1UTNA

Trypsin specificity as elucidated by lie calculations, x-ray structures and association constant measurements
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSINOGEN
publication title Trypsin Specificity as Elucidated by Lie Calculations, X-Ray Structures, and Association Constant Measurements
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utnA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utnA02
1Q2WA 2VIQA 2QYIA 1DY8A 1JIMA 1FAKH 4X1NU 2BDHA 6LPRA 1P57B 3RXIA 1T32A 2OP9A 2BD9A 2BX4A 3HKIB 1FY4A 2SNWA 3E3TA 1XKAC 2ZU4A 1HPGA 1SLUB 3H7TA 1MQ5A 3GY6A 1QQUA 2AERH 2HPQH 2F9VA 1OYTH 1E37B 1JRSA 4XBBA 2Y7ZA 2D8WA 5DP8A 1SVPA 3M7UA 4E05H 1HB0B 4CH2B 7GCHG 4K8BA 1HFDA 5GIBA 1ELCA 4WH6A 1FQ3A 1LVMA 1SGCA 2WYGA 1L4ZA 3FP6E 4ZKOU 1Y5UT 3BG4C 1W7GH 1P8VC 3BG4B 4YTAA 2SGPE 3MH7A 4SGBE 3O8RA 4CRDA 1GHYH 2CV3A 3F1SB 3GICB 1ELVA 2Y7XA 1GBJA 3OSYA 1DITH 3BTME 3RMOH 4KELA 2BMGB 3SI3H 1WQVH 3KNXA 2SGQE 1QBOA 4ASHA 1ELBA 3BTHE 1QJ1B 1OPHB 3TPIZ 3C27B 4Y8ZA 2BQ7B 3E90B 1Z71A 3P92A 1W14U 5JPMH 3RXGA 3SW2B 1TGTA 3LT3A 3A7TA 4ZROA 4X8SH 1C4U2 4MDSA 2DE8A 4MLFB 3M7TA 4Y76A 4AN7A 4AG2A 1DWCH 2QXHA 2PWXA 3RXSA 1PPGE 1C2IA 3NUMA 2P8OC 4GAWA 1CT0E 1YGCH 4K8YA 2A45B 1QQ4A 3VB5A 2XC5A 3S0NA 2A5KA 4YOIA 4FU7A 3PM3A 4YT6H 3TGJE 2PUXB 1TMBH 1TNJA 2B9LA 1A61H 1AGJA 3I29A 5GJ4B 1MH0A 2QXIA 1CGIE 3ZZDA 2OD3B 1DS2E 1AUJA 2RG3A 2M5TA 1DUAA 1ANDA 1F5LA 1HAIH 1NTPA 5F03A 4TPIZ 1KLJH 1Z1JA 5E0JA 1V3XA 2FMJA 2PKSC 1S0RA 2PKSB 1Z8GA 4Y0YE 5DO4H 1QRWA 2ZF0H 3MH4A 2J9NA 1LHDH 3BTKE 3OY5U 2F83A 1DXWA 2UUKB 2ZKSA 3QK1A 3SHCH 3T28A 1ESAA 1P2JA 4LZ4B 1LHEH 1SQAA 3OX7U 3UR6A 4JYUH 4MVNA 1C1SA 4I7YH 1GHBF 1YPHE 3RXPA 1EB1H 2XBWA 3GY8A 1HAXB 3S9BA 1PQ8A 1LHGH 3NKKA 1MQ6A 1FMGA 2XBXA 3EA7A 2BY7X 1YYY1 1SGFA 4DY7B 1MTVA 1XUHA 3LH1A 4YT7H 5A8XA 4IGDA 3P8FA 1A1RA 1ZMNA 1O2RA 2BM2A 1TNIA 3ATKA 2UWPA 1ZSLA 5HYOA 4YESB 3K9XB 3LGUA 4Q2KA 1AB9B 1TRNA 2FS8A 2ZI2H 3M7QA 6GCHF 2BD8A 5EXMA 5L2ZH 1CGHA 1SFQB 4TWWA 5IDKA 4WVPE 3U1IB 3A7WA 2GD4B 1K1LA 4YZUA 3EE0B 1OKXA 2FOMB 3A8BA 1C5OH 2ODQA 1EB2A 1BIOA 2OTVA 3MH5A 3KCGH 1PFXC 1ZJKA 3RLWH 2XCFA 3ESTA 4WMDA 3BTWE 3URCA 3QWCH 3BTEE 1GI0A 1U6QA 1KTTB 1UO6A 1GJ4H 1PPEE 3MOCA 1TPAE 3QX5H 4UFGH 2PSXA 1CQQA 3ZZ5A 3HGNA 4A6LA 1O3EA 1BTHH 1RTFB 1G2MA 1ZZZA 1EJMA 4IBLH 5C1XA 3UNRA 2WPKS 1Z1IA 2F91A 2GZ9A 5E2OA 1QBVH 4IC5A 1MD8A 4ZKSU 1OP2A 5T6GA 3TK5A 1A4WH 4X2XA 2ZU2A 2BY5X 4Y8XA 2FEQH 2QXJA 2XC0A 2WV5A 5GXPA 2IN2A 4ISOA 1C2FA 4MPVA 5FBIA 4IN1A 1HXFH 3JZ2B 2XXLA 4F4OC 1DVAH 4DIIH 2JETC 3RU4T 5HM9A 2JETB 3KQCA 1TA2A 2B7DH 3A7ZA 3ZV8A 1GGDB 2BVXH 1XUKA 1Y3YA 1KXDA 1GG6C 5J4QA 1Y3VA 4DURA 3GYMA 1NRPH 2AGIX 4I8JA 3MNCA 1P03A 1NU9A 1SPJA 2QA9E 1O36A 3A80A 3I78A 1J17T 3UOPA 1GHAG 2FI5E 4MTBA 1TBQH 1TGCA 3Q3YA 1V2VT 1O38A 1SGNE 1F0RA 4KTUA 2C8WB 5L2YH 2ZEBA 4QT8C 2VIVA 1V2KT 1KSNA 1OWIA 5K0HA 4NSVA 3QUMP 1HAVB 3RXAA 1S6FA 5FCRA 2WV4A 1BDAA 2XYAA 3HKJB 1HLTH 1C1NA 2G55A 4BAMB 1KY9A 4KTSA 9LPRA 1TBRH 1VCQA 4TYDA 5FPSA 1EP5A 