1UTLM

Trypsin specificity as elucidated by lie calculations, x-ray structures and association constant measurements
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
222
structure length
222
Chain Sequence
IVGGYECKPYSQPHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPTSCAPAGTMCTVSGWGNTMSSTADSNKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMASY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN I
publication title Trypsin Specificity as Elucidated by Lie Calculations, X-Ray Structures, and Association Constant Measurements
pubmed doi rcsb
molecule tags Hydrolase
total genus 51
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utlM01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utlM02
4ZKSU 3RXPA 1OWJA 2BM2A 1GDNA 2G8TA 1X7AC 2VINA 2FX4A 1P02A 1V2MT 2GD4B 2BX3A 4WH6A 1QURH 2Z3EA 3A88A 1K1PA 3GY5A 1W0YH 1XXDA 2CHAB 1AWHB 1DLEA 1DOJA 4ZROA 3L33A 5FPTA 5AHGH 1OP2A 4H4FA 2PUQH 1V2UT 3URDA 1CSOE 3PTBA 1AB9C 1A61H 3EA9A 3F6UH 2BD7A 2QF3A 4FVBA 2OC8A 1FY8E 1GDUA 1O3GA 1EUFA 4ZXYH 1Y3WA 1YM0A 1QB6A 3M5MA 2AYWA 1UVOA 1UK2A 3RXOA 1O5FH 3VPKA 3S0NA 1O39A 1MKWK 3FAOA 4X1NU 1FY5A 2PLXA 7LPRA 3P8OA 2V0BA 5GIBA 3SV7A 1T8NA 2BVSH 4NWKA 3KHVA 4AORA 4ZUHA 3A89A 3KCGH 3SU4A 5DG6A 2ODQA 1G9IE 5LPRA 1F7ZA 1RIWC 1Z7KA 4MPXA 9LPRA 4YOGA 1GVLA 1TPSA 1KLTA 3BTWE 2BDIA 3RXQA 1TX7A 1IOEA 3RXLA 1O31A 1QHRB 2A5KA 4FUJA 4Q7XA 3PYHA 1P3CA 4ABAA 1RXPA 3UNQA 4ZKNU 2GT7A 2BLWA 3LGTA 3TK5A 1SQTA 1VITG 3GCHC 2Z7FE 3A7WA 7GCHG 2BOHB 2XCNA 3B9FH 4IN1A 5JB8S 2W3IA 3TNSA 5C1YA 1RGQA 1YPKH 2G4UA 1J16A 1ELAA 3NZIA 1TABE 3PMBB 3ZZ6A 1SC8U 1HBTH 1XX9A 2ZFSA 3KGPA 3QK1A 5AFZH 2NU4E 2OBOA 5HMAA 4DIIH 2Y6TA 3W95A 1A1RA 1VITH 3D23A 1NRQH 3KEEA 1HAXB 4LZ4B 5EU8A 4CH2B 4WJG2 1P04A 2F83A 1FI8A 1P2NA 3STJA 1BOQA 4BAMB 2AH4X 1OOKB 2F9NA 5FCKA 2Z9LA 2D1JA 2OTVA 4FUCA 1C2MA 3SQHE 2HNTF 1EOLA 3M5LA 3FP8E 2QXHA 2O8TA 1ZGVA 3NXPA 1S83A 4X0WU 3ZVAA 1FIZA 2HPQH 1MAYA 4GLYA 1QB1A 1GBBA 5DP6A 1KXFA 3SUDA 3E1XB 1AVGH 2Y80A 1HAVA 4AB8A 2DE9A 5A09A 4ABEA 3Q3YA 4KTCA 1C5LH 1C5TA 2BY5X 1WQSA 2F9BH 1EZSC 1ELDE 4DGJA 3RC6A 1MD8A 3ITIA 3DFLA 5SGAE 1ZOMA 1K9OE 2VWNA 4BTUB 3E90B 5EODA 1GHZA 4B2BA 1O2MA 1PPZA 1KXAA 3PMHB 2QXIA 4CRAA 2JETC 3BEIB 3LJJA 4UFEH 2IN2A 8GCHG 1CA0C 3ZVEA 1EPTB 1O5EH 5EQQA 4HFPB 1GJDB 3CS0A 3C1KA 4JYUH 3ZZ4A 2ZPSA 3A84A 2WINI 1TB6H 5BRRE 2OXSA 2STAE 3UFAA 2A5IA 1DSTA 3R3GB 1Y5AT 3TJOA 4ABJA 3U8OH 4FVDA 1GI1A 5F8XA 1XM1A 4B74A 3TU7H 1ZMNA 1P9SA 1GL1A 4GVUA 2XWBI 4H6SB 2F9PA 9ESTA 2GMTB 1XUIA 1SL3A 4DY7B 2QXGA 2G5VA 1A7SA 1MAXA 3K6YA 1ABJH 1NRPH 1BUIA 4RKOB 4X2WA 4ISLA 1S82A 5DGJA 5EG4A 1CA0B 2WYGA 2GKVE 1UVUH 1A3BH 1VGCB 1FLEE 5FPYA 4NA8A 1DXWA 1L2EA 1EOJA 2KAIB 5GWZA 3ZYDA 2F9OA 4CR9A 1EZUC 1SLUB 1QL7A 3GDUA 1N6YA 1XUHA 1GJBB 1P57B 1NFXA 1FAXA 4NSYA 1AFQC 2ZDAH 5A0AE 1W14U 2QAAA 2I6SA 2A32A 3QTOH 1LHFH 1RTFB 3TGKE 3SBKA 1BTWA 2QGRA 3HGPA 3U8TH 2ZU4A 4TPIZ 2GDEH 4D8NA 5CE1A 1DUAA 1NZQH 1SLVB 1ZPCA 2QN5T 3UY9A 5DP8A 2BDCA 3TJVA 4NCYA 3MO3A 5IYTA 1ANEA 3Q00A 1HXFH 4FU9A 3TH4H 3MI4A 1DVAH 2WPKS 1BMNH 2A0QB 1EZQA 1CO7E 1TRNA 2Z6BD 1PJPA 1P2MA 2VVCA 4NFEA 1PQ5A 1ZTJA 4GAWA 2OC1A 3MH4A 2EI7A 2ZHWH 3A8DA 3M37A 3OX7U 1Q31A 2H9TH 2BQ6B 2VVUA 3BTKE 4ISIH 4THNH 1QFKH 3SORA 1V2ST 1IQNA 1ID5H 3V12A 1MMJN 2AEIH 2FESH 3EGKH 1SGCA 3ZVDA 3QN7A 2C8XB 1C5WB 2B0FA 2CXVA 3Q77A 1JBUH 2BY9X 1L4DA 5GDSH 1C1RA 1O5BB 4I8HA 1ZPBA 2ANKH 3GY8A 1HCGA 1JOUB 1ZHRA 2A7JA 1KXBA 5JB9S 1VITF 4CHAC 7GCHF 5LPEA 2WV5A 1GI0A 2ZU3A 3P92A 2VNTA 1TWXB 1LVBA 1UTMA 3MTYA 2ZNKH 1BRCE 1NU9A 2VH0A 1FV9A 3ZVFA 3LU9B 4BNRA 1K1NA 1TPPA 2JKHA 1GBHA 3UWJH 1Y5BT 5CHAC 4NIXA 1CT4E 3LH1A 4NA9H 1OYQA 1QJ1B 2R2MB 2WV4A 1GHBG 1C5ZB 5BPEA 2EI6A 1HJAB 4I33A 3KQBA 1ELVA 3NUMA 1FN8A 2A4GA 1THRH 1O5AB 4Y8XA 3UNSA 4E06H 1XXFA 2H6MA 3UTUH 1V2PT 2B8OH 1SFQB 3JZ1B 2QCYA 4UFGH 1O2ZA 1A5IA 1FPCH 4JZEH 1DDJA 1O3DA 3LJOA 4BTTB 4DVAU 3VGCC 1HIAB 1O30A 4A1VA 3VB3A 1C2JA 4Y8YA 3DT0H 3U1JB 3V3MA 3ZZ3A 4YO9A 5ESTE 3S9BA 1GMCG 1PYTC 2ZCLP 2FXRA 1WBGB 4TWYA 1P12E 1GCTB 1SR5C 2PSXA 3MH7A 1CQQA 2HVXA 1S6FA 2NU0E 4B2CA 3FZDA 5F03A 3OYPA 1TNIA 1C1PA 5DP4A 1GBMA 2ZGBH 4X6OA 2LNCA 1GVZA 1AIXH 1C1MA 4X8SH 3ZZ7A 1T4VH 1C1NA 2FYQA 3MU0A 2ODYB 3RUOA 1ZLRA 1ANCA 3GY6A 6LPRA 8GCHF 4TYDA 1J15A 4I7YH 1C2KA 1O5GH 4Y0YE 2ZU1A 3P95A 1O3OA 2XC5A 3MHWU 1AZ8A 2BZ6H 4WXVA 5EQRA 1G30B 1DWDH 3A85A 1B0FA 5I46H 2NWNA 1J8AA 1V2QT 2PTNA 1OP0A 3TVJB 1EAWA 3NKKA 4VGCB 1YP9A 1ZJDA 1Z6JH 4Y8ZA 2FEQH 4Y10E 2Q6GA 1A2CH 4AGKA 5DP9A 2Y7ZA 3CP7A 3MNSA 2FZZA 4X8VH 1TNGA 5H4IB 1F5RA 4AOQA 2O8LA 1TGNA 2ZU2A 3U1IB 3TGJE 1KTSB 1RRKA 1AKSB 2OQ5A 3M5NA 2AGIX 3SI4H 4SGBE 1JIMA 1PYTD 5ESBA 1NROH 2ZQ2A 1TQ0B 1LKAA 3MFJA 1HGTH 4I8KA 2WUBA 3LIWA 1O3FA 1C5YB 1UTNA 3SGAE 1Y5UT 2BDAA 1S0RA 5L2ZH 4IGDA 1A5GH 2GT8A 3RXRA 1P2KA 1IQGA 3UIRA 1HYLA 3W94A 5A8YA 2G5NA 3MH5A 1N8OB 2FX6A 4DIHH 2PKAB 2H5CA 3IITA 3RC4A 1TOCB 5LPFA 3UR6A 3SNCA 1GI4A 1UVPA 2FOGA 3UR9A 4AYVB 1IHSH 4GPGA 3DA9B 3A7YA 1C5SA 1BZXE 1GI9B 2R9PA 2UUYA 1KY9A 3GCTG 3ZVBA 4K1TA 1EXFA 1GBKA 1O2HA 5FAHA 4Y7BA 3TITA 4GHQA 4YM9A 3MNCA 1BBRK 2ZHDA 