1UT4A

Structure of the conserved domain of anac, a member of the nac family of transcription factors
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
166
structure length
146
Chain Sequence
GSHMGIQETDPLPPGFRFYPTDEELMVQYLCRKAAGYDFSLQLIAEIDLYKFDPWVLPNKALFGEKEWYFFSPRDRPNRVAGSGYWKATGTDKIISTEGQRVGIKKALVFYIGKAPKGTKTNWIMHEYRLIEPSDDWVLCRIYKKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NO APICAL MERISTEM PROTEIN
publication title Structure of the Conserved Domain of Anac, a Member of the Nac Family of Transcription Factors
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transcription regulation
total genus 28
structure length 146
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02365 NAM No apical meristem (NAM) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.150 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1ut4A01
1UT4A 3ULXA 4DULA 1UT7A
chains in the Genus database with same CATH superfamily
1EBMA 1KFIA 4ROEB 2EHBD 3C04A 2JOIA 2QRCA 5JMVD 2FKFA 1C47A 3OH9A 1K2YX 3HS9A 1QN8A 4ROCB 1KY7A 1PCMX 4TPSA 1LXTA 2F7LA 3HS8A 1WJWA 1N3AA 2NWVA 3UW2A 5BMNA 1KFQA 2DKCA 4D7RA 4CFFA 1UT7A 1CDWA 3CVTA 2NOZA 1M5Q1 2V92A 3TE5A 1QTPA 2NOLA 3D7QA 4EJYA 5AN4A 2DKDA 3ENCA 3OLPA 2NOHA 1TUOA 2FGTA 3D4VA 2HZSA 1QNCA 2NOEA 3OSMA 3F10A 2VJ0A 1QN9A 1XSZA 3OSEA 2IV8A 3OGDA 1MPGA 1QNAA 1VTLE 3I0XA 1QTSA 2PWWA 2OOYA 1E42A 1V5SA 2G30A 2H4LX 2ZFDB 1KO9A 4EAJA 2DKAA 2D0AA 2Y8QA 1PVSA 3CWAA 1M3QA 3VN5A 2NOFA 1JDYA 2JPIA 2NVMA 1YTFA 3RSMA 4HJHA 3IH7A 4RODB 2O3OA 4WZSD 3F0ZA 3ULXA 2D0CA 4EAGA 1LWVA 2R5XA 3H1ZA 5IYBP 1YTBA 1VOLB 1DIZA 4PY5A 1K35A 2OOXA 1WQAA 2YA3A 1UL7A 4BJUA 1LWWA 3EIKA 3CW7A 3TDHA 3KRMA 1Q9UA 3CVSA 4EAIA 1QN4A 3OSTA 1C9BB 1QN7A 1YQRA 3PDKA 1YQLA 2NOIA 4B0AA 1W80A 4DULA 4MRQA 2V8QA 1TGHA 2IV9A 2HKPA 2MJ7A 4WX8A 2Z8UA 3SNSA 3CWTA 3DPTA 1VKLA 1YQMA 3EAYA 3T4NA 1KYUA 4D7QA 2QLVA 5IYDP 2QREA 3RPJA 1J3MA 2JHNA 5F9CA 1FN7A 1NVPA 3KTUA 1PZDA 1PCZA 2HZMA 4Q11A 2D0BA 4I8OA 1M3HA 1QN6A 2FUVA 2QRDA 3I0WA 2QR1A 3I3WA 1P5GX 1KYDA 1P5DX 5BMPA 1QN3A 1HU0A 2FKMX 2NLVA 5JN5A 1YQKA 2H5AX 1KYFA 3BKQX 1NH2A 1N39A 2HL8A 2Z0FA 3N89A 1C4GA 4EJZA 1JFIC 2I5WA 3OC3C 1N3CA 1KY6A 5KL0A 5HSHA 2Y8LA 3DPUA 3NA5A 2JHJA 2YH5A 5IYCP 1T6AA 2MZ8A 1UT4A 3PMGA 1VTOA 1RM1A 2V9JA 3ASMA 1D3UA 1TBAB 4IL8A 2XHIA 3OH6A 2LAEA 1B9KA 1TBPA 1R4XA 5EPCA 3CWUA 3ENOC 1VOKA 1NGMA 3CWSA 2HL9A 1MP9A 4WXAA 1QN5A 1AISA 3OCIA 4EALA 2NOBA 1EUVA 4EAKA 4QG5A 1QNEA 1QNBA 1PCJX 4C7PA 1LWYA
