1UT2A

Afae-3 adhesin from escherichia coli
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
139
structure length
138
Chain Sequence
GSFTPSGTTGTTKLTVTEECQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCNARQVALKADTDNFEQKFFLISDNNRDKLYVNIRPMDNSAWTTDNGVFYKNDVGSWGGTIGIYVDGQQTNTPPGNYTLTLTGGYWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Studies of the Afa/Dr Adhesin Drae and its Interaction with Chloramphenicol
pubmed doi rcsb
source organism Escherichia coli
molecule tags Adhesin
molecule keywords AFIMBRIAL ADHESIN AFA-III
total genus 27
structure length 138
sequence length 139
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2003-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04619 Adhesin_Dr Dr-family adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1570 Mainly Beta Sandwich Immunoglobulin-like Dr adhesin 1ut2A00
2JKLA 1UT1A 2BCMA 2JKJA 2JKNA 1USZA 1USQA 1RXLA 1UT2A 2W5PA 2IXQB 2VERA
chains in the Genus database with same CATH superfamily
2J56A 1OVZA 3D25B 4QOKB 1CFTA 1A6ZA 3FQ4A 4FDWA 3P40A 3HLKA 2BP8A 2HJLB 3EGXB 5B4MC 4KTDH 2FWLB 1TKWB 2XBZA 5CZVL 5IIEA 3I50H 3BZFB 4KI5D 2F1EA 4NQCA 5EO9A 1HVXA 5F1IB 3T5WA 4P4RA 3MRLA 2W94A 3C8HA 4WU5A 5L7XL 5KYXA 4LXFA 4N2GA 5LWYL 3UH8A 5CZRA 3FQNA 4P04A 3MJ9A 4X7SL 4LEBA 5BV7L 3WIFB 4BHUI 2HT3C 2OXHB 4JW3A 4R5VA 3MV8A 4ODXB 3FUIA 2WXKA 4NO5B 1FL3A 1EDYA 3VFWB 3JWDL 1KTLA 5CAYB 1U2CA 1ORSA 2UWEE 1CLYL 4J4PD 2AMGA 2Y7LA 2C9QA 4AXWA 4TQEH 4XNUL 5CCJA 4HEPG 4YDMA 1TJHH 4J3OG 3B37A 4JKMA 3ZL4L 5BVJA 1HHHB 4FG6D 4QHPA 1VZHA 5CIPA 4TSCL 1J9SA 3GZQA 5J57B 1XGUA 3N40P 3RVVC 3DROB 1ICTA 3EG9A 1QFUH 1TT6A 2GK0A 4XNAA 3UIZA 3W5MA 1PEWA 3NQKA 2QELA 3VXSA 1DBAH 1JNNH 4Y5YB 3CFEA 4HCIA 3HG0A 4JS7A 4IRJC 2IANE 4FJYA 4NO0A 3RY4A 1X9UA 3HLAA 1CXFA 3N9GL 4TN9A 2O5NA 2MJWA 4NKQB 2B39A 4JDTL 4PB9H 5D4HA 3MLTA 2Q2LA 5C08D 5JHLL 3NA9H 3OBAA 3QQ9C 4XCFL 5AW7B 4CW1B 3VQ2C 2XTJB 3HBGA 4BFFA 3V7MA 2BRQA 5DZAA 2OL3L 2I5YH 5LDSA 1YNLL 1C12B 3QQ9D 4A39A 2FECL 3DECA 4FXKA 5DUBA 3OC8A 3BKJL 2QQNH 4OGAD 2F5AH 3JYBA 3BW9B 2IDCA 2GFBB 2B16A 4S1SL 3RIFF 4LRIA 1AE6L 5EBGA 2NQCA 2PW1B 4PS8A 1EJ8A 3UL4A 1F4YL 4OZFB 1PTZA 5D7LA 4MQXC 2BRRL 3VI3E 5IQLA 4P46C 3SKJL 3ZMEA 4IDLA 3EXJA 2OTWB 1QA9A 4YSOA 4ZBJA 1LILA 2DQEH 5EZLB 3BKYL 5JPMB 3QZOA 1KCBA 2MQGA 2PR9A 3OWEA 4NZRL 4YSRA 4NZ8A 2VDLB 1IVLA 4A67A 1LMKA 4ERSL 1AZVA 4OGQC 1SBSL 1FRGH 2A9BA 3KL0A 3LNGA 5D7SH 3WLBB 3CVBA 4LARH 4OF0A 3GLZA 4XBEH 4Z7QF 2WCSA 3ZKNC 5J1AB 3FSVA 1NCBL 3ARRA 1MVUB 3EJTA 3G6JF 1ACZA 5I17B 4BXSV 1QQDA 3MLRH 4ZS6D 1NINA 1I9EA 3EKCA 5B8CB 1BVOA 3JWNH 3MLUH 4K3GA 4KJYB 1CE1L 5DQ9B 1M6UA 4PREB 5SV3A 5GRJH 4NWUH 5IGXH 1P7HL 3L7FB 2Q20A 5ADPH 2FO4B 4GP5B 2ZWNA 4KI5E 3GMRB 5IEKB 3QPKA 5HPMB 3BAWA 4AL8H 5E6SB 1UD5A 3VXNB 1EHNA 2H3NB 3JV4B 3FCSA 3ZZLA 2V37A 3GSNB 5D1ZB 3Q06A 1SXNA 3IKCB 1MFBH 5F1IA 5MI0B 4HKJA 4KQ0A 4AV0A 1KY6A 1PLAA 1JVOA 4QRRB 4JAMA 4WTXA 5JORA 3WKMH 3ZKXC 2OL3B 3KYOA 3QZMA 1SXAA 5HD8D 3AG1B 3AWEA 1S78C 1JGVH 1T0MB 4DP2X 4NLHA 5JOEA 5MHSE 3S5LA 3MV9B 4K0OA 4IM8A 5GZOA 4Q97A 4JCLA 4QTHA 2NW2B 4MGXA 3NJKA 4OJFL 3JZYA 1JE6A 1OAXH 1QRNE 1U8KA 2J25A 4ZDHB 4LVNC 3S3PA 2NSXA 1JNJA 2YGNA 4RX4D 3UBXA 5ESQB 5AKTA 5I1EL 4NZUH 3DHUA 5CEXA 3F5WA 2ZUUA 3HN3A 3TZVC 1NFIA 2YSTA 4QRSA 3SCMD 3WUWG 3GB7B 2EXTA 3TT3H 3FQUB 3ESPA 2HVKA 4UCFA 2X4UB 1EJFA 4WGKA 2BNRE 1WZAA 3GK8L 1YNKH 1I1YB 3WN6A 4YHLL 2OI9C 5EU6A 5CF3A 3U0WL 4M43H 5I74B 1PX8A 4P9HC 4JDTH 5F1SA 4HULB 1TVHA 1IC4H 4EI5A 5GJSL 1A1OA 4KRMB 4J3BA 5D2NC 2C4XA 1CDCA 1UT9A 1E4HA 1R3IH 3ECBA 4AT6B 1QABA 1DZ0A 3U7YL 4EI5D 4I3RL 3V6BR 3D5OF 3MV9E 1QI5A 1QFWM 2ARJA 2G0LA 1SRDA 2G5BB 1ZS2A 2OJZL 2YAOA 3FOMB 4AGOA 4P5RA 3E6FB 1I9JH 3OHMB 1S4IA 5SX4I 4PJDF 2OBGA 5C0EB 1FG9C 1LDPL 3O8XC 4YE0A 4MB1A 4JKPL 3Q9PA 1BM7A 3VSVA 3IFNL 4MNQD 5FM4A 2NUTA 4XMZA 3V0WL 1J5IA 2ZYHA 1QSFD 5K39A 1F00I 1CFMA 4LK4A 2VXQA 4GNKB 3KGRA 3NSFA 1T3FA 4U3XA 5GGQL 5DZOA 5CU5A 4PBDA 4N2IA 1QMUA 5DTFB 5ETUB 3QUYC 4NUPA 3RVVD 1MRCH 4XH2A 43CAB 5DJ2A 1QSEB 2XACC 1CE6B 4XRCA 5INDA 1W15A 5ICUA 1XF3A 3PV6A 3VRIA 2HT3D 2AZUA 3NBNA 3N42F 2J1XA 2O26U 2VWEC 2ZOLA 2X4TB 2KPWA 4LGPB 4LQFH 1DEEA 3N0AA 4U7KA 3V0HA 5F7HA 1T7YA 4DPBX 4GLRI 4HWZA 4X7TB 1KULA 4Y4FC 3ZDYB 3ZE1B 4F7MA 4HJJH 1OGAA 3ARZA 4KTEL 1NL0L 4NQQA 4BH8A 5DD6A 4GRLA 5CGYC 1MJ7H 3DO7B 4UYPA 3TO4B 4F9PC 2YOCA 3F65A 4UTAH 3QUMA 3ZR5A 4PJ9C 2CCVA 3DX1A 1DVYA 3CTTA 5K1NA 5GISL 2EC9U 4IJ3C 1DFXA 4YE4H 1D7BA 2VQ1B 1YDPA 2PR4L 2YUVA 1FL6A 4A38A 1GGIL 3EOBB 5CGBA 3SDAB 3D4GA 4PR5A 5BZDB 3JWOL 1NCAL 5ID1B 1ZGLB 3P2BA 3UTTE 4FI8A 1O7DE 2XV0A 1UOLA 3FTVA 4M1CC 1HH9A 4MJ5A 4ZMWA 3NZUA 3SIKA 1LK3L 1B4LA 3BAXA 4Y9FA 2FZ3A 4YHNA 4YHPB 4ANUA 4W4OA 4ELKA 5GHWH 5C0CA 2ED6A 2B0SL 2VZ1A 1XF1A 1HWGB 3OMAB 4DVBB 2ZXEB 4GY4A 2UZXB 2FEEI 2VDRL 5I1GH 2VXUL 3QUXA 3PWPE 4KJWC 4OZGA 3LKOA 2FGZA 1SM3L 3O2VL 4O4YL 4UZSA 1T80A 2FT7A 1U93A 3VM7A 4KXBA 1ONQA 3M1BB 4LSUH 4N24A 4PJ7A 2ZP0T 3SPVB 1T1ZA 1S8DA 3EOTL 3JV6A 2VOTA 3O9WA 2IGTA 3ARBA 3M46A 3NQIA 1DE4A 4LPTA 3NZ8A 3ML8A 4P2OC 3R8BB 3KVPA 4PEEA 1DSFL 4ZFFA 2LLLA 4FG2A 3VWJA 4JFHE 