA 3N0PB 3QFDB 1IGCL 5DJYA 1ZA3B 2YFNA 5IB3B 4EUPH 2BM3A 4X7TA 4L37B 5GISH 2CBOA 4ZTOL 2R4SH 2WSDA 3F65A 4OJYA 4QKXB 1KGJA 5F7EL 2AJVL 2H2PD 4OZIA 1E90A 4ODXA 1OP3K 3WNPA 4Z76A 2OP4L 5F3HA 1UCBL 4UZSA 5K9KA 2VABB 4UU9B 4BEIA 2W80C 4Z78A 1TJIL 3VB8A 1N6UA 4HJEA 4M5ZH 3UBHA 1NDGB 5BVPL 2ED8A 4O2CA 5K9OB 1MRCL 4XTRC 1YVLA 1A65A 3BMWA 4D9LL 1RURH 4LHUD 4JG1H 5I0YA 5F7MC 4JN2A 4XPHL 1NANH 4ISVA 2YXVA 3U7YH 4DPBX 5B8CB 3S37L 1BXUA 4Y16C 3DUSA 4X8JA 4N8CH 1XF3A 4ZS7H 5I8KH 1Z5LA 1VFAB 1SJHA 2ZQKA 2NY3D 3ILQC 2HFEB 1NPJA 4R7VA 5C9JA 1YA5A 1T1XA 4UDTB 4XWOD 2HLAA 3WNNA 4GQPH 3QEHA 1YUKB 3SY6A 5IVZB 3KPPB 4YIQB 5D1QB 1QNZL 4BSWB 3VFWB 2ICWJ 3PUCA 4R4FH 1EFXA 3PXLA 1BLNB 4PJFB 2FAUA 1Z9SA 4W81A 2DWEA 3E2HC 3NABH 4PY8J 1L9QA 5KANG 3VFUA 1K9TA 3FYEB 2ESVB 4AXWA 1FVEB 1HWWA 1AGEB 1QFUL 2VR5A 2W92A 5IJVA 5KYXA 3TV8A 4U3HA 4PLJD 1RURL 5B39A 1G7QA 4K5NA 1RZIB 3FSOA 1Q9WB 4OV5A 3U2SA 4AMKH 3QZWB 4DTGL 1ZA6A 1OOWA 2WYHA 5C9KA 4AVJA 3U0PA 3IPBA 4JDVB 3EO1A 4ZS7L 5I8KL 2AC0A 3N1GC 5AYUH 2Q87A 4FXGA 1E7VA 3LNHA 1K4DB 3DX3A 4ERSH 1DQIA 4FA8A 5KWYC 3IBEA 5T1DH 1UZGA 4E9YA 4NNXB 2OX5A 4ZZKA 1OW0C 4OZFH 1ET7A 1P1VA 4ODSH 4W9DC 2O6EA 4XNUL 1R47A 2X38A 1P69B 1C16B 1BZDA 4R4FL 5HJBA 5SV4A 3C6LB 4OLVH 5EZLB 3LXUX 5DEZA 3REWA 3IAQA 2IO5A 3QP3A 3NABL 1C1EH 3IDNA 3X1GA 3H6JA 4AJ0A 1NL0H 4G8FB 5EU3A 5T3ZH 3QJUB 4F15B 1T22B 2DTSA 3OXSA 4XMLH 3RWHB 3O6FA 1ZSDB 2DEWX 1JF6A 4FI7A 4Y16B 5FUZH 1KTCA 3TA3D 2UVFA 5L9DL 1FCCA 5BUAA 1KJ3H 3R8BB 3WMSA 4AMKL 2VE6A 1XT5A 4PTUA 4ZG1A 3K1DA 4DSYA 4MD0B 4LVHC 3BQUC 4PJXB 3S4SB 4TN9A 2G4GA 1LD9A 3OKKB 3COOA 5ID0A 4C47A 1BLIA 3T4AA 3NFNA 1MCIA 4OGYH 3VH8A 5CKGA 1NKGA 1F4HA 4HZ1A 1ZSHA 4YBQD 4JJOA 1ZIAA 1KGWA 4U4BA 3G5ZA 5AW2B 2G2RB 2K0RA 5E56A 1QBLH 3E2HB 1JGUL 4X98B 5H8DA 3PQYE 1JZ2A 4CVXB 2GSMB 1XXFC 2EXWD 5A6IA 4PI0A 3U25A 4XO4A 4AQAA 1BG1A 5T3ZL 4MD5B 5I1DB 1JD9A 4XMLL 4U1NB 3S8FB 4ZFZB 5FUZL 4CILA 1LMIA 2YAFA 4HULB 3EUDA 1EA9C 3K8LA 2F54E 3N42F 2R2HB 2VM4A 2Y4SA 3K4AA 2LU3A 4HMDA 2IOMA 4U3CA 2JJSC 3H7BA 5EH1A 1FFTB 2F61A 3VFOB 3FO9A 2UZIH 5TGBB 4WW1A 4XVJH 4BZ1L 5D4QA 3T0AA 2X4SB 2NY2C 1GGTA 3QQDA 3BZFA 3FCBA 4JFHE 3ABGA 5G5DA 4FNLH 5I0WA 3KLHC 2CMRH 3BFOA 3KWXA 2E7HA 4PRID 4UM9D 5LVEA 1VA9A 1IEHA 4DVBB 2Y72A 5EIIA 2XFXB 1FCGA 3FT4B 4JKPH 2GC7C 2FJGB 3NFSH 5F89B 2QEJA 1KPVB 1XGZA 2ZUVA 4P5KA 3H53A 4BFKA 3HG2A 1QSZA 2MPVA 1WZAA 1KG0A 4M43H 1WFJA 4X4XA 3UP6A 1OE2A 3X1EA 4B9YA 2QBWA 3VSVA 3K6SA 3KEDA 4EVNA 3AQZA 4XNZB 1WWAX 1TT6A 1Y6NR 1JRHH 4HETA 5T1KA 4E0RB 4LVHB 5EC2A 3BQUB 3HG1B 3QIBC 5D7LA 3P4NA 4FI8A 5KJRH 4LVEA 1G1YA 3OLIA 2VDNH 2NQDA 1I85A 1NGWA 4QXTA 4AL8C 4JFDD 3ARFD 4JDTH 2Y3NA 4PJDA 1EERB 3FO1A 3RTQC 2UZIL 1E3FA 5FYKH 2APWA 4R3SB 3CN2A 4XVJL 2WKLA 2FCBA 4LSSH 1EK3A 3MKKA 4FNQA 1SYSB 4FNLL 3A24A 4MAUL 4AE1A 1AO7A 3DHMA 1JXFA 4KRMB 4QRSB 4HG4K 1OAXH 1Q9OA 1NEPA 4JKPL 3NFSL 5J89A 3JTTA 3MLVH 3KBPA 2DTMH 5D5MB 3GXFA 3T3PE 4MCZB 3RDTD 4XHJC 1Q9LB 1CYGA 4JK0D 1PG7W 3BLKA 4WV1A 2ZX6A 3QCUH 3LKSB 4H8QA 2JCCE 1YPZA 2MCG1 1ZGLM 4Y4KC 3H0TA 3ILPB 5KJRL 3WFDH 4O2FA 5DD6A 4LLWB 2DJMA 3I75B 2NY2B 2ETWA 1L9MA 4JDTL 5FKPA 5DD1H 4K3GA 3CFNA 1NGXB 1SFHA 3NZSA 4YJZL 4LSDA 4M7LL 1E50A 4LSSL 4G43B 1FORH 2YSSA 3S3BB 1RUPL 4UQ3A 3AMKA 1P4LA 4KNQA 5I1CH 5J13C 1G7JB 1S9YA 5F6HI 1KSRA 2F15A 2FT8A 4FJYA 1TZAA 1QSFB 3BHBA 2NYYD 3IETA 1OAXL 3KCPB 3OMZA 4HGWB 5I26A 3QUMA 2WIMA 3FHQA 1P7QA 3DK2A 3VFNA 2YGPA 1PL3A 2J71A 3BESR 3QIBB 1XR8A 2X3AA 1P5UA 1GGCL 3QCUL 3KGUA 3SDAA 4ZYKB 2JIXA 4K7PL 1DUYA 4H20H 3RTQB 4DQOH 