2QXJA 4Q7ZA 1O3LA 4XSKU 1O2NA 3OY5U 1GBFA 3LKWA 3GY3A 5DP3A 3RXBA 2P3TB 1PPCE 2ZP0H 1E37B 4ZH8A 2XBXA 6CHAC 2FTMA 2AS9A 2SGDE 1WQVH 1YC0A 3MU1A 1FZZA 4INHA 1NRRH 1C1WH 1YF4A 1V2NT 2AGEX 4MPVA 3TK9A 3RM2H 1SOZA 3C27B 4SGAE 2VGCB 1DT2A 3DUXH 3DHKH 3ZZBA 1MKWH 3BTQE 4RN6A 1NY22 1TMBH 1C5XB 1L0ZA 1YKTA 2GV6A 2G51A 1O2JA 1SHYA 4CRCA 1NFWA 1HNEE 2ZWLH 4MNWA 3SGBE 1Z6EA 3TJUA 4XBCA 5GPIB 3RDZA 3PWCA 4U2WA 1GJ5H 4O3UA 4IN2A 1O35A 1O3JA 2Q1JA 5LGOA 2HGTH 4XFQA 2ZDMA 3LOXA 6GCHG 3M3SA 1P03A 3TK6A 2OLGA 1GHBF 5EXMA 3SGQE 1GHWH 3ZZCA 2BXUH 1AWFH 1LTOA 2CHAC 1A5HA 2ZIQH 2C93B 3TNTA 3M61U 3T2NA 1E35B 1QY6A 1PPHE 1C1OA 2F9UA 3BTFE 3LGYA 3P8NA 4YT6H 3RP2A 1UCYK 1LPKB 3RXSA 1DLKB 1O34A 3RXMA 1ZGIA 1C5OH 4KELA 3F68H 2IJOB 2QYIA 2B7DH 2ZDLA 4JMYA 5E2PA 1QL9A 3SNBA 1KXEA 2BB4A 2ZPQA 3S9AA 1MQ6A 1E36B 4I31A 1D6WA 1Q2WA 4CH8B 1CA8B 3SJOA 5EPYA 4HI3A 1DWBH 2TGPZ 1GMCF 1UTKA 2BDYA 2FOAA 3AAVA 2FOBA 3H7OA 5JPMH 2ZA5A 2WPLS 2AERH 1KSNA 1O2XA 4AFSA 2QY0B 1BCUH 4DW2U 1GJ6A 2Y82A 2FM2A 1SI5H 5FHTA 2VVVA 2G4TA 1GI8B 1BQYA 2AFQB 1ARBA 3TJNA 3SU1A 4Z6AH 3D62A 4WMFA 3ATLA 5F8TA 5B6OA 4Y0ZE 2OC0A 2C8YB 1HAPH 1ANDA 1C5QA 4OS6A 1RFNA 5DP5A 2J95A 1BJVA 2FWWA 4H42U 1V2JT 1Q3XA 4O9VA 4Y11E 2A4RA 2WPJS 4BXWA 4JYTA 3ZZDA 4AZ2B 5E0GA 4QT8C 3P70B 2AMDA 2OBQA 1D4PB 1TNHA 1YYY1 3RXDA 3ZZAA 4MPUA 1SOTA 1QBNA 3RXEA 3ATIA 2PWXA 4U32A 1ELEE 1MD7A 1LVYA 1MUEB 4OGYA 2XBVA 2THFB 1HJ8A 1C2FA 1UMAH 2GCTB 3V13A 2A4OA 1O3IA 1WTGH 2ZGCA 1QR3E 5EXNA 1GDQA 1IQHA 5EW2H 1OS8A 3PWBA 1C2HA 3PO1B 4CBNA 1W13U 1Z1IA 1MTWA 2GCHG 1F0UA 2XBWA 3RXAA 3SZNA 4MVNA 1SLXB 4XBDA 1AGJA 1ETRH 2HLCA 3RXKA 3SU3A 5T3HA 1SPJA 4UFDH 1OX1A 1Y59T 2FPZA 2GTBA 1DX5M 5C67A 1BHXB 1BHXF 1C2IA 1CE5A 1GMHG 4HTCH 1WAYB 2C8ZB 5AFYH 1GBCA 3VXFH 3ESTA 4F49A 1GBJA 1WOFA 4O97A 2BDGA 2O9QA 3SU5A 3KF2A 5C3NA 1VJAU 1BRUP 1QBOA 1F5KU 3GCTF 3PMJA 4CRDA 1V2OT 3M5OA 1XVMA 3BTDE 2BMGB 3GISB 2H9HA 1ZMLA 3HKIB 3T26A 2FI5E 2UWPA 1GHXH 1EPTC 1GJAB 2BVXH 4Q2KA 8KME2 1P01A 4AX9H 3P6ZB 4R8TB 2M5TA 4U30A 5K0HA 5DPAA 2G55A 1B5GH 2A45B 2OUAA 1O3KA 2G00A 2VIWA 1LHGH 1MKXH 1BB0B 3SU6A 4TY7A 1TYNA 1HFDA 1EQ9A 2GMTC 5DK1A 3SV8A 3F9FA 3ZVCA 1S0QA 1WSSH 1W0ZU 4YLQH 1QA7A 5FCRA 1GGDB 2Y5FA 4I8LA 1P05A 1OWHA 3EE0B 2O8WA 4HZHA 3A8AA 2R0LA 3FVFB 3AAUA 1F0TA 1VGCC 2CGAA 2FYRA 4ZHAA 2SFAA 2SGFE 1P3EA 3GDVA 3ZZ8A 4NWLA 4OS5A 1TMTH 2FOFA 2ESTE 1GMDG 2FODA 3ODDA 1CT0E 1SHHB 1ZTLA 1L4ZA 5I25A 3GYLB 1P10A 2RA0A 3EA7A 1JIRA 3UOPA 3MU8A 1NESE 2P93A 1UO6A 1C1TA 3A87A 1XUGA 2D8WA 1C4V2 3BTEE 3PLBA 1QA0A 2GZ9A 1GI6A 1C1VH 1HUTH 3I29A 4OS7A 1A0JA 2TGTA 1P0SH 1C1QA 2J92A 2WYJA 2VIOA 3SQEE 4K8BA 3VXEH 1NC6A 1Y8TA 4ABFA 4KTSA 1CHGA 2VIVA 1BTPA 1H9LB 5K7RA 2GX4A 3BIVH 3TPIZ 3SO3A 3O8DA 1O2YA 1GL0E 2C3SA 3T5FH 4MNYA 2FIRH 3UOUA 4B2AA 4LZ1H 1YLDA 1B0EA 1J9CH 2F91A 1OWIA 4YZUA 3GY7A 1CU1A 2XWAA 2F9VA 3TH3H 1O0DH 1QQ4A 1W7XH 1XUJA 5FX5A 2XYAA 4A92A 1A0LA 1T8LA 2FMJA 1EPTA 5T6GA 5A2MH 4JYVH 2WUCA 2FOHA 2TGAA 5DJ7A 2XXLA 4A6LA 2H9EH 1WV7H 1C5NH 1SGRE 1AVXA 1BMAA 1RTLA 2FOMB 1P2IA 1CHOG 3LC5A 3KQDA 4H6TA 2A31A 1TMUH 2BLQA 3RMOH 1HPGA 3LDXH 2V35A 2W26A 3ZV8A 1G3EA 4FUBA 2ODPA 3QO6A 1ELCA 1P9UA 1S84A 1HJAC 1NN6A 1UTOA 4I32A 4TPYA 2UUJB 3STIA 4B75A 1UTPA 1G3CA 3BN9A 2YOLA 1E0FD 2QF0A 1ZHPA 1ESAA 2GCHF 3M36A 3HGNA 1P2QA 1ETTH 4AFUA 2AGGX 2KAIA 2PGQB 2IPHA 1UTLM 4X6NA 1FDPA 2CJIA 1BMLA 1TGBA 4NA7A 2GZ7A 3RXGA 4KTUA 1RD3B 1MZAA 5J4QA 2RG3A 2Z9IA 3SNEA 5JBCS 1DY8A 1SBWA 1S5SA 4IS5A 4D76A 4MQAA 1AMHA 2ZDNA 2FTLE 2PFEA 3NPSA 1UTQA 3ATKA 1BA8B 4ABGA 4NIWA 1GCTC 2SNVA 3DFJA 1AD8H 1HAGE 5LH8A 3FP6E 4X2XA 2FO9A 3SW2B 4NZQA 1GJ8B 1YPLH 4ZKRU 2HWLB 1O3NA 1K1MA 3F9EA 3A7ZA 4IC6A 3H7TA 1O2UA 2BX4A 1GG6B 3QZQA 1EX3A 1OKXA 1S81A 3NCLA 3ODFA 2Z3DA 4PROA 4NIYA 1EZXC 4YT7H 1O3MA 2BYAX 2XC4A 2ZI2H 4AG2A 2H5DA 3QZRA 2W7UA 4MNXA 1W2KH 1TA2A 2NU2E 2DE8A 1TRMA 1AU8A 1NO9H 1OYTH 3BF6H 1K22H 4VGCC 1QQUA 2BD5A 3P8GA 1FQ3A 1NTPA 1HAOH 5AVDA 1V2RT 1C5RA 2RCEA 2ZZUH 1T4UH 4OGXA 4DT7B 1BBRH 1ELFA 2HOBA 1XUFA 3IWMA 5TCCA 2Z3CA 4AN7A 1CGHA 3K2UA 1VZQH 3T25A 3U8RH 5L2YH 1UJ1A 2B5TB 1S6HA 4GSOA 2ANYA 3KQEA 2B9LA 5EQSA 2Y5GA 1OP8A 1SFIA 1O2IA 3VB6A 3KL6A 2HPPH 1V2WT 3FANA 1IQIA 5J4SA 4WF8A 1GMDF 4Z0KA 3U69H 1QRWA 1BTHH 5L30H 3JZ2B 3EDXB 1DICA 1MTNB 3I78A 2ALPA 1SGDE 5FBEA 1N1LA 1N8OC 4O3TA 2UUKB 4NIVA 1H9IE 4X6MA 5A8ZA 1UHBB 1O38A 2O8MA 1LMWB 3K9XB 4JZDH 3SNAA 4GUXA 3RM0H 1IHTH 1W10U 3MOCA 3AASA 1TGTA 1OWKA 2ZTZA 4MNVA 1JRSA 5T6FA 5C2ZA 4ZKOU 1YBWA 4BANB 1ZTKA 4AB9A 1MTUA 1HIAA 1GI5A 1Y3UA 2OCVB 3A8BA 5HM9A 3BV9B 1TE0A 1LQDB 2OP9A 2F3CE 2PGBB 4K1EA 3HK6B 1J14A 3VB4A 3F9HA 1G3DA 3NWUA 1TPOA 4Y76A 1GJ9B 4ASHA 3A7TA 2PR3A 4ISHH 1GI7B 1YCPK 3IG6B 1UCYH 2XBYA 3MNXA 4BAOB 1AZZA 2R2WU 4OS2A 1HV7A 1O3PB 5E8EH 4ISOA 1D3QB 1GJ4H 1K28D 2BD2A 2P3FH 4CREA 2Y5HA 4JK6A 5FXLA 3EAJA 4GHTA 3M7UA 5F6MA 1KDQB 1V2TT 1ZSKA 2VIDA 3GYMA 1W11U 4A7IB 3QX5H 2VGCC 1SGTA 2GGVB 2ZECA 5DKMA 2WPIS 2FOEA 1L1GA 2OD3B 4GCHG 1QGFA 1XVOA 1M9UA 1LQEA 2ZFQH 3E8LA 4TY6A 4YOJA 1G37A 2H2ZA 2OINA 1GI2A 2VIPA 4WMDA 4MDSA 4E05H 5TCAA 1CHOF 2BD9A 4D7GA 3RXIA 2FP7B 4UD9H 1IQKA 1K1OA 2BD3A 