2FXRA 4WXVA 1GVLA 1LPKB 5C67A 2SGFE 4X6OA 1H4WA 3L3TA 3KEEA 4B1TA 4UD9H 2C90B 3TIUA 1OXGA 3PLPA 2H2ZA 5EW1H 1FPHH 2OUAA 1K9OE 2D1JA 2FOHA 3LGIA 1G3DA 2BDCA 2UUYA 1W12U 4FUDA 1OP8A 4BANB 4MNWA 2F9UA 1ZMJA 1H1BA 3K6YA 1SGEE 3A8AA 2PLXA 1O2JA 1TX7A 1GBCA 4U32A 3NK8A 1O2SA 3UY9A 2BVSH 3BIUH 4NA9H 1E0FD 1PPCE 1DX5M 2BVRH 1S83A 2QAAA 1HAYB 3ZVDA 1O39A 3QDZB 1K1MA 4GVUA 4JZFH 2V3HH 2GP9B 1W3CA 1UCYE 1GMDF 1QJ7B 1GMHG 2CHAC 2PHBA 3CS7A 3LGWA 3GCNA 2CHAB 1LQEA 2HWLB 5CMXH 1BZXE 4U01A 1P02A 5L6NH 2STBE 4K60A 3RXLA 2AGGX 4AFQA 4GHQA 1BQYA 2ZFRH 5TJXA 1BUIA 3LH3A 2Y5GA 1SGFG 4JZ1A 4Q80A 1Y3WA 2BY6X 1O3JA 3F9EA 3HK6B 5FHTA 1FY1A 1P2MA 2OLGA 3HK3B 2AMPA 2FX4A 2VB0A 1EOJA 5GCHF 2R9PA 3QTOH 4BAHB 1YPLH 1K1PA 2CGAA 3P95A 4D9RA 5GWZA 2KAIA 1TA6A 2AH4X 1C5LH 3E0PB 2ZDLA 1KTSB 2UUJB 8KME2 4FUBA 4GCHF 3Q00A 1T8OA 3TVJB 1H9HE 5FCKA 5I46H 1O3MA 1HJAB 2VWMA 3UQVA 1IHSH 3SJIA 3UNSA 2P3TB 1O5AB 5AFZH 4GHTA 1CO7E 1ESBA 1W0ZU 1XVOA 3TNSA 1MCTA 3PTBA 3EAJA 1UTOA 4WXIA 4B2AA 1N1LA 1AZZA 2QN5T 2O8WA 4DOQA 2ZCLP 4MNVA 1A5IA 1QA0A 2Y82A 3A86A 2NU1E 3IWMA 1FDPA 1O2GH 5T6DA 3PB1E 3FVFB 2OBQA 1G30B 1IQNA 1FXYA 1F7ZA 3PMAB 2J2UA 1YCPK 3DA9B 4JMYA 3BTGE 1F0TA 1O34A 4E7RG 2BD5A 1LPZB 2PTCE 1BT7A 1QA7A 1C2LA 4K69A 3BEIB 3GDUA 1P2QA 1G2LA 1C5YB 3HATH 2CMYA 4I8LA 1UTPA 1RTLA 3ZYDA 2ZZUH 1GBDA 5C2ZA 3EDXB 2W7SA 1ESTA 3JZ1B 1TAWA 2WPLS 1WV7H 3RDZA 1RS0A 4CRAA 3MI4A 1P9SA 2ZPQA 8GCHG 1UVUH 4DJZB 3K65B 3GDSA 1P11E 2BHGA 3TH2H 2XNIA 1LQDB 1O3NA 4X2VA 3RC4A 1GJBB 1BRBE 2F9OA 2HRVA 1BA8B 1BJUA 1SB1H 2RDLA 2A4OA 3ZZ4A 1DFPA 2ZDVH 3K6ZA 2BTCE 2BYAX 2SGAA 2WUCA 1CGJE 4NZLA 1W11U 2AFQB 4UE7H 1ZSKA 1WU1A 1O3CA 4DW2U 3EYDA 1NY22 1A3EH 1C1VH 1CSOE 3N7OA 1OSSA 1XKBC 3RXKA 1DSTA 1IQEA 2VIOA 4SGAE 1HBTH 3GY4A 1A5HA 3O8DA 1GHVH 4YLUA 5C20A 1V2QT 1QRXA 4CRBA 1L0ZA 4RKJB 1O2UA 3DFJA 3T29A 1PPZA 4I8KA 1GJ6A 3RU4E 1MKWK 2VIDA 2NU2E 2ZG0H 3VGCC 3T26A 2BY8X 3VGCB 2BQWB 3F6UH 2QY0B 1A46H 4AFZA 1CVWH 1ZPCA 3MO6A 1NRRH 1XUFA 4LOYH 3TNTA 1LMWB 2PGQB 1GL0E 2PW8H 4AG1A 4D9QA 1SSXA 7GCHF 5CHAC 3V7TA 1HIAA 2V3OH 3MTYA 2A31A 5CHAB 3RXCA 3LGYA 3ATWA 1EJNA 4BTUB 1SQOA 1SG8B 1UTQA 1F0UA 1JXPA 1C4Y2 1AVGH 1BMLA 4JYTA 3AASA 2PSYA 2YNAA 3TJNA 2OQUA 1W10U 3GCTG 3UIRA 5A09A 1LHCH 2THFB 4GUXA 1JBUH 3ZVBA 1VCPA 1WYKA 2RCEA 4Z0KA 1AI8H 3QGNB 1K1NA 5AHGH 2H6MA 1BHXB 3S9AA 2H5DA 2JKHA 2A7CA 1GHZA 2ALVA 3A82A 1FN8A 2DE9A 2VGCC 5EQSA 4DVAU 3TLOA 2VGCB 1AKSA 4X1SU 3SU2A 1LTOA 4K1EA 3A89A 2Q6FA 1V2OT 4MPXA 2HALA 4AB9A 1TFXA 1ELFA 1GI9B 3KQEA 2Z3CA 3MHWU 1TE0A 3K2UA 3ZYEA 5E0HA 1QB6A 1GDNA 4FVBA 1J9CH 2NWNA 1V2MT 4ABHA 2IOTA 1FNIA 2BDAA 3U8OH 2C3SA 1TRYA 2G5VA 1UHBA 3SV6A 2BDGA 3SZNA 1V2UT 1Y5AT 2A4RA 4MPUA 1HUTH 1SGPE 2GGVB 2I6QA 4X8TH 1FIZA 1SHHB 1VGCC 2OXSA 3F68H 1VGCB 1MAYA 4AZ2B 2BZAA 3CENA 3F9HA 3SQHE 1C5TA 1QRZA 3TH4H 1EAIA 2ZDNA 4MG3A 1ZOMA 1C5NH 1TONA 3ITIA 1SBWA 1ZR0A 3QZQA 1QB9A 4ZHLU 5HGGA 2ZHEH 1KXFA 3M35A 1EXFA 2ZTZA 2GX4A 1D6RA 1IQHA 2BLVA 3STJA 2BD4A 1NFWA 3IG6B 1ETSH 2A32A 3M5MA 1PQAA 