1B4TA 4GKZA 4NZDA 3F7LA 3RGVB 1BQ5A 3DHJA 2IQAA 1W0WA 3OF6A 3OWRA 5F97E 1EZLA 4HIJA 3AC0A 4NIKB 3MZTA 3BLBA 3O3BA 4WHCA 1AH1A 4HIEA 1DQDH 3JVFC 1TVDA 3D87B 4PJGE 4KH2A 1N64L 3ILDA 2HMIC 5IREA 3IJ8A 5F7AA 4JPKH 3F85A 3K0WA 3OKLB 3DRQA 1ZLEA 3S3BB 1T0PB 1JGUH 3HC2A 1KLGA 1OLLA 5E5LA 4WO4D 2XN9B 4KQ3L 5EF0A 3BRFA 2LR4A 3NUKA 4DQOH 2DTML 2X3BA 4PLJD 1IO4C 3UZQB 1L9OA 3L5XL 3DX7B 2KL6A 2OSLB 4K8RC 3IMRA 4I18A 5AAMA 3GJFK 3PWLB 3ZTDC 1AS8A 4A55A 4FLQA 4QD2E 3OX8A 3QJSB 4OJFH 3KLLA 4Y5YC 5FKAA 5IJVA 1S7QB 2RQ8A 4L0YA 1SF3A 2Z34A 3VXRB 3T1WA 1ETZB 2W1NA 1R3KA 3ISWA 4PWGA 1ZVNA 1NAKH 1JG9A 2DICA 3QEQB 4KI5C 1U3HB 2CLZB 4MWFB 1OAJA 5EU6B 4N4YB 2X4RB 4ISVB 4KMLB 3LNFA 2EXSA 2X89A 5KVMC 5T5NF 5I74C 2ESVE 4Q4IA 4AQ8C 1OLZA 2MKWA 1IEBB 4DQOL 4AUUA 4L3EE 2DM2A 5KJRL 5D1QB 4BQ6A 3VVWA 1KJ2B 5FDWB 1EJOH 1T4KB 3D52A 4Z76B 4J2QA 3WHE1 3P73B 3P1VA 3FFCA 4YHKL 3BGFC 4ATTA 3KHOA 2EAEA 4ONGL 3C8DA 5DLML 1Z0MA 1NUGA 4HAGA 3CFUA 3HI6L 2IMMA 1X9RA 2E46A 2H2PD 3LVEA 4M7ZB 3F7YB 4QRPD 4TULH 3OXSB 2J8UB 5CU9A 4DVRL 5C08E 4OKVA 3L3OB 4XBPB 5AKVA 2OK0L 1Z32X 5BXFB 4H0IA 4OLYL 5FO7A 3HUJB 4DP4X 2WWKO 2CNZA 5D7LD 2Z7UA 1T1WB 1JFQH 4G43A 3B3IB 3BUQA 5D1ZI 3DJTA 3TCTA 3WFEL 3GXNA 2Q0ZX 4P57A 4UBDC 3LZQA 5LCVA 5FYLD 3WG7B 1A21A 2OCJA 1FIGH 3H6JA 5DLMH 1BW8A 3BKCL 2JCCF 1CZ8L 4AX3A 1Q90A 5ISZD 3TTYA 3DX9B 1IBYA 1YECH 3KPRD 7PAZA 4JVPA 1KJ3L 2BVOA 1BIIA 5A7BA 3OMIB 5AWNH 4WFFD 4ILDA 4AYDC 2W9EL 4JFDB 3AXLB 1S5IH 1INDL 1LWRA 4NX0A 3VXMD 1L6XA 4IGBB 4F2FA 5DUPL 1WF5A 2W0FB 2VLJD 3ZL2A 4C4BA 2DJUA 2ZAGA 4I13B 4PJ9B 3JTSB 4XMVA 4OD3L 1PFOA 4N3TA 4NN7C 5DGRA 4JQIA 4AIXA 3QJHB 1CS6A 4KBPA 2C9UA 2DM4A 4HWBH 3C8KA 5HYQB 4RRPM 3HNTH 4KJYA 12E8H 1Z9SB 1TR7A 3Q8AA 2IGFH 3L5XH 1E4KA 4PVNA 3GBLA 3MYJB 3QE5A 5F7MC 1X7QA 6FABH 1TNNA 5CSZA 1SZNA 4CVUA 3NIDF 1E3FA 5KBMA 5I1KL 3MUY1 1FGVH 4K7PH 2HFFA 4TVUA 2W07A 5F71A 2G2PA 1T2QL 4ACPA 3VD0A 4QT5B 2WNXA 2YEVB 3B9KA 1I1AB 2HN7B 4FHKA 2O61B 4UQEA 2YGQA 5AW0B 2CKNA 5HVHC 5E03A 2CO7B 2Y4SA 4ZFFB 5I18L 1FBIL 3KWXA 3SE4A 3BH9B 2AJ3A 5DQJB 4EQ2A 3LCYA 5DJ8A 1GGUA 5J06A 2G3ZA 3T3PE 1V3MA 1TFHA 3IMUA 4YC2B 1J5CA 5EEWA 1HCVA 4XXWC 1KWKA 4PW9A 1Y6NR 2AP2A 1XAUA 2QADC 4FQPA 2ZWKA 4MNGA 2Z31C 1SOKA 5E51A 1X5MA 4XNYL 2NXZD 4HAKA 1VSCA 4YWGH 1EFQA 1VACA 4HX1B 4U7MA 1DQQA 1OGTA 2JB5L 3HPJB 4HKBB 3SOBL 2DYPA 1KBVA 1WZKA 4NP9A 3W39A 3LQZB 5CBEA 1L4IA 2F7PA 2WKOA 2BMKA 1A6TB 2I60H 4MA3B 4RBPH 4ONFH 3TPKA 3UG4A 1KT2B 3R4RA 4WEEA 2BY0A 4ALAL 1T0MA 1SGKA 5I8EA 3CH8A 1IEAA 4Y7MA 4LNRA 2DQ6A 4IKLA 3VWKB 1D7DA 2NNFA 4N6RA 2LQRA 4OLEA 1PJWA 1OKEA 3F7YA 1QHOA 2VZOA 3ARTA 3DJ9A 2P7TA 3II3A 1GYUA 1UC6A 3PWUA 5E1AB 3O0RL 4KDVA 1AD9B 1AMXA 2J7LA 4K07A 3LIZL 3VXNA 4ZFOL 1F6FB 5GJTH 2PABA 3AJ7A 4I0PA 1NCAH 3EW3B 1UCTA 35C8H 2QGCA 1XGPB 2OTUB 1SEQH 2YKLH 32C2A 2A83B 1TYJA 2BPBA 3DHPA 3I3BA 3PFUA 3V79C 3ULSA 5J13B 3PREA 4FNTA 4MMZA 3LN4B 2PP9A 4ODHL 5T1LB 4RMRA 3HC4L 3M45A 3P73A 3BE1L 2LLGA 3FCBA 3QG7L 1UWYA 3BRDA 2LTQB 5ABAA 3PWNB 5CILH 4JE0A 3FCTA 4R90L 3L6FB 2OMTB 3MR9B 4IJTA 4N3UA 1J8HE 4OU3A 4XPHL 3TFKC 4G6FD 3SDCB 3U9PH 3Q13A 4QIRA 3NA4A 3VW3L 3UO8B 3W0WE 4ABQA 5BOZG 5E4OA 3L3OA 1Q1JH 2FJHA 3QDHA 4JANA 2IFGA 5AAPA 3C6LD 1IQWL 3L8QA 1SY6L 3U2IA 3MRMB 3I6GA 4ZMNA 2Q10A 1BDYA 1YNTF 3EH2A 4XBPA 4XCEB 4OUUB 4AEHL 5JIDA 3TJHC 3GXMA 4RWYH 3PL6B 1M7IB 1T7VA 2QHRH 2MPVA 3QNYA 4IHOA 5D1QC 1BVKA 1KPRA 3CPUA 2LFEA 3MSPA 4CMMA 5CJ8A 3GO1H 1JZ8A 5IMOB 2GT9B 2AJVL 2NY0D 3TV8A 1RJCA 3LQAC 3X1FA 4ZZFA 1CK0H 1EZSA 3FH8A 1A6PA 4H1LH 1Z9NA 4FTVA 4OQTL 3F2LA 3QO1A 2DRUA 1A7OL 2UVFA 2G5RA 1W6LA 5DEFB 1GZHA 3ZOAA 5C0EA 4HG4K 3LKQA 4KKCC 3LHPH 4G9FD 4EBQH 5DUBB 2C1OB 5AYTA 1YUHA 2J6WA 2PWFA 3W2DH 3MLSH 4GAAA 4ZFOA 2OFQA 3CVHB 4B9IA 1SFHA 4Q2ZA 5EA0L 3UTTA 4LCCB 3FUFA 3ZO9A 4I0CC 2QHLA 5I66A 3HS0B 3RY5A 1UH3A 4L8SB 4NZRH 4GRWF 4L8BA 2ICEC 4AUJA 1QNZL 5B1KA 2GG1A 2DQIH 1PYWB 1KLFB 2V17H 4X4KA 4GMSL 4LSRL 2HVBA 3GMQB 3QFJA 3ZW3A 4BA8A 4FLRA 2C1PA 2ZD0A 4JZOB 3T6VA 1C5BL 1DQDL 5HDRA 3ZUNC 4Y5XC 3K2KA 4M7LL 3ZO0A 1UWFA 2X42A 1YEGH 1NDGA 3LZNA 4DEWA 5BMFH 1BCIA 2ZCKL 3LIUA 4MB3A 3GMPA 4TLTA 1K85A 1IM9D 3U46A 5C3IA 4PLJC 2GUOB 4OIBA 4PJ7E 5EG6C 3UTSE 1PZSA 1CU4H 4G72B 5BRZE 4F91B 4FFWC 1GZPB 5JA9A 4MMYA 1S7UA 4DW2L 1VPOH 5EA0H 3Q7JA 3I2CH 3PHOB 2BCMA 2R4SL 3QJHA 1XH1A 1QACA 1NEPA 1SLVA 5A3IC 1BLNA 2QKIB 5I82A 2CGZA 1R0AH 2X41A 3MLZL 1UOWA 3T4YB 4NAJA 3DMMB 5A2IH 5IT2L 2V2WA 3VD7A 4K7FA 2NNRA 5D7JB 3UCQA 4FQ1H 2VAAB 4GSQA 4YK4C 3FOLA 5H37A 3FCSB 3B2MA 1BQRA 1B0IA 2BP8B 2HJLA 1G4MA 3EGXA 4L8DA 3EHBC 2H26B 3BH8A 4PR5B 4YUEH 1BA9A 2R8SH 1SF5A 3IT8D 5L9DH 1T1ZB 2CAKA 4U6TA 2H0FA 2DTMH 3ARDC 1PIFA 2D0HA 3CN3A 4QHKI 4XO5A 3KH4A 5EEYA 2MOQA 2FEJA 4F7EB 2FX9H 3LQAH 1NGPL 1AO7E 3T77B 4G59C 3GI9L 4HK3J 4J28A 4XCFH 3EYOB 2VN6A 2YGOA 3V0JA 1OTTC 5F9DC 5H94A 2BY3A 1ID5I 1RCYA 3BPNC 3L9RA 1W2KT 4URTB 3GJFB 4B97A 1PG7L 5DHVH 5GRYA 1IGCH 2E7HA 4JRFA 3LHPL 4HSQA 1F6AB 5DRWA 3IWUA 4DZBB 4QNPF 1FV1B 4G8EB 1P7QB 3IDNB 3T1FA 4UM9D 4NO0D 3OAYH 1X7TA 4HIIB 2FX7L 3AADB 4DK3A 4OQTH 3X1GA 2ITDA 2JKRM 3VXSD 2FR4A 3SDXA 1KGCD 3Q43A 3RDTB 3HB3C 1EFXA 4OZFA 