1DSUA 1ZRKA 2Z94A 1FY4A 1GPZA 1VJ9U 2XRCA 4D7FA 3CS7A 1GI3A 1O32A 3EA8A 1AVWA 2ZDKA 1B7XB 1KXDA 2ZO3H 5E0JA 2CF8H 3GCOA 5C5NA 1K1JA 3D65E 1BTZA 2RDLA 3GY4A 1ETSH 4WY3A 1TNLA 1AKSA 4LXBH 2ZFTA 2SGEE 1GVKB 3MO9A 1S85A 1K2I1 1ZJKA 3CENA 5A8XA 1G2MA 5C1UA 1DUEA 6ESTA 2A7CA 1G36A 3E0PB 4UE7H 1LHEH 2R3YA 4B71A 1A3EH 1NRNH 3PLPA 2VWOA 4K60A 4BXSA 1TOMH 2BLOA 3GCNA 1V2LT 3P17H 5C1XA 4FU8A 2PKAA 2IOTA 4YOIA 3O8RA 1H4WA 1LO6A 2FOCA 3SN8A 1ACBE 2A4QA 3RXJA 3GY2A 2H1UA 3RMMH 1Z71A 1DWEH 3SJ8A 1N6XA 2ZC9H 3S69A 3I77A 1IQMA 1YPEH 1EJAA 1ZZZA 2VWMA 2HALA 3ELAH 4UFFH 2BZAA 2GP9B 3MWIU 1IQLA 3LGUA 1K21H 1C5UA 5TJXA 3VB7A 1C2GA 2LPRA 2TGDA 3BSQA 1L1NA 1O2OA 2VJ1A 4OS4A 2ZHQH 5PTPA 3T62A 2NU3E 1IAUA 3P8FA 2ZHEH 1QRZA 1C9TA 1SMFE 3RXVA 1NM6A 1FIWA 1PQAA 1CBWB 2A2QH 2BXTH 4NGAH 2BVRH 1OWEA 1SGYE 4YLUA 4OS1A 3ZVGA 3LPRA 3RXTA 4BAKB 5E2OA 4JZFH 2PKSB 4X2YA 3UQVA 5EPNA 1NPMA 3RU4E 2EA3A 1O3BA 1T8OA 1PQ8A 5F8ZA 1FY1A 1ELBA 5DO4H 1DXPA 2P8OB 3F1SB 1O2WA 2A7HA 7ESTE 5FBIA 1ESBA 2GCTC 1AHTH 1C1SA 1HAZB 3E91A 1EAXA 1Y3VA 1IQEA 1EAUA 1WTHD 3A7XA 4K1SA 5GXPA 3BG4B 1MBMA 1PPEE 1VR1H 3PO1C 1D9IA 2CF9H 3RXFA 1C5MD 4Q7YA 1E38B 1TA6A 2QIQA 1ZMJA 1BT7A 3BIUH 1INCA 5JYIA 2XW9A 3AW0A 2YNAA 3EYDA 3E6PH 4D9QA 1CT2E 2HNTE 1PPFE 2ZGXH 1C4Y2 1HLTH 3HPTB 4K5ZA 1ZSLA 4ESTE 5EXLA 1P11E 3Q76A 3SU0A 2CV3A 4CRBA 4MTBA 1SGQE 4NZLA 4CBOA 1HAVB 1A0HB 4UONA 1SB1H 1V2KT 1CGJE 1D3PB 2FS8A 1MTSA 1FMGA 5T6DA 2ULLA 2HNTC 3UWIA 1AB9B 4JZ1A 5ABWA 1EJNA 3MO6A 4UEHH 1BMMH 1L1JA 1KYNA 5C5OA 2SGAA 1J17T 4IW4E 4LOYH 1H9HE 4X1PU 1NU7B 1QCPA 4CRGA 2V3OH 4FU7A 3E0NB 3RXUA 3S7KB 1BRBE 4HGCA 5L6NH 4ZAEA 4A5TS 1TIOA 1D6RA 1EP5A 3QDZB 3SOSA 2WPMS 3A82A 3A81A 5JBTA 3BTTE 2ANWA 3RU4D 1LDTT 3V0XA 3ZZ5A 1P09A 1Z8JB 2OQUA 2ILNA 5HYOA 2FS9A 3UPEA 2AIQA 3AW1A 3OSYA 2FLBH 3S9CA 1SG8B 1GGDC 1JWTA 5EGMA 4GCHF 2ZG0H 1RIWB 1YLCA 2VWLA 4FUIA 1TALA 2ZFFH 3M7TA 8LPRA 3BG8A 3N7OA 1FY3A 1QIXB 1OXGA 1A46H 3U9AH 1O2PA 1Z8GA 2C8WB 1W12U 1AQ7A 2A5AA 5EOKA 2D26C 4WWYA 4CR5A 2GZ8A 3GCHB 2Q6FA 1AI8H 2CN0H 3GDSA 1JMOH 1AN1E 2ZQ1A 4Y6DA 2ASUB 1UK3A 1MBQA 1TBQH 1YPJH 3LONA 4X2VA 2J4IA 2FI4E 3M35A 3MMGA 2CMYA 2P16A 2ZFPH 4JCNA 2BDBA 2QV1A 3S7HB 1ZSJA 1PPGE 4ZHLU 4NFFA 4MG3A 1KTTB 1LHCH 1DS2E 1O3AA 4ISNA 1C5VA 5G4BA 1OPHB 2G81E 3QGJA 4NSVA 2AIPA 1ZPZA 2XNIA 2ZCKP 1F92A 1FAKH 1DANH 5E0HA 2P95A 1EATA 1V3XA 4BOHA 2UUFB 1NS3A 6GCHF 1TNJA 1EB2A 1K1LA 1TONA 4FUDA 4WMEA 1C2DA 1ORFA 3MU5A 5C20A 2GVFA 3KN2A 1O33A 3UUZA 1T31A 1PPBH 1EASA 1FNIA 4ABIA 2W7SA 1TRYA 3SUFA 3M3TA 1CGIE 1QB9A 1WU1A 3TLOA 1PQ7A 3V7TA 5CMXH 2PUXB 4BAQB 2R3UA 3B23B 1P06A 3PM3A 3D49H 2SGQE 1TQ7B 1DPOA 1BTYA 5HXFA 1AY6H 1SQAA 4DG4A 1NFUA 1C4U2 3T27A 2ALVA 1ELGA 4ABDA 1Z1JA 3QTVH 1W7GH 4AFQA 2ZPRA 4Q80A 1IQFA 4U01A 2P59A 2K1QA 5GCHG 4Y79A 3LGIA 1QJ7B 2NU1E 2ZDVH 1GBEA 3BTGE 3M7QA 2JETB 1LPZB 1DITH 5EW1H 2PTCE 5JDUB 1U6QA 4RKJB 4IMZA 3GOVB 3UQOA 1HAYB 3A7VA 2YNBA 2RA3A 2SGPE 1RS0A 3LGVA 4TWWA 3ENSB 2BQ7B 3O8BA 2BQWB 1O5DH 1Y3YA 3A86A 2FDAA 4AG1A 3A83A 1SGFA 4I8JA 1ZR0A 3PROA 4I8GA 4R0IA 3O8CA 1EKBB 3RC5A 1XUKA 5FPSA 2OC7A 2A1DB 1Z8IB 1YPHE 3ZV9A 5A0CA 3KNXA 4J2YB 2UWLA 2BLVA 2ZTXA 4M7GA 1P2JA 3UREA 1MKXK 1QNJA 2BD8A 1BRAA 3PLKA 1JRTA 1RJXB 3E3TA 4WXIA 1ESTA 2A2XH 2BDHA 5JBBS 3SHCH 1O2KA 1TLDA 3M3VA 4ZMAH 1FJSA 1EB1H 4B73A 1O2LA 1H8IH 1TBZH 4MPWA 1TBRH 3SV6A 3URCA 4WVPE 1TGCA 1YPHC 3VB5A 3LT3A 1PFXC 1XKBC 2ZEBA 3Q3XA 2WPHS 4X8UH 4X8TH 4ZHMU 3RXCA 4AFZA 1V6DA 3BTHE 3EQ0H 5DP7A 4X6PA 1XKAC 1AFQB 1GWAA 3PB1E 4ABBA 4A1TA 1LVOA 1MQ5A 1ZHMA 1FUJA 1ZRBA 3GICB 5A0BA 1MU8B 5JBAS 1GG6C 1GJ7B 2J34A 4LK4A 3VFEA 2Q6DA 1O3HA 1GBIA 2JH0D 4F4OC 4DCDA 3H5CB 1ANBA 1GMHF 2J94A 1GBAA 4D9RA 1YPMH 2J38A 2Y81A 1YCPM 4B76A 1WYKA 5FX6A 1KLIH 4YTAA 4YESB 2ZKSA 2R0KA 2UWOA 1GHYH 4FUHA 7KMEH 1IQJA 4NG9H 1WCZA 1SGNE 1UTJA 3LH3A 5HM2A 3SNDA 3BTME 1GHAG 4Y71A 1SQOA 4MLFB 1ARCA 4JZIA 1ABIH 1GBTA 4IC5A 1W3CA 4X1SU 4INKA 2EC9H 3ATMA 1YCPH 4XOJA 2QA9E 1C9PA 2SNWA 2V6NA 3VEQB 1OSSA 1SGIB 2TBSA 4CHAB 3MNBA 1MCTA 3RU4T 3QUMP 1DWCH 2Y7XA 4BTIB 1H1BA 1MTNC 1HB0B 3RMNH 2JH5D 2VU8E 4WH8A 3SV9A 1TFXA 2BHGA 5CHAB 1WUNH 1OWDA 4KKDA 2Z9GA 1V2VT 1FONA 1O3EA 1SVPA 1DE7H 2GDDA 1DM4B 2XCFA 1D3TB 1O2SA 1T8MA 1BJUA 1LKBA 2P3UB 2BOKA 2O8UA 1JXPA 1GHVH 1GCDA 4DURA 1EP6A 1THPB 4INLA 1BTXA 1O2RA 3NK8A 4E7RG 3AVZA 4X1QU 4A1XA 3BEFB 4E7NA 4XBBA 1MU6B 1G32B 2AMQA 4UDWH 2ZTYA 1MZDA 1AUTC 1ELTA 2XC0A 1GJCB 1G2LA 3SJKA 2J9NA 1THSH 1BDAA 1HXEH 2PV9B 4Y7AA 2TPIZ 1TGSZ 2W3KA 3VGCB 1Y3XA 2BTCE 1GBDA 1GBLA 1QBVH 4JK5A 1FPHH 1MH0A 1UVSH 3SHAH 2Z9JA 1SSXA 1RTKA 3K65B 1LVMA 4BAHB 1F5LA 1SGPE 1AUJA 1C2LA 1TPAE 3LGWA 1QTFA 1FN6A 1A4WH 2PHBA 4KP0A 3RMLH 3TGIE 2Z9KA 1EJMA 5ETXA 1LHDH 1O2QA 1D3DB 3L3TA 5GCHF 4IMQA 3SI3H 1YPGH 1C2EA 2GV7A 1O3CA 4FUEA 3TH2H 3WY8A 1C5PA 3UNRA 4ABHA 3OTJE 2D2DA 2STBE 2BY8X 3SUEA 1HJ9A 4FUGA 2C90B 5HGGA 5GJ4B 2ZCHP 1MCVA 1AE8H 3T28A 3QWCH 1P8VC 2VB0A 2I6QA 1QJ6B 2DUCA 2BY7X 1E34B 4B1TA 3SJ9A 1TX8A 1O2TA 1F0SA 2FLRH 2AMPA 2TIOA 4KGAA 3MH6A 3ZYEA 1FXYA 2VIQA 2BY6X 1HAIH 3A80A 1T7CA 3R0FA 1O36A 3OU0A 4K3JA 4AYYB 4RSPA 1DY9A 3RLYH 2XTTB 3U98H 1NT1A 