3O8CA 1QFKH 3TJOA 4IS5A 4ZMAH 1WTHD 1V2PT 4FXGH 3SBKA 4FU9A 4FUJA 2FI3E 1AZ8A 3RP2A 2P8OB 3BTQE 1UJ1A 4BAKB 1A3BH 1GDQA 4WJG2 1QJ6B 1FIWA 2ZHWH 3SV9A 5AF9H 1MAXA 3GYLB 2ZPRA 1YC0A 3RMMH 2ESTE 1O3OA 3S9CA 5EU8A 3RXDA 1NRSH 3ATMA 1A2CH 3PO1C 4YOGA 1Y59T 2FOEA 3Q76A 2YNBA 3PO1B 2H5CA 4AYVB 2ANKH 3SV2H 1NESE 3RXHA 3QTVH 4TY7A 3HPTB 1RGQA 1BMAA 2JH0D 1TRMA 2FYRA 5HXFA 2P16A 1IQKA 1QNJA 3RC6A 1GJ9B 2ODPA 2G00A 1V2LT 2PGBB 1QL7A 1EP6A 1YKTA 3EA9A 2O9QA 1A0JA 4A1VA 5EPNA 1XUGA 3LKWA 3ZZ7A 2ZDMA 3GOVB 1UTJA 4NWKA 1TMTH 2ANMH 1LCYA 3A85A 5FAHA 4AGKA 4GSOA 2BDBA 1O3IA 2JH6D 4OS4A 4Q7XA 1PPHE 3URDA 1WSSH 1V2NT 1ZTKA 3UNQA 1OOKB 1AE8H 4XSKU 1F5RA 1F92A 3MWIU 2A2QH 1FV9A 1P2OA 1QHRB 4MNXA 4D8NA 1GL1A 1DM4B 4I32A 1LPGB 3SV7A 3ZZCA 2ZFFH 4WY3A 4Y79A 3RM0H 3UFAA 2GCTC 2BD2A 3MU4A 1KDQB 4Y8YA 3M3VA 1O2OA 4IMZA 3V0XA 2Z9IA 3SNDA 4AORA 1W2KH 5B6OA 2W7UA 1FLEE 3BV9B 4KGAA 1DWDH 1FY5A 4TPYA 1N8OC 5CE1A 4A7IB 3TJUA 2A5IA 1ZYOA 1N8OB 1XMNB 2STAE 1LO6A 1GBIA 1BTPA 1T8MA 2XW9A 3GISB 1WTGH 1IQJA 3G01A 3RUOA 1W8BH 3VB3A 1FN6A 3ZZ6A 3FP8E 1BMNH 2GZ7A 2ZGCA 4XOJA 2CJIA 1FZZA 2VVVA 4JZEH 1GJ5H 1TPPA 2Z3DA 1TX6A 5T6FA 1QURH 4JK6A 4I31A 1OWJA 2Y80A 5EW2H 3TK9A 3WY8A 1C5WB 3LGVA 1Y3XA 2ILNA 1HIAB 4DG4A 2Y5FA 2O8TA 1UCYK 1MCVA 1BRCE 2QF0A 4ISHH 4X1PU 1Z7KA 1Z6EA 1NZQH 1P01A 2F9BH 1S82A 4RKOB 3ZV9A 2A1DB 1S6HA 1K28D 1SLVB 2FTLE 3MU8A 1TGNA 2XWAA 1JRTA 2VNTA 1MU6B 1IOEA 2ZDAH 2J95A 3NCLA 3RXOA 1NPMA 4YM9A 5J4SA 5F6MA 2TRMA 3RXRA 3RXEA 1TNGA 2GCHG 1UVSH 1P9UA 1L1JA 1O2WA 4AOQA 2P93A 3RU4D 4CBNA 1AKSB 3VB6A 1MBMA 4UEHH 5DP5A 1D4PB 2NU4E 1HDTH 2EI8A 1C1WH 4IMQA 1O3BA 2HNTE 1ARBA 1GG6B 2W3KA 1O2PA 3F9FA 3SJOA 1TOMH 1H8DH 1C5ZB 4H42U 4KKDA 1AE5A 1C2KA 4X8UH 1DDJA 1WCZA 1ZPBA 2FWWA 2AIPA 3VB7A 5FPYA 1GMHF 3U69H 3RXTA 1Z6JH 2Q6DA 5FX6A 4D7FA 2FODA 2PFEA 4Y7AA 3AW1A 1TWXB 2FOGA 1UTKA 1UHBB 1NN6A 2GDEH 3SU6A 2UWLA 3F9GA 5C1YA 1SR5C 4K3JA 1UK2A 4BXWA 1BOQA 1TQ0B 2FESH 4CR9A 1O3FA 1YCPM 1ZHRA 4UONA 5EOKA 4BOHA 1UCYH 1O3GA 4BNRA 1SMFE 1THPB 1O5BB 1L1NA 5JBCS 2H1UA 4WMFA 3RLYH 4DGJA 2VINA 1UVPA 3R0FA 4K1TA 2TPIZ 5ESBA 1FY8E 1EPTA 2VH6A 3MFJA 1S0QA 2OQ5A 5HM2A 4M7GA 3P70B 2BDYA 2B0FA 3PMJA 1E38B 6CHAC 4O3TA 4ABIA 6CHAB 4X6PA 2OC0A 4NFEA 5C5NA 3SGQE 2ZGBH 1W0YH 1BBRE 1SGTA 1EX3A 3D49H 4ABBA 5JBBS 3SNCA 1RTKA 4XBCA 3A8DA 3MYWA 3ATLA 2BQ6B 4RSPA 4NIXA 5EXNA 3A7YA 4B76A 3R3GB 1O30A 3GY2A 3A88A 3RXQA 5JB9S 1MTUA 3BTFE 1PQ5A 3BTDE 5DP3A 1ETRH 4Y11E 1AO5A 1O0DH 1O33A 1TQ7B 1ANEA 4IN2A 4BTTB 3RXFA 4UFDH 1YPMH 3MMGA 5DP6A 1GMCG 1XUJA 1FUJA 1MUEB 1UK4A 1HAPH 3UWJH 4HTCH 4X1RU 1AFEH 1D3PB 4JK5A 2W26A 3SUGA 5BRRE 3ZVEA 1SFIA 1OYQA 1P09A 1WUNH 4X0WU 2ZDKA 5HMAA 1EUFA 2G4TA 4YO9A 1DLKB 4AB8A 1A7SA 2OBOA 3W95A 3P8OA 4HGCA 4XBDA 1DWBH 4OGYA 2VIPA 4X6NA 1SOZA 2A0QB 4NIVA 2ZU1A 2Y81A 4I33A 1DICA 1O2LA 8GCHF 3NXPA 1OWEA 1C5QA 1AN1E 3FZZA 2TGAA 1KXCA 1O2VA 1SQTA 2W3IA 1LVOA 3LJJA 4ABDA 2GTBA 1RRKA 2BOHB 1ZMLA 4PROA 3UR9A 4Y10E 1HAZB 1IQGA 4B71A 1MKXK 2ZA5A 3VFEA 5IYTA 4ABFA 1EQ9A 1GI8B 