2A77L 4J3UA 4JL1A 2V2XA 3FZUC 3P9MA 1DBML 4Z76A 2WLIA 4G8GB 4WI0A 1CPUA 5KSVB 2VH5L 2VKWA 2A4EA 3Q1SH 4BRVA 3QO1B 1BZ7A 2YEZB 3WUWB 1L9RA 4FNLL 5TGBB 1I7RB 4Q0XL 2NX5B 1DJWA 3CFCL 4M00A 1ETJA 1FLRH 5E6YA 1IC1A 1JGEB 1YEKH 2C9VA 3ORJA 1FPTH 2CLZA 1E8WA 3P4NA 2Z9TA 2AJSH 4P9MH 2IEPA 3EUDA 4NN6C 3T09A 2WB1A 1P2CA 4CC0A 3H3PL 1O6SA 5LAPA 4ODTH 4BK5A 1WFUA 4ZTOL 1J9QA 3QQ4B 5AVWB 4Y4KC 4Y2DC 4XRCB 1OAZL 5C6PB 2G2RB 4AVKA 4FJ6A 2EDNA 3B6SA 4MD5B 5JQIB 1XF4A 4JDZB 3E8UH 5I1GL 1QUNA 5FA3B 3VFNA 1JXGA 2ZCHL 1ZGLP 2D31A 1BVNT 5FM5M 3DX4A 1ZLDA 1FZJB 3P0VL 1GC1L 3K3QA 3O3UN 3ZYJA 5IQ7L 4XNMB 2SEBA 3MRGA 1BQUA 3NN8B 1JNLH 5TPWH 2KUTA 3F7KA 4M5ZH 4V2CB 4W68A 1JUFA 3WIIL 2NDGA 2V3FA 2YLHA 3GMOA 1BFVH 1LO3L 5F9OL 4RAUB 4CDGC 4EEEA 3IETA 1J9RA 2AEPH 4IK6A 4JY6A 2J8OA 2W65B 3QJUB 5FIEA 3TM6A 5CR1A 2NW2A 5ICZA 3QQXA 1Q0XL 1J0JA 3IFPA 3EF7A 3H1ZA 2LFGA 5BOPA 4WK0B 2G3XA 3IBOA 2D2CC 4AQ1A 4X5RA 1YEEL 3AQZA 2RFXB 1DQJA 4PG2A 2WK2A 2XNAA 3FT2A 1VFMA 5IMMA 2IFFH 2J8UE 1JHKL 3VXUA 3SY0A 4O2FB 5JPMC 4U0QB 3GMRA 5IEKA 1AXIB 1T2XA 3GSQA 43C9B 4GAJH 3REVB 5FUZL 2B1AL 4CSZA 1BQLH 3HS0C 3HZYB 3DO3A 3BN9C 3S37L 2NT0A 3VRLE 3DIFA 2VLRD 3KLDA 4PJXE 2CDFB 4OI9A 3WN5A 4N2CA 5KYUB 2R0LL 5AWNL 1U8KB 3BSGA 1FYHB 4KJQD 4TVPE 2D73A 3CWGA 3PWJB 1G7QA 3FONB 2WBJC 3CE1A 1IAIL 5F6IC 4K9JA 3MJ8A 5D1ZA 2N01B 5LGJA 3ZRCC 3N44B 5GGQH 4JY5L 3RNKB 3VU1A 1OL0A 2ATKA 4EZLA 1MCPL 3VDBA 1D5MB 1CXEA 3H9SE 4PJFA 3MRRA 1JN6A 2OP4H 5AL0A 5KN5A 3CFNA 1FL5B 2FX9L 2XX0A 2XKSA 4IBQA 1KPUB 1LL1A 5IVXF 2X6AA 2MHAA 2R7EA 3GSVA 4S1QH 4JM4L 3VE0A 1A3RL 1WO2A 3QIBD 5TE6H 3TA3C 5B8CA 2EIDA 5IMKA 4PCSA 4BYHA 3IS0X 3R06A 3WJJC 2ZIDA 3BHBB 3HNTL 4LE8A 4FG4A 1S7VB 3ULUH 3WFZA 5JDJA 4WWKD 3HAEA 1KIRB 1ML0A 3G6DL 3RBSA 1NGWB 1OP3H 3QPQD 3F83A 1IX2A 2QQLL 4FLHA 3QI9A 4GW5A 5E4EC 1CIUA 5D1XC 1NCWL 2CGRL 1PGRB 3OKMA 1BZ9A 5CN2A 2D3NA 3QUKA 4OQTA 4YHLH 3RPIB 2PPCA 2ESVD 1DBKL 4N8VA 4HIIA 1Y18B 5CEZH 1HL8A 4M7JH 3T2LA 1HHGB 5L4FA 2QGEA 3FFOA 3BVNB 4M62H 2EC8A 3KNBB 3KPPA 4QEGA 5ANME 2VDMB 3F62A 1CU4L 3QR1A 4QKTA 4DHLA 2CO6B 4LMQI 1RP8A 3VCLB 5D7IA 1TJMA 2JKSA 4XMWA 3QP3A 1IEHA 1SMOA 3VGHA 1FCGA 3CVCA 4GLRH 4P05A 2OW7A 3F5WB 2ZG3A 3KPSD 2Z0BA 4E9SA 3DOHA 4NI6A 4XP5H 2QVMA 4N8CL 1MFBL 4JRXB 3VMOA 2Z1PA 2C3VB 2XN9E 1L0YA 3CZGA 4IRJD 1EXUB 4ZUUB 3O81A 1VFAB 2BDNL 3EDEA 2FT6A 2F7QA 1KTDA 3T0WA 1LE9B 1JPGA 1WAAF 3WIFA 1ZHLA 2OMWA 1EWHA 1U58A 2HUEA 4WI4A 5I8OH 2OAAA 1U91B 4OIFA 4B0MM 4WFGD 2WC7A 5FC9A 4MKMA 2YMOA 5HHOD 4D8PA 1J8RA 1FO0A 3WS6C 1HX0A 4Y89A 4PI2A 2H7WA 5DLLA 4J7RA 15C8H 2DQUL 3D0AA 5C0RL 5EWIH 1DL7L 4XI5C 4YDLC 4YZFF 4C55A 1NCIA 2NY5H 3KPRA 5KVDL 3MMEA 2X4QB 5D7SL 1U92A 3BZDA 3CLWA 5AB9A 2OMNA 4P57B 2CDFA 3QWQB 3KDPB 4IIQA 3B2VH 4HFWB 2YBRB 3LSOB 4L05A 3AABA 1BQHG 8FABB 2D31B 1C5DA 2J4WL 2QQKL 4DGYL 1A6AA 1T66D 4UBDD 3V0GA 3FQ1A 2R23A 4RWHA 1H6FA 3SE8H 3NJXA 2C1PB 4JZOA 3KEDA 3AM8A 2C7FA 1AR2A 4MJJA 5C8JB 2NXYB 1A7NH 5FF6B 1GYCA 1VAHA 3T6XA 5BJTA 5JPNA 1IGIL 5C08B 1JHTB 5LBSA 5IHBA 5IR1A 3PAZA 2EYRB 1MCOH 1N4XH 1U8JB 4MMYB 1A7OH 1DVSA 1JJUA 2BSSA 2JKXA 4NP4H 2HKHH 3OZLA 5JXAH 2KH2B 1XL4A 3BESR 4L8SC 1T6VN 5C0JA 3HMWH 1KYFA 1FFRA 2PKDA 2X2JA 4IOIA 3VGAB 4IBZA 4XCNB 1OCCB 2FJUB 4JHZA 5I6XB 1WWBX 2BOLA 4WI7A 4KNTA 1GGYA 3LPWA 4WWNA 2OCCB 5EU3A 4EZMA 2Q3XA 3IDYB 1EAOA 1AZCA 3OKNB 4QY8A 5EIIB 3T0BA 5KZCB 3DURB 4APXB 4K94L 5I26A 2TRHA 3UTSB 4M6OL 4QCIB 2GSGA 5EBLA 2F61A 4ESKA 4YZFE 2DEXX 4K8RD 1FGNH 5ID0A 5TDOA 1ZLUH 3X12B 1DE4B 3FH7A 4YDNA 3RGVA 5EO0A 3B2DC 2OSLA 4PU2A 3TVMD 1Z3GL 2FBJH 2WYIA 4L4VD 3NSDA 5F7YC 1JZ6A 3K6SB 4YBLB 1FNEB 1UKSA 4TQEL 4XNUH 4Y5VA 4WFHE 4EIGB 1GZQA 3GXPA 3QDMB 4IS6B 3RBGA 4AKPA 2NLJB 3GJFA 2FLMA 2H47C 3SKOA 5FO9A 3PV7A 5F6IB 5FR3A 2IDTA 3L9RB 3OKLA 1LO0L 3QUXB 1HYRC 1E4JA 4GW4A 1ZVYA 2WNGA 3KGSA 3VTAA 1RLWA 1YNTA 1DVTA 5T1DL 1QD0A 3U0PB 4UQAA 4MCZB 3CC1A 5EIIG 1I8UA 4DETA 2CNYA 3TNNB 2BJML 2R56L 4KDTA 4GRMB 4EOWH 1GGCL 4ZSOE 1A4BA 2G5UA 2Y2TA 5ICYA 3IU4L 3QZPA 4GQRA 4DGIL 1NC2A 3SDXF 2C9SA 5D1ZD 4YDZA 4NN6B 5ABDE 5D8JL 5I1AB 1IFHH 3JBG7 4Y4HB 4WV1A 5JXEA 3CK0L 1G7LB 1PKQA 2F54A 2O4EA 2CRZA 3ULVL 1RZGA 4K5PA 3HIZA 3B7TA 4XX1G 5AOLA 3O8XD 1YY9C 4NO3B 1BIIB 1GOGA 5TH2A 3PQYA 5D8JH 4NKOB 4PRDB 3U82B 3UYPA 4E5XG 3MRPB 3BFOA 5HHVH 2YPLB 1RZKC 2RHEA 3CBJB 3GJEA 5AVYB 1C1EL 4NKDA 4NPYA 3UTPE 4EI0A 1K9TA 2DIEA 5L2JA 2A9AA 5KBPA 2EDBA 4HJEA 3MUZ1 2E4FA 2PYEB 4X7CC 5JHLA 4LOFA 3G6JA 4LESA 1MJ8L 3D9AL 2Z8WC 4GXUM 4N8UA 5GSRA 4NUJB 1J1OH 4L9LB 1MUJA 4I77H 2UZIH 5EZOL 3K8MA 1AGDB 3A6CL 1WAAE 2HRLA 4UQ3A 5C0GA 5TK4A 1DVFA 4DOHE 1AZZC 2AS5M 5B1AB 4ZPTB 2ZOTA 4U2ZA 5EF1A 4WZ9A 1AG6A 1CD1A 3H0TA 4BZ2A 1SHWA 3IGLA 1IZKA 2GBVA 2ZOLB 2ERJB 4BQCA 1RUPH 3OJVC 2ENPA 2WLHA 1WHPA 2V5MA 4EN2A 4XVJL 2VC2L 4PLNC 3PXHA 2XKNA 4BWWA 3KYAA 3V6FB 5DJZB 3B8SA 3MLWL 3QCUH 3KYMB 2GCYB 3WFEH 2K8MA 1AXTH 4BCXA 1A65A 3FMGH 1E6OL 2C9AA 2YA1A 3S6CA 3SGJA 5I23A 4GAYA 4DP9X 4TSAH 4FQJL 3V7AE 3BWUF 1XF4B 3NCEB 4JDZA 3M17A 3OKEB 4HV8A 4IK7A 4EDXB 2BVPA 3WFHA 1ADWA 5JQHC 2ED9A 4H0GA 3RWCB 3UAJA 3MLYH 4EE2A 4L1HA 3PV6B 4IBVA 2JTDA 4ONGH 4FZEL 5M95B 1FPTL 1N8ZB 3I6KA 