4JM2F 5DJCA 3WFDL 2VLKB 1NJ9A 3CCHB 5DR5H 3SY0A 1U8KA 1T0NA 2VAAB 1JK9B 4OH2A 4K9EL 1CO1A 3IS0X 1UZ8A 2E8ZA 4HXBL 1XDTT 3NTCH 4JJ5A 2G5BB 4ZMLA 1NIFA 1JZ7A 1FORL 3E0GA 1NBZB 1TMCB 1J5HA 2P8PB 1UWGH 3DO7B 5I1CL 4J12A 3FU9A 1MWOA 3AWGA 1FO0B 3D06A 3L6FA 4TRPH 5FM5M 2RALA 4AENA 3VW3L 4R2GD 5CEXB 3LPWA 1J48A 3SYCA 5LGJB 1KXQA 1RK0A 4W4OA 3GHBL 2R1XA 4X8CA 3CZFB 4I0PD 3ZRSA 1QUPA 1BCIA 4Y4KB 4OFIA 4HJ0D 5ES4B 1A7QL 5E9NA 3PP3K 1X5GA 5E94A 5IIEA 4W9EC 3L3JB 4HUUB 4G5ZL 4H20L 1NLDL 3HAEA 3AVEA 5LGHH 4GUOA 2EIDA 2AABL 1NIEA 1PEZA 2DKUA 1F13A 3D0AA 2D9QB 2I26N 1CGVA 4B7IA 3NTCL 4G9DB 2KHAA 5J13B 1ECYA 3PAYA 1XH1A 1F6AB 1QYGL 3IJ8A 3LS4L 1KBVA 4WWKD 2H9GA 3CC5A 2F54D 3NPSC 5CGBA 3V7AE 3Q6FB 3X1NA 3G5WA 4QXGH 1N3NA 2X10A 2VZVA 4DZ8B 4TRPL 5DJAB 5I1HH 3ECQA 2Q76A 1AGFA 3H7LA 4G1EB 1RJLA 2XKNA 4HSQA 4NC1E 3E9TA 4YAQA 1ASPA 2CGYA 3IDIA 5D7LE 3TASA 4JFHD 2ARJQ 2XBZA 4BQ9A 2N7BA 2W65B 4NYLB 5FDWB 3HE7D 5LNEA 4U6XA 4FG0A 4ODTL 2A1WH 2QFPA 2EDJA 4KNUA 1LNUB 1Q0EA 2YKLH 5LGHL 1GY1A 1BYOA 4DJMA 2EKJA 1OTTC 2QR0A 2X4RB 1MI5B 3CN0A 2LVCA 1IIKA 1AO7E 4Z3IA 1EJOL 2YC1A 1WZLA 2XZQH 2NW2B 1JCKA 2QFRA 3NRFA 2C7UB 2YEVB 4PAZA 3ZVVA 2WXJA 1V3LA 4FLHA 2JJWA 1DLFH 2ZWNA 1G6VK 1BZ9B 1UQSB 3T3ME 4OKDA 5CXPA 5E0QA 5I1HL 5BZDA 2ZYIA 5I66B 4MNQB 2QGEA 4NZRH 5HGHA 2YAHA 5JHLA 2LOEA 4Y8DC 3HC3L 3MOAL 1WO2A 2WTPA 1GTFA 1QEXA 1E4WH 1CFTB 2HWZH 1ZJAA 3L3GB 1J9QA 5JZ7D 2A1WL 3APCA 1S3RA 5IWLC 3BAWA 2YPVL 2VM3A 3MCKB 2ZWYA 3MXWH 3AABA 4B9PA 2MFNA 2ICEA 1ND0B 1T2JA 4OLXL 1R6VA 3LKOA 3NPSB 3PWPE 4FFWD 3D4ZA 1ZLEA 2G60H 3IJYB 5BXFB 2KQNA 3ARZA 3K6DA 1NC4A 5FYJH 5L4IA 4X6CF 1G7MA 3KPNB 5CU9A 4DESA 4QRFA 5K59E 3MNZB 2ZWSA 5F96H 3AY2A 3UYPB 3R06B 1BQLL 3GJEB 4DUXA 4OLEA 1FFPA 3ZE2F 5I1KH 1VERA 2OPCA 1FQ9C 3Q06A 3QUYB 4XO3A 4MAYC 3GLZA 4L3ED 1NC2A 3DTDA 3QJHB 4LSQL 1KB9K 3CZLA 2EZ0D 3DRQB 2Q86A 1M4KA 4LLAA 2AAVA 3A23A 1TTCA 1H8OA 1E4WL 1K8DB 1DJYA 2OBGA 2EIJB 2UZYA 2PPCA 3BCFA 2XWJB 2GSIB 2YGQA 3IXAA 4H2AA 4JO2L 1BQHA 1K3ZA 2HXAA 3RLSA 2FX9H 4X6FB 4KVPA 1BD2E 3MLWH 1SZNA 4BZYA 1MQKH 4I48A 4XN9A 5GGRB 5G4MA 5EN2A 4WW2C 1LP9F 3RGVC 3TCTA 2GTZB 3RWFB 4GAYB 5IFHH 5C70A 2B7DT 1RIUH 3FHEA 3J8F7 1OVZA 1IM9A 4JHVA 4QOKB 4X9HA 3QFJB 5FYJL 2OK0H 5F96L 1KXQE 1YEDA 3HCVB 2C1PA 5MEQA 3MBWB 5KAQF 1FNSL 4G6MH 1DR9A 4XI5C 3HAEH 1PCXA 2ATPB 4R7DA 4H40A 3GMLB 5IMOA 5D6DA 5E9DD 2Y7NA 3VFMB 3W11D 2Q3ZA 4PRDA 2VL5B 1G7IA 3FU8A 3OJ2C 1FZKA 4WHYH 4P8QA 1LQBC 4XBEH 3Q6GH 3L4VA 5IMKA 1TLMA 4GI8A 2EDXA 1TYJA 2YBGA 4Y9FA 4JPIA 3VD7A 3EBGA 1W0VB 4WCYH 2FX9L 1X7SA 3QO0B 3US0A 4FMVA 1ED3B 1INQB 2EYSA 4HS3B 1HL5A 3AFLA 4XNQB 5I5MA 3WTWA 3QCVH 2BHYA 5HI5C 3QXAB 4L0PB 4HUXA 4JDZA 4WENB 1MCCA 1ZT7A 4FAAB 1RIUL 2R7EB 3ESUF 4QCIB 4JVPA 2YUZA 1DEDA 4MAYB 3IE4A 4X5LA 3GJFA 3BAKA 1TO4A 4G6ML 4XVTL 3TPUA 4DN4L 2XN9A 1Y07A 2AXGB 3B6SB 3TTSA 3HZ3A 1KPRB 1HKLH 1XGYH 1ZT1A 3MRDA 2XQYK 4PB9H 2OQJB 4ZX6A 3C2AH 4DIXA 4PFEA 3BVNB 3O8XA 1GMEA 2AI0H 2Z92B 3DUUA 4BV1A 1HXKA 3GSXB 1CUOA 4MJ5A 4G11A 2AV1B 4XBEL 2I7SA 4N8VB 4ABUA 3Q6GL 4N6RA 2C3VB 5I1EL 4RRPA 2CO6B 4M1DH 5F70A 2W94A 5BZWB 5DUBA 3GT6A 4OLUH 4XBPA 4WW2B 4RWYL 4WCYL 5TF1H 3A6OA 3RGVB 5JHDB 2M8XA 5AOJA 2BNRD 4YHNB 1OLZA 1KUMA 3IJEA 5C0CD 5D2NA 3QCVL 5JHLH 1PIFA 1TJMA 3WTVA 2I07A 2WSPA 1SJVA 1JNNL 2ADIB 1PJWA 3QDMA 4NRXB 2DRUA 3HRZA 3F7VA 1H0DB 1T66C 4LU5L 5EORL 1FSKC 1MLBB 4WO4A 5E99H 3BUIA 3F7YB 1AMXA 1HKLL 1P0SE 1HDMA 1XGYL 4IHOA 1VLXA 4PB9L 4R7NB 4Q9RL 5HTSA 4UIKH 5IT2H 4JR9H 4N0CC 2R4RH 3N1MC 4RISL 3S3SA 1G7PA 3RL1B 5IG7B 