chains in the Genus database with same CATH topology
1EBMA 4ROEB 2JOIA 3HS9A 1QN8A 4ROCB 1KY7A 4TPSA 3HS8A 1N3AA 1UT7A 1CDWA 2NOZA 2NOLA 1QTPA 4EJYA 5AN4A 2NOHA 2FGTA 1QNCA 2NOEA 2HZSA 3OSMA 3F10A 2VJ0A 1QN9A 2IV8A 1QNAA 1VTLE 3I0XA 1QTSA 1E42A 2G30A 1KO9A 2D0AA 1M3QA 3VN5A 2NOFA 1YTFA 3IH7A 4RODB 2O3OA 4WZSD 3F0ZA 3ULXA 2D0CA 1LWVA 3H1ZA 5IYBP 1YTBA 1VOLB 4PY5A 1LWWA 3EIKA 3KRMA 1QN4A 3OSTA 1C9BB 1QN7A 1YQRA 2NOIA 1YQLA 4B0AA 1W80A 4DULA 1TGHA 2IV9A 2MJ7A 3SNSA 2Z8UA 3DPTA 1YQMA 1KYUA 5IYDP 3RPJA 1FN7A 1NVPA 3KTUA 1PZDA 1PCZA 2HZMA 4Q11A 2D0BA 4I8OA 1M3HA 1QN6A 3I0WA 1KYDA 1QN3A 1HU0A 1YQKA 1KYFA 1NH2A 1N39A 3N89A 4EJZA 1JFIC 2I5WA 3OC3C 1N3CA 1KY6A 3DPUA 2YH5A 5IYCP 2MZ8A 1UT4A 1VTOA 1RM1A 3ASMA 1D3UA 1TBAB 2XHIA 2LAEA 1B9KA 1TBPA 1R4XA 1VOKA 1NGMA 1MP9A 1QN5A 1AISA 3OCIA 2NOBA 1QNEA 1QNBA 1LWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UT4 A;  3ULX A;  4DUL A;  1UT7 A; 
#chains in the Genus database with same CATH topology
 1EBM A;  1KFI A;  4ROE B;  2EHB D;  3C04 A;  2JOI A;  2QRC A;  5JMV D;  2FKF A;  1C47 A;  3OH9 A;  1K2Y X;  3HS9 A;  1QN8 A;  4ROC B;  1KY7 A;  1PCM X;  4TPS A;  1LXT A;  2F7L A;  3HS8 A;  1WJW A;  1N3A A;  2NWV A;  3UW2 A;  5BMN A;  1KFQ A;  2DKC A;  4D7R A;  4CFF A;  1UT7 A;  1CDW A;  3CVT A;  2NOZ A;  1M5Q 1;  2V92 A;  3TE5 A;  1QTP A;  2NOL A;  3D7Q A;  4EJY A;  5AN4 A;  2DKD A;  3ENC A;  3OLP A;  2NOH A;  1TUO A;  2FGT A;  3D4V A;  2HZS A;  1QNC A;  2NOE A;  3OSM A;  3F10 A;  2VJ0 A;  1QN9 A;  1XSZ A;  3OSE A;  2IV8 A;  3OGD A;  1MPG A;  1QNA A;  1VTL E;  3I0X A;  1QTS A;  2PWW A;  2OOY A;  1E42 A;  1V5S A;  2G30 A;  2H4L X;  2ZFD B;  1KO9 A;  4EAJ A;  2DKA A;  2D0A A;  2Y8Q A;  1PVS A;  3CWA A;  1M3Q A;  3VN5 A;  2NOF A;  1JDY A;  2JPI A;  2NVM A;  1YTF A;  3RSM A;  4HJH A;  3IH7 A;  4ROD B;  2O3O A;  4WZS D;  3F0Z A;  3ULX A;  2D0C A;  4EAG A;  1LWV A;  2R5X A;  3H1Z A;  5IYB P;  1YTB A;  1VOL B;  1DIZ A;  4PY5 A;  1K35 A;  2OOX A;  1WQA A;  2YA3 A;  1UL7 A;  4BJU A;  1LWW A;  3EIK A;  3CW7 A;  3TDH A;  3KRM A;  1Q9U A;  3CVS A;  4EAI A;  1QN4 A;  3OST A;  1C9B B;  1QN7 A;  1YQR A;  3PDK A;  1YQL A;  2NOI A;  4B0A A;  1W80 A;  4DUL A;  