3LN5B 3UTZA 2C34A 5LXVA 5E8OB 1D5XA 2DF3A 5A6IA 5AZ2H 3MUGA 3K71A 1KCVL 4FNUA 5KSAC 4XPAL 3ZDXB 4FQ1L 1PMYA 3QZNA 3NJFA 5FX3A 1NOFA 4UOZA 2KHAA 2RQEA 3AGWA 1E3XA 2ZE0A 4R3SA 2RAMA 3TT3L 4MAZA 4AI7A 5FHBL 3D85A 2HAZA 3QIWC 4CU8A 5J9PA 4Z8FL 1N6QH 1RK7A 4PWIA 1ZLSL 4IRSA 3LEXA 3FU9A 2AAAA 3DV6A 2IADB 4JHUA 4JQIL 5LG1A 4Y0GA 1P4IH 2I32A 2AK1L 4G9FE 1NJ9B 5LDUA 1I7UB 3V6OE 1VFUA 3DX8B 5D6DA 3PY9A 3BN9D 1JN6B 3BCDA 2VDOL 5LNGA 2KKQA 4HJ1A 3FUMA 3GGWB 4ETYA 2P24A 4OF7A 4YFLF 5AOKA 3PUCA 1ASQA 3VFRA 25C8L 3WTTA 15C8L 5HDQL 5KJ7E 1WCBB 4P4RB 3FKUS 4JY5H 2WVSA 1R5WA 2DQFB 2G4EA 2Y36H 3MXVH 3RWDA 3ABMB 4LHUB 5CEZD 4Q52A 1IGYA 4G11A 5C0AB 4X9YA 1V7ML 4BE5A 4U0RC 5E1HB 5I8EB 5KVFL 5LNDA 4RNRB 5JW4Q 1OW0A 2H2SD 2C7UA 1OF2A 3K7UA 2VW7A 5FGBA 5T1KA 2YPLA 5ANHA 2BSBA 1LP9E 1AZBA 2W60A 4BH7A 2DW5A 1A5FH 1TQWA 4CSTA 4KKBD 3LKOB 5EOQH 1D3CA 5HGAA 3QEGH 5FM8A 1UXWB 2OCFD 2A3TA 4CMHB 1JTTA 2Q3AA 1KJVB 2R2HB 4NHUB 5DQDL 2BXZA 1KCRH 3FU8A 4M5YH 3HE7C 2WVTA 4XCCL 4Y19A 1AE6H 5CHNB 2KBGA 1TPXC 4XPTL 2GIXA 1WIUA 1NLBL 3I75A 4QRAA 1NKRA 3N1PC 4CNIA 4PJEB 3GLAA 3PWUB 2B5IB 4F9LA 3ARYA 6CGTA 1RQ5A 3NJMA 4PJBA 1Q0EA 4OB5H 5JHDD 3EJJX 1LD9B 3NZHL 4ANKA 1C8PA 4M8QA 1YJDH 4ZTEA 1HIMH 4TQHA 4EN3B 2YFOA 3DX0A 5IQOA 1OF0A 4XWOC 5ICYB 5F9JB 5DRZB 5EUOA 5J6HB 2C3VA 1Y6KR 1Q9KB 2FJGB 1H5BC 2WQXA 1PW3A 2G9KA 3U30B 1D9KB 1MCRA 4RETB 4F93B 1S46A 4LASL 5A2JH 5T1JA 4FXKB 4GH7B 3OR6B 4JFFB 2XN9A 1LJMA 2XN9D 3G6DH 1R5IB 3ULUE 5IQ7H 3S2CA 4FYRA 5ABZA 1EPFA 3BI9X 3FRUB 5ITFA 2E9IA 1UWGH 3SGKC 3ZZQA 4OIAA 1IAIM 5CSBA 4P2CG 3JWOH 5DFVC 4EI6B 5EC2B 5TE6L 4OCXL 3BD4A 3V8CA 4A37A 1UB5B 1FVCB 1KIQA 1MI5D 2PN5A 4LIQH 1L0PA 2APXA 1AD0B 4FQHB 1DEEB 3S35L 1A4AA 2X9YA 1BAFL 3P9LB 1CF8L 5GGTL 1JNNL 3T08A 1KJMB 1YY8A 1K72A 2ZXAA 1GAFL 5T5NG 1AQKL 2P47B 3QUKB 1XB8A 5FUZH 3UTTB 4AH2B 3D08A 3TV3H 4JM0A 4P9ML 5DWUH 1MAML 4R2GB 5LCVL 3O2VH 4O4YH 3S5YA 1NL0H 1SBBA 4RZCB 4F3FB 1MPAH 5KVGH 5GXBB 4QHNA 5ICXA 4GAYB 2X2UA 2EZ0C 3KPQB 2PW1A 1EEYA 4OCNC 1XGUB 1PDKB 5MEND 3S88L 4HUMB 1UG9A 4L9LC 1XQ4A 3BMWA 4XNZC 4CC1A 1RK0A 2QR0B 2R2BB 4PSRA 2VC2B 1BF5A 4EMZA 1QI4A 4F15B 1P9MC 4H8WL 3QPXL 1F4WL 3T04D 5F1KC 4ANXA 3R0NA 3QA3A 1L9NA 1UWEH 1BQKA 2F58L 4OZ4B 4P59H 3QUZB 2A2QT 4PPTA 4L1BA 2P46B 1JRHL 2MSPA 4L4VA 3K4DA 3T2QA 1YO4A 4WUKH 2ADFL 4YDKL 3VW3H 2FHBA 3FU5A 1W16A 2VLJA 2NY6B 2IFFL 3RFRA 3DUUA 2DQJH 4QRQB 3FHAA 2F19H 5ITBH 5EUKA 1KC5H 3NIFB 3WBDA 1XH3A 5JOFB 1MXGA 5IOKA 4HFWA 2HKAA 4Q9RL 1G87A 5D2LB 1ZIAA 1G6RA 5T3ZD 1GXEA 2E7DA 3E8UL 4OH2A 2CA4A 5EV7A 2OQJA 3ZPDA 1A4CA 3PWVB 4JCWA 1G0DA 5K9KA 1W0VA 3LS4L 5CJ5A 2QPDB 3FB6A 4FABH 1CTNA 4MJ6A 4PJAE 4K3EH 5IEHB 4M6AA 5ESVB 1QASA 1BXXA 3HCVA 3QEHB 3PAUA 4PGDA 2FJFA 2WLLA 5FYJE 1CLZL 2PTTA 3FB7A 3KBPA 2UXTA 3H3BC 3OZKA 3RFZB 5ISZE 4OI7A 2L7QA 3KPRB 3WFCL 1LO2H 1S7WB 2VITA 4PJAF 4LRNL 4UZGA 3GTNA 2YS4A 1IARB 4FFZA 4KMTH 3RDTA 4F7EA 1R5VB 4RMSA 5HYSG 2HZHA 3HS9A 4YJZL 4JRYD 5ACLA 3TWCL 4MXVF 1CF1A 5K93A 4JNXA 4N85A 5CEYB 3LPPA 3VXMB 3L4YA 4IGBD 4HJIA 4PGCA 3HNSL 5KTEL 1AGCB 1PZDA 3BLPX 4ZD3L 1L7IH 4U6XA 5EORL 1N10A 5HGGS 4JB9L 1A6VL 1SUHA 1G7MB 1J8KA 3UZEC 3RY6C 5LUMA 1GMEA 3B56A 3TZVB 1SOQA 4XPBL 5B4MD 5HHQB 3EDDA 3L45A 2VDQH 3DTDA 1LDPH 3ZYIA 4JEGB 4L5FE 5I8KL 4YR6B 5EBMB 3RNQB 3QUYD 3ELAT 4X4ME 1TZIB 4ODBD 5GJTL 1FFOA 1L3NA 5T1MA 2IWGA 2P1YA 3EDJA 3MACH 1F1AA 3CDZB 1FNEA 5BZWB 4A68A 1FIGL 1N5AB 5DMKA 1I1AD 3VFNB 3C6SB 5I18H 1FNSL 1BOYA 5E9DA 5F8RC 3MFFB 4G83A 3IRZA 3P2TA 4EIUA 4OZIA 1GCFA 1QFWL 4J3SA 4N90E 1KZYA 4V1DE 1HH6A 3CH1B 4L3CB 1F2XK 4ZMZA 2EDDA 1MCDA 3B5TA 1HZKA 3TS8A 3L1FA 3TCLA 1UJTA 1X5JA 2C9RA 2FCBA 3GZKA 2HB0A 1R5IA 1BJ1H 1QSZA 3BPOB 3EJZC 2B4CC 4J4PA 1PDKA 1UYWL 2IDQA 4UQIM 4G80B 3WIAA 5ADOH 3VX0A 1BP3B 3AVEA 5FA4A 3WEXB 2EUWA 3OKKA 3GS7A 1CDUA 1RK1B 4GINA 1D5ZB 2HLAB 4J8QA 2ED7A 2VJXA 4EDWL 2GTQA 3MUUA 3NDZE 4WHTA 1BF2A 4M6MH 2P52A 1WVZA 4EN3A 4KK5C 3F64A 2YPVH 3LEYL 4HXAH 3ULVE 3DBXA 5B3NA 3ECVA 3GI9H 2ZUXA 4Y8AA 1Q9KA 2F8OA 4Y4FD 1ZT7B 4FQXB 3WGVB 3B2VL 4YSEA 4X4XB 1ZIBA 1DQTA 2AABH 2BZDA 3M1OA 4XZ4A 3OKOB 2ZWLT 4I4WB 2IALB 3QCVH 2AGJL 3DXAB 4XPGH 4CRPA 2WMPA 1WT5C 4F5CA 1HQ4A 4ETQB 4MA7H 4FA6A 1JMZA 2X09A 3NH7L 2BP0A 5CGMA 3MRKA 2X70A 4LCWD 4TL5A 1E4WL 4A2MA 1UB5A 1MQ8A 2YD8A 5GSRB 5CCKH 4C4UA 4JZJB 4KRPB 3RJQB 5KSBE 5GRZA 5IVZA 1KN2L 4DP8X 4NPKA 4LKXA 2VN4A 3HBPA 4D0CA 4QF1B 4C56D 1V3LA 4HXAL 4XBEL 3V5KA 3HCVB 3QEHA 4Y1SA 5AENA 1LLAA 1MFDL 2ITFA 4GUPA 3WGUB 3SDCD 5C0BE 1CB4A 5T3XE 1T0NB 1K8IB 4YHNB 2E9BA 2UUDK 4WNSA 3KG5A 5ALBH 5JOPD 1HSAB 1PZAA 5DVNA 4TNEA 1MHEB 2CHWA 3IXAB 1CVRA 3OB0K 4LB8A 1YEGL 1X9QA 2FZ3B 5GGVH 4WNQA 4QHUA 3I02A 4B5EA 2OYLA 2YEQA 4YDJB 1I3VA 1KXQA 2R23B 3AG3B 5EBWB 4GB9A 4B9JA 4JO2H 4KY1L 2YA0A 3EFDH 2OMVA 2IANB 4P23C 1IAIH 2OTWA 2FEDD 1G6RH 2D7TL 1MVFA 3AT0A 3MBWB 5MERA 4X42A 4HD5A 2A4ZA 1X5IA 1OSEA 4AVIA 2I60L 3RKDC 1ZPLA 4PGZA 4YX2H 2G30A 1TQBC 5ESVA 4YMPA 2P42B 3U6RA 5C09D 3U25A 3UFIA 1P5VB 3HHSA 4QRBA 1T20B 2NY6C 4FLSA 4R96A 1UKQA 3LZFH 5A2LH 5FYKD 4K7PY 4FXGA 4YBQD 5FWRA 1IBZA 1J0HA 1J1PL 4IRZA 4RSYA 4XAKD 2LHAA 4MCMA 3SPIA 4DGWC 1MHPH 1NPUA 