1Z5YD 3AT8A 2WBJD 4P59L 4Y2OB 3DROA 3D2UA 2VZSA 4M1DL 5AUMB 4OLUL 4X99B 5HVGB 5TF1L 4GG8A 2XZCL 4PRPE 2XWEA 4DGYH 2HKFL 4XNXL 1L7TH 5E8NA 4KKCC 4PP1D 4X9IA 2EXTA 3RWIA 3SGEH 4AW7A 1J1OH 3RY6C 4BCZA 3WJLC 2F1BA 4AK1A 5DI8A 3W37A 3S3PA 1CLYH 4H0LC 2X9XA 1JPTL 4YBLB 2IOOA 2AJZB 4AYFB 3D85B 4I1RA 4XN2A 1TZ8A 4UILH 4LSTH 4AGLA 1KGCE 2B9BA 4P5RA 3UX9B 1YYMH 3CDGA 1AP2A 1XF5B 4GG6A 1FZOB 3P3TA 4G9FE 1H5BA 4MMYA 2FQFA 3IMSA 2VUOA 3PWPD 4RAVB 4POZD 3US9A 5J0BA 5TF0A 4WNQB 4JR9L 5C09D 3AS2A 2R4RL 2QDWA 3VFSA 2O61A 2NY1D 3CK0L 1FL3B 5KVFL 3FQUB 5F9DC 1LO4H 3P0YH 1WAPA 1OSEA 3V10A 4BGDA 2IAMA 3SE4C 1IRAY 1ZV5A 5HGBB 4OFYD 4BRVA 5L0QC 3BSGA 4P23C 1JYNA 2AAAA 3WIFB 3UC2A 2NUTA 1IBHA 5EOTB 1AFVL 6CGTA 4TULH 4QXVA 3WFZA 5DD0L 1L7TL 3RVWC 3MRNB 3HW7A 2DMKA 4PG9A 2PYEB 1LWJA 4BXVA 3QFDA 5EZOH 2VLRE 5TE6H 5IB3A 1FSKB 4GRLD 4L37A 2WINB 3JTSA 3MLTB 4DFIA 2XVKA 1IEBB 4J8QA 5ISZB 3HIZA 3Q8AA 4XAKE 2DM3A 4KVNH 1AQ8A 1BD2D 4UTBA 1WQVT 2H0FA 3ROLB 2HMIC 1OIOA 2R0ZL 2AMUA 4OGAD 4CU8A 3ARPA 1MF2H 2SODB 2VABA 1MHCB 4UU9A 4E9LA 2WLMA 4FYSA 3BZ5A 5AB0A 1CMOA 2Q3AA 1VZGA 2MQGA 3F5WB 1EZLA 3FQYA 1NDGA 5A3IC 1KN2H 3BPLC 3P0YL 2VDKH 5K9OA 4QTHA 1IGFH 4YDZA 3V9FA 3K71A 4OGXL 4ABWA 1UXMA 2A6KB 4Q9QL 4CDHA 2WMPB 1SMAA 2C4FU 3V0FA 2AKRA 1FL6B 4TULL 5BV7C 4L5FE 5LAXB 3A4EA 3AG3B 2Y07L 4FFYL 4A2EA 4MGXA 4NUQA 3MNVB 1A6AB 1VFAA 1MHPH 1IZKA 3HS0C 4YHIB 3UGXA 3LZQA 1WCQA 2XN9E 4YQXH 5I8OL 2FDBP 3CSPA 3KVPA 2NW3B 4F3FB 5EZOL 5TE6L 3BEWB 1DVYA 1KTBA 4ELKB 4PJ5B 3UPRA 2UY7B 1EHXA 3ZO0A 1R5IB 4Y1AB 3TP4A 2W95A 2CD0A 3KPPA 4KVNL 5IVZA 4BSWA 2CK2A 3VFWA 3ZX1A 4DEWA 4JQXC 1G6RB 3QXTA 2K1MA 3S5LG 1BLNA 4AJWA 2ZJSL 4PJFA 2I9TB 4UZUA 3WGUB 1F00I 2QPFA 5L0QB 2C3HA 2HCZX 4P23B 2ESVA 3DSNA 4WI3A 3QHTC 3U4KA 2VDKL 3QNYA 1GAFH 3KYAA 4PGJA 1IARB 1TZOA 2DQIH 5D2NE 3VXSB 1RZIA 2VQTA 3BIAX 2OSLB 4HHGA 1KCKA 3WLBA 4JDVA 2FZ3A 4B0MB 2ZUUA 3R4DA 4M1CC 4PJIB 1DQMH 5GRUH 4E41E 4PIRF 1SN0A 4M6NL 1P4BH 1GZPA 4YQXL 3FKUS 3K8KA 1J11A 1K4DA 1HT6A 5DS1A 4NNXA 3QG7H 1DANT 4OQTA 2VUKA 1ICTA 2P8MA 4GW1B 4B9FA 4MBRA 1F90L 1T4WA 3VQLA 1HL4A 5C07E 3T5WA 3K74B 1C16A 1NOFA 3C6LA 4KXCA 5EZLA 3X14B 4QHKI 3T3PF 1FF5A 3ML8A 4JEGB 3BPLB 3ESOA 5DC0A 1RUAH 2JXMB 2R83A 5I73C 4Y9CA 1M3JA 2NY6C 3WKNA 4GW4B 1DEEA 4UBDC 4WUUE 3RWHA 4DFHA 3WDHA 5BV7B 3L5HA 4Y16A 1GAFL 5AKTA 3PWNA 1KCVH 1ID2A 3GSQB 5D72L 4GIAA 3KYOA 3PFQA 3HS0B 2ZSWB 1NM4A 2VXQA 3HUJB 1CD8A 4MD0A 1BFOB 4X7FC 4QXUH 5GRUL 4KQ0A 4PJXA 3U0WH 4WHDA 1P4BL 3GMPB 4GG6E 2N7AA 3UROR 4NXSA 4Y4HA 1AJ7H 5GGVH 4M7ZC 4J7RA 3WDJA 3KVDD 4HWUA 1T6BX 1QI3A 4PRPD 2J21A 4X98A 4UQ2B 2BS71 1JFHA 2KMWA 4CVXA 1BQUA 5TDNB 3BGMB 2YLKA 1SEQH 1L0PA 2B20A 3S35H 1OGAE 5I18H 2NUPB 4Y4FC 4MD5A 2ADYA 1JXDA 1JAEA 1R5WA 2MQCA 3UIYA 5I1DA 4GNKB 3SD5A 4U1NA 1KGCD 4M48H 4LEXL 4ZFZA 5KSUB 1ZS2A 4KWUA 5ABAA 2WVVB 4TNGA 4Q6YA 4G9FD 4OF5A 3WFHB 4UTBH 5FGSA 3IGKA 3LPGA 3QISA 3FQ1A 2Z7YA 2R2HA 4N2FA 3BH4A 1A9BB 4TQ8A 4EKJA 1HIML 1TVHB 3CFBB 3QYCA 3SBWA 3WO3B 4JMXA 4DH2A 3EO9H 3CBRA 3VFOA 2OMVA 4GBXC 1EV2E 3LIZL 2X4SA 5DZPA 2VN4A 3WU1A 1CTMA 1RY7B 2LU4A 4HFWA 1G7LB 4HKBB 1AJ7L 2GK0A 3DX0A 3KCWA 4QRPB 5CO1A 5EBWB 1E5ZA 1U2HA 2CGRH 2IQ9H 2WXMA 1BMZA 2CPUA 3NEXA 3SGKC 4DVBA 1F4YL 4Z3FA 2PPDA 2NY6B 2FJGA 3KWVA 4HS6B 5F89A 1KPVA 3ZE1E 2VLRD 3VD4A 2EYTB 4DN3L 2A4ZA 4GAGH 3N3EA 3TH4T 5B1AB 1YNTF 2Q10A 2D73A 5IW1B 5HHQB 4XAKD 1A66A 4YBHA 3GD1C 1BVNT 2B1HH 4NERA 5AVUB 4E0RA 4AI7A 1EZSA 3O2DA 3HG1A 1DHKA 1TEGA 1YECH 2AK1H 2AHIA 3FB6B 3RG1C 3C08L 5CP3H 4TUJB 3EJTA 3PXJA 4PS3A 