3GY3A 2R2WU 3SJKA 1BJVA 1ELEE 1RIWC 4U30A 3AW0A 2AMDA 1EAUA 1NFUA 1E36B 1RIWB 4CHAC 5DP9A 2A5AA 2ZGJA 4Z6AH 3T5FH 5F8XA 2VJ1A 3PV4A 3VB4A 4THNH 3LGTA 4BAOB 3KGPA 1HJ8A 2PKAA 3BSQA 3SO3A 3LC3A 5K7RA 4UFEH 1AUTC 1XVMA 1SGYE 2Z7FE 1ORFA 1T8LA 2D26C 4JZIA 2CF8H 1BRAA 3SU1A 1QIXB 3SN8A 1GVKB 3U98H 1CHGA 1IQLA 3H7OA 2SNVA 1MTNC 3L6PA 1O2MA 1BTXA 1YM0A 1ELGA 1C5RA 4JCNA 2PTNA 5JBTA 3FFGA 1QTFA 3P8NA 1YPGH 1O5GH 1TALA 1BHXF 4OGXA 3T2NA 5E2PA 5DP7A 1YF4A 1Z8IB 1ZRKA 3AVZA 3PYHA 2CF9H 2HGTH 1HAHH 2GMTC 2BLQA 1O3LA 1C1QA 1ZTLA 5DP4A 2GMTB 3FP7E 3M5OA 2NU3E 2QXGA 1HGTH 1GI3A 2F9NA 1ARCA 4FUHA 5JBAS 3MNBA 1GBHA 9ESTA 5L30H 2OCVB 1GVZA 3ODDA 3BEFB 4NZQA 1GBTA 3SI4H 2P95A 3PMHB 1P04A 1LVBA 1P2NA 1IQMA 3RXVA 1VJ9U 2XTTB 1H8IH 4NGAH 1GI7B 1V2WT 3GCTF 5DG6A 1O3DA 1TPOA 1XX9A 2V0BA 1O37A 4VGCC 2FOFA 1P3CA 2ALPA 3ZZAA 4VGCB 4AX9H 1ABJH 3A7XA 1K1IA 1L1GA 1V2TT 2BXTH 5ESTE 3TGKE 4O03A 4CH8B 1C5SA 4CRCA 1TB6H 2R0KA 1NO9H 2C93B 3U9AH 1VITG 2A7JA 1YCPH 4X1QU 2FS9A 2TIOA 2FDAA 1C2JA 2HNTC 4K1SA 5PTPA 3SJ8A 2A2XH 1CE5A 3C1KA 1C1OA 1THSH 2BZ6H 4JYVH 3KF2A 5G4BA 3U1JB 2CXVA 2V35A 4FUCA 2F9PA 3NZIA 5EQRA 3ELAH 1C5VA 3RXMA 2QC2A 1B0EA 4ZH8A 4ZKNU 4GPGA 2P94A 4J2YB 3STIA 4INHA 1KXAA 1PPBH 3SQEE 4BTIB 1Y5BT 5C1UA 3ATIA 1AVWA 1F2SE 2HVXA 1ZTJA 1EZSC 2HOBA 1EOLA 1GBMA 3CP7A 3CS0A 1A0LA 1DUEA 4FUEA 1IQFA 1EPTC 1P10A 2J4IA 4ZXXH 2LPRA 4FU8A 3BN9A 2BB4A 1EAXA 4ZHMU 1EPTB 1GJ8B 1MU8B 1BB0B 2H9EH 1G36A 1SC8U 2ZCKP 4NA8A 4YLQH 1J8AA 2Z9GA 1D6WA 1UTLM 2WPHS 5EPYA 1AWFH 1SGIB 4AGJA 1FY3A 1P0SH 5H4IB 1P2IA 1S84A 1O2QA 3EGKH 1C2MA 2FOAA 4YOJA 1P06A 2ZTYA 3H5CB 1G3BA 4FUGA 4CR5A 1K22H 2G4UA 2Z9JA 4BXSA 2UWOA 1AD8H 1GCTC 2GT7A 2XBVA 1C2EA 1EKBB 1GCTB 1UVTH 2ZQ1A 2G5NA 4R0IA 2Z9KA 5EXLA 1QGFA 1WQSA 2OC7A 3S7HB 1OP0A 5DPAA 5DK1A 1MKWH 4MPWA 5GDSH 5TCAA 3MU5A 1O5DH 1EJAA 2TGDA 1JIRA 1PYTC 3UPEA 3TU7H 1W7XH 1NT1A 1GWAA 2R3YA 1CHOG 3SU5A 1TGSZ 1O3HA 1UVOA 3M37A 2ZP0H 3P17H 4TY6A 2IJOB 5A2MH 2ZHQH 5EGMA 3UREA 5BPEA 1ZJDA 3UTUH 4XE4A 1C2HA 3KQBA 4B2CA 1FAXA 3TGIE 2KAIB 4FUFA 3TJVA 2WUBA 4ISLA 3T25A 2VWOA 2J34A 2J92A 1NS3A 1ZHPA 2FYQA 2FM2A 5EG4A 1HAVA 3KN2A 4HFPB 3DT0H 1C5UA 1Q31A 3LPRA 2ZGXH 1JWTA 3LJOA 1GI2A 2NU0E 2C8XB 1AIXH 1PYTD 4RN6A 4LK4A 4B75A 3S69A 3FANA 1YPEH 2D2DA 3LIWA 3SU4A 2XCNA 1DOJA 5LGOA 4A1TA 4ZXYH 2Z3EA 1LDTT 3U8TH 1TNHA 3M5NA 1AHTH 2ZFTA 2O8LA 2H9HA 2ZCHP 3TK6A 4D7GA 4J1YA 2ANYA 4CREA 1KLIH 2AEIH 1AFQC 1AFQB 3E0NB 1KXEA 1NM6A 2GZ8A 3A7VA 3P8GA 1EASA 1TGBA 2R0LA 4A92A 4O9VA 1O2NA 1WBGB 4BAQB 1O31A 4KP0A 1H9IE 2BLWA 3GDVA 4OS2A 1N6YA 2PKAB 2FOBA 3MO9A 1PQ7A 1K1JA 1UTMA 1ZSJA 2J94A 1GHXH 1TPSA 1SGDE 4OS1A 1FJSA 4NIYA 3OTJE 2ZQ2A 1O2TA 1MMJN 1H9LB 1JOUB 1VZQH 2GKVE 1C4V2 2Z94A 4UFFH 2AS9A 1YLDA 4A1XA 3VPKA 3Q3XA 1AU8A 1C1MA 5F8ZA 1WOFA 4AFUA 1W13U 2AGEX 1S81A 2ZWLH 3MH6A 1GI6A 2HLCA 2HPPH 2R2MB 1AQ7A 1D3TB 1TBZH 2VIWA 1G37A 5C5OA 1CU1A 3A81A 2ZECA 3T62A 2AIQA 1C5MD 1Z8JB 2BLOA 3PTNA 7ESTE 1S5SA 4ABAA 4INKA 1FPCH 3SHAH 1C1RA 4B73A 1C5PA 1C2DA 1BCUH 