4P8QA 1I8KB 4QI3A 3VH8A 3GSRB 3IDXH 4ZPVB 1NIDA 2XXMB 4C56E 1K5WA 3D7PA 4H20H 4OF5A 2V2TA 3VVVA 2WAQA 4YBQC 1YUKB 5GGSY 4L0ZA 1U3ZA 3TJEH 4KZEH 3RTQD 3U2SB 4G6AC 2WOBA 3RL2A 2BVPB 3MA7B 1D5RA 3L95A 5KUMA 1WE5A 2EE9A 3U36A 1Q0XH 4CSSA 2BZ7A 4E36A 1CFQB 3QUGA 3IE4A 4F33B 1LP9A 1J18A 1NGWA 5IFHL 1INEL 1SFDA 1FGVL 3O2WH 4PTTB 3RX9A 4IDJH 4X2UA 4P2OB 2BSDA 3RB5A 4UIMB 3ZIYA 2LGNA 1EGJA 1G7IB 5TE7L 3HZVB 1UFUA 3S0PA 3AG2B 3G5ZA 1OWWA 4XP6H 4CDHA 4XMLL 1ZS8A 3F84A 2ZPKL 2WLIB 4G8GA 3OF6D 3KPMA 4GFXA 4LU5L 3QG6B 2CCWA 3IMSA 4QTHB 5A2CA 2Q7YB 2ZKWA 3G9VA 1T21B 4YDKH 2CR3A 4UM9A 2DLFH 5CNHA 4P5TD 1A9VA 2DQTH 2ICWA 5G5DB 4MBRA 1A3QA 2ATKB 2XVKA 1U8PB 5D7JD 2F58H 4P59L 5E4EB 4B9FA 3Q2CA 4JE4B 4JN1L 2E7MA 3L3JA 4EF3A 4JGJA 3V0DA 1LE5B 2CDEB 4FNPA 3KWTA 3DVFA 1UENA 4U6YA 3LH2L 3AAZB 1ZA6B 4NWTH 3LNHA 1BM3L 5BZWA 3A0OA 2CBTA 1NBZA 4XVOA 4U4BA 3QJXA 2JKTM 1N6UA 4D9QD 2BC4A 3H42L 4UOW1 4L0PB 5I75B 5BRZD 1K4DA 4NM8H 4GSXA 4LP4A 4OBRA 4XMLH 3FUJA 4XAKE 3R7QA 2H6PA 2R9HC 5ILTH 4JGUA 1OTUD 2CJUH 1UVQB 2XV2A 3GS4A 1I85A 5DJCB 3KJ4C 1T03L 1EEQA 1XO8A 2VLLB 5LLIC 4RGOL 3QDJD 2IO5A 4X9BA 4GXFA 3QWOB 5H4ZA 4JDVB 4JKPH 3NK3A 4OVVA 2NOYA 4YAQB 3V7AG 1EHKB 4OCLC 4JRWA 3GLEA 1LEKB 1P6FA 5TFSH 4QHUB 4YE4L 1U91A 3BAJA 4ABVA 1N59A 5EBWA 4JFTA 1MI5A 3WTUA 3CC5B 4NOFA 3O6FB 3BPLC 3GINA 3SKMA 3RWIB 4JPVL 3C5ZC 2XXGA 2VIRA 1TJIL 4U1NB 5D4QA 2J44A 2WHVA 3MCKA 5ERWB 4HWBL 3F3HA 5ELIA 2Y25A 4PIBA 4NNPL 3QIUA 4RRPA 3O6LL 4X4XA 3FT9A 3WLWD 4KTEH 1DANU 3MV7A 2RTTA 3IMBA 4MBOA 4MJHA 1A0QH 4KK6C 4QMEA 3RL1A 3ERXA 1W72A 3SE6A 3RIFK 3VB8A 4CN4A 1UWGL 5E5MA 3MTRA 1A6UH 1FYTD 1S5IL 1ZTMA 4ZMYA 7TAAA 4F7MB 4GO8A 1PZ3A 4YL9A 3SDDC 1QQDB 5HDQH 1XDTT 1DJIA 2CJSA 1E40A 4EKXA 2YQGA 4YUEL 2CO1A 4DOHB 2DDQL 3IDIA 1MRCL 4XOCA 3RWFB 2VDOH 1TTCA 2L4OA 4A1RA 2NX5E 4Z3JA 1IVTA 2B14A 3K0YA 3K2UL 1MAMH 5I0XA 2ICWJ 2FSDA 4FA7B 2VYRE 5E99L 1IAOB 1MFMA 4A63A 1KGUA 5ALCH 2NXYC 3ZE2E 4A2FA 2Z93B 1YZZA 4Z0XB 4FE9A 3CJJA 2EDTA 4TUOA 3MRGB 3GBEA 3E2HC 1NCDL 1ECYA 4JPIA 4KJQC 2D7OA 2JH2A 2OJZH 2DTSA 2GEEA 2VLRA 3EUUA 3P3SA 4ZO6A 3T0EA 4UIKH 4JPKL 4NQED 4YDVB 2DZEA 3RUGF 1DL7H 3TBSA 1UT2A 4KROD 3TCXA 5AW6B 3KCPB 4K23L 3DKHA 5GGTA 2F53E 1F3JB 4XC3H 4HA1A 1UZ6E 2LVCA 3O3DB 1R24B 4J6RL 5DCCA 5TDPA 4P5KA 4O2EB 5F9WB 2RCSL 1AS7A 5DO8A 1ETB1 1OB1B 2HKFH 2D03H 2P8LA 4G6ML 2X38A 3IFLL 2A9MH 5EIIA 5EO9B 1BEYH 1CCZA 4HEMA 3O9WB 3O6ML 2GSGB 5EBLB 3WEOA 1TKWA 2N1KA 1CFNB 3V52L 5MI0C 3ETBF 4N1HB 3SPVA 2ESVA 1FFOB 4OB5L 3WL9A 1AXTL 4WHDA 1EHXA 4HBCL 4Z7VE 2E0PA 4KH9A 5DT1H 1NAKL 4X4MA 3WN5B 3NFSH 3FL7A 5C0JB 3KVDD 2IDSA 4NN7B 3DIFB 4U1KB 4JQXA 1VF5C 4IOIB 3ARFC 4EDWH 1DBJH 5GZOD 2J88L 5F3HB 1SLXA 1FQ9C 2IXQA 5KW9L 4GKSA 1JD7A 3PWPB 3D6GA 4PCTA 1N12A 3X13A 4XP1L 1FZOB 5KWYC 3NCMA 4NO3A 32C2B 4FF9A 4G6AD 4GQZA 3EJPA 1U8OA 1KV3A 5JORB 5F7FA 1CGVA 1OANA 1MCQA 1R3LB 2GJZB 3UEZA 4H8WC 3RTQA 5E6IB 3I6GB 3ECUA 3ZT5A 5ADPL 3L3JB 5DWPA 1LE5A 5IGXL 2X9WA 1F6LL 5D7LE 4PVLA 2ZCKH 5IKCB 1SOSA 1GGIH 2EDLA 4FZEH 2DQHL 5INDB 2CIIA 2QV4A 5SWQA 1IGFH 2LTQC 3KBHE 3JXAA 4JRYE 1MRFL 4XPHH 5FAAA 1BOGA 2VLLA 2DM3A 1XT5A 3D25A 1M1XB 5B1JC 1M05A 3U6XS 1YNTB 3EGDB 3BVWA 4U1HA 4Y1AA 1T83A 2BY1A 5I19L 3MRPA 1X4YA 5EN3A 4DGVL 2QDVA 4WWKB 5LXGH 3UIYA 4FQQA 3IVKB 2AQRA 1RERA 4QO1A 1BF8A 3TIDA 1F0LA 4PG9B 5HGHB 4GEIA 3S37H 1XF5B 4KI1A 2A9NH 4AK2A 2IH3A 4D0DB 3EH4B 5AW4B 1QSED 4Y9EA 5CP7A 5E8NB 3R7RA 3LIZH 3O0RH 1OE3A 1EQWA 3LZPA 1UJ3C 1DN0B 4LT7A 4EOWL 1EVTC 1HHGA 3B3BA 3II2A 3BDBA 3E0GA 4PUBH 1E28A 1NC4D 1TLKA 3P9LA 2G3MA 1UM5H 3L3HB 1MZZA 3NJNA 1WBZB 3AQDA 4U1GC 2XWTA 3VB9A 2QHRL 4PTUA 1FAIL 1PLGL 4WKXA 3P02A 4HYTB 3NEOA 3SY6A 4H26B 3DPDA 4Q2ZB 1OCWH 1KTKE 1S3RA 2QLYA 3DI2B 3EO1A 3T0VA 1E8YA 1A9BB 3QJRB 3IBEA 2CK0H 4JPIB 4HVBA 4PJ8A 4APQB 1UH4A 2BS8A 3MXWL 4PJ8D 5ICXB 5MEOA 4PB9L 3FO0L 1C12A 4F7KA 4F57L 5DJ6B 4N9GA 1BMGA 4B50A 5D1QE 3MAWA 1HFUA 3U4KA 1BVKB 4KXZH 1N26A 1OAYL 4PIRF 3TH2T 1NMCC 1KXQE 4TNWF 4YH6A 5IMOA 4FYSA 2CJ3A 2VERN 1GSMA 3G5XB 3WJLA 4MA8H 4TUJB 2BXYA 2XXCB 3GQFA 4L4TA 1TFPA 2CZNA 1QUPA 2VDNB 1DBBH 4NCDA 1RJZA 1T89A 1FLTX 2WQWA 4GT0A 4XXCC 1R19A 4XR8C 4DKTA 3GBDA 5J3HD 5FDYA 2P45B 4TUKL 4OLUL 4R4BA 2DS4A 1K4CB 5EF2A 1NMAL 2YOAA 3ZJAA 4ZOCA 3W38A 1G0YR 3OLEA 3V10A 1EIBA 3CHQA 4GPVA 4W6YB 4N8VG 1KB5B 3GMNB 1KXTA 4UNUA 4FNLH 4IMLB 4JM2C 2ATPB 4Y16D 5A40E 1RJYA 4DESA 2IBBA 1J1PH 3CBKB 5J6HA 2NY2D 4UV4L 5BOJA 1HXMA 2NY7L 3U1SL 2DWSA 3ZE0B 4MJ5B 3WTXA 2XWBB 3QFJD 4JG9A 1KTJA 1T2JA 3SKNB 1TJGL 3V5DA 1XCWA 1GYVA 4BSWB 3OVUB 4X5QA 3RGVD 3RWDB 1DFBL 3DPBA 5BUPA 4WEBL 1PAZA 5G4MA 1CWVA 4G6KH 5EZPA 4HS3B 2XVBA 5IWLA 4GG6A 4P2QB 1UGKA 1JPEA 5ECGA 1BLNB 1PAMA 2XA8H 2Y72A 3D4ZA 1ACXA 3CFKB 1BIHA 5DHVA 1C7TA 4DPCX 2NYZA 2YK1L 1ZS8B 5F6HJ 4JL2A 1P1ZA 2DWEB 3CHRA 1L6PA 3LEXB 5FGSA 2KS0A 5DMGC 4KAQL 3T3PB 1DVXA 4ISVA 3QQDA 4E0RB 3LRMA 1UT1A 1MCIA 1A2YB 2ZX9A 3M86A 4U1MA 5B38G 4CADA 2NTSP 1KYUA 5I71C 4KXDA 1JZEA 2FD6L 2AKRB 4QOKD 3L5HA 1A8JH 4NERA 4DN4L 4G7YL 4HIHB 2CDEA 1NIFA 3UTSD 5I0ZA 2OXGA 1NBVH 1I9JL 5AYQA 2EE2A 1O6SB 2XQYK 1TO4A 1I4FA 3B7YA 4NRYB 4UDTB 1KCSH 1VJSA 5I1AA 5DZ9A 3VXRD 