8ESTE 1XMNB 2PSYA 1T32A 1G3BA 1KLJH 1UHBA 1BBRE 1Z8RA 2J2UA 2ZGJA 3G01A 2HRVA 1UVTH 1HDTH 2FI3E 1UK4A 3SU2A 3QGNB 3SV2H 1NRSH 3OY6U 1BTUA 1BITA 3E16B 1O5CB 3BEUA 3Q3KA 3KIDU 3L6PA 2W5EA 1VCPA 4DOQA 3FFGA 1H8DH 4O03A 1BIOA 4X1RU 3MU4A 1LPGB 1K1IA 1TX6A 1W8BH 1QL8A 3FZZA 1O2GH 3DD2H 1KIGH 3QLPH 1O2VA 3FP7E 3MYWA 3B8JA 3ATWA 3PTNA 1NFYA 4K2YA 4FUFA 5IDKA 1CBWC 1F2SE 1SGFG 3PV4A 3T29A 2V3HH 1EAIA 3KQCA 1F0RA 2ZU5A 1AO5A 3HKJB 1SLWB 4XDEA 3SJIA 3ZZ9A 2QC2A 2TRMA 1O37A 1KXCA 3K6ZA 2PKSC 5AF9H 1VCQA 1LCYA 1HAHH 2PW8H 1KDQA 1YGCH 4J1YA 1SGEE 2BD4A 6CHAB 4ZXXH 3HK3B 2P8OC 1CVWH 3TIUA 1HRTH 2ANMH 2EEKA 2EI8A 4AGJA 4DJZB 2ZHFH 4XE4A 1GHAF 3LC3A 1AE5A 1ZYOA 4IBLH 4CRFA 1VCWA 2ZF0H 3A8CA 1AFEH 2G52A 3BG4C 2C4FH 2VH6A 3F9GA 3SUGA 3PMAB 3RLWH 4K69A 4K8YA 1MTVA 1TAWA 3HATH 2JH6D 3RXHA 2P94A 1QRXA 2ZFRH 1UCYE 4FXGH 1DFPA 1P2OA 1C1UH 2ZGHA 1TNKA
chains in the Genus database with same CATH superfamily
4ZKSU 3RXPA 3U28C 1OWJA 2BM2A 1GDNA 2G8TA 1X7AC 2VINA 3H09A 2FX4A 1P02A 1H8ED 1V2MT 2GD4B 2BX3A 4WH6A 1QURH 2Z3EA 3A88A 1K1PA 3GY5A 1W0YH 1XXDA 2CHAB 1AWHB 1DLEA 1DOJA 4ZROA 3F2HA 3L33A 5FPTA 5AHGH 1OP2A 1BMFD 4H4FA 2PUQH 1V2UT 3URDA 1CSOE 3PTBA 1AB9C 1A61H 3SYJA 3EA9A 3F6UH 2BD7A 2QF3A 4FVBA 2OC8A 1FY8E 1GDUA 1O3GA 1EUFA 4ZXYH 1Y3WA 5KGOA 1YM0A 1QB6A 3M5MA 2AYWA 1UVOA 1UK2A 3RXOA 1O5FH 3VPKA 3S0NA 1O39A 1MKWK 3FAOA 4X1NU 1FY5A 2PLXA 7LPRA 3P8OA 2V0BA 5GIBA 3SV7A 1T8NA 2BVSH 4NWKA 3KHVA 4AORA 4ZUHA 3A89A 3KCGH 2K0QA 3SU4A 5DG6A 2ODQA 1G9IE 5LPRA 1Z7KA 1F7ZA 1RIWC 4MPXA 9LPRA 1KMHB 4YOGA 1GVLA 1TPSA 1KLTA 3BTWE 2BDIA 3RXQA 1TX7A 3AK5A 1IOEA 3RXLA 1O31A 1QHRB 3SZEA 2A5KA 4FUJA 4Q7XA 3PYHA 1P3CA 4ABAA 1RXPA 3UNQA 4ZKNU 2GT7A 2BLWA 3LGTA 3TK5A 1SQTA 1VITG 3GCHC 2Z7FE 3A7WA 7GCHG 2BOHB 2XCNA 3B9FH 4IN1A 5JB8S 2W3IA 3TNSA 5C1YA 1RGQA 1YPKH 2G4UA 1J16A 1ELAA 3NZIA 1TABE 3PMBB 3ZZ6A 1SC8U 1HBTH 1XX9A 2ZFSA 3KGPA 3QK1A 5AFZH 2NU4E 2OBOA 5HMAA 4DIIH 2Y6TA 3W95A 1A1RA 1VITH 3D23A 1NRQH 3KEEA 1HAXB 4LZ4B 5EU8A 4CH2B 4XD7D 4WJG2 1P04A 2F83A 4B6FA 1FI8A 1P2NA 3STJA 1BOQA 4BAMB 2AH4X 1OOKB 2F9NA 5FCKA 2JDID 2Z9LA 2D1JA 2OTVA 4FUCA 1C2MA 4B6EA 3SQHE 2HNTF 2XNDD 1EOLA 3M5LA 3FP8E 2QXHA 2O8TA 1ZGVA 3NXPA 1S83A 4X0WU 3ZVAA 1FIZA 2HPQH 1MAYA 4GLYA 1QB1A 3FO8D 1GBBA 1NBMD 5DP6A 1KXFA 3SUDA 3E1XB 1AVGH 2Y80A 1HAVA 4AB8A 2DE9A 5A09A 4ABEA 3Q3YA 4KTCA 1C5LH 1C5TA 2BY5X 1WQSA 2F9BH 1EZSC 1ELDE 4DGJA 3RC6A 1MD8A 3ITIA 3DFLA 5SGAE 1ZOMA 1K9OE 2VWNA 4BTUB 3E90B 5EODA 1GHZA 4B2BA 1O2MA 1PPZA 1KXAA 2IJD1 3PMHB 3MQKC 2QXIA 4CRAA 2JETC 3BEIB 3LJJA 4UFEH 2IN2A 8GCHG 1CA0C 3ZVEA 1EPTB 1O5EH 5EQQA 4HFPB 1GJDB 3CS0A 3C1KA 4JYUH 3ZZ4A 2ZPSA 3A84A 2WINI 1TB6H 5BRRE 2OXSA 2STAE 3UFAA 2A5IA 1DSTA 3R3GB 1Y5AT 3TJOA 4ABJA 3U8OH 4FVDA 1GI1A 5F8XA 1XM1A 2W6ID 4B74A 3TU7H 1ZMNA 1P9SA 1GL1A 4GVUA 2XWBI 4H6SB 2F9PA 9ESTA 2GMTB 1XUIA 1SL3A 4DY7B 2QXGA 2G5VA 1A7SA 1MAXA 3K6YA 1ABJH 1NRPH 1BUIA 4RKOB 4X2WA 4ISLA 1S82A 5DGJA 5EG4A 1CA0B 2WYGA 2GKVE 1UVUH 1A3BH 1VGCB 1FLEE 5FPYA 2QE7D 4NA8A 1DXWA 1L2EA 1EOJA 2KAIB 5GWZA 3ZYDA 2F9OA 4CR9A 1EZUC 1SLUB 2KCYA 1QL7A 3GDUA 1N6YA 1XUHA 1GJBB 1P57B 1NFXA 1FAXA 4NSYA 1AFQC 2ZDAH 5A0AE 1W14U 2QAAA 2I6SA 2A32A 2EY4C 3QTOH 1LHFH 1RTFB 3TGKE 3SBKA 1BTWA 2QGRA 3HGPA 3U8TH 2ZU4A 3WW7A 4TPIZ 2GDEH 4D8NA 5CE1A 1DUAA 1NZQH 1SLVB 1SQRA 1ZPCA 2QN5T 3UY9A 5DP8A 2BDCA 3TJVA 4NCYA 3MO3A 5IYTA 1ANEA 3Q00A 1HXFH 4FU9A 3TH4H 3MI4A 1DVAH 2WPKS 1BMNH 2A0QB 1EZQA 1CO7E 1TRNA 2Z6BD 1PJPA 1P2MA 2VVCA 4NFEA 1PQ5A 1ZTJA 4GAWA 2OC1A 3MH4A 2EI7A 2ZHWH 3A8DA 3M37A 3OX7U 1Q31A 2H9TH 2BQ6B 2VVUA 3BTKE 4ISIH 4THNH 1QFKH 3SORA 1V2ST 1IQNA 1ID5H 3CNRA 3V12A 1MMJN 2AEIH 2FESH 3EGKH 1SGCA 3ZVDA 3QN7A 2C8XB 1C5WB 2B0FA 2CXVA 3Q77A 1JBUH 2BY9X 1L4DA 5GDSH 1C1RA 1O5BB 4I8HA 1ZPBA 2ANKH 3GY8A 1HCGA 1JOUB 1ZHRA 2A7JA 1KXBA 5JB9S 1VITF 4CHAC 7GCHF 5LPEA 2KZ4A 2WV5A 1GI0A 2ZU3A 3P92A 2VNTA 1TWXB 1LVBA 1UTMA 3MTYA 2ZNKH 1BRCE 1NU9A 2VH0A 1FV9A 3ZVFA 3LU9B 4BNRA 1K1NA 1TPPA 3PRDA 2JKHA 1GBHA 3UWJH 1Y5BT 5CHAC 4NIXA 1CT4E 3LH1A 4NA9H 1OYQA 1QJ1B 2R2MB 2WV4A 1GHBG 1C5ZB 5BPEA 2EI6A 1HJAB 4I33A 3KQBA 2KFWA 2J98B 1ELVA 3NUMA 1FN8A 2A4GA 1THRH 1O5AB 2JJ2D 4Y8XA 3UNSA 4E06H 1XXFA 2H6MA 3UTUH 1V2PT 2B8OH 1SFQB 3JZ1B 2QCYA 4UFGH 3GS9A 1O2ZA 1A5IA 1FPCH 4JZEH 1DDJA 1O3DA 3LJOA 4BTTB 4DVAU 3VGCC 1HIAB 1O30A 4A1VA 3VB3A 1C2JA 4Y8YA 3DT0H 3U1JB 3V3MA 3ZZ3A 4YO9A 5ESTE 3S9BA 1GMCG 1PYTC 2ZCLP 2FXRA 1WBGB 4TWYA 1P12E 1GCTB 1SR5C 2L6OA 2PSXA 3NRLA 3MH7A 1CQQA 2HVXA 1S6FA 2NU0E 4B2CA 3FZDA 5F03A 3OYPA 1TNIA 1C1PA 5DP4A 1GBMA 2ZGBH 4X6OA 2LNCA 1GVZA 3VG8A 1AIXH 1C1MA 4X8SH 3ZZ7A 1T4VH 1C1NA 2FYQA 3MU0A 2ODYB 3RUOA 4ACAA 1ZLRA 1ANCA 3GY6A 6LPRA 2J5UA 8GCHF 4TYDA 1J15A 5KECA 4I7YH 2PP6A 1C2KA 1O5GH 4Y0YE 2ZU1A 3P95A 1O3OA 2XC5A 3MHWU 1AZ8A 2BZ6H 4WXVA 5EQRA 4DT4A 1G30B 1DWDH 3A85A 1B0FA 5I46H 2NWNA 1J8AA 1V2QT 2PTNA 1OP0A 3TVJB 1EAWA 3NKKA 5HKKD 4VGCB 1YP9A 1ZJDA 1Z6JH 4Y8ZA 2FEQH 4Y10E 2Q6GA 1A2CH 4AGKA 5DP9A 2Y7ZA 3ZIAD 3CP7A 3MNSA 2M2AA 2FZZA 4X8VH 1TNGA 5H4IB 1F5RA 4AOQA 2O8LA 1TGNA 2ZU2A 3U1IB 4HG6A 3TGJE 1KTSB 1RRKA 1AKSB 2OQ5A 3M5NA 2AGIX 