1P3EA 2PV9B 2WPMS 2VWLA 3L33A 5F8TA 2UUFB 2VWNA 4XDEA 1Y8TA 2P3FH 3ZZ9A 2GV6A 4R8TB 5EODA 2WINI 2A4GA 1O3KA 1SHYA 1KLTA 1O32A 3V13A 1GCDA 2GCTB 2GCHF 3VXFH 5ABWA 2OINA 3RMNH 1J14A 1GBKA 3SJ9A 1MTSA 3SUEA 5DKMA 3PROA 4B74A 2BX3A 1HJ9A 1HAOH 1ZPZA 1TMUH 1WAYB 5DGJA 4CRGA 3SOSA 2B8OH 1BBRK 2FX6A 1GHAF 1AB9C 2QGRA 1K2I1 1Z8RA 1C1UH 1TYNA 2G52A 2QCYA 1XXFA 2P3UB 3B8JA 1CBWC 7LPRA 5LH8A 1QBNA 4NCYA 2Q1JA 3BTTE 1CBWB 1P05A 4Q7ZA 1ANBA 3IITA 1O2IA 1MZDA 5TCCA 1ZLRA 1DANH 3MU1A 3NWUA 4NWLA 1BMMH 1E35B 2ZU5A 4DT7B 2YOLA 3LC5A 1S85A 2TBSA 2A4QA 1TNKA 1RXPA 1AY6H 1OWDA 1DY9A 2Z9LA 3EA8A 1VR1H 3SV8A 3RXJA 1GHBG 2C4FH 2BXUH 3QO6A 5AFYH 1GJAB 1GI4A 1GHWH 2BDIA 3W94A 3SORA 3SGAE 1K21H 5LPRA 1FI8A 1VITH 3A84A 3TITA 3KHVA 1NRNH 3P6ZB 4CBOA 1GJDB 1EZXC 1XXDA 1GI1A 3BIVH 1LVYA 2SFAA 1EZUC 2FLRH 3PMBB 1X7AC 1V2ST 1XM1A 2EI7A 5C3NA 1DWEH 4UDWH 2GT8A 5E0GA 4Q7YA 1ELTA 1DE7H 4DCDA 4I8GA 1O5EH 3M3TA 3S7KB 3UQOA 3VXEH 1GJ7B 1NFXA 1MTWA 3OYPA 4X2YA 1JMOH 1Y3UA 4Y6DA 1BTZA 6GCHG 1GGDC 3E8LA 2ODYB 1HXEH 2DUCA 1VJAU 1BBRH 3VEQB 1QCPA 4LZ1H 2ANWA 5LPEA 3D23A 3GCOA 2RA0A 2FLBH 2SGDE 3SNAA 1B0FA 4TWYA 1ANCA 2GVFA 4KTCA 1OS8A 1TX8A 2G81E 1GMCF 5FXLA 2K1QA 1DT2A 1EAWA 5EQQA 1DPOA 2J38A 1N6XA 3DFLA 3ENSB 3PLKA 2VVUA 3O8BA 2FOCA 3AAVA 4ZAEA 4ESTE 1TOCB 2QV1A 4HZHA 4K5ZA 3BEUA 3E91A 4AFSA 2PR3A 1CT4E 3PWBA 1INCA 1BRUP 1GDUA 1GBEA 2EI6A 1K1OA 3D65E 3E1XB 4Y0ZE 1T4VH 1YPJH 1QR3E 2H9TH 1F0SA 1TABE 4H4FA 4X8VH 4WWYA 4O3UA 1GBFA 3GY5A 2BD3A 2O8UA 4NG9H 1IAUA 1OWHA 3ZZ3A 3E6PH 3HGPA 2XWBI 3ZVAA 3EQ0H 2EEKA 3T27A 3V3MA 3FAOA 4ABEA 1IQIA 1UMAH 1YBWA 4Y7BA 3U8RH 1VCWA 2FTMA 3DHKH 1IHTH 1NROH 4NFFA 2F3CE 4ABGA 3PWCA 5JYIA 4E06H 4K2YA 1GI5A 1ZRBA 4NIWA 1AVXA 1AMHA 1HV7A 1ACBE 2B5TB 1ID5H 4OS6A 2VH0A 3E16B 3A83A 1G3EA 1GPZA 3ZZBA 2TGPZ 2ZFPH 2C8YB 3ZVGA 1BTWA 1A5GH 3RM2H 2FPZA 2XC4A 4ZUHA 3DD2H 3RC5A 3RXUA 2FO9A 5LPFA 3RXBA 4D76A 1XUIA 2BY9X 1V2RT 1GBAA 2Q6GA 2TGTA 1C9TA 1SLXB 2VVCA 3SGBE 4IC6A 5A8YA 1GJCB 3MNXA 4ABJA 1G3CA 1SOTA 3M36A 1O3PB 1DXPA 3QLPH 1ZHMA 1T8NA 2IPHA 3OY6U 1NU7B 4INLA 1CA0C 1D3QB 1SL3A 1CA0B 2ZHFH 2ULLA 1MZAA 1THRH 1V2JT 1PPFE 2FZZA 3V12A 1QL8A 1OX1A 1O2HA 4FVDA 2EA3A 4ISNA 1HJAC 3ZVFA 1O2XA 5T3HA 1YPKH 2HNTF 3SNBA 4A5TS 1Q3XA 3BG8A 4WMEA 5DJ7A 1AWHB 3OU0A 1EZQA 4WH8A 1CT2E 4MQAA 1ZGIA 3QGJA 2FIRH 1HYLA 2ZIQH 1SGQE 1TIOA 1O2YA 4JZDH 5A8ZA 5SGAE 3ZZ8A 1F5KU 2ZPSA 1YPHC 1O5CB 4CHAB 1B7XB 2Y5HA 1GMDG 1A0HB 1J15A 1P2KA 5A0AE 4DIHH 1EATA 8LPRA 1O5FH 4NA7A 1O35A 1C1TA 2C8ZB 5JDUB 2ZHDA 4H6SB 1VITF 4X2WA 1P12E 1C2GA 4H6TA 1C5XB 1CA8B 1QY6A 4IW4E 5FBEA 1YP9A 5FX5A 1HRTH 5FPTA 8ESTE 1MTNB 2GV7A 6ESTA 2P59A 3GCHC 1LKBA 1BTYA 3PLBA 5GCHG 1NFYA 1ELDE 3GCHB 5I25A 2Z6BD 1PJPA 4FUIA 3SU3A 2VU8E 4Y71A 3LOXA 1RD3B 3M61U 1QB1A 2OC1A 1FONA 2OC8A 2Y6TA 1RFNA 4I8HA 4X6MA 1B5GH 4GCHG 3KIDU 3RMLH 5ETXA 1C9PA 4CRFA 3LDXH 1KYNA 1V6DA 1SLWB 2ASUB 2XRCA 4ZHAA 2ZFSA 2ZO3H 4E7NA 2QIQA 2ZU3A 1E34B 1UK3A 3SUDA 2RA3A 1DLEA 2ZNKH 2WYJA 3QZRA 3Q77A 1UTNA 2AMQA 1ETTH 1MKXH 1TLDA 