2EDFA 1U8LA 2R1WB 3EFOB 3TVMB 5IB3A 1IC5H 5I16B 5KOMC 4OLWH 5DJ2B 2ENJA 3QEQD 4Y19D 4OZIB 4W6WB 1YEJH 4LL1A 4IBUA 3IGAB 3SJVE 3PP3K 4ABUA 3WDHA 1G9NH 1WQVT 4LSTH 4PHZA 1RFDL 1NGXA 2YO3A 2LW3A 4HGKC 4JQVC 1HYSD 1JZGA 1JWUA 1A7QH 3CSGA 5FECB 1NMBH 2FK9A 2Z6FA 3Q8BA 5HP5A 4XX1E 1JAEA 3QO0A 4G7VL 5FKPB 3NP3A 2A6KA 1UOKA 3V6FA 3RVXD 2CLVA 5MEPA 1RJLA 4M7JL 2BW5A 3FU7A 2OZ4A 3HOGA 3QR2A 4JO1L 4HSCX 3S5LG 5JZ7D 5IUSA 5HI5C 4GUQA 1JYVA 1UFGA 4R84A 4CVZA 1ID2A 1QBMH 4UTCA 4W6XB 5EEXA 1S2EA 5D55A 3T3ME 5J12B 4WKZA 1RSYA 4IMKC 2YXVA 1DN0A 1VB9A 2IV9A 3CFEB 4XP9L 2ITCA 4MZ3A 1GC1C 4UF7C 4H8PA 4FQ2H 3OKEA 4WFHD 5C2BL 2HJKA 4FD0A 1BPVA 4K3HA 5FB8A 3O8XB 3LDBC 1GYAA 1IQDB 4JM4H 5K9OB 4MAYC 4YHYB 4TSCH 5G2NA 2YFNA 4PW3A 4CSPA 3EJSA 4N26A 3P69A 3DGGB 4R2GC 2CPUA 3ZT7A 3EJCA 2C9PA 1FHNA 4RIRA 1RL1A 4ZMLA 1CUOA 2FUTA 3QNXA 3QSKB 4EBQL 1JGDB 2JKLA 3JWNE 4FZ8H 3ALPA 5DD5L 2DJSA 3X11B 3SBWC 1W0VB 3LPGA 2HXAA 4J6RH 4XCYA 4MQTB 3GFUA 3MCKB 3THML 1ASPA 2HJFA 5HJGA 5DD0L 1CD1B 3H0TB 5FM5O 2ISDA 3AY2A 4GFTB 1U8HB 4L2LA 5E2UH 4X7SH 3KPTA 3PIQB 5DJAB 5E7FA 4DPRA 1T1WA 4ZW7A 3FO1B 2XA8L 3CFMA 5GRVK 4GAFB 1EO8L 2VISB 4JHWL 4BSWA 1JDDA 2AGJH 2VLJB 1BZOA 4ZO8A 1DDHA 4ZI8A 1KWGA 1IM3D 1S7WA 2VITB 1MY7A 3O3EB 3CFDB 2FLRT 3QNZA 2W65A 3IKKA 3UGXA 2FECI 4N6QA 4POZC 5FEBA 2ATAA 3FB6B 3SKJH 1DBJL 2BSRA 4YO0B 2J8UF 5FYKE 3V4UH 1KEML 1GIGL 3GZPA 2XZZA 4GUCA 1ZY9A 1U95A 4KDWA 4LLYA 3L3KA 1GJWA 2WXLA 1OF2B 4AQZA 3H3KA 1PFCA 4NGHH 1XD1A 4U1IB 1I53A 2DAVA 2WXRA 4PRBB 1BYNA 1OTTD 4LRNH 4F37K 4LPCA 3L2MA 5IVXB 1MCBA 4KGJA 4Y5VB 1RIUH 5AUMB 5HHMD 1O9WA 4U1LB 5GZOC 1UXMA 1S7TA 1V54B 2X88A 2I07A 3WSQL 3NCYS 4A7TA 1WD9A 2P5PA 1TENA 5L2KE 2DIAA 1A14H 2YD4A 3LRSB 3T4YA 5E9DB 1YEHH 4AOFA 1BBJB 1Q94B 4WNJA 2R0WH 4RMUA 1KELH 1LP9F 1BWMA 1FNAA 3EYUL 4BINA 4V1DA 1R24A 5TDPB 4G7QB 1ZT7A 5DMIH 3WXWH 1YMMA 3O41A 4XXDB 1IU1A 1KC5L 3KYNB 1CDIA 2DQJL 3ZYOA 2GI0A 4XBGA 3GSUA 3N55A 1IEBA 2IADA 1OAYH 1P5UA 5IY5B 2GK2A 4XVJH 2A74B 2F1AA 4OZHE 3WFBH 5HHPB 1GW0A 3I50L 3WS3A 3CHOA 4KNUA 1FH5H 1LNUB 1V7NH 3BGMA 3BP5B 3BJ91 2WNKA 3LRKA 4G3YL 4G8FA 4P3CH 5D2NA 1FL5A 3L3GA 3WNIA 3KLHD 5GQBA 3RIKA 3MBXH 1KCKA 2UY6B 3V55A 3VWKD 3S34H 1OE1A 2I9TB 2V4LA 4JLRA 1A1OB 3OX8B 3QUHA 5GSVB 4N2BA 3GHBH 4XN9A 4P5KB 4I18B 3CH1A 1XEDA 4JRYA 3EO9H 3P4LA 1JCVA 1KBGH 2VL5B 2Y1VA 2FWUA 1FBIH 2UZYB 1MCPH 2V7HA 3N85L 3IPFA 3TIDB 4F5CE 4IOFC 2C8NA 3A22A 1EERB 2ITEA 4FQQB 3BXNB 3W57A 1IKNA 1QSFA 4NHUA 2WIIB 3ILEA 1ORQB 4NUGH 2OM5A 5IROD 4CMMB 3QDAA 1TMQA 3QUYA 1MNNA 2YAPA 4HWBA 4IBLT 4PMEA 3A47A 4DGVH 2ZWYA 3CK0H 3DYMA 3HFFA 4UNIA 4ZXBB 4F8PA 3UPRB 2PCXA 1EFXB 4C8XA 4GI9A 4NJ9H 1E4XL 1QTPA 2CM5A 1F18A 4I3SH 1CR9H 5SWQB 4EQ3A 2QVFB 5DS2A 4WRLA 1QWNA 2ZOOA 1AJ7H 5JOPE 3AXIA 3EYFA 1Z3GH 3L13A 1NCUA 1PSKH 1OTUC 1OM9A 1ERNA 2J8UA 3NIDE 3CFTA 5JHDB 4BQBA 4Y4FA 1EZUA 1JRHH 2V5SA 3AW5A 5AW2B 4DERA 2O5YH 4EN3D 3CZJA 1TU2B 5DJDB 2GYSA 1U3YA 3H3PH 4FQLL 4ODVL 3H9YA 4F9PA 2NY0B 4NKMA 1E43A 2RBLA 3MA9H 3IDJB 4PJEE 5H37H 4E9LA 3V5KB 4OI8A 3KVQA 1RZIB 4X0KA 5LN4A 3GKWL 3BP4B 3J07A 4JHAH 1HS6A 1TZHB 1BFVL 4G9FB 4LLDA 3GMPB 4D0BB 5I8CA 1MIEH 2JELL 2WWMD 1OP4A 5DK2B 2JK5B 2A9DA 3U79A 2JCCE 3D0VB 5IF0A 4HALA 4XMKL 4L4TB 4M6OH 1NDMA 2AJXL 2Z4QB 1MCHA 1ZGLA 1E7UA 3SB3A 4AH2A 1RJZB 2QMKA 4KHTH 5LGHH 2PCPB 2WMPB 1IGCL 4KKLD 4W4OC 1JFQL 3GD1C 1JZHA 2KZ1B 2Y5QA 2AJ3B 2Z8VC 3VYNA 4PRHE 4R2GD 4XCYB 4B95C 2OYMA 4Y9GA 2AITA 3SKUD 3HI5H 3OAUH 4XAWL 1KXTB 4DKFL 1ZWIA 3MRNA 2WUCL 4Z3FA 1I7UA 2AK4A 2WKLA 3HG3A 4KPHH 3ZL1A 1ZXKA 4QLRA 2WAHA 4HT1L 1TTAA 2R2BA 2ZKHL 5F1NB 2V8MA 3TWYA 1P5UB 1M3IA 3H7BB 2QADB 4O00A 4XVTL 3GSNH 2P5WD 3UTOA 2OLDA 3MJ6A 4ORGB 4WGVB 3OZ9H 3IDGA 1OCOB 4HZAA 1LO4L 4C4KT 5IFHH 4U6YB 4ALAC 2ADYA 4P2OA 2ZSWB 4FI6A 5JLZA 1KUMA 1JNHA 1GZQB 1PG7W 3KEHA 4IS6A 5HYFA 3VWJC 1A6WL 2VSDA 2CGYA 2ALWA 5E8PB 4QXUL 1MJUL 1JV2B 4U1LA 2P5EA 1R0AL 5EC1A 1WDAA 3BH9A 3RTLA 5GS0D 5I0DA 1F97A 3JT2A 3UJJH 3V4PB 2D7PA 5C9JA 3JTTA 5AAWA 5D7JC 1Q8MA 4U1IA 4ZW5A 4P4KA 3L9YA 2FBRA 4Z5RA 1QVOA 2EO9A 3VJ6A 1SN0A 1A2YA 5CSZB 4Y2LA 1HHHA 2R69L 3OHXB 4UAOB 3OZ9L 5HTSA 3BUYB 4M4RB 5C0IA 4KTYA 4QXGH 1JXKA 3S96A 5FGCE 3HHSB 4UTBL 4LVHC 3KPLB 1A3LL 3MGOA 1BAWA 3ROLB 5AAMC 2K45A 2VW6A 5DMJB 2R27A 3QQNA 2VDPH 2WQVA 3CVIL 4RMVA 2EDWA 2R7EB 3UBXB 3PU7A 4F7TA 1QNZH 2ROYA 2XIDA 5KYXB 3TVMA 1TQCC 4OD2B 5I2IA 5DHVB 5IB3B 3H4FA 4L8DB 5EEZA 1ZT4A 3TYFA 5CP3H 3UPAA 3LOWA 3OGCB 1U3NA 3CAFA 4GO6B 4LVOB 3VFPA 3ZN6A 3ZUCA 2X4SB 3LRHA 4N25A 2APBA 2GEQA 1YAZA 5IIEB 3IB4A 4OFKA 3NJJA 3V5DB 3WNLA 4DZ8B 4AW7A 3OKOA 5C0ND 2VDMH 1U3HD 4F20A 1AGEB 1KACB 4YLBA 1KG0A 3A5VA 4LBEA 1QHPA 1KJ2A 1MIEL 2JELH 4FGMA 3BD5A 3T4AC 3UGUA 1M7DA 4E2OA 1TJHL 3GIZL 4MQ7B 2ZOKB 3QORA 2YGVA 1UVQA 4X0KB 1TLMA 3HC0B 3JUZA 2ZG2A 3QUYB 2GBUA 1HOEA 4JZJA 4JG1L 1RK1A 2FYVA 3C60B 3KJ4B 5FHBH 1I3GH 5FUCE 2R2EB 4DUVA 2UXVA 4OFYA 3GJFH 5IOPA 5D7HA 5CM1A 2G75B 2HVJB 3FBKA 2B59B 3K6DA 4YGVA 3IJSA 4MCNA 3UAEA 3KLAA 4MNGE 3RA7L 4ZAKC 3ARGD 5BXFA 5EU6E 4YHZL 1S3KH 2TSBA 4IRZL 2WWOA 2J6EA 4PD4J 4XN8A 4KKPA 3CD4A 2VCOA 4R83A 5ICZB 5BO1L 4LEOB 4FQLH 1LE9A 4W93A 3UZQA 4GKOA 