4D7BA 2D7PA 2CKBH 5D1QE 5SWSB 3MVSA 4R3SA 5F7BA 5H37A 1WGVA 4PJFE 4XVSH 2AJYH 2QHLA 3S7GA 4LO9A 1MCWM 2BSED 3LPFA 3RGHA 4A6YL 5JIKA 5AVTB 2WWMC 3NJKA 2CGRL 4Y7MA 1P6AB 3UEQA 3VD9A 3VXUB 1I7ZB 4Y4FB 3W0WB 4KNTA 4QRSA 4ZDHB 4E5XG 1DBBL 2CU9A 3VXTB 3GMOB 4GAGL 2WLYA 3ARGA 3PLYA 3DXAA 2IXQB 1AMYA 3H3BC 5EPMB 4OQTH 3S48A 3NK3A 5DD5H 5GS0L 1A8ZA 2XV0A 5GGSB 1S6NA 3A6CH 1CIUA 1SXZA 2JJSA 3LKSA 4BFEA 3ZRFC 3GRWL 4CW1A 5HDRA 1YECL 4MMXC 4GBXB 1HS6A 3ILPA 4PS4H 3U0TA 2R29A 4LLWA 1R0AH 1NCAH 1GGUA 4NHCH 2DICA 3BI9X 2CKBL 5DC4B 4M3JA 3JWNC 1NGXA 4XVSL 3QEQD 2AJYL 1OTSD 2F5AL 2ZWKA 4H5SB 3EYOB 5D7IB 5IEHB 2J73A 3OG6B 4ZPVA 3H42L 5EBMB 1Z7JA 2XV2A 1FNAA 1G7JA 3MGTB 3WKQA 2PR4H 3CLEH 1JJUA 4E41D 4LLDB 3WTXA 2VXQH 1QSFA 2ORBL 2WAQA 3KCPA 4HGWA 2BVPB 2J72A 4B95C 4AV4A 4AY0A 4BE5A 1QHPA 4QLRA 5AOKA 1PY9A 1EXHA 1VZHA 3QIBA 1NEZG 4GIOA 4PJXE 3AACA 3PNWB 2QSQA 2CKNA 1UT1A 3NFPB 3HMWL 3VNYA 4OJDH 2X0UA 3PHSA 1II4E 3DX8B 3RTQA 1A1OB 1NCIA 4YVNA 3ZMEA 2VLKA 4JHUA 4KK5C 1R0AL 4WO0A 1S7RB 5BJTA 1JK9A 1BF2A 3QI9C 5K59F 5IY5B 2BIMA 4WUUD 1NGYA 5TTRA 4MQTB 2G5BA 2EDBA 1T21A 2WXHA 2GABA 3GS4A 3OLDA 3TZVB 3LRHA 2NXYC 4WY7L 5JORB 1WS8A 1UTDA 1NBZA 4ANKA 1K5WA 2P8PA 3CX5J 4OZ4B 5F7HA 2Y1AA 4BFIB 3CLEL 4N2DA 5AOMA 1FO0A 1ZV9A 1IEAB 2FATH 2VXQL 4W9FC 5D1ZI 5DRWB 3VSTA 1SF5A 4DT2A 1VENA 5LGJA 3CZSA 3B2MA 1S9VB 4MKTA 5FYLE 2DI8A 1GS8A 3APNA 3KWUA 4Y19B 1AD0B 1ONQB 2AW2A 4QAMB 3ECBB 1BXAA 3VQMA 4CL7A 1GSKA 4MMXB 4AWJC 2RCSH 5CZRA 4Z7VB 2ADJA 3ULAB 3L3JA 2JKJA 3DETD 3L2MA 4HUUA 3P2BA 1KN4H 2D03H 3B9DA 4YH6A 1A02N 3OZ9H 1BAFH 1UC6A 5HDQL 4X9YA 4C54A 1MHHA 2L7EA 1AG0A 1DTUA 2FX8H 1O9VA 4HEPG 2EIBA 5ELIA 4G9DA 4XNMB 5FO7B 1OXYA 3PJLA 4HF5L 2VDRH 3AMLA 5T8IA 3WFBH 2H6PA 4GMTH 3CFIC 5EZIL 3Q6FA 3FTGB 3Q2LA 5E8OA 2ZP9A 2PXYC 3O2DH 3VJ6A 1RJZB 3P2DA 2YIHA 4LPTA 2Y23A 3OKLB 4OF7A 3SD2A 2O1AA 4ECNA 4I13B 4G1EA 3UTPD 3CMOH 1KLGB 3GI8H 3P73A 5DDHB 3ULVC 1IKNA 4ZMVA 3MJ7B 3T1WA 1OE1A 2MCPH 3CN4A 3E80A 1OM3H 4IBYA 5H37H 1VCBC 1JXJA 2BY2A 5I71C 1QWUA 1GJUA 3DX1A 2W65A 4G7VH 4KTYA 4NYLA 3ZKMC 1A14H 4IOSA 4W9JC 5JQIB 2PPFA 1LNUA 5FGCB 3QI9B 5AVVB 1CU4H 4KK9C 5LN8A 3VFRB 3UTTD 3OZ9L 1BAFL 2F7QA 5BCAA 5I2IB 2CDGB 5FV1L 3ABMB 3R0MA 3EDJA 3HNSH 2Y1VA 5J56B 2FX8L 2X4RA 3L5IA 1MI5A 3SGJC 3AREA 5GGQH 3BLBA 5HPOA 1N64L 5ESAA 3OMIB 3M7FB 2C7UA 3ZTJH 1CL7H 2VDRL 4KZEH 5D5ME 4RDQG 5DZ9A 2CUAA 1AXSB 2VCOA 2VZ1A 4AEHH 3ULUC 3IK2A 1BZ9A 4X4MA 1A3LH 2R29H 3FFCB 5D1QD 2X05A 3SO3C 3CMOL 3GI8L 2G5UA 3MQIA 1WWCA 4NQVB 2BRRL 4JRLA 4XC1H 2BW5A 4MLIA 4S1SH 1JWSB 1TPXC 1OM3L 2IH8A 2AF2A 2HKHH 2G30A 3EF4A 1CFTA 2HT4D 2VDPB 1A14L 4IKJA 1TFPA 2Q0ZX 1PX4A 2DWYA 4XCEB 2YR3A 3FRUB 4F8OA 1CU4L 4UT9L 3SPHA 1JI1A 3L5WB 3MCKA 4HPHA 1KTLA 2Y5TA 4ZBJA 4QRRB 3HNSL 3N55A 3DOHA 4ONHB 2H8PB 4KMLB 1ND0A 3VXOB 2BDNH 4W6YB 4G42B 2LLGA 3SDYL 1L0XA 3IJYA 4LBEB 5BXFA 1G43A 1MFUA 1QSFE 2PXYB 3H3KA 3LN9A 3MODH 3O4LB 1CL7L 1T83C 3MNZA 4KZEL 3PABA 4NBZB 4ZFGL 3R06A 5MERB 1RVFH 3K0WA 3GBDA 1MW3A 3GJEA 4AEHL 2GTQA 5KVGH 2WYZA 1DBKH 1JPGB 1A3LL 3POHA 1RZGB 3QUYA 1FYTB 4HCRA 4XGZA 4K07A 4X7SL 3QJHA 5I71B 1A1NB 4Z7NB 3S2CA 4K0OA 3JT0A 3DRQA 1WBYA 4G6KL 2DDQH 5IFAH 2CHZA 4FLQA 4XTRD 2HKHL 1XBDA 1K8DA 3FQTB 1SHXA 3V7MA 2WQ8A 3WDIA 2XWJA 1N7ML 2J8UA 2GSIA 1T2QH 1W8NA 1HZHH 3ME0B 4GAJH 1TQUA 2FWUA 4I0KA 1DVFB 4MDIB 5DK3A 4HUVB 3T04D 1ZTXL 3H1ZA 1DCEA 5INDA 3BJLA 3N41B 3U46B 3L7EB 3TU6A 3T0VA 3JUYA 4XXDB 2Z7UA 4MXVE 4IEFB 4PUBH 3RPBA 5GGRA 1JIBA 4KDVA 5E6ID 2KZ1B 2BDNL 4X9BA 4G1MB 2GTZA 3RWFA 2FO1A 2ZP8A 