3ODFA 3UUZA 1O3AA 3SU0A 5E8EH 2JH5D 2FP7B 3GY7A 2WPJS 1L2EA 1OWKA 3FZDA 1T31A 3KL6A 2G51A 1M9UA 3LU9B 1L4DA 3MNSA 5AVDA 1NRQH 3UWIA 3B23B 3M3SA 3M5LA 4NSYA 3B9FH 2G8TA 1KXBA 1GBBA 1HCGA 1BTUA 1QL9A 1KDQA 1SI5H 2CN0H 3LONA 2R3UA 1T4UH 4HI3A 2QF3A 4U2WA 1ELAA 2ZGHA 1GBLA 1C1PA 3MO3A 1LKAA 2O8MA 4ISIH 1HNEE 2BD7A 1D9IA 2PUQH 1J16A 1G32B 1YLCA 4OS5A 2WPIS 1ABIH 4XFQA 2LNCA 4GLYA 1CHOF 1KIGH 1BITA 3KQDA 2ZTXA 3ZVCA 3A87A 1NC6A 7KMEH 2ZFQH 5JB8S 3D62A 1G9IE 4ZKRU 1LHFH 1RJXB 3BF6H 5GPIB 4OS7A 1O2ZA 2BOKA 4O97A 1TNLA 2GDDA 4MNYA 3A8CA 2EC9H 2V6NA 1MBQA 2XBYA 3QN7A 1D3DB 1SGRE 4B2BA 1DSUA 4AYYB 4LXBH 3MU0A 3DUXH 3I77A 1T7CA 2A7HA 4F49A 4WF8A 2FI4E 2SGEE 3SUFA 3AAUA 1ZGVA 3UOUA 2AYWA 2W5EA 1HAGE 5A0BA 3NPSA 3SNEA 2I6SA 5A0CA 1O2KA 1MD7A 2ZC9H 3Q3KA 3TH3H
chains in the Genus database with same CATH superfamily
1Q2WA 2VIQA 2QYIA 3DSGA 1DY8A 1JIMA 1FAKH 4X1NU 2BDHA 6LPRA 1P57B 3RXIA 1T32A 2OP9A 2BD9A 2BX4A 3HKIB 1FY4A 2SNWA 3E3TA 1XKAC 2ZU4A 4XD7D 1HPGA 1SLUB 3H7TA 1MQ5A 3GY6A 1QQUA 2AERH 2HPQH 2F9VA 4YXWD 1OYTH 1E37B 1OHHD 1JRSA 4XBBA 2Y7ZA 2D8WA 5DP8A 1SVPA 3M7UA 4E05H 1HB0B 4CH2B 7GCHG 4K8BA 1HFDA 5GIBA 1ELCA 4WH6A 3OEHD 1FQ3A 1LVMA 1SGCA 2WYGA 1L4ZA 3FP6E 4ZKOU 1Y5UT 3BG4C 1W7GH 1P8VC 3BG4B 4YTAA 2SGPE 3MH7A 4SGBE 3O8RA 4CRDA 1GHYH 2CV3A 3F1SB 3GICB 1ELVA 2Y7XA 1GBJA 3OSYA 1DITH 3BTME 3RMOH 4KELA 2BMGB 3SI3H 1WQVH 3KNXA 2SGQE 1QBOA 4ASHA 1ELBA 3BTHE 1QJ1B 1OPHB 3TPIZ 3C27B 4Y8ZA 2BQ7B 4B6EA 3E90B 1Z71A 3P92A 1W14U 5JPMH 3RXGA 3SW2B 2W6JD 1TGTA 3LT3A 3A7TA 2M2AA 4ZROA 4X8SH 1C4U2 4MDSA 2DE8A 4MLFB 3M7TA 2F4LA 4Y76A 4AN7A 4AG2A 1DWCH 2QXHA 2PWXA 3RXSA 1PPGE 1C2IA 3NUMA 2P8OC 4GAWA 1CT0E 3FO8D 1YGCH 4K8YA 2A45B 1QQ4A 3VB5A 2XC5A 3S0NA 2A5KA 4YOIA 4FU7A 3PM3A 4YT6H 3TGJE 2PUXB 1TMBH 1TNJA 2B9LA 1A61H 1AGJA 3I29A 5GJ4B 1MH0A 2QXIA 1CGIE 3ZZDA 2OD3B 3UAIC 1DS2E 1AUJA 2RG3A 2M5TA 3NRLA 1DUAA 1ANDA 1F5LA 1HAIH 1NTPA 5F03A 4TPIZ 1KLJH 5CHBA 1Z1JA 5E0JA 1V3XA 2FMJA 2PKSC 1S0RA 2PKSB 1Z8GA 4Y0YE 5DO4H 1QRWA 2ZF0H 3MH4A 2J9NA 1LHDH 3BTKE 3OY5U 2F83A 1DXWA 2UUKB 2ZKSA 3QK1A 3SHCH 3T28A 1ESAA 1P2JA 3PV2A 1LHEH 4LZ4B 1SQAA 3N99A 3OX7U 3UR6A 4JYUH 4MVNA 1C1SA 4I7YH 3VG8A 1GHBF 1YPHE 3RXPA 1EB1H 2XBWA 3GY8A 1HAXB 3S9BA 1PQ8A 1LHGH 3NKKA 1MQ6A 1FMGA 2XBXA 3EA7A 1FX0B 2BY7X 1YYY1 2RFKC 1SGFA 4DT4A 4DY7B 1MTVA 1XUHA 3LH1A 4YT7H 5A8XA 4IGDA 2WHXA 3P8FA 1A1RA 1ZMNA 1O2RA 2BM2A 1TNIA 3ATKA 2UWPA 1ZSLA 5HYOA 4YESB 3K9XB 3LGUA 4Q2KA 1AB9B 1TRNA 2FS8A 2ZI2H 3M7QA 6GCHF 2BD8A 5EXMA 5L2ZH 2JIZD 1CGHA 1SFQB 4TWWA 5IDKA 4WVPE 3U1IB 3A7WA 2GD4B 1K1LA 4YZUA 3EE0B 1OKXA 2FOMB 3A8BA 1C5OH 4Q63A 2J98B 2ODQA 1EB2A 1BIOA 2OTVA 3MH5A 3KCGH 1PFXC 1ZJKA 3F2HA 3RLWH 2XCFA 3ESTA 4WMDA 3BTWE 3URCA 1BMFD 3BTEE 3QWCH 1GI0A 1U6QA 1KTTB 1UO6A 1GJ4H 1PPEE 3MOCA 1TPAE 3QX5H 4UFGH 2PSXA 1CQQA 3ZZ5A 3HGNA 4A6LA 1O3EA 1BTHH 1RTFB 1G2MA 2LP6A 2EQNA 1ZZZA 1EJMA 4IBLH 5C1XA 3UNRA 2WPKS 1Z1IA 2F91A 2GZ9A 5E2OA 1QBVH 4IC5A 1MD8A 4ZKSU 1OP2A 5T6GA 3TK5A 1A4WH 4X2XA 2ZU2A 2BY5X 