3SI4H 4SGBE 1JIMA 1PYTD 5ESBA 1NROH 2ZQ2A 1TQ0B 1LKAA 3MFJA 1HGTH 4I8KA 2WUBA 3LIWA 1O3FA 1C5YB 1UTNA 3SGAE 1Y5UT 2BDAA 1S0RA 5L2ZH 4IGDA 2V3MA 1A5GH 2GT8A 3RXRA 1P2KA 1IQGA 3UIRA 1HYLA 3W94A 5A8YA 2G5NA 3MH5A 1N8OB 2FX6A 4DIHH 2PKAB 2H5CA 3IITA 3RC4A 1TOCB 5EJ1A 5LPFA 3UR6A 3SNCA 1GI4A 1UVPA 2FOGA 3UR9A 4AYVB 1IHSH 4GPGA 3DA9B 3A7YA 4XRNA 1C5SA 1BZXE 1GI9B 2R9PA 2UUYA 1KY9A 3GCTG 3ZVBA 4K1TA 1EXFA 1GBKA 3OE7D 1O2HA 5FAHA 4Y7BA 3TITA 4GHQA 4YM9A 3MNCA 1BBRK 2ZHDA 2QXJA 4Q7ZA 1YY3A 1O3LA 4TSFD 4XSKU 1O2NA 3OY5U 1GBFA 3LKWA 3GY3A 5DP3A 3RXBA 2P3TB 1PPCE 2ZP0H 1E37B 4ZH8A 2IPQX 2XBXA 5EJLA 6CHAC 2FTMA 2GJGA 2AS9A 2SGDE 2QF5A 1WQVH 1YC0A 3MU1A 2KX4A 1FZZA 4INHA 1NRRH 1C1WH 1YF4A 1V2NT 2AGEX 4MPVA 3TK9A 3RM2H 1SOZA 3C27B 4SGAE 2VGCB 1DT2A 3DUXH 3DHKH 3ZZBA 1MKWH 3BTQE 4RN6A 1NY22 1TMBH 1C5XB 1L0ZA 1YKTA 2GV6A 2G51A 2WPDD 1O2JA 1SHYA 4CRCA 1NFWA 1HNEE 2ZWLH 2HLDD 4MNWA 3SGBE 1Z6EA 2XOKD 3TJUA 4XBCA 5GPIB 3RDZA 3PWCA 4U2WA 1GJ5H 2KCAA 4O3UA 4IN2A 1O35A 1O3JA 2Q1JA 5LGOA 2HGTH 4XFQA 2ZDMA 3LOXA 6GCHG 3M3SA 1P03A 4M9FA 3TK6A 2OLGA 1GHBF 5EXMA 3SGQE 1GHWH 3ZZCA 2BXUH 1AWFH 1LTOA 2CHAC 1A5HA 2ZIQH 2C93B 3TNTA 3M61U 3T2NA 1E35B 1QY6A 1PPHE 1C1OA 2F9UA 3BTFE 3LGYA 3P8NA 4YT6H 3RP2A 1UCYK 1LPKB 3F2FA 3RXSA 1DLKB 1O34A 3RXMA 1ZGIA 1C5OH 4KELA 3F68H 2IJOB 2QYIA 2B7DH 2ZDLA 4JMYA 5E2PA 1QL9A 3SNBA 1KXEA 2BB4A 2ZPQA 3S9AA 1MQ6A 1E36B 4AC9A 4I31A 1Q2WA 1D6WA 4CH8B 1CA8B 3SJOA 5EPYA 4HI3A 1DWBH 2TGPZ 1GMCF 1UTKA 2BDYA 2FOAA 3AAVA 2FOBA 3H7OA 5JPMH 2ZA5A 2WPLS 2AERH 1KSNA 1O2XA 4AFSA 2YMSB 2QY0B 1BCUH 4DW2U 1GJ6A 3F0OA 2Y82A 2FM2A 1SI5H 5FHTA 2VVVA 2G4TA 1GI8B 2WV9A 1BQYA 2AFQB 1ARBA 3TJNA 3SU1A 4Z6AH 3D62A 4WMFA 3ATLA 5F8TA 1NBME 5B6OA 4Y0ZE 2OC0A 2C8YB 1HAPH 1ANDA 1C5QA 4OS6A 1RFNA 5DP5A 2J95A 1BJVA 2FWWA 4H42U 1V2JT 1Q3XA 4O9VA 4Y11E 2A4RA 2WPJS 4BXWA 4JYTA 3ZZDA 4AZ2B 5E0GA 4QT8C 3P70B 2AMDA 2OBQA 1D4PB 1TNHA 1YYY1 3RXDA 3ZZAA 1YWUA 4MPUA 1SOTA 1QBNA 3RXEA 5FL7D 3ATIA 2PWXA 4U32A 1ELEE 1MD7A 1LVYA 1MUEB 4OGYA 2XBVA 2THFB 1HJ8A 1C2FA 1UMAH 2GCTB 3V13A 2A4OA 1O3IA 1WTGH 2ZGCA 1QR3E 5EXNA 1GDQA 1IQHA 5EW2H 1OS8A 3PWBA 1C2HA 3PO1B 4CBNA 1W13U 1Z1IA 1MTWA 2GCHG 1F0UA 2XBWA 3RXAA 3SZNA 4MVNA 1SLXB 4XBDA 1AGJA 1ETRH 2HLCA 3RXKA 3SU3A 5T3HA 1SPJA 4UFDH 1OX1A 1Y59T 2FPZA 5HIZA 2GTBA 1DX5M 5C67A 1BHXB 1BHXF 1C2IA 1CE5A 1GMHG 4HTCH 1WAYB 1S6LA 2C8ZB 5AFYH 1GBCA 3VXFH 3ESTA 4F49A 1GBJA 1WOFA 4O97A 2BDGA 2O9QA 3SU5A 3KF2A 5C3NA 1VJAU 1E1QD 1BRUP 1QBOA 2LELA 2W6JD 3UB0A 1F5KU 3GCTF 3PMJA 4CRDA 1V2OT 3WWFA 3M5OA 1XVMA 3BTDE 2BMGB 3GISB 4P02A 2H9HA 1ZMLA 3HKIB 3T26A 2FI5E 2UWPA 1GHXH 1EPTC 1GJAB 2BVXH 4Q2KA 8KME2 3KYFA 1P01A 4AX9H 3P6ZB 4R8TB 2M5TA 4U30A 5K0HA 5DPAA 2G55A 1B5GH 5T1VA 2A45B 2OUAA 1O3KA 2G00A 2VIWA 1LHGH 1MKXH 1BB0B 3SU6A 4TY7A 1TYNA 1HFDA 1EQ9A 2GMTC 5DK1A 3SV8A 3F9FA 3ZVCA 1S0QA 1WSSH 1W0ZU 4YLQH 1QA7A 5FCRA 1GGDB 2Y5FA 4I8LA 1P05A 1OWHA 3EE0B 2O8WA 4HZHA 4ZCNA 3A8AA 2R0LA 3FVFB 3AAUA 1F0TA 1VGCC 1VKYA 2CGAA 2FYRA 4ZHAA 2SFAA 3N7EA 2SGFE 1P3EA 3GDVA 3ZZ8A 4NWLA 4OS5A 1TMTH 2FOFA 2ESTE 1GMDG 2FODA 3ODDA 1CT0E 1SHHB 1ZTLA 1L4ZA 5I25A 3GYLB 1P10A 2RA0A 3EA7A 1JIRA 3UOPA 3MU8A 3N99A 1NESE 2P93A 1UO6A 1C1TA 3A87A 1XUGA 2D8WA 1C4V2 3BTEE 3PLBA 1QA0A 2GZ9A 1GI6A 2HVYB 1C1VH 1HUTH 3I29A 4OS7A 1A0JA 2TGTA 1P0SH 1C1QA 2J92A 2WYJA 2VIOA 3SQEE 4K8BA 3VXEH 1NC6A 1Y8TA 4ABFA 4FOUC 1CHGA 4KTSA 2VIVA 1BTPA 1H9LB 5K7RA 2GX4A 3BIVH 3TPIZ 3SO3A 3O8DA 1O2YA 1GL0E 2C3SA 3T5FH 4MNYA 2FIRH 3UOUA 4B2AA 4LZ1H 1YLDA 1B0EA 1WXRA 1J9CH 2F91A 1OWIA 4YZUA 3GY7A 1CU1A 2XWAA 2F9VA 3TH3H 1O0DH 1QQ4A 1W7XH 1XUJA 5FX5A 2XYAA 4A92A 1A0LA 1T8LA 2FMJA 1EPTA 5T6GA 3W1EA 4JYVH 5A2MH 2WUCA 2FOHA 3OEED 2TGAA 2AHME 5DJ7A 2XXLA 4A6LA 2H9EH 1WV7H 1C5NH 1SGRE 1AVXA 1BMAA 1RTLA 2FOMB 1P2IA 1CHOG 3LC5A 3KQDA 4H6TA 2A31A 1TMUH 2BLQA 2KR7A 3RMOH 1HPGA 3LDXH 2V35A 2W26A 3ZV8A 1G3EA 4FUBA 2ODPA 3QO6A 1ELCA 1P9UA 1S84A 1HJAC 1NN6A 1UTOA 4I32A 4TPYA 2UUJB 3STIA 4B75A 1UTPA 1G3CA 3BN9A 2YOLA 1E0FD 3OEHD 2QF0A 3OAAD 1ZHPA 1ESAA 2GCHF 3M36A 3HGNA 1P2QA 1ETTH 4AFUA 2AGGX 2KAIA 2PGQB 2IPHA 1UTLM 4X6NA 1FDPA 2CJIA 1BMLA 1TGBA 4NA7A 2GZ7A 3RXGA 5DSFA 4KTUA 1RD3B 1MZAA 5J4QA 5DN6D 2RG3A 2Z9IA 3SNEA 5JBCS 4Q63A 1DY8A 1SBWA 1S5SA 4IS5A 4D76A 4MQAA 1AMHA 2ZDNA 2FTLE 2PFEA 3NPSA 1UTQA 3ATKA 1BA8B 4ABGA 4NIWA 1GCTC 2SNVA 3DFJA 1AD8H 1HAGE 5LH8A 3FP6E 4X2XA 2FO9A 3SW2B 4NZQA 1GJ8B 1YPLH 4ZKRU 2HWLB 1O3NA 1K1MA 3F9EA 3A7ZA 4IC6A 3H7TA 1O2UA 2BX4A 1GG6B 3QZQA 1EX3A 1OKXA 1S81A 1W0KD 3NCLA 3ODFA 2Z3DA 4PROA 4NIYA 1EZXC 4YT7H 1O3MA 2BYAX 2XC4A 2ZI2H 4AG2A 2H5DA 3QZRA 2W7UA 4MNXA 1W2KH 1TA2A 2NU2E 2DE8A 1TRMA 1AU8A 1NO9H 5B6LA 5C17A 1OYTH 3BF6H 1K22H 3EE7A 4VGCC 1QQUA 2BD5A 3P8GA 1FQ3A 1NTPA 1HAOH 5AVDA 1V2RT 5EJZA 1C5RA 2RCEA 2QF4A 2ZZUH 1T4UH 4OGXA 4DT7B 1BBRH 1ELFA 2HOBA 1XUFA 3IWMA 5TCCA 2Z3CA 4AN7A 1CGHA 3K2UA 1VZQH 3T25A 3U8RH 5L2YH 1UJ1A 2B5TB 1S6HA 4GSOA 2ANYA 3KQEA 2B9LA 5EQSA 3UAIC 2Y5GA 1OP8A 1SFIA 1O2IA 3VB6A 3KL6A 2HPPH 1V2WT 3FANA 3WWBA 1IQIA 5J4SA 4WF8A 1GMDF 4Z0KA 3U69H 1QRWA 1BTHH 5L30H 3JZ2B 3EDXB 1DICA 2JJ1D 1MTNB 3I78A 2ALPA 