2XKUA 4DO5A 4G9DA 4L29A 1CLZH 3IGUA 4ZUUA 5FYKH 5H2BA 1KCSL 1DQKA 2C3GA 1OTSD 2ICEB 3ZBMA 4ZD3H 3CLEL 1JDCA 4NNPH 2CCLA 1XIWA 1G7HB 5IROA 2GUOA 2YUXA 5HDBF 5TQ0H 4Y5XB 1B3IA 5IW6A 3EO1B 4HK3N 3LNDA 1RUML 3Q6FB 4TNFA 4ZX4A 4GXVL 5ISZB 1GA2A 1NUDA 2XVGA 4I0KA 4ZG1A 4NFCA 4CW1A 2F18A 3D85D 1AFVL 4I2XB 5I6NA 4JGNA 1N7ML 4A6YB 5I28A 2XSKA 1TSHA 4ETQA 3Q5YA 2ADFH 1TEYA 1UHVA 3VWJB 2X6CA 4MTMA 5D6CA 4LDLB 3VRJA 2IALA 1FZMA 1F3RB 4NQSB 4PBVC 4JFDD 3DXAD 1N3NA 3ZDZE 2YQBA 3K4AA 4GW1A 4ADIA 4IU3B 3B2PA 4NZTH 5DHXB 1FNSH 2VSCA 1R3HB 4LO9A 4BDVA 1EHAA 4F58L 2OKMA 2W9DL 3K6IA 1F3JA 5AZUA 4MA8L 4UU9B 7FABH 2G4GA 1K3IA 2CD0A 4EDXA 3LKQB 3W9DB 5LG6A 2PUQT 3CZFB 1GVIA 5EH1A 4HZLA 4PJBF 4FA8A 2ZCLH 4JM2D 3HBZA 2VZTA 3RKPA 2WP3O 1U8JA 5CINH 2VLMD 2FNBA 5GS0H 2HX8A 1KTBA 5DUPH 1LEGA 2UZXA 1Q9WA 7FABL 1WZLA 3O3EA 1G94A 5E1GA 2K4AA 3SE4C 2QVTA 3NESA 3OPZH 3Q9QA 5DYFA 4ZFZA 1CF8H 1SY6A 5GGTH 1S7TB 4LHUG 4AVHA 4YX2L 2O5XH 3MRFA 2BSCA 4PJIF 1QZ1A 4R7LA 3ATBA 5EOTA 1M71A 1M4KA 4OV5B 1NSNL 1JWSA 4LVNB 2A6DA 3PGDA 4HAFA 3S4SA 4AG4H 4XXWA 3H2PA 4N87A 1F6AA 4LIQE 5GS1B 2D7TH 1P4LA 4NRXB 5SX4H 4ELMF 3HFMH 1P7QA 3IDNA 4PCYA 3T1FB 5IFAH 4WSKA 3PQYE 1NKOA 1C08A 2XWEA 2RR3A 3WU1A 1FZOA 5TPWL 5AD0B 2B3RA 3B2UD 2K1MA 2J72A 4RRPG 3V0WH 2X1WL 3ASOB 3FRPB 3T0AA 1XVSA 4YHOL 3QORB 2ZAHA 5C09B 4PVBA 2A7BA 5GGSB 2ZG1A 1UD2A 1KYOK 5T3XD 2IXQB 1AZRA 1WV7T 3C5JB 5HDBE 4N5ED 1YYML 4X6DE 2H0JA 3VGBA 4LCIH 4TS6A 1T04B 4H4NA 2DD8L 4PGEB 5ECJE 2VZ3A 1QVOB 3D4YA 4ZS6C 3TJEL 3SGDH 4KZEL 3CFQA 2FX8L 3WO4C 1IGYB 4L4JA 2F19L 2ZXCA 5GGRY 1BVLB 3IAGC 5BNXD 1AD9A 3IDUA 1CDYA 5TQ2L 3UAAA 1JGLL 4UAOC 4DFIA 4YWGL 3RTQB 1FWXA 2BOCA 2P7TB 4G42B 4QRTB 4WI2A 3X2QB 5JW3H 5L4MA 1U8PA 4R0LB 1YY8B 2EP6A 1VADA 3JSSA 3D18A 4LSSH 1ZE3C 4FYQA 1KJ2H 3UCRA 3GSWB 1YG9A 2J3SA 4F7TB 4PB0L 2A1WH 3BAIA 4LVHB 5I15L 4XPFL 3ZTEA 3QR0A 4PJCB 2CO2A 2Q6WA 1OSPH 4NQXA 5GRXG 1JMXA 1ZDQA 2YIHA 1NLDL 1J9TA 2K6YA 4EI6A 5JZ7C 2OPCA 1CFSA 4QHMB 4Q9QL 1HNYA 5KVFH 2H6PB 1GHFL 2XZAH 2H41A 2APFA 3LEYH 1ED3A 4UQBA 3KS0J 3KYNA 2WTOA 3PP4H 4M5YL 4K5MA 5DFVD 1WBZA 1QBBA 4D8OA 2KYIA 4LLAA 5E56A 4RZCA 2OMZA 1YHPA 2E8ZA 4MD4B 4OZFH 5DD5H 5E0QA 1KDJA 1SLUA 1UCBH 4Z7WA 5E6RB 2HRPH 3ZTCC 2IVFC 5K9JL 3ZVVA 4N2HA 4LF3B 1M57B 3GBNL 4ONHA 2EVHA 2NMSA 4AL8L 2GBTA 5DC4B 1QSEA 4XTRD 2DJMA 3R18A 4KKCD 1RHFA 2I9LB 5CO1A 2FQGA 5DTFA 1CDHA 1IBHA 1MLCA 2IH1A 5HYIA 2Z8SA 4I1PA 4Q9QH 1KIQB 3KLAB 1AKJD 4ZFGH 5IW6B 1N0LB 4JMXA 4OFIA 3CMOL 4ENED 3OKDB 3GPEA 4ZAKB 2Q3ZA 3E9TA 3EGDA 3HVNA 2Y2WA 3LD8B 3KE0A 3MACL 2A73A 1JPSH 1JWMB 4YHZH 5DEFA 3Q05A 4HKXA 3W11C 1F41A 1B2WH 3VXOA 1XGPA 2OTUA 3THMH 1ZLVK 4MAUL 1BECA 1Q72H 2ICEA 1EA9C 3CFKA 1R17A 4MMZB 1ITBB 3ZDZB 3FFCE 4LLVB 3DX6A 3O6FA 3WMQA 4PRHA 3BP7A 5F7DB 3EOTH 3QXVA 3PXJA 5ERWA 4LLUB 2VUKA 2VMCA 5FXCH 5IJKA 3DUSA 3WE6B 4D7PA 3RNKA 1PNCA 3ES6A 3O11B 5C07A 3TGXA 4DAGL 1EK3A 4MD0A 2AVGA 2W38A 4AKQA 2VLME 3EYFB 3MJ8B 3UPCA 3PGFH 4RISH 4M1GH 3M88A 4KO5A 4X5PA 1YDPB 5D93C 5DK2A 1E65A 3QUZC 2FJHB 2DDQH 1ZVSB 1SJHA 3O4LE 5BV7B 1IC5L 1VCAA 2IPUG 1RSFA 3QJFA 1RV6X 4RAUA 3W9EA 3RL1B 1LO5B 4WUUB 4GG6E 1LEIB 3F12A 5GGSA 5ANMA 4MS8D 2WBJD 5KBKA 1DZBA 5CUSL 2OL3H 2VM3A 1PLBA 2FVNA 1RZ8A 2PO6A 5H4YA 1YN7B 5BS0E 5IHWA 1IGML 5SWSA 3C5XA 2P5EE 1G6RB 2V8LA 3CSTA 2RFXA 4S1RH 2O6CA 4Y1TA 4I1RA 4V1DD 3SCMC 2RIKA 4KJPD 3WO4B 1IGJB 4KAQH 3DMMD 3BC9A 4RQQA 3ZTNH 4XPFH 1J1OL 5KBNC 3ARDA 2R69H 1FL6B 1TJGH 2BZCA 2MQCA 2O61A 1SY6H 4OM0H 4EUPB 3ULAB 3VFGH 1YN6A 4MSWA 2J43A 3VFRB 2CO7A 2FATH 1JPFA 4S0TD 1JHLH 5E08L 2ZSWA 4Y16A 2WKGA 3IPBA 1KGXA 4PRIA 4XMPH 2F15A 1AC0A 3CZLA 4Q6IC 3MODH 5EFIA 2FO1A 4KRNA 4U2YA 4RH4A 4WF7A 4WFED 4I3SL 1P7BA 1GGTA 2L8AA 2MEJB 3I74A 4NC2B 3P54A 4P3DB 2Y24A 2ZYRA 2B1HH 1SM3H 3MROA 4HWUA 3T9WA 1A6WH 3FNKA 2DYRB 1NFDE 3FUHA 1U3HA 2FSEA 4Z5RB 1TVBA 2AQNA 4WUUE 1HILA 1L9TA 3NCCB 3LH9A 2FR4B 3NCXA 3O6LH 2FQEA 4UNTA 3N3EA 2AJUH 4D94A 3LH2H 4R0LA 2B2XL 2I9TA 3SBQA 4QJ4B 3PWLA 2WBXA 1G7PA 1P6WA 1WBXB 3VFOA 1PCSA 3MV01 4Z7NB 1BGXL 3MRJB 3VXTA 3DBXB 4GAGL 1N5AA 3NAAL 1S9XB 1OOWA 3D09A 4LCYB 1TETL 2XICA 2J1YA 4GKLA 2IMNA 4AXWB 4P48A 1JFHA 1AS6A 1XH2A 4CC4C 4HSAC 2IOIA 4MA1C 2I24N 5PAZA 1PKOA 1MWAA 3WUWA 3EGSA 3WEAA 1H6TA 1KCUL 4FFVD 2IH8A 1EAPB 3BYYA 4HF5H 4JFEA 3TYGL 3UZVA 1AYOA 3MNZB 3LV3B 3MCYA 3ROOB 4NC1C 2BOBB 2JIXD 2RA1A 4Y4KA 3L48A 3SKMB 3T4AB 4LEOA 5JIMA 3ZGIA 4QGTA 4LCVA 3Q5OA 5CP7B 5CR8A 3WY1A 3TEZA 1CYGA 1IC0A 1MN4A 2JIXA 8CGTA 3Q1SL 3G3LA 5IV2B 4J3TA 1ZKAA 4TSBL 3GUTB 1I8IB 1KV7A 4J5VA 3QDGD 4TVPL 3UEQA 3GSXB 3QW9A 4YDIL 3ILQD 2Y9RT 3ZE2B 4WENB 1ESOA 5M7QA 4KO7A 4QXVA 3C12A 1T0NA 1QLEB 3CLFL 3VSUA 1BXVA 4X80H 1QYGL 2A73B 4M4PA 3NN8A 2ZKYA 3R4DA 1OD7A 4OKDA 3V2AR 4EUPH 3LMJH 3T2NH 1FYTA 2XETA 2JQAA 1RUMH 4W1TA 4JFFE 5FO2A 1FFNB 3BZEA 2CG9X 1XR9B 5DUJA 4ODWA 1KCLA 3D2UD 3VFTA 4AQ1C 5HDWA 4IHBA 1A4JB 3HG4A 1DQJB 5IMMB 4LHJB 2AI0H 1YYLH 3PAYA 1MFEL 1PQZA 3INOA 2XN2A 5JPMA 5HHOA 3WDIA 4MD0B 3VTTA 1QLRB 3PIQA 2AEOA 4NM4H 2Z35B 5DJAA 2L7UA 3V0IA 5ID0B 4M1CD 3UTQA 3FSWA 4BWUA 2I7OA 3HS0A 3NMEA 5BRQA 3RVTC 3RILA 5JIHA 1MH5B 1AO7B 4YDVA 4A6YA 5J11B 