4Y8XA 2FEQH 2QXJA 2XC0A 2WV5A 5GXPA 2IN2A 4ISOA 1C2FA 4MPVA 5FBIA 4IN1A 1HXFH 3JZ2B 2XXLA 4F4OC 1DVAH 4DIIH 2JETC 3RU4T 5HM9A 2JETB 3KQCA 1TA2A 2B7DH 3A7ZA 2L74A 3ZV8A 1GGDB 2BVXH 1XUKA 1Y3YA 1KXDA 1GG6C 5J4QA 1Y3VA 4DURA 3GYMA 1NRPH 2AGIX 4I8JA 3MNCA 1P03A 1NU9A 1SPJA 2QA9E 1O36A 3A80A 3I78A 1J17T 3UOPA 1GHAG 2FI5E 4MTBA 1TBQH 1TGCA 3Q3YA 1V2VT 1O38A 1SGNE 1F0RA 4KTUA 2C8WB 5L2YH 2EY4C 2ZEBA 4QT8C 2VIVA 1V2KT 1KSNA 1OWIA 5K0HA 4NSVA 3QUMP 1HAVB 3RXAA 4XRNA 1S6FA 5FCRA 2WV4A 1BDAA 2XYAA 3HKJB 5IK2D 1HLTH 1C1NA 2G55A 5HIYA 4BAMB 1KY9A 4KTSA 9LPRA 1TBRH 1VCQA 4TYDA 5FPSA 1EP5A 2FXRA 4WXVA 1GVLA 1LPKB 5C67A 2SGFE 4RT1A 4X6OA 1H4WA 3L3TA 3KEEA 4B1TA 4UD9H 2C90B 3TIUA 1OXGA 3PLPA 2H2ZA 3WWFA 5EW1H 1FPHH 2OUAA 1K9OE 2D1JA 2FOHA 3LGIA 1G3DA 2BDCA 2UUYA 1W12U 4FUDA 1OP8A 4BANB 4MNWA 2F9UA 1ZMJA 1H1BA 3K6YA 1SGEE 3A8AA 4ZCNA 2PLXA 1O2JA 1TX7A 1GBCA 2KCOA 4U32A 3NK8A 1O2SA 3UY9A 2BVSH 3BIUH 4NA9H 1E0FD 1PPCE 1DX5M 2BVRH 1S83A 2QAAA 1HAYB 3ZVDA 1O39A 3QDZB 1K1MA 4GVUA 4JZFH 2V3HH 2GP9B 1W3CA 1UCYE 1GMDF 1QJ7B 1GMHG 2CHAC 2PHBA 3CS7A 3LGWA 3GCNA 2CHAB 1LQEA 2HWLB 5CMXH 1BZXE 4U01A 1P02A 5L6NH 2STBE 4K60A 3RXLA 2AGGX 4AFQA 4GHQA 1BQYA 2ZFRH 5TJXA 1BUIA 3LH3A 2Y5GA 1SGFG 4JZ1A 4Q80A 1Y3WA 2BY6X 1O3JA 3F9EA 3HK6B 5FHTA 1FY1A 1P2MA 2OLGA 3HK3B 2AMPA 1VKYA 2FX4A 2VB0A 1EOJA 2K0QA 5GCHF 2R9PA 3QTOH 4BAHB 1YPLH 1K1PA 2CGAA 3P95A 4D9RA 5GWZA 2KAIA 1TA6A 2AH4X 1C5LH 3E0PB 2ZDLA 1KTSB 2UUJB 2IPQX 8KME2 4FUBA 4GCHF 3Q00A 1T8OA 3TVJB 1H9HE 5FCKA 5I46H 1O3MA 1HJAB 2VWMA 3UQVA 1IHSH 3SJIA 3UNSA 2P3TB 1O5AB 5AFZH 4GHTA 1CO7E 1ESBA 1W0ZU 1XVOA 3TNSA 1MCTA 3PTBA 3EAJA 1UTOA 4WXIA 4B2AA 1N1LA 3SZEA 1AZZA 2QN5T 2JDID 2O8WA 4DOQA 5C94A 2ZCLP 4MNVA 1A5IA 1QA0A 2Y82A 3A86A 2NU1E 3IWMA 1FDPA 1O2GH 5T6DA 3PB1E 3FVFB 2OBQA 1G30B 1IQNA 1FXYA 1F7ZA 3PMAB 2J2UA 1YCPK 3DA9B 3FN8A 4JMYA 3BTGE 4TSFD 1F0TA 1O34A 4E7RG 5T1VA 2BD5A 1LPZB 2PTCE 1BT7A 1QA7A 1C2LA 4K69A 3BEIB 3GDUA 1P2QA 5KECA 1G2LA 1C5YB 3HATH 2CMYA 4I8LA 1UTPA 1RTLA 3ZYDA 2ZZUH 1GBDA 5C2ZA 3EDXB 2W7SA 1ESTA 3JZ1B 3U28C 1TAWA 2WPLS 1WV7H 3RDZA 1RS0A 4CRAA 3MI4A 1P9SA 2ZPQA 8GCHG 1UVUH 4DJZB 3N7DA 3K65B 3GDSA 1P11E 2BHGA 3TH2H 2XNIA 1LQDB 1O3NA 4X2VA 3RC4A 1GJBB 1BRBE 5EJLA 5B6LA 2F9OA 2HRVA 1BA8B 1BJUA 1SB1H 2RDLA 2A4OA 3ZZ4A 1DFPA 2ZDVH 3K6ZA 2BTCE 2BYAX 2SGAA 2WUCA 1CGJE 4NZLA 1W11U 2AFQB 4UE7H 1ZSKA 1WU1A 1O3CA 4DW2U 3EYDA 1NY22 1A3EH 1C1VH 1CSOE 3N7OA 1OSSA 1XKBC 3RXKA 1SKYE 1DSTA 1IQEA 2VIOA 4SGAE 1HBTH 3GY4A 1A5HA 3O8DA 1GHVH 4YLUA 5C20A 1V2QT 1QRXA 4P02A 1L0ZA 4RKJB 4CRBA 1O2UA 3DFJA 3T29A 1PPZA 4I8KA 1GJ6A 3RU4E 1MKWK 2VIDA 4ACAA 2NU2E 2ZG0H 3VGCC 3T26A 2BY8X 3VGCB 2BQWB 3F6UH 2QY0B 1A46H 4AFZA 1CVWH 1ZPCA 3MO6A 1NRRH 1XUFA 4LOYH 3TNTA 1LMWB 4Q4LA 2PGQB 1GL0E 2PW8H 4AG1A 4D9QA 1SSXA 7GCHF 5CHAC 3V7TA 1HIAA 2V3OH 3MTYA 2A31A 5CHAB 3RXCA 3LGYA 3ATWA 3F0PA 1EJNA 4BTUB 1SQOA 1SG8B 1UTQA 2J97A 1F0UA 1JXPA 1C4Y2 1AVGH 1BMLA 4JYTA 3AASA 2PSYA 2YNAA 3TJNA 2OQUA 1W10U 3GCTG 3UIRA 5A09A 1LHCH 