4MRQ A;  2V8Q A;  1TGH A;  2IV9 A;  2HKP A;  2MJ7 A;  4WX8 A;  2Z8U A;  3SNS A;  3CWT A;  3DPT A;  1VKL A;  1YQM A;  3EAY A;  3T4N A;  1KYU A;  4D7Q A;  2QLV A;  5IYD P;  2QRE A;  3RPJ A;  1J3M A;  2JHN A;  5F9C A;  1FN7 A;  1NVP A;  3KTU A;  1PZD A;  1PCZ A;  2HZM A;  4Q11 A;  2D0B A;  4I8O A;  1M3H A;  1QN6 A;  2FUV A;  2QRD A;  3I0W A;  2QR1 A;  3I3W A;  1P5G X;  1KYD A;  1P5D X;  5BMP A;  1QN3 A;  1HU0 A;  2FKM X;  2NLV A;  5JN5 A;  1YQK A;  2H5A X;  1KYF A;  3BKQ X;  1NH2 A;  1N39 A;  2HL8 A;  2Z0F A;  3N89 A;  1C4G A;  4EJZ A;  1JFI C;  2I5W A;  3OC3 C;  1N3C A;  1KY6 A;  5KL0 A;  5HSH A;  2Y8L A;  3DPU A;  3NA5 A;  2JHJ A;  2YH5 A;  5IYC P;  1T6A A;  2MZ8 A;  1UT4 A;  3PMG A;  1VTO A;  1RM1 A;  2V9J A;  3ASM A;  1D3U A;  1TBA B;  4IL8 A;  2XHI A;  3OH6 A;  2LAE A;  1B9K A;  1TBP A;  1R4X A;  5EPC A;  3CWU A;  3ENO C;  1VOK A;  1NGM A;  3CWS A;  2HL9 A;  1MP9 A;  4WXA A;  1QN5 A;  1AIS A;  3OCI A;  4EAL A;  2NOB A;  1EUV A;  4EAK A;  4QG5 A;  1QNE A;  1QNB A;  1PCJ X;  4C7P A;  1LWY A; 
#chains in the Genus database with same CATH homology
 1EBM A;  4ROE B;  2JOI A;  3HS9 A;  1QN8 A;  4ROC B;  1KY7 A;  4TPS A;  3HS8 A;  1N3A A;  1UT7 A;  1CDW A;  2NOZ A;  2NOL A;  1QTP A;  4EJY A;  5AN4 A;  2NOH A;  2FGT A;  1QNC A;  2NOE A;  2HZS A;  3OSM A;  3F10 A;  2VJ0 A;  1QN9 A;  2IV8 A;  1QNA A;  1VTL E;  3I0X A;  1QTS A;  1E42 A;  2G30 A;  1KO9 A;  2D0A A;  1M3Q A;  3VN5 A;  2NOF A;  1YTF A;  3IH7 A;  4ROD B;  2O3O A;  4WZS D;  3F0Z A;  3ULX A;  2D0C A;  1LWV A;  3H1Z A;  5IYB P;  1YTB A;  1VOL B;  4PY5 A;  1LWW A;  3EIK A;  3KRM A;  1QN4 A;  3OST A;  1C9B B;  1QN7 A;  1YQR A;  2NOI A;  1YQL A;  4B0A A;  1W80 A;  4DUL A;  1TGH A;  2IV9 A;  2MJ7 A;  3SNS A;  2Z8U A;  3DPT A;  1YQM A;  1KYU A;  5IYD P;  3RPJ A;  1FN7 A;  1NVP A;  3KTU A;  1PZD A;  1PCZ A;  2HZM A;  4Q11 A;  2D0B A;  4I8O A;  1M3H A;  1QN6 A;  3I0W A;  1KYD A;  1QN3 A;  1HU0 A;  1YQK A;  1KYF A;  1NH2 A;  1N39 A;  3N89 A;  4EJZ A;  1JFI C;  2I5W A;  3OC3 C;  1N3C A;  1KY6 A;  3DPU A;  2YH5 A;  5IYC P;  2MZ8 A;  1UT4 A;  1VTO A;  1RM1 A;  3ASM A;  1D3U A;  1TBA B;  2XHI A;  2LAE A;  1B9K A;  1TBP A;  1R4X A;  1VOK A;  1NGM A;  1MP9 A;  1QN5 A;  1AIS A;  3OCI A;  2NOB A;  1QNE A;  1QNB A;  1LWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...