1SGDE 5FBEA 1N1LA 1N8OC 4O3TA 2J98A 2UUKB 4NIVA 1H9IE 4X6MA 5A8ZA 1UHBB 1O38A 2O8MA 1LMWB 3K9XB 4JZDH 3SNAA 4GUXA 3RM0H 1IHTH 1W10U 3MOCA 3AASA 1TGTA 1OWKA 2ZTZA 4MNVA 1JRSA 5T6FA 5C2ZA 4ZKOU 1YBWA 4BANB 1ZTKA 4AB9A 1MTUA 1HIAA 1GI5A 1Y3UA 2OCVB 3A8BA 5HM9A 2WSSD 1FX0B 1LQDB 1TE0A 2F3CE 2OP9A 2PGBB 3BV9B 3HK6B 1J14A 3VB4A 3F9HA 1G3DA 3NWUA 1TPOA 2J97A 4Y76A 1GJ9B 4ASHA 3A7TA 2PR3A 4ISHH 1GI7B 1YCPK 3IG6B 1UCYH 2XBYA 3MNXA 4BAOB 1AZZA 2R2WU 4OS2A 1HV7A 1O3PB 5E8EH 4ISOA 1D3QB 1GJ4H 1K28D 2BD2A 2P3FH 2RDEA 4CREA 2Y5HA 4JK6A 5FXLA 3EAJA 4GHTA 3M7UA 5F6MA 1KDQB 4I86A 1V2TT 1ZSKA 3PV5A 2VIDA 3GYMA 1W11U 4A7IB 3QX5H 1W0JD 1SGTA 2GGVB 2VGCC 2ZECA 5DKMA 2WPIS 2FOEA 2KM0A 1L1GA 2OD3B 4GCHG 1QGFA 1XVOA 1M9UA 1LQEA 2ZFQH 3E8LA 3DSGA 4TY6A 4YOJA 1G37A 2H2ZA 2OINA 1GI2A 2VIPA 4WMDA 4MDSA 4E05H 4ACBA 5TCAA 1CHOF 2BD9A 4D7GA 3RXIA 2FP7B 4UD9H 1IQKA 1K1OA 2BD3A 1DSUA 1ZRKA 2Z94A 1FY4A 1GPZA 1VJ9U 2XRCA 4D7FA 3CS7A 1GI3A 1O32A 3EA8A 1AVWA 2ZDKA 5IK2D 1B7XB 1KXDA 2ZO3H 5E0JA 2CF8H 3GCOA 5C5NA 1K1JA 3D65E 2WZQA 1BTZA 2RDLA 4F55A 3GY4A 1ETSH 4WY3A 1TNLA 1AKSA 4YXWD 4LXBH 2ZFTA 2SGEE 1GVKB 1QZ8A 3MO9A 1S85A 1K2I1 1ZJKA 3CENA 5A8XA 1G2MA 5C1UA 1DUEA 1E1RD 6ESTA 2A7CA 1G36A 3E0PB 4UE7H 1LHEH 2R3YA 4B71A 1A3EH 1NRNH 3PLPA 2VWOA 4K60A 4BXSA 1TOMH 2BLOA 3DSOA 1V2LT 3GCNA 3P17H 5C1XA 4FU8A 2PKAA 2IOTA 4YOIA 3O8RA 1H4WA 1LO6A 2FOCA 3SN8A 1ACBE 2A4QA 3RXJA 3GY2A 2H1UA 2KCOA 3RMMH 5C94A 1Z71A 1DWEH 3SJ8A 1N6XA 2ZC9H 3S69A 3I77A 1IQMA 2YMSC 1YPEH 1EJAA 1ZZZA 2VWMA 2HALA 3ELAH 4UFFH 2BZAA 2GP9B 3MWIU 1IQLA 3LGUA 1K21H 1C5UA 5TJXA 3VB7A 1C2GA 2LPRA 2TGDA 3BSQA 1L1NA 1O2OA 2VJ1A 4OS4A 2ZHQH 5PTPA 3T62A 4Q4LA 2NU3E 1IAUA 3P8FA 2ZHEH 1QRZA 1C9TA 3OFND 1SMFE 3RXVA 1NM6A 1FIWA 1PQAA 1CBWB 2A2QH 3KQ5A 2BXTH 4NGAH 2BVRH 1OWEA 1SGYE 4YLUA 4OS1A 3ZVGA 3LPRA 3RXTA 4BAKB 5E2OA 4JZFH 2PKSB 4X2YA 3UQVA 5EPNA 1NPMA 3RU4E 3FOAA 2EA3A 1O3BA 1T8OA 1PQ8A 5F8ZA 1FY1A 1ELBA 5DO4H 1DXPA 2EQNA 2P8OB 3F1SB 2JIZD 1O2WA 2A7HA 7ESTE 5FBIA 1ESBA 2GCTC 1AHTH 1C1SA 1HAZB 3E91A 1EAXA 1Y3VA 1IQEA 1EAUA 1WTHD 3A7XA 4K1SA 5GXPA 3BG4B 1MBMA 1PPEE 1VR1H 3PO1C 1D9IA 3PV2A 2CF9H 2YMSD 3RXFA 1C5MD 4Q7YA 1E38B 1TA6A 2QIQA 1ZMJA 1BT7A 3BIUH 1INCA 5JYIA 2XW9A 3AW0A 2YNAA 3EYDA 3E6PH 4D9QA 2F4LA 1CT2E 2HNTE 1PPFE 2ZGXH 1C4Y2 1HLTH 3HPTB 4K5ZA 1ZSLA 4ESTE 5EXLA 1P11E 3Q76A 3SU0A 2CV3A 4CRBA 4MTBA 1SGQE 4NZLA 4CBOA 1HAVB 1A0HB 4UONA 1SB1H 1V2KT 1CGJE 1D3PB 2FS8A 1MTSA 4ASUD 1FMGA 5T6DA 2ULLA 2HNTC 3UWIA 1AB9B 4JZ1A 5ABWA 1EJNA 3MO6A 4UEHH 4RT0A 5EIYA 1BMMH 1L1JA 1KYNA 5C5OA 2SGAA 4F48B 1J17T 4IW4E 4LOYH 1H9HE 4X1PU 1NU7B 1QCPA 4CRGA 2V3OH 4FU7A 3E0NB 3RXUA 3S7KB 1BRBE 4HGCA 5L6NH 4ZAEA 4A5TS 5F53A 1TIOA 1D6RA 1EP5A 3QDZB 3SOSA 2WPMS 3A82A 3A81A 5JBTA 3BTTE 2ANWA 3RU4D 1LDTT 3V0XA 3ZZ5A 1P09A 2V7QD 1Z8JB 2OQUA 2ILNA 5HYOA 2FS9A 3UPEA 2AIQA 3AW1A 3OSYA 2FLBH 3S9CA 1SG8B 1GGDC 1JWTA 5EGMA 4GCHF 2ZG0H 1RIWB 1YLCA 2VWLA 3PRBA 4FUIA 1TALA 2ZFFH 3M7TA 8LPRA 3BG8A 5C0TA 3N7OA 1FY3A 1QIXB 1OXGA 1A46H 3U9AH 1O2PA 1Z8GA 2C8WB 1W12U 1AQ7A 2A5AA 5EOKA 2D26C 2K8IA 4WWYA 4CR5A 2GZ8A 3GCHB 2Q6FA 1AI8H 2CN0H 3GDSA 4K1EA 1JMOH 1AN1E 2ZQ1A 4Y6DA 2ASUB 1UK3A 1MBQA 1TBQH 1YPJH 3LONA 4X2VA 2J4IA 2FI4E 3M35A 3MMGA 2CMYA 2P16A 2ZFPH 4JCNA 2BDBA 3DSPA 2QV1A 4Z1MD 3S7HB 1ZSJA 1PPGE 4ZHLU 4NFFA 4MG3A 1KTTB 1LHCH 1DS2E 1O3AA 4ISNA 1C5VA 5G4BA 1OPHB 2CK3D 2G81E 3QGJA 4NSVA 2AIPA 1ZPZA 2XNIA 2ZCKP 1F92A 1FAKH 1DANH 5E0HA 2P95A 1EATA 1V3XA 4BOHA 2UUFB 1NS3A 6GCHF 1TNJA 1EB2A 1K1LA 1TONA 4FUDA 4WMEA 1C2DA 1ORFA 3MU5A 5C20A 2GVFA 2WHXA 3KN2A 1O33A 3UUZA 1T31A 1PPBH 1EASA 1FNIA 4ABIA 2W7SA 1TRYA 3SUFA 3M3TA 1CGIE 1QB9A 1WU1A 3TLOA 1PQ7A 3V7TA 5CMXH 5HIYA 2PUXB 4BAQB 2R3UA 3B23B 1P06A 3PM3A 3D49H 2SGQE 1TQ7B 1DPOA 1BTYA 1MABB 5HXFA 1AY6H 1SQAA 4DG4A 1NFUA 1C4U2 3T27A 2ALVA 1ELGA 1K0HA 4ABDA 1Z1JA 3QTVH 1W7GH 4AFQA 2ZPRA 4Q80A 1IQFA 4U01A 2P59A 2K1QA 5GCHG 4Y79A 3LGIA 1QJ7B 2NU1E 2ZDVH 1GBEA 3BTGE 3M7QA 2JETB 1LPZB 1DITH 5EW1H 2PTCE 5JDUB 1U6QA 4RKJB 4IMZA 3GOVB 4FETA 3UQOA 1HAYB 3A7VA 2YNBA 2RA3A 2SGPE 1RS0A 3LGVA 4TWWA 3ENSB 2BQ7B 3O8BA 2BQWB 1O5DH 1Y3YA 3A86A 3OTPA 2FDAA 4AG1A 3A83A 1SGFA 4I8JA 1ZR0A 3PROA 2RFKC 4I8GA 4R0IA 3O8CA 1EKBB 3RC5A 1XUKA 5FPSA 2OC7A 2A1DB 1Z8IB 1YPHE 3ZV9A 5A0CA 3KNXA 4J2YB 5GNDA 2UWLA 2BLVA 2ZTXA 4M7GA 1P2JA 3UREA 1MKXK 1QNJA 2BD8A 1BRAA 3PLKA 1JRTA 1RJXB 3E3TA 4WXIA 1ESTA 2A2XH 2BDHA 5JBBS 3SHCH 1O2KA 1TLDA 3M3VA 4ZMAH 1FJSA 1EB1H 4B73A 1O2LA 1H8IH 1TBZH 4MPWA 1TBRH 3SV6A 3URCA 4WVPE 1TGCA 1YPHC 3VB5A 3LT3A 1PFXC 1XKBC 2ZEBA 3Q3XA 2WPHS 4X8UH 4X8TH 4ZHMU 3RXCA 4AFZA 1V6DA 3BTHE 3EQ0H 5DP7A 4X6PA 1OHHD 1XKAC 1AFQB 1GWAA 1EFRD 3PB1E 4ABBA 4A1TA 1LVOA 1MQ5A 1ZHMA 1FUJA 1ZRBA 3GICB 5A0BA 1MU8B 5JBAS 1GG6C 1GJ7B 2J34A 4LK4A 3VFEA 2Q6DA 1O3HA 1GBIA 2JH0D 3FKSD 4F4OC 4DCDA 3H5CB 1ANBA 1GMHF 2J94A 1GBAA 4D9RA 1H8HD 1YPMH 2J38A 2Y81A 1YCPM 4B76A 3N7DA 1WYKA 5FX6A 5CDFE 1KLIH 4YTAA 4YESB 2ZKSA 2R0KA 4RI0A 2UWOA 1GHYH 4FUHA 7KMEH 1IQJA 4NG9H 1WCZA 1SGNE 1UTJA 3LH3A 5HM2A 3SNDA 3BTME 1GHAG 4Y71A 1SQOA 4MLFB 1ARCA 1COWD 4JZIA 1ABIH 1GBTA 4IC5A 