4GAYA 4ZW6A 1ACCA 3U9WA 4D2NA 3MODL 1EZVY 1BFTA 4QOKA 1X7QB 3DOSB 1NKOA 3BPNC 3FMGH 3QFJA 3RX5A 4L1HA 3QXUA 2DQ6A 3QQ4B 3SO3B 2DWDB 3UG3A 1RVFL 3PNRB 3GNMH 2ATAA 3UTQB 5KVGL 4WHCA 1XR9A 1DQQA 2ATPA 3VFVB 4KUZH 1TPXB 1M53A 3GMLA 3QYNA 4L8CA 4WU7B 5JOPE 3FCUB 4XZUB 5I19L 3ZYJA 3F6JA 5T3XH 3VI4B 4RMQA 1B9ZA 3W38A 2DDQL 1LLAA 3DO3A 3F00A 3RX8A 3DYPA 3DARA 2XKUA 1VFUA 3FUIA 3KEHA 5IWLA 4OUUB 4KRPC 1T2QL 4Q56A 5KYWB 1R17A 4B9IA 4B7LA 3SOBH 5FS5A 3PJNA 1W0VA 2R23A 2NPLX 1UACL 4JFEE 4O9HH 3WTYA 1ED3A 4Z0XB 4Q14A 2ZX9A 2FEEL 3K2UH 4HS3A 4IW4C 4XNQA 5IOPB 2A0LC 4PWGA 3O2WH 4LHQB 2NZ9C 1CTNA 2OTWB 3OR6B 2FUQA 1G0YR 3QXAA 4YEFA 1ADWA 2R7EA 2QVFB 1FVCB 4QCIA 4PJHA 4MAYA 1NCCH 3B6SA 3GIVA 3A4DA 3RB5A 5T5NF 4G8IB 4PH8A 1KPRA 5AW3B 3A47A 3E9UA 3NZUA 5DYOA 3WXWL 1M9WA 4BHUI 2OQJA 2A9CA 3EYUH 5FM8A 3MOQA 3RQ3A 3GO1H 1WBZB 3LZFL 4GXVL 4D0BB 3EJZC 5JPMC 2Z92A 4MXWL 1AANA 3GSNL 3EH1A 1MJ7H 4PI2A 1MJUH 2I60L 5E4IA 2DBLH 5DZAA 2CDEB 3MV01 2C3VA 1A6ZB 4YPGB 1MI5E 2IH9A 2CO6A 5KBKA 4FEMA 3SOBL 2CZNA 3QO1B 4LSPH 4N2NA 2B15A 3RGVA 1HHIB 1G5GA 4LE8A 4N85A 5JHDA 3BQUD 5ESVB 3ZYOA 3KPQA 4YHNA 1Y0LA 3MRGB 3K2UL 4EZMA 3V55A 3AUWB 3Q1SH 3BPNB 4DCQB 3ZT5A 3O2WL 3OZKA 4X4ME 1I1AC 2QSCH 3ZZQA 2E59A 1DFBH 2ADIA 5DVKA 25C8L 3FJTA 1PZAA 4L1TA 2X1WL 2X2IA 4K3EH 4NRXA 4MNQE 3EBAA 3DVGB 4H8WC 2I5YH 1H0DA 1NCCL 4GFXA 1MLBA 1YJDH 3OQRA 5E8EB 4EO5A 5J7CC 4JG0H 1RSYA 4R7NA 4X9FA 3FTXA 5I8EB 4P99A 4Q4EA 1HKFA 4TVPE 3STZB 4ENED 2XXMB 4P4RB 1MJ7L 3EIFA 4PRHB 3RL1A 3IMRA 1MJUL 1MOEA 1QNIA 1JV5B 3L16A 4Y2OA 3DKHA 4KJQD 4TNFA 3UG4A 2UYLB 3QUGA 4Z0BH 2BFGA 4PBXA 5AW4B 5AUMA 2BSDA 4X99A 5IW6B 1ETJA 5DLMH 2IPKB 1AY1L 3CSYB 2IOIA 4HCRH 4E5XB 4GS7C 4OSUL 4BD4A 3UERA 3FSVA 2BIPA 1SRDA 3G6DH 3T2PA 1NCDH 2H1PL 4G7SB 2E46A 2JKXA 4X6EB 5DTFB 4AIOA 4HZLA 4PRBB 3D85A 3PXHA 4CADB 1A3RH 4MZIA 1CFVL 1YJDL 4PIBA 1FZOA 5AG9A 4F8TA 2AVGA 3VXNB 4IRJD 4NQEB 3U6RB 4JG0L 4WTZG 2BPBA 1SHSA 2LV4A 4NO2B 1HAWA 5JPNC 3B2DC 5JIHA 3DJRA 4OI9A 4RBPH 1X4XA 4G6AC 5FYKU 3FOLB 3ZYZA 4YE4L 4QO1A 2WV3A 1DUZB 3UO1L 1XF4A 2HA1A 3H4HA 3PPSA 5HGBA 2R59A 4CSPA 1U42A 1LMKA 1KBBA 3WIFA 4RAHA 3OKMB 1HHGB 1U8PA 1TJHH 1DBMH 5EOTA 4W1TA 4XP5H 2J56A 2RQEA 3V0WL 4QOKE 5DLML 3S37X 4DO5A 3KYMA 3QFJE 1I1AB 2X12A 2OTUA 3HLAB 4GG6F 1AOZA 3MRNA 4EOWH 5I75C 1JWMB 3GMQA 3NDZE 2ZX8A 1NCDL 2FEEI 1BBDH 4X7EC 4EXKA 1UVQB 2CGZA 3UAEA 3MJGX 3L9EA 2WINA 3MLTA 4J5VA 4JQIL 4AJYV 5JXEC 2WBXA 5ISZA 4EE2A 1THCA 1QWHA 4LCYA 2Z31C 3ROLA 4AEIH 3TEUA 1MHCA 5GZOC 4Q74A 1LO2L 4FQ1L 5AAWC 3G5YA 4ODWA 3F5WA 4NN6C 1HYSC 2VXTH 3H9SE 2WP3T 3O45B 3OHMB 4UQAA 4UV7L 4L8BB 5FO8B 2B77A 3WG7B 4A68A 4PJ8A 3UG5A 3EYFA 4ZNEE 3L3KB 2A6KA 2XZAL 4Y4KD 4GS7B 1CF8L 1TJHL 4FTVD 3RY6A 5JOPD 3QUZC 5E9DA 4YHLH 3WJLA 5LAXA 2NQ3A 3NP3A 2ZYRA 2WB7A 1A6AA 1AS6A 4NN7C 4YHIA 2D0HA 2E86A 2J55A 1BHGA 4K7PY 1BBDL 3WEXA 1SDDB 4A7QA 4PB0H 2NW3A 4F3FA 4DQAA 3WLWC 4O51B 4ELKA 2CHWA 3ARVA 4LPVA 4IS6B 4XWGH 2D3VA 1R5IA 3TESA 5JPNB 3JVGC 4CVUA 4JFED 5DJ6A 1HESA 2JKNA 3FU7B 2V9TA 4AEIL 5E6RB 4I87A 4TL5A 3ZE1F 1G6RA 1JTPA 1TOXA 1D5BB 1WAAA 3JQOB 2ED6A 4RFNC 2CR3A 2I9TA 4KROD 2R1WB 3CFDB 3SE4A 5LBSL 2VXTL 3QGVA 5JHDE 4DERA 5K1JA 1GS6X 5DMIH 3MV8B 4QRTB 1SBBA 3HKZA 2VNCA 4KKRA 3E1ZA 4HW6A 3TYGL 2J12B 4AQZA 3QWRD 3SKNB 3VXSA 4HIHB 5I75B 2XACC 3BSHA 2OSLA 1NGQH 3CG8A 2H3KA 1B6UA 2XLLA 2HUHA 4NRZA 3TWYA 4PJFF 1WISA 3W2DL 1J5OH 2OLDA 2DQCL 2O5YH 2QGCA 2AJSH 1ZLWH 3T09A 2Z31B 4HLEA 4XWGL 1ROWA 1WICA 4S1QH 3P3UA 5GHWH 1TTGA 2WZPD 5IB2A 4A37A 2BNRA 3GHPA 4FFZA 4H1LG 