2Q7AA 2GABA 3WO3B 3EO9L 4PWHA 1E6JH 2X0VA 3CFCH 3FB5B 3VH8G 2AEQL 4Z7OB 1M3JA 2KZWA 3HR5B 4RIRB 3VQ1C 4GRLB 2V3DA 1P7KA 2W9LA 2WBJA 3RVWD 3NIFE 4AMKH 5IT2H 3BO8A 3LNEA 4UAHA 4XP4H 3CZNA 4JQIH 1IGTA 5FPIA 5FA3A 1LP9B 1VLXA 2YARA 1ODAA 2V7HB 3SDYL 1IJ9A 4HKZA 3NGBC 2ETWA 1MJUH 3QZWA 4XC1H 1TQBB 4BA0A 4WU7B 1VZGA 4ZT1A 4I8DA 5KUKA 3K72B 4FXLA 2DQGH 3PHQB 4I48A 3VFGL 3O4OC 1G6RL 2FTAA 4N5EC 3KXFD 4HFUH 4NWUL 2X1XR 3WKPA 4NQSA 4Z7WF 2VABA 1NDTA 1SHSA 3EH5B 3AUVA 3GMLA 3K8LA 4GBXC 4MXWH 5D2NB 1MF2L 3U6XA 3TA3A 5B8CC 3WJJA 2HPOA 2ODIA 1XSIA 4JG1H 4P3DA 1MW1A 1QP1A 2ZX7A 1FFQA 3BHBA 3FQUA 3LKNA 3GSUB 3D69A 4U1SA 5AW1B 3X17A 1IBBA 4AEIL 5GRJL 2V5YA 1AY1L 2ZP9A 3UOAB 3CVIH 3FU6A 4AM0B 5TK2A 3US0A 2JXMB 3SQOH 4Z23A 1QSFE 4P4KD 4Y16B 5E2JA 1Z7JA 1FORL 1LVEA 5CEZE 4QRPE 5AD0A 4NLAA 3NJLA 4Z77B 1H3XA 1CXLA 1VADB 4R6UA 2QSQA 3ZIMA 5I1LA 5BQ7B 3U1PA 2X4PB 1WFTA 2AFNA 5AUMA 4TUUA 5CCKL 4Y4HC 4XN2A 3PRZA 4ZPTA 1N59B 2O5ZH 4YHKH 1MW0A 5IV2A 1PLCA 2EQDA 5FS5A 2A6DB 3X14B 2B5IC 3UJJL 1AANA 4JPQA 5CJBA 1GHFH 2HTKD 2XZAL 4UB0H 5LAXB 3E8VA 5KAQF 2DQEL 1U8MA 3ARFD 2F5AL 5L4JA 2QQNL 3CBRA 3PWNA 4IKJA 1PD6A 3M07A 4JDVA 2R1YA 2ZTBA 3MV11 3VDCA 3QZWG 1D9KD 3PLYA 1NQBA 3UX9B 4I77L 4ZUSA 4OCMC 1YA5A 2GTWB 1BFOA 4O2CB 1FDLH 3RZCB 1A7RL 4NKDB 4NPYB 1K8DA 3LX9A 3QAQA 2O5YL 3AQYA 2PYFB 3EZ8A 3F6LA 3MV7D 1OGTB 1EUTA 1UA6H 4NKMB 3RWIA 2WW8A 2DBJA 4X6CE 1G1CA 4Y88A 3HMXA 3L7EA 3DGGA 3GSNL 1NAMH 2EIKB 4JRXD 2CBMA 1MI5B 2MQ0A 1VCBC 2EIMB 4PP2B 3VNZA 1OZUA 1TJIH 3GSOA 4YSDA 2ZNWA 3FT2B 3WS6A 4H7VA 3VGEA 2QGDA 5DEJA 4PH8A 3ZYZA 5D4IA 3BIBX 1FE8H 2R0ZH 4X5XA 5C7XL 1B0GA 3X1BA 2BVUA 4LPVA 2WZ6A 4HLZG 3UTTD 1NIEA 3D48R 2Y6SC 1PX4A 2Q2EB 1C9SA 1CD8A 3ROOA 5K33A 1V27A 2BCKA 1JGUL 2CDGB 3KPOB 1JP5A 1LQSR 1DQMH 2ZONA 4XP5L 3RGHA 4LAJH 3OQ3B 2PXYB 1BQLL 4WW2C 5FCUH 3LEVL 3RWGB 1ADQH 4IIQC 4Z7OF 5MENB 2GFBA 4OM1L 3SZKC 2E47A 1OIOA 4FQ2L 4E41B 1JK8B 4IRSB 2OQJB 4S10A 1MWAL 4Q14A 1MVUA 5F44A 3BVUA 3SYAA 3JTTB 2PETA 2FYYA 1OPGL 1U6AL 3U2JA 4C56A 3L4UA 3TASA 4AC4A 1PKQE 4ZMPA 1X3DA 4NAQA 4MB4A 4YPGA 4OVUA 1HXYB 2DWDA 5JPNC 4EKJA 1A02N 2I5YL 3OPZL 2J5LB 4YFEA 1G84A 1SJVA 3CFIC 4XMXA 4WTQA 3DSNA 3Q01A 5IBTL 1JNHB 3PL6C 3WHE0 2DI7A 1W6WA 2J12B 3ZQXA 2Y1AA 3DI3B 4L8SA 1JXFA 1XZWA 5I1DA 3CDFA 3FN3A 5KSBB 3I3EA 4G5AA 3ZHLA 2OZ4H 4N90D 4OLWL 3FSOA 3TO2B 2ZPKH 3DLQR 5BS0B 4XCNA 3HAEB 3WE1A 1PVHA 2DKSA 2CXKA 1HE8A 2BP3A 1WA1X 1P7KB 3FF8A 1HHJB 5IB2A 5DJ0B 1AOHA 3DJSA 1LK3H 1NBVL 5DK0B 4M5TA 4MLSA 4G70B 1YMMB 3ZSTA 1S9KC 2NR6A 3WSQH 2BW4A 5F2FA 3RFZC 4JUSA 4N8VB 4Y9BA 1ZHKA 2B08A 2IQAB 1G7JA 4PJIE 4DSYA 3TNMA 2A38A 5LCVH 4Y5VC 2W8CA 3PABA 4XNQB 1P84K 3QJZA 4IGBA 4JFPB 1UB6B 4JAMB 2R0KL 4LSVH 2Y3AA 2H32H 3DJRA 4JRLA 4AEFA 1DLFL 2BVQB 3BPNB 2A0LC 3HG5A 5C3LD 4JFWA 3MROB 3Q1EA 3ZY7A 5C86A 1J8HB 4MJ4A 3TZVD 1KEMH 1WITA 2WGNB 4I87A 3VG0L 4HLZH 1BM3H 3V9CA 4D9QE 2F8IA 3VXUE 4BZ1A 2B7DT 2X4UA 1MKFA 3U7WL 2NY3D 4DP5X 5FYKL 2MWCA 3L3IA 2TRYA 1M05B 2ZUWA 1XX9C 4QRSB 2DYSB 3SSGA 3AITA 3MOBL 2FJGA 3IJ7A 4GAJL 2IGLA 4Z7VF 3V4VH 1QR1A 3MJGX 1WUNT 1LO5A 4OD1L 4WUUA 5L88H 3BDYH 3BXNA 4FCAA 3VG0H 4QRRE 2CIIB 5HJBA 4QKXB 5K9QI 1HOCA 4FOMA 5JXED 3EBGA 4AUYA 3D05A 4LBEB 4E42A 2KC0A 2BIIA 5IJCC 5BW7A 4DKDC 1J0ZA 2HRGA 2XTLA 5HHMB 3B6SB 4MD5A 1MRFH 2VLKE 4NNYB 1EDQA 4HS6A 2D8KA 1VGEL 5EZIH 1E2VA 2E74C 5CP3A 3EAKA 3E1ZA 1E30A 4RGNB 2QQQA 5DMYA 4I7ZC 5E8EA 4PWKA 5DU7A 1BFSA 3HMWL 1K5NA 1HEZB 1FNGB 3AUWB 3APCA 4MNQA 4QTIL 3VGGA 5TE4H 4LHQB 5EZJA 3GRWH 4Y4KD 2PYFA 4J2XA 2FX7H 3IJHB 2BNRA 2CH8A 4G8FB 5A7EA 2BDNH 1N4XL 2YPLD 2GAZB 4NKIL 1RUKL 2DI9A 3L1OL 4H1LB 2WSDA 1ORQA 4TULL 3MNWB 5AW9B 4LEEA 1DVFC 5IVZB 2H1PL 3BPLB 4MZIA 4QHMA 1AHWA 3ECWA 4UQ9A 4WTZG 1U33A 1IZJA 3VQLA 3WJMB 3KPSE 2NLJA 1GIGH 2JCWA 5EU7C 3VXTB 1QG3A 4M7KH 3EJZD 1JXDA 5I5RA 3LZFL 4OF6A 2CHZA 5F3FA 4GS7B 1BJ8A 2A6IB 3HG2A 2EICA 2QZQA 4LF3A 4P5SA 1GH7A 4PJ9D 4DT2A 4DZBA 2EKSA 1JUFB 4G7RB 3DNKA 5CMAA 4D9LL 4PG9A 5CZXD 2EVGA 3MUHL 1BQHA 2HLAA 4OSUL 3SGJC 4D0DA 3DGDA 1EHLH 2QSVA 3DROA 2GY5A 2BVYA 4N0UB 1TSRA 2VM4A 4E41A 1KGJA 3NSJA 5DXWA 1O75A 3HC3H 1M56B 1MHHB 4JFVA 3P9MB 4X6DF 5SWZD 3FAWA 4PWEA 2F53D 4GMTL 3BMVA 3MRNB 4FL4C 3S8FB 3APMA 3DETC 4BUHA 1RPKA 3KPOA 2E27L 4UIKL 3GIZH 4JK0D 4KHXH 1UZGA 1SBSH 2NY4C 5EO0B 3L3HA 3CFDA 5KVEH 1J10A 4XHJC 3CGTA 2ADGB 1KCVH 3NEXA 1E6JL 4PGCB 2D03L 1NGYA 1U8QA 4G6MH 4ZUVA 4MXQC 2IAND 8FABA 6PAZA 1CTOA 3L2NA 3QIWA 1WLHA 3SYOA 3TH4T 3KGTA 4NUJA 4R8WH 4FP8H 5TF1H 4IRSC 5F96H 4QGYA 1XR9A 3PWJA 4OZGB 1EGJL 4WW1A 1BBDL 2NXZB 1TZHA 2WYTA 1FJ1A 1NOAA 4PJHF 1CICA 1D5BA 1I7ZB 3MRQA 2NW3A 5GS2H 5F0PB 2XOTA 3IGKA 1DVZA 2IIJA 2P5WA 5E9NA 4QYOA 4LLDB 4WO4C 2FJFB 2WLLB 3DTXB 3IDMB 4DUWA 4HH9B 4YEFA 1QEXA 1OSPL 5H37G 5EEVA 3FT4B 1OAQL 4JFQA 4ZYKA 5L9DL 5LVEA 3FRPA 1ET7A 2JQZA 2RGSA 4L1TA 4AGPA 4UOW0 3WUZA 1T1YA 2H1LM 3RU8H 1KB5L 3WV0A 4B53A 5C2BH 2YAHA 4HS3A 4GG6B 1HH9B 5JHBA 1RULL 1WFNA 1F5WA 2QQLH 1GKEA 3K81A 3PABB 4XNQA 5L0QC 2AJZB 2W81C 1RZFL 2EXYC 1HCFX 1M71B 5D7KE 2XIBA 3B9KD 1OW0C 1PYWA 5D5MF 2M2DA 1A6ZB 4HC1L 3J7HA 1NCTA 2VO8A 1UZ8B 2E4TA 2FX8H 5C0AD 1CDGA 1KYAA 2EINB