1W3CA 4X1SU 4INKA 2EC9H 3ATMA 1YCPH 3F2GA 4XOJA 2QA9E 1C9PA 2SNWA 2V6NA 3VEQB 1OSSA 1SGIB 2TBSA 4CHAB 3MNBA 1MCTA 3RU4T 3QUMP 1DWCH 2Y7XA 4BTIB 1H1BA 1MTNC 1HB0B 3RMNH 2JH5D 2VU8E 4WH8A 3SV9A 1TFXA 2BHGA 5C0UA 5CHAB 1WUNH 1OWDA 4KKDA 2Z9GA 1V2VT 1FONA 1O3EA 1SVPA 1DE7H 2GDDA 1DM4B 2XCFA 1D3TB 1O2SA 1T8MA 1BJUA 1LKBA 2O8UA 2BOKA 2P3UB 1JXPA 1GHVH 3F0PA 1GCDA 4DURA 1EP6A 2KCPA 1THPB 4INLA 1BTXA 1O2RA 3NK8A 4E7RG 3AVZA 4X1QU 4A1XA 3BEFB 4E7NA 4XBBA 1MU6B 1G32B 2AMQA 4UDWH 2ZTYA 1MZDA 1AUTC 1ELTA 2XC0A 1GJCB 1G2LA 1SKYE 3SJKA 2J9NA 1THSH 1BDAA 1HXEH 2PV9B 4Y7AA 2TPIZ 1TGSZ 2W3KA 3VGCB 1Y3XA 2BTCE 1GBDA 1GBLA 1QBVH 4JK5A 1YLNA 1FPHH 1MH0A 1UVSH 3SHAH 2Z9JA 1SSXA 1RTKA 3K65B 1LVMA 4BAHB 1F5LA 1SGPE 1AUJA 1C2LA 1TPAE 3LGWA 1QTFA 1FN6A 1A4WH 2PHBA 4KP0A 3FN8A 3RMLH 3TGIE 2Z9KA 2OK5A 2L74A 1EJMA 5ETXA 1LHDH 1O2QA 1D3DB 3L3TA 5GCHF 4IMQA 3SI3H 1YPGH 1C2EA 2GV7A 1O3CA 4FUEA 2LP6A 3TH2H 3WY8A 1C5PA 3UNRA 4ABHA 3OTJE 2D2DA 2STBE 2BY8X 3SUEA 1HJ9A 4FUGA 2C90B 5HGGA 5GJ4B 2ZCHP 1MCVA 3KYGA 1AE8H 3T28A 3QWCH 1P8VC 2VB0A 2I6QA 1QJ6B 2DUCA 2BY7X 1E34B 4B1TA 3SJ9A 1TX8A 1O2TA 3DCLA 1F0SA 2FLRH 2AMPA 2TIOA 4KGAA 3MH6A 3ZYEA 1FXYA 2VIQA 2BY6X 1HAIH 4P00A 3A80A 1T7CA 3R0FA 1O36A 3OU0A 4K3JA 3F3BA 4AYYB 4RSPA 1DY9A 3RLYH 2XTTB 3U98H 1NT1A 8ESTE 1E79D 1XMNB 2PSYA 1T32A 1G3BA 1KLJH 1UHBA 1BBRE 1Z8RA 2J2UA 2ZGJA 3G01A 2HRVA 1UVTH 1HDTH 2FI3E 1UK4A 3SU2A 3QGNB 3SV2H 1NRSH 3OY6U 1BTUA 1BITA 3E16B 1O5CB 3BEUA 3Q3KA 3KIDU 3L6PA 2W5EA 1VCPA 4DOQA 3FFGA 5KEDA 1H8DH 4O03A 1BIOA 4OM9A 3MU4A 4X1RU 1LPGB 1K1IA 1TX6A 1W8BH 1QL8A 3FZZA 1O2GH 3DD2H 1KIGH 3QLPH 1O2VA 3FP7E 3MYWA 3B8JA 3ATWA 3PTNA 1NFYA 4K2YA 4FUFA 5IDKA 1CBWC 1F2SE 1SGFG 3PV4A 3T29A 2V3HH 1EAIA 3KQCA 1F0RA 2ZU5A 1AO5A 3HKJB 1SLWB 4RT1A 4XDEA 3SJIA 3ZZ9A 2QC2A 2TRMA 1O37A 1KXCA 3K6ZA 2PKSC 5AF9H 1VCQA 1LCYA 1HAHH 2PW8H 1KDQA 1YGCH 4J1YA 1SGEE 2BD4A 6CHAB 4ZXXH 5CHBA 3HK3B 2P8OC 1CVWH 3TIUA 1HRTH 2ANMH 2EEKA 2EI8A 4AGJA 4DJZB 2ZHFH 4XE4A 1GHAF 3LC3A 1AE5A 1ZYOA 4IBLH 4CRFA 1VCWA 2ZF0H 3A8CA 1AFEH 2G52A 3BG4C 1WDIA 2C4FH 2VH6A 3F9GA 3SUGA 3PMAB 3RLWH 4TT3D 4K69A 4K8YA 1MTVA 1TAWA 3HATH 2JH6D 3RXHA 2P94A 1QRXA 2ZFRH 1UCYE 2VBCA 4FXGH 1DFPA 1P2OA 1C1UH 2ZGHA 1UW7A 1TNKA 2F43B
chains in the Genus database with same CATH topology
4ZKSU 3RXPA 1OWJA 2BM2A 1GDNA 2G8TA 1X7AC 2VINA 2FX4A 1P02A 1V2MT 2GD4B 2BX3A 4WH6A 1QURH 2Z3EA 3A88A 1K1PA 3GY5A 1W0YH 1XXDA 2CHAB 1AWHB 1DLEA 1DOJA 4ZROA 3L33A 5FPTA 5AHGH 1OP2A 4H4FA 2PUQH 1V2UT 3URDA 1CSOE 3PTBA 1AB9C 1A61H 3EA9A 3F6UH 2BD7A 2QF3A 4FVBA 2OC8A 1FY8E 1GDUA 1O3GA 1EUFA 4ZXYH 1Y3WA 1YM0A 1QB6A 3M5MA 2AYWA 1UVOA 1UK2A 3RXOA 1O5FH 3VPKA 3S0NA 1O39A 1MKWK 3FAOA 4X1NU 1FY5A 2PLXA 7LPRA 3P8OA 2V0BA 5GIBA 3SV7A 1T8NA 2BVSH 4NWKA 3KHVA 4AORA 4ZUHA 3A89A 3KCGH 3SU4A 5DG6A 2ODQA 1G9IE 5LPRA 1F7ZA 1RIWC 1Z7KA 4MPXA 9LPRA 4YOGA 1GVLA 1TPSA 1KLTA 3BTWE 2BDIA 3RXQA 1TX7A 1IOEA 3RXLA 1O31A 1QHRB 2A5KA 4FUJA 4Q7XA 3PYHA 1P3CA 4ABAA 1RXPA 3UNQA 4ZKNU 2GT7A 2BLWA 3LGTA 3TK5A 1SQTA 1VITG 3GCHC 2Z7FE 3A7WA 7GCHG 2BOHB 2XCNA 3B9FH 4IN1A 5JB8S 2W3IA 3TNSA 5C1YA 1RGQA 1YPKH 2G4UA 1J16A 1ELAA 3NZIA 1TABE 3PMBB 3ZZ6A 1SC8U 1HBTH 1XX9A 2ZFSA 3KGPA 3QK1A 5AFZH 2NU4E 2OBOA 5HMAA 4DIIH 2Y6TA 3W95A 1A1RA 1VITH 3D23A 1NRQH 3KEEA 1HAXB 4LZ4B 5EU8A 4CH2B 4WJG2 1P04A 2F83A 1FI8A 1P2NA 3STJA 1BOQA 4BAMB 2AH4X 1OOKB 2F9NA 5FCKA 2Z9LA 2D1JA 2OTVA 4FUCA 1C2MA 3SQHE 2HNTF 1EOLA 3M5LA 3FP8E 2QXHA 2O8TA 1ZGVA 3NXPA 1S83A 4X0WU 3ZVAA 1FIZA 2HPQH 1MAYA 4GLYA 1QB1A 1GBBA 5DP6A 1KXFA 3SUDA 3E1XB 1AVGH 2Y80A 1HAVA 4AB8A 2DE9A 5A09A 4ABEA 3Q3YA 4KTCA 1C5LH 1C5TA 2BY5X 1WQSA 2F9BH 1EZSC 1ELDE 4DGJA 3RC6A 1MD8A 3ITIA 3DFLA 5SGAE 1ZOMA 1K9OE 2VWNA 4BTUB 3E90B 5EODA 1GHZA 4B2BA 1O2MA 1PPZA 1KXAA 3PMHB 2QXIA 4CRAA 2JETC 3BEIB 3LJJA 4UFEH 2IN2A 8GCHG 1CA0C 3ZVEA 1EPTB 1O5EH 5EQQA 4HFPB 1GJDB 3CS0A 3C1KA 4JYUH 3ZZ4A 2ZPSA 3A84A 2WINI 1TB6H 5BRRE 2OXSA 2STAE 3UFAA 2A5IA 1DSTA 3R3GB 1Y5AT 3TJOA 4ABJA 3U8OH 4FVDA 1GI1A 5F8XA 1XM1A 4B74A 3TU7H 1ZMNA 1P9SA 1GL1A 4GVUA 2XWBI 4H6SB 2F9PA 9ESTA 2GMTB 1XUIA 1SL3A 4DY7B 2QXGA 2G5VA 1A7SA 1MAXA 3K6YA 1ABJH 1NRPH 1BUIA 4RKOB 4X2WA 4ISLA 1S82A 5DGJA 5EG4A 1CA0B 2WYGA 2GKVE 1UVUH 1A3BH 1VGCB 1FLEE 5FPYA 4NA8A 1DXWA 1L2EA 1EOJA 2KAIB 5GWZA 3ZYDA 2F9OA 4CR9A 1EZUC 1SLUB 1QL7A 3GDUA 1N6YA 1XUHA 1GJBB 1P57B 1NFXA 1FAXA 4NSYA 1AFQC 2ZDAH 5A0AE 1W14U 2QAAA 2I6SA 2A32A 3QTOH 1LHFH 1RTFB 3TGKE 3SBKA 1BTWA 2QGRA 3HGPA 3U8TH 2ZU4A 4TPIZ 2GDEH 4D8NA 5CE1A 1DUAA 1NZQH 1SLVB 1ZPCA 2QN5T 3UY9A 5DP8A 2BDCA 3TJVA 4NCYA 3MO3A 5IYTA 1ANEA 3Q00A 1HXFH 4FU9A 3TH4H 3MI4A 1DVAH 2WPKS 1BMNH 2A0QB 1EZQA 1CO7E 1TRNA 2Z6BD 1PJPA 1P2MA 2VVCA 4NFEA 1PQ5A 1ZTJA 4GAWA 2OC1A 3MH4A 2EI7A 2ZHWH 3A8DA 3M37A 3OX7U 1Q31A 2H9TH 2BQ6B 2VVUA 3BTKE 4ISIH 4THNH 1QFKH 3SORA 1V2ST 1IQNA 1ID5H 3V12A 1MMJN 2AEIH 2FESH 3EGKH 1SGCA 3ZVDA 3QN7A 2C8XB 1C5WB 2B0FA 2CXVA 3Q77A 1JBUH 2BY9X 1L4DA 5GDSH 1C1RA 1O5BB 4I8HA 1ZPBA 2ANKH 3GY8A 1HCGA 1JOUB 1ZHRA 2A7JA 1KXBA 5JB9S 1VITF 4CHAC 7GCHF 5LPEA 2WV5A 1GI0A 2ZU3A 3P92A 2VNTA 1TWXB 1LVBA 1UTMA 3MTYA 2ZNKH 1BRCE 