5EB9A 5TQ0H 3NYKA 3X14A 4NI6A 3FTVA 1M56B 3LB6C 4XMVA 43C9B 2VMFA 1RZJC 1ESOA 4OLWL 2X4OB 3GHEH 4JHWL 2JXMA 3FQ2A 4WEMB 1KENL 4HLZG 1N8OE 4AZ8A 5C0IB 4AIXA 3ZGIA 3I50H 4MNQD 4GW4A 5DMIL 3QUZB 3SOTA 4N5UA 1FLRH 5C6TL 4FA7B 3GSQA 5ADPH 1TZGH 3GMMA 5DRZA 3UJIH 3PL6C 2Q1EA 4NN7B 2XVGA 4ZS6C 3TFBA 2ZSWA 1NGQL 4QGYA 4PSPA 3AG2B 3UTOA 4OF8A 2VR3A 4KXAA 2GB2A 4TVPD 5GIRB 1KBPA 3IJSA 2XU9A 4MBOA 1J5OL 1XGUB 4K3JL 1NFAA 1AC6A 3KLSA 2PO6D 4EN3D 1I7RA 4JQXA 1T5XB 4E9QA 1MCKA 2AZAA 3SJVE 4S1QL 4RFNB 2CJTA 2VQUA 1AZCA 4GMSH 2BVOB 2I85A 1J9TA 1OF2B 5TDNA 3MGAA 2FK9A 5KN5B 1QZNA 1A6TB 1FLTX 2NUPA 3L81A 4M5YH 4PJXF 3EUUA 1RCYA 2DLHA 4NZ8A 4PV9B 5CSZB 3WXVH 2BLFA 2J2ZB 5KSUA 1HEZB 2WVVA 1FLRL 2E9WA 4UAOC 3PWVB 5ADPL 2PYEE 3CVHL 3WFHA 3MREB 3UJIL 3IGUA 2EDMA 1YEGL 3ERXA 2WK2A 1A9BA 4MVBC 1HFUA 1TVHA 2Q2EB 1OTTD 5IQNA 3CFBA 1TF4A 3BYTA 4XMXA 2EABA 5CR1A 3LAFA 4M6OH 1M57B 3CFJA 5FLVA 5IZ7A 4WHTA 3HN5A 4KJYA 2HSIA 5EBLB 5L2KA 2E7LC 3BRFA 5EBWA 5EV7A 5HYSB 3JT2A 4GMSL 3N44B 1Z1WA 4JKLA 4BGLA 1LK3L 1EAOA 1CLVA 4HS6A 1QLEB 2EYTA 3RU8H 4L8DA 2HFTA 5IW1A 5F2FA 2EDOA 3MDJA 5EOCL 3PL6B 1HI6A 2EYRA 3QQ9C 1P4UA 2EE9A 4LMQE 5IBTL 2A9BA 1EPFA 4JFFB 4MA8H 1AZVA 3PHQB 4Z7UA 4B5EA 3WKPA 3FB6A 2O5NA 4PJ5E 4M9PA 1KJ2L 4C8XA 4TUJA 4UM8B 4KKZA 3CNKA 4PU2A 4XMWA 4Y1AE 1FH5L 1WRFA 3H9SD 5IHZB 3CGTA 4M6OL 4ADJA 1KYUA 3LRMA 2AQRA 3MU3A 2F8XC 2HFFB 4X83A 4X6DB 3FQRB 3C6EA 2V2TB 1Q1JH 4JPKL 5DLLA 3WFEL 3O3BB 1QTYT 1Z32X 2DQGH 3FB7B 3BT0A 4XN5A 3M8OH 3VXUA 2E7CA 2AEQH 4Y4FA 5C0DB 1B4LA 3N5AA 4ZDHA 5C0BA 3TT1H 2RD0A 4S1DC 1Y1DA 4UNVA 3VXTA 2OR8A 3GMOA 3L3OB 4UAOB 4LDOB 3S0PA 3NQIA 2IXQA 2YD3A 3BX7C 3FCTB 5EPMA 1EEQA 4PJIE 5GGSA 2XETA 5CJBA 1B0WA 3L5XH 1ROCA 4GXUM 4NP4L 1JCVA 2YD9A 4LNRA 3B34A 4KFMA 4XRCB 4F9PC 1AKJB 4OCSH 4FFZH 3P77B 3FT9A 3WY1A 2EDDA 1NIBA 1JMZA 2DL9A 3KXFE 4N20A 4Y2DB 1X6LA 2A6JB 1SHWA 2PTTB 1SXSA 1IKOP 5D5MF 1TG8A 5KW9L 4L4TB 3W9DB 2VGLM 1OGPA 1RLBA 1TJXA 1Q1JL 4H5SA 5D7IA 3GTNA 4L9DA 4QHLA 4XI5D 1F42A 5EBMA 2K8MA 4I8DA 1DJGA 3MGTA 3M8OL 1URZA 4X4KA 2FYYB 4LLDA 3CHSA 1PFCA 3A5VA 4EIZC 1ADQA 3L1FA 4JFQB 2BVPA 4XMPH 4FJZA 4NZJA 4OQ1A 1N12A 2V6HA 1WA0X 5F9WC 1HXMA 1KBWA 1ZMYA 2OMWA 3MPCA 3HUJE 5DUML 3UH8A 4AYBA 1OGTA 3O6LL 3G6AB 3MACL 2N3JA 3QORC 1INDH 3VVWA 4TSAH 3NFPA 1MXGA 3MRBB 4LP4A 2WVTA 4LPCA 2KYIA 1AHMA 4QDGA 1A1OA 4FFZL 3GM0A 2H3NA 1HEJC 4OIAA 3ZYIA 2D0FA 1BIIA 4YXHH 1S7RA 1FE8H 2EIMB 2CXGA 4JZJB 5HI5D 1PKQB 3IF1B 2JK5B 1SMOA 3PHOA 2JKRM 4WI5A 2GIMA 3EJQA 1KPUB 2XN2A 3TZVA 5I0DA 1QD0A 5BZXA 5JORA 1YZZA 3A67L 1UWXK 4LOEA 4OZ4A 2AMGA 4RMSA 3MGOA 4YGVB 4BFIA 3SDDC 3QNZB 1KZYA 1TU2B 1MCOL 5CSGA 4WLCA 1AQHA 3E8VA 5IEKB 1S9VA 4UCFA 4YHOH 1MVYA 1KLUB 4Y19A 1AD0A 1ONQA 3SJVD 1N8ZA 3ECBA 1ZE3C 4DKEL 1DJIA 2Z8VC 3GC3A 1YDPA 3GSWB 4FNTA 4MXVF 1ZEAL 3HI5L 3UGEA 1UZ6E 3O0RL 3K46A 3BKCL 2R15A 3I6SA 2FRGP 2WVUA 4JN1H 4QRPE 4J4PA 4AIEA 2LAAA 5EO1A 2F7IA 5JIQA 1RK7A 2JELH 4XNMA 2YXMA 2K9FB 5FO7A 1QFWM 2PYED 2P3YA 3X3FL 3BVUA 2FT6A 1YG9A 1T66D 1E5AA 3FTGA 3QRBA 2XWRA 1RJZA 5F8QC 1IB5A 2C9PA 5J1AA 5JXAH 3OKLA 1IBZA 3UAFA 4N8UA 5F9WB 2XPYA 1P6WA 1L0QA 4I5BA 1ITBB 1W72A 1J8SA 2FSEB 3ARQA 4N0CD 5F1SA 3MJ7A 4YHOL 3QORB 3ZIMA 1NFIB 1Z3GH 4NKQB 3X13B 1S7SB 3KNBB 3LKQB 5KJ4A 1E8ZA 5SWSE 1VEPA 1KELL 1CXKA 3GUFA 5DMYA 2JB5H 3VFRA 1GR7A 3VXQB 4NFCA 4KKCD 5I2IA 4PJ9C 1Z9NA 2WCPA 4KJPC 4NNPH 1SVCP 3VXUE 2JELL 1L0YA 1X4YA 3BKYL 1B0IA 2K6ZA 2ZCLH 3GXIA 3W0WE 1HK6A 1OM9A 4ZMQA 3KPTA 1KB3A 1BAWA 2NYZA 3SDDB 1M2VB 1OB0A 1V7ML 5JNYB 1KCUH 4Z8FH 1WE5A 4PJ5D 1QLRA 1AXSA 5HGGS 1CI5A 4G3YH 4Y1AD 1KFAH 4IHBA 2EDLA 3FFCA 2VW7A 5KVEH 3OZLA 3FT0A 1KCRH 1U8NB 1SXNA 1BEYH 4ADIA 4NQVA 1Q4NX 1QI5A 5HYJD 3O3AB 4Y9GA 1Z3GL 1MCBA 1ZJBA 2F53B 4L0ZA 2CQVA 1LDPL 3JWOC 4WEEA 4RRPM 4GKNA 4BK8A 5DURB 2IFGA 1JFQL 3NCMA 4J23A 3ZJAA 3U7WH 3FRUA 3S5LA 2G9KA 2JB5L 2L3BA 3RVWD 1BVKB 3L5WA 1ADQH 5D7IE 4QRRA 4ONHA 2H8PA 3VXOA 4NNPL 2G3NA 2UUDH 1W0YT 1E3ZA 2ZCLL 4LBEA 2PXYA 3O4LA 5SWZB 4M61B 2X53A 3TBBA 1LO3H 3WFCH 4L9LC 1KCUL 5MERA 4Q58C 2HRPH 4Z8FL 4HJIA 3K5RA 2VDLB 1OSPH 2X6BA 4G3YL 4R4BB 4UV4L 1KFAL 2AK4E 1JPGA 4IDJH 2NSXA 5EEWA 3MRKB 1JV2B 1TQWA 3KXFD 1RZGA 3IWVA 1FYTA 4GXUN 3NJNA 4ZUVB 4H4NA 1Y1UA 4FLRA 5E23A 1BEYL 2XWDA 1SGKA 4K3DH 4XN1A 1B88A 1HCFX 3SKUD 3P40A 4ZMWA 1QG3A 3LH2H 1QRNB 1OOAA 1G0DA 1A2YB 5H94A 3SN6N 2OA9A 4PJ9B 5JMOC 4P5MB 4HUVA 4M1GH 3TEZA 1DVFA 4MDIA 2GKIA 4H1LB 3IFOB 4TUUA 4MNHB 1DBAL 5I82A 3SGJA 3U46A 3L7EA 1ADQL 2W88A 4NUJB 4XNYH 5DHVB 3HI1B 1P53A 3ZT7A 3BO8B 4G1MA 2B08A 1MAJA 1UOLA 2C9SA 1BF5A 2C4FT 1S7XA 1X7QA 2WLJA 3DOSA 1LO3L 2HYMA 3CC1A 1G9ML 2H45A 5F1NA 4MNGB 2BNQB 1RMFH 2VMJA 1RZQA 4IDJL 1L3WA 2HPOA 2W59A 3MLZH 2V2WA 3GLDA 4WU7A 3X12B 2AJUH 4GP5B 4NNYB 3I74A 4Z7VE 5F0JB 3KAAA 3FTUA 1BSIA 2BS8A 4HPOL 2RGSA 1SFDA 3A4FA 5HHQA 3W5MA 3JWNE 3KYKH 3QZBA 1WF5A 1UWYA 1E28B 1MJ8L 2YPLD 3BIKA 4OUUA 3TNMA 5KYWA 1CICC 1QP1A 5C71A 3PV6B 5CINH 5DJXB 4G71B 4M1CD 3RA7L 3QDGE 1YQVH 1GIGL 4LF3B 3LKPB 4M7KH 4Z0XA 4XNYL 3H2PA 1W72H 1ECZA 2IADB 5CD5C 1WUNT 4RMVA 4L9LB 3F7PC 3OR6A 4FHJA 3T0EC 4J3OG 1T7VA 5IGXL 4LL4A 2KZBA 1FVCA 4QI3A 1F45A 1XCTB 1X5XA 4JFOA 5JMRA 5I0VA 1DP0A 4I77H 2WVSA 2VN6A 1YYCA 2VKWA 4QRPD 4RFOH 3ESNA 4YXLL 3WHE1 1E8YA 5C0ND 3IVKB 4K2UH 4DK6A 4D0BA 2QQQA 1C12B 2K3TA 5FGCE 1GPOL 3HFMH 2UX6A 5SX5K 3KYKL 2W0FA 1UOWA 5AZUA 3AITA 4HGKC 3FT3B 2CDEA 5IQ7H 2P52A 1NWOA 4APQB 2Q8AH 1QFOA 1I1FB 4P2OC 4P2RB 1U8IA 2EDWA 3QO1A 5CINL 2ARJB 2CUMA 3HRPA 4NWTH 2MOQA 1LO5B 2ZF9A 3LCYA 5MI0B 3WIIH 1QO3B 3LJ3A 1W72L 3MRGA 5DEGB 1SM3H 1UB5A 4DCQA 1CQYA 5M95B 3MNMA 4PD4J 4FABL 4CNIA 3FFCE 3T2NH 1UT9A 2B16A 3U2IA 4AW4A 4Z3GA 1BJ1H 1SY6L 2JF1A 5LKNA 1PMYA 3F2LA 2NT0A 3DVGA 4HU2A 3VCLB 3H55A 5E2UH 3UTTA 4GB9A 4YSUA 3TJEL 4HUWB 1IJ9A 5IB4A 1I8KB 5I8CA 2NSMA 5E8EA 3MAWA 2RR3A 4WW2F 3DPBB 2DAVA 4PTTA 3QRGH 3HFML 4PV8B 3STZA 3L4YA 4HWBA 1CICB 1JSYA 1UFUA 3IDGA 2WTOA 4PRHA 3VG0L 3BKJH 1JV5A 3PWUA 3MUGB 5IQ7L 4HVBA 2UYLA 3WAKA 2UXFA 3U6XS 3TF4A 4RCAA 4GLRH 1GW0A 3O4LE 5IW6A 3WAJA 1FVDA 5CZVL 4Q97A 2O26U 4HYTB 4N2BA 3T0EB 3CSYA 3WIIL 4JKWA 4E5XA 4ELMA 4A2DA 3MYZA 1MCSA 2X7LB 2B9AA 2JKIS 4GBXD 4IGBC 3ULVE 2E5EA 4P3WA 4R90L 1XQ4A 5DTFA 2XA3A 3EZ8A 4WGWB 3T2NL 1AGCB 3TA4D 4PRBA 4CADA 4Z7NE 4BH8B 1MFCH 1M1XA 3BPCB 4NC0B 5DK0A 3TO2B 5JIDA 4HJ1A 4YLCA 2A4EA 3D4CA 4FQIL 2CM5A 3VXNA 1WK0A 4KAQH 3U6RA 1ZHLA 1FZJB 4NO2A 4P57B 3FOLA 1Z2KA 2D3JA 3SHSA 3JV4B 5CEYA 3NA4A 2FQDA 4P2OB 1DUZA 4K8RC 4MX7B 1JGLL 3LN4B 2AK4D 4U6VL 2ZKXA 3VD3A 1HHGA 3FOMA 2ZG3A 3ULUE 3N6YA 3HLAA 3GYRA 1OWWA 3M86A 5HHPB 5CBAA 1MUJB 4OM0H 1JWMA 2XBDA 5F72S 1YRKA 4X5XA 1N6QL 3ABLB 1JGEB 5ALBH 1NEZA 1DO6A 1ET8A 2PW2B 1A6UH 4QUOA 3VACA 2WWMD 1MFCL 2IANE 1INEL 3DNKA 3VI4E 4N2HA 3FONB 1Y6MR 1OB1B 3CDFA 2D0GA 4K7FB 4J1UA 4ZW5A 1GOGA 5D93C 4L1LA 2KL6A 3NACH 1PG7H 3AT9A 2DQJH 2EXYC 3RAJH 3F6IA 3ULSA 1DSFL 2IPUK 1BZ8A 3O45A 5FO8A 1G9NL 4BDVB 4L8BA 3OMAB 3VYOA 3S8GB 3DA0A 3ASOB 2L0DA 3L3KA 3PYCA 1HCVA 2QGBA 1T1ZB 1Q72L 4QF1B 5SX4H 4LCUB 2EDQA 2GIYA 3TYFA 4A63A 1TZHB 2X2HA 2IV9A 4OM0L 2K7PA 3QQ3B 4NQXA 3V4VL 4APXB 1YSOA 