1NU9A 2VH0A 1FV9A 3ZVFA 3LU9B 4BNRA 1K1NA 1TPPA 2JKHA 1GBHA 3UWJH 1Y5BT 5CHAC 4NIXA 1CT4E 3LH1A 4NA9H 1OYQA 1QJ1B 2R2MB 2WV4A 1GHBG 1C5ZB 5BPEA 2EI6A 1HJAB 4I33A 3KQBA 1ELVA 3NUMA 1FN8A 2A4GA 1THRH 1O5AB 4Y8XA 3UNSA 4E06H 1XXFA 2H6MA 3UTUH 1V2PT 2B8OH 1SFQB 3JZ1B 2QCYA 4UFGH 1O2ZA 1A5IA 1FPCH 4JZEH 1DDJA 1O3DA 3LJOA 4BTTB 4DVAU 3VGCC 1HIAB 1O30A 4A1VA 3VB3A 1C2JA 4Y8YA 3DT0H 3U1JB 3V3MA 3ZZ3A 4YO9A 5ESTE 3S9BA 1GMCG 1PYTC 2ZCLP 2FXRA 1WBGB 4TWYA 1P12E 1GCTB 1SR5C 2PSXA 3MH7A 1CQQA 2HVXA 1S6FA 2NU0E 4B2CA 3FZDA 5F03A 3OYPA 1TNIA 1C1PA 5DP4A 1GBMA 2ZGBH 4X6OA 2LNCA 1GVZA 1AIXH 1C1MA 4X8SH 3ZZ7A 1T4VH 1C1NA 2FYQA 3MU0A 2ODYB 3RUOA 1ZLRA 1ANCA 3GY6A 6LPRA 8GCHF 4TYDA 1J15A 4I7YH 1C2KA 1O5GH 4Y0YE 2ZU1A 3P95A 1O3OA 2XC5A 3MHWU 1AZ8A 2BZ6H 4WXVA 5EQRA 1G30B 1DWDH 3A85A 1B0FA 5I46H 2NWNA 1J8AA 1V2QT 2PTNA 1OP0A 3TVJB 1EAWA 3NKKA 4VGCB 1YP9A 1ZJDA 1Z6JH 4Y8ZA 2FEQH 4Y10E 2Q6GA 1A2CH 4AGKA 5DP9A 2Y7ZA 3CP7A 3MNSA 2FZZA 4X8VH 1TNGA 5H4IB 1F5RA 4AOQA 2O8LA 1TGNA 2ZU2A 3U1IB 3TGJE 1KTSB 1RRKA 1AKSB 2OQ5A 3M5NA 2AGIX 3SI4H 4SGBE 1JIMA 1PYTD 5ESBA 1NROH 2ZQ2A 1TQ0B 1LKAA 3MFJA 1HGTH 4I8KA 2WUBA 3LIWA 1O3FA 1C5YB 1UTNA 3SGAE 1Y5UT 2BDAA 1S0RA 5L2ZH 4IGDA 1A5GH 2GT8A 3RXRA 1P2KA 1IQGA 3UIRA 1HYLA 3W94A 5A8YA 2G5NA 3MH5A 1N8OB 2FX6A 4DIHH 2PKAB 2H5CA 3IITA 3RC4A 1TOCB 5LPFA 3UR6A 3SNCA 1GI4A 1UVPA 2FOGA 3UR9A 4AYVB 1IHSH 4GPGA 3DA9B 3A7YA 1C5SA 1BZXE 1GI9B 2R9PA 2UUYA 1KY9A 3GCTG 3ZVBA 4K1TA 1EXFA 1GBKA 1O2HA 5FAHA 4Y7BA 3TITA 4GHQA 4YM9A 3MNCA 1BBRK 2ZHDA 2QXJA 4Q7ZA 1O3LA 4XSKU 1O2NA 3OY5U 1GBFA 3LKWA 3GY3A 5DP3A 3RXBA 2P3TB 1PPCE 2ZP0H 1E37B 4ZH8A 2XBXA 6CHAC 2FTMA 2AS9A 2SGDE 1WQVH 1YC0A 3MU1A 1FZZA 4INHA 1NRRH 1C1WH 1YF4A 1V2NT 2AGEX 4MPVA 3TK9A 3RM2H 1SOZA 3C27B 4SGAE 2VGCB 1DT2A 3DUXH 3DHKH 3ZZBA 1MKWH 3BTQE 4RN6A 1NY22 1TMBH 1C5XB 1L0ZA 1YKTA 2GV6A 2G51A 1O2JA 1SHYA 4CRCA 1NFWA 1HNEE 2ZWLH 4MNWA 3SGBE 1Z6EA 3TJUA 4XBCA 5GPIB 3RDZA 3PWCA 4U2WA 1GJ5H 4O3UA 4IN2A 1O35A 1O3JA 2Q1JA 5LGOA 2HGTH 4XFQA 2ZDMA 3LOXA 6GCHG 3M3SA 1P03A 3TK6A 2OLGA 1GHBF 5EXMA 3SGQE 1GHWH 3ZZCA 2BXUH 1AWFH 1LTOA 2CHAC 1A5HA 2ZIQH 2C93B 3TNTA 3M61U 3T2NA 1E35B 1QY6A 1PPHE 1C1OA 2F9UA 3BTFE 3LGYA 3P8NA 4YT6H 3RP2A 1UCYK 1LPKB 3RXSA 1DLKB 1O34A 3RXMA 1ZGIA 1C5OH 4KELA 3F68H 2IJOB 2QYIA 2B7DH 2ZDLA 4JMYA 5E2PA 1QL9A 3SNBA 1KXEA 2BB4A 2ZPQA 3S9AA 1MQ6A 1E36B 4I31A 1D6WA 1Q2WA 4CH8B 1CA8B 3SJOA 5EPYA 4HI3A 1DWBH 2TGPZ 1GMCF 1UTKA 2BDYA 2FOAA 3AAVA 2FOBA 3H7OA 5JPMH 2ZA5A 2WPLS 2AERH 1KSNA 1O2XA 4AFSA 2QY0B 1BCUH 4DW2U 1GJ6A 2Y82A 2FM2A 1SI5H 5FHTA 2VVVA 2G4TA 1GI8B 1BQYA 2AFQB 1ARBA 3TJNA 3SU1A 4Z6AH 3D62A 4WMFA 3ATLA 5F8TA 5B6OA 4Y0ZE 2OC0A 2C8YB 1HAPH 1ANDA 1C5QA 4OS6A 1RFNA 5DP5A 2J95A 1BJVA 2FWWA 4H42U 1V2JT 1Q3XA 4O9VA 4Y11E 2A4RA 2WPJS 4BXWA 4JYTA 3ZZDA 4AZ2B 5E0GA 4QT8C 3P70B 2AMDA 2OBQA 1D4PB 1TNHA 1YYY1 3RXDA 3ZZAA 4MPUA 1SOTA 1QBNA 3RXEA 3ATIA 2PWXA 4U32A 1ELEE 1MD7A 1LVYA 1MUEB 4OGYA 2XBVA 2THFB 1HJ8A 1C2FA 1UMAH 2GCTB 3V13A 2A4OA 1O3IA 1WTGH 2ZGCA 1QR3E 5EXNA 1GDQA 1IQHA 5EW2H 1OS8A 3PWBA 1C2HA 3PO1B 4CBNA 1W13U 1Z1IA 1MTWA 2GCHG 1F0UA 2XBWA 3RXAA 3SZNA 4MVNA 1SLXB 4XBDA 1AGJA 1ETRH 2HLCA 3RXKA 3SU3A 5T3HA 1SPJA 4UFDH 1OX1A 1Y59T 2FPZA 2GTBA 1DX5M 5C67A 1BHXB 1BHXF 1C2IA 1CE5A 1GMHG 4HTCH 1WAYB 2C8ZB 5AFYH 1GBCA 3VXFH 3ESTA 4F49A 1GBJA 1WOFA 4O97A 2BDGA 2O9QA 3SU5A 3KF2A 5C3NA 1VJAU 1BRUP 1QBOA 1F5KU 3GCTF 3PMJA 4CRDA 1V2OT 3M5OA 1XVMA 3BTDE 2BMGB 3GISB 2H9HA 1ZMLA 3HKIB 3T26A 2FI5E 2UWPA 1GHXH 1EPTC 1GJAB 2BVXH 4Q2KA 8KME2 1P01A 4AX9H 3P6ZB 4R8TB 2M5TA 4U30A 5K0HA 5DPAA 2G55A 1B5GH 2A45B 2OUAA 1O3KA 2G00A 2VIWA 1LHGH 1MKXH 1BB0B 3SU6A 4TY7A 1TYNA 1HFDA 1EQ9A 2GMTC 5DK1A 3SV8A 3F9FA 3ZVCA 1S0QA 1WSSH 1W0ZU 4YLQH 1QA7A 5FCRA 1GGDB 2Y5FA 4I8LA 1P05A 1OWHA 3EE0B 2O8WA 4HZHA 3A8AA 2R0LA 3FVFB 3AAUA 1F0TA 1VGCC 2CGAA 2FYRA 4ZHAA 2SFAA 2SGFE 1P3EA 3GDVA 3ZZ8A 4NWLA 4OS5A 1TMTH 2FOFA 2ESTE 1GMDG 2FODA 3ODDA 1CT0E 1SHHB 1ZTLA 1L4ZA 5I25A 3GYLB 1P10A 2RA0A 3EA7A 1JIRA 3UOPA 3MU8A 1NESE 2P93A 1UO6A 1C1TA 3A87A 1XUGA 2D8WA 1C4V2 3BTEE 3PLBA 1QA0A 2GZ9A 1GI6A 1C1VH 1HUTH 3I29A 4OS7A 1A0JA 2TGTA 1P0SH 1C1QA 2J92A 2WYJA 2VIOA 3SQEE 4K8BA 3VXEH 1NC6A 1Y8TA 4ABFA 4KTSA 1CHGA 2VIVA 1BTPA 1H9LB 5K7RA 2GX4A 3BIVH 3TPIZ 3SO3A 3O8DA 1O2YA 1GL0E 2C3SA 3T5FH 4MNYA 2FIRH 3UOUA 4B2AA 4LZ1H 1YLDA 1B0EA 1J9CH 2F91A 1OWIA 4YZUA 3GY7A 1CU1A 2XWAA 2F9VA 3TH3H 1O0DH 1QQ4A 1W7XH 1XUJA 5FX5A 2XYAA 4A92A 1A0LA 1T8LA 2FMJA 1EPTA 5T6GA 5A2MH 4JYVH 2WUCA 2FOHA 2TGAA 5DJ7A 2XXLA 4A6LA 2H9EH 1WV7H 1C5NH 1SGRE 1AVXA 1BMAA 1RTLA 2FOMB 1P2IA 1CHOG 3LC5A 3KQDA 4H6TA 2A31A 1TMUH 2BLQA 3RMOH 1HPGA 3LDXH 2V35A 2W26A 3ZV8A 1G3EA 4FUBA 2ODPA 3QO6A 1ELCA 1P9UA 1S84A 1HJAC 1NN6A 1UTOA 4I32A 4TPYA 2UUJB 3STIA 4B75A 1UTPA 1G3CA 3BN9A 2YOLA 1E0FD 2QF0A 1ZHPA 1ESAA 2GCHF 3M36A 3HGNA 1P2QA 1ETTH 4AFUA 2AGGX 2KAIA 2PGQB 2IPHA 1UTLM 4X6NA 1FDPA 2CJIA 1BMLA 1TGBA 4NA7A 2GZ7A 3RXGA 4KTUA 1RD3B 1MZAA 5J4QA 2RG3A 2Z9IA 3SNEA 5JBCS 1DY8A 1SBWA 1S5SA 4IS5A 4D76A 4MQAA 1AMHA 2ZDNA 2FTLE 2PFEA 3NPSA 1UTQA 3ATKA 1BA8B 4ABGA 4NIWA 1GCTC 2SNVA 3DFJA 1AD8H