3Q13A 4MKMA 3OGOE 2NMSA 3CPLB 3B2UC 5F1IB 1CLZH 2KBGA 4O4YL 1A6UL 4J3OD 4O51A 4IS6A 2B0SL 5FW8A 2VW4A 1EH9A 3B8SA 1IAKA 2V0AA 3QDGD 1NZRA 1QFWI 3H2QA 3FU7A 4FN0A 3BD3A 1Y18A 4QWWC 2W8CA 4HHAB 4YN3A 3GZPA 1IAIH 1D5BA 3ZDYE 2GCYB 3A3YB 2B14A 1LO0L 1X5MA 3NACL 2AXHA 2DQJL 1I1YB 2EECA 2OI9C 4HEPA 4NPJA 3RAJL 5L88L 2HX8A 4MJIB 4BZ2A 4ILDA 3CH8A 2GITB 5C08B 3RWJB 3MBEC 4FFVC 3MV8A 4QRTA 2J88H 4LCVA 4BH7B 5BUGA 5FOBB 1THAA 3UPAA 5FCUL 3MCYA 3SKNA 4OB5H 3II3A 3U79A 3CIQA 4KK5D 5CLWA 1OP9A 4PGEB 5HHOA 3D0LB 3EJSA 4Y9EA 3QI9D 1H8NA 2AZUA 1HQ4B 2PW1B 2MEJB 5TQ2H 4F58H 5I6MA 5KEZA 3QS2A 4DPRA 5B1JC 5JXEA 1NMAH 3PHAA 4HWBH 3REVB 1YAZA 2NXYD 1USZA 1OCWL 3CV5A 5F7KC 5GZOA 2XBTA 5D93B 2A77H 4HK0B 2GK2A 2N7SA 4ZOCA 4PRHE 2H6UA 4LQ1A 1IAIL 3NZHH 4XMKH 5I5IA 1IC7H 4JLRA 43C9A 4E9WA 2WW8A 4PJIF 4HJUA 5F97E 3QQXA 2NR6C 3DHPA 5C0IA 2VYRE 5EF1A 1XIWC 2F0CA 4DO6A 3QUZA 2J88L 4F8QA 1ZLVK 3IMWA 4HHWA 2NZ1A 1E43A 1T6VN 5CEZE 4ORGB 4MYWB 3O6MH 2CLZB 1FNHA 4N68A 4H8VA 4Z7QB 3C75A 4Q89A 1I82A 1JTOA 1J0ZA 1NFDA 4DPCX 1KC5L 3BVTA 5TQ2L 1IBBA 1KBGH 1NMAL 1NCUA 1UJTA 3BP6B 3JVGA 4ALAH 3BUQA 1NPUA 2Z35A 4NQEE 3CJJA 3UXFA 4JGJA 4D9RD 1T5XA 5F1KC 1B4JH 3G5XB 2BP8B 2O5XH 1RZFH 1ERNA 4A67A 3MX0B 1HILB 3EHBC 2MOGA 4U49A 4ONGH 2VWEC 3D39B 3U4EB 4L1DA 1OF2A 1ZWIB 2BOCA 4XMKL 4MJ2A 3V6OA 3MBEB 5FHBH 3HUJF 3S35X 3EOTH 2NRDA 4S0TD 1A6TA 3ZN6A 3QCTH 3VAEA 1I9RL 1F97A 1WZMA 4H8WH 5AEAA 1SXAA 5E1IA 1YEHH 2V3FA 3KPSB 1HEZA 4ZUTB 5I30L 3PWVA 1OTUC 3MREA 4KK9D 3O6ML 3CWGA 4R6UA 4EEEA 4EDXB 4ACTA 4KGLA 4C59B 1GZHC 3QC5X 2KKQA 3ATBA 4U6YB 2K9UA 2R0LL 5JR1H 2AGJH 3CQPA 2NOYA 4ALAL 4EI5D 2I7OA 5BQ7A 3U9PL 2ZPKH 4AYDC 2VDQB 4XP4H 5EBLA 1RZFL 1MG3C 3ULUD 3DSFH 5HYSA 4GW5B 2WQAA 3L1OL 6FABH 5DJ0B 3G5VA 3NJLA 1D5RA 2BHUA 1AQKL 1W80A 3APDA 4TSCH 2FSDA 4HV8B 3TBTA 1MKFA 1SUHA 1PZBA 4IBQA 4P9HC 5KSVB 5A1AA 2IAND 4N3UA 2VQ1A 1M9SA 3G04B 5AW6B 3G7TA 4ONFL 2NCMA 4LKCB 5I1JL 1JVKA 5JW4M 1UZ6F 4CSTA 3D05A 1MN4A 5AVQB 1SLWA 3FQ4A 3LHPH 1NINA 4JFFA 4BK4A 3GDBA 2EO1A 5D1XE 3N43B 3GSVB 3IFLH 4UM8A 1HSAB 1AI1H 1N2RB 3HI6L 1AVAA 2Q7YB 3I6KB 1T5KA 1L5GB 3UDWC 4BZ2H 1K85A 4XE5B 1UWEH 2HFFA 4LK4A 1JZ3A 1WTLA 4X6DA 2NQCA 3FQRA 3Q2WA 2V2TA 2ZPKL 4XP4L 4URTB 1BBJA 3M17B 4N0UB 3O3BA 3FUDA 3V95A 3BP7B 1TR7A 2EJ1A 2XTLA 3DSFL 4WI7A 6FABL 3UMNA 1LK2B 2BMKA 2BS9A 1RP8A 4J3UA 1L6XA 1CGSH 2ITEA 1BXVA 1K6QH 1KDJA 1OALA 1E67A 3L3OA 5CCKL 1A7RL 4OU3A 4NENB 1HWHB 3FCTA 5GS2D 1YY8B 2MRYA 3FF7A 1XGPB 3D25B 4A39A 4AT6B 3NRQA 4TNEA 5IROD 2Y6SC 2Z6FA 4MLSA 4XRCA 1VESA 1AKJA 4HAFA 2WP3O 3P77A 4NZTL 1CD1B 2MCAA 5GZNC 2XVBA 5CBEB 1AZUA 4Y2DA 4WDIA 3VWKC 4BZ2L 2A6JA 2PP9A 1UWEL 2OAAA 4L4TA 4I2XB 4PW9A 4NGHL 3QWRA 4HJTA 3IPEA 4R8WL 3VU1A 4F8LA 1E9QB 4PVMA 3BD5A 1ACYH 2BCMA 1R3LB 1A4KB 1PKOA 3BH9A 4FZ8H 4YO0B 2CLRB 4FKEA 3OTTA 5E4OA 1QR4A 5FA3B 1Q0YH 3GLAA 1IT9L 4N1EA 4KGJA 3VMPA 5IMMB 1OAUH 1XCQB 1PLGH 4KRPD 2OCJA 5DXWA 1V7NH 4PJAB 3BFWA 3MRBA 1B90A 5D7IF 1NDTA 3M88A 4FTDA 3SE9H 4ZMPA 1TMQA 4RIRB 4HGMA 4F8PA 3TO4A 2A0LD 1RHHA 1NBYB 1E0OB 2NZ9D 1DE4B 1QAWA 1QVOB 4JZJA 1PKQA 3IF1A 2JK5A 3MOBH 1FWXA 3MV7D 1TLKA 3BZDA 3FTSA 3OPZL 2L8AA 5DJZA 1JGVH 4LQFH 5CEZD 1L9PA 4KUCD 5E2TL 4RETB 1YEJH 5ESQA 4U7MA 4K23H 4X9GA 3ZDZB 3EJJX 1ACYL 4JUSA 5E1HB 4N8PA 4YGVA 5ACZB 3QNZA 4DKTA 2DJ4A 1NM9A 1TU2A 2FGWL 3IDUA 4MQ7A 2R8SH 3LPOA 4NQED 2BSBA 3QDJB 5GRWA 3WUZA 1MW0A 3CVIH 3KW8A 2ZAGA 2E3VA 1OAUL 2GEEA 9CGTA 3TEYA 2EUWA 4JFTA 5C0FB 4RSVA 3UABA 4U7SA 1KYOK 1OSZB 4H44C 2BXZA 1HAUA 4H2CA 4PRAB 3UC0L 3VWKB 5KVMC