2THFB 4GUXA 1JBUH 3ZVBA 1VCPA 4ASUD 1WYKA 2RCEA 4Z0KA 3F2GA 1AI8H 3QGNB 1K1NA 5AHGH 2H6MA 1BHXB 3S9AA 2H5DA 2JKHA 2A7CA 1GHZA 4P00A 2ALVA 3A82A 1FN8A 2DE9A 2VGCC 5EQSA 4DVAU 3TLOA 2VGCB 1AKSA 4X1SU 3SU2A 1LTOA 4K1EA 1SQRA 3A89A 2Q6FA 1V2OT 2F43B 4MPXA 4I86A 2HALA 4AB9A 1TFXA 1ELFA 1GI9B 3KQEA 2Z3CA 3MHWU 1TE0A 3K2UA 3ZYEA 5E0HA 1QB6A 1GDNA 4FVBA 1J9CH 2NWNA 1V2MT 4ABHA 2IOTA 1FNIA 2BDAA 3U8OH 2C3SA 1TRYA 2G5VA 1UHBA 3SV6A 2BDGA 4TT3D 3SZNA 1V2UT 1Y5AT 2A4RA 4MPUA 1HUTH 1SGPE 2GGVB 2I6QA 4X8TH 1FIZA 1SHHB 1VGCC 2OXSA 3F68H 1VGCB 1MAYA 4AZ2B 2BZAA 3CENA 3F9HA 3SQHE 1C5TA 1QRZA 3TH4H 1EAIA 2ZDNA 4MG3A 1ZOMA 1C5NH 1TONA 3ITIA 1SBWA 1ZR0A 3QZQA 1QB9A 4ZHLU 5HGGA 2ZHEH 1KXFA 3M35A 1EXFA 2KCAA 2ZTZA 2GX4A 1D6RA 1IQHA 2BLVA 3STJA 2BD4A 1NFWA 3IG6B 1ETSH 2A32A 3M5MA 4M9FA 1QZ8A 4B6FA 1PQAA 3O8CA 2KX4A 1QFKH 3TJOA 4IS5A 4ZMAH 1WTHD 1V2PT 4FXGH 3SBKA 4FU9A 4FUJA 2FI3E 1AZ8A 3RP2A 2P8OB 3BTQE 1UJ1A 4BAKB 1A3BH 1GDQA 4WJG2 1QJ6B 1FIWA 2ZHWH 3SV9A 5AF9H 1MAXA 3GYLB 2ZPRA 1YC0A 3RMMH 2ESTE 2RDEA 1O3OA 3S9CA 5EU8A 3RXDA 1NRSH 3ATMA 1A2CH 3PO1C 4YOGA 1Y59T 2FOEA 3Q76A 2YNBA 3PO1B 2H5CA 4AYVB 2ANKH 3SV2H 1NESE 3RXHA 3QTVH 4TY7A 2QE7D 3HPTB 1RGQA 1BMAA 2JH0D 2KM0A 1TRMA 2FYRA 5HXFA 2P16A 1IQKA 1QNJA 3RC6A 1GJ9B 2ODPA 2G00A 1V2LT 2PGBB 1QL7A 1EP6A 1YKTA 2WSSD 3EA9A 2O9QA 3OFND 1A0JA 2OK5A 4A1VA 5EPNA 1XUGA 3LKWA 3ZZ7A 2ZDMA 3GOVB 1UTJA 4NWKA 1TMTH 2ANMH 1LCYA 3A85A 5FAHA 4AGKA 4GSOA 2BDBA 1O3IA 2JH6D 4OS4A 4Q7XA 1PPHE 3URDA 1WSSH 1V2NT 1ZTKA 3UNQA 1OOKB 1AE8H 4XSKU 1F5RA 1F92A 2IJD1 3MWIU 2A2QH 1FV9A 1P2OA 1QHRB 4MNXA 4D8NA 1GL1A 1DM4B 4I32A 1LPGB 3SV7A 3ZZCA 2ZFFH 4WY3A 4Y79A 3RM0H 3UFAA 2GCTC 2HVYB 2BD2A 3MU4A 1KDQB 4Y8YA 3M3VA 1O2OA 4IMZA 3V0XA 2Z9IA 3OE7D 3SNDA 4AORA 1W2KH 5B6OA 2W7UA 1FLEE 3BV9B 4KGAA 4Z1MD 1DWDH 1FY5A 2PP6A 4TPYA 1N8OC 2WPDD 3WW7A 3TJUA 4A7IB 2A5IA 1ZYOA 5CE1A 1N8OB 1XMNB 2STAE 1LO6A 1GBIA 3OAAD 1BTPA 1T8MA 2XW9A 3GISB 1WTGH 1IQJA 3G01A 3RUOA 1W8BH 3VB3A 1FN6A 3ZZ6A 3FP8E 1BMNH 2GZ7A 2ZGCA 4XOJA 2CJIA 1FZZA 2VVVA 4JZEH 1GJ5H 1TPPA 2Z3DA 1TX6A 5T6FA 1QURH 4JK6A 4I31A 1OWJA 2QF5A 2Y80A 5EW2H 3TK9A 3WY8A 1C5WB 3LGVA 1Y3XA 2ILNA 1HIAB 4DG4A 2Y5FA 2O8TA 1UCYK 1MCVA 1BRCE 2QF0A 4ISHH 4X1PU 1Z7KA 1Z6EA 1NZQH 1P01A 2F9BH 1S82A 4RKOB 3ZV9A 1E79D 2A1DB 1S6HA 1K28D 1SLVB 2FTLE 3MU8A 1TGNA 2XWAA 1JRTA 2VNTA 1MU6B 1IOEA 2ZDAH 2J95A 3NCLA 3RXOA 1NPMA 4YM9A 5J4SA 5F6MA 2TRMA 3F2FA 3RXRA 3RXEA 5EIYA 1TNGA 2GCHG 1UVSH 1P9UA 1L1JA 1O2WA 4AOQA 2P93A 2K8IA 2V7QD 3RU4D 4CBNA 1AKSB 3VB6A 1MBMA 4UEHH 2YMSC 5DP5A 1D4PB 2NU4E 2YMSB 1HDTH 2EI8A 5DN6D 1C1WH 4IMQA 1O3BA 2HNTE 1ARBA 1GG6B 2W3KA 1O2PA 3F9FA 3SJOA 1TOMH 1H8DH 1C5ZB 4H42U 4KKDA 1AE5A 1C2KA 4X8UH 1DDJA 1WCZA 1ZPBA 2FWWA 2AIPA 3VB7A 5FPYA 1GMHF 3U69H 3RXTA 1Z6JH 2Q6DA 5FX6A 4D7FA 2FODA 2PFEA 4Y7AA 3AW1A 1TWXB 2FOGA 1UTKA 1UHBB 1NN6A 2GDEH 3SU6A 2UWLA 3F9GA 5C1YA 1SR5C 4K3JA 1UK2A 4BXWA 1BOQA 1TQ0B 2FESH 3SYJA 4CR9A 1O3FA 1YCPM 1MABB 1ZHRA 5EOKA 4UONA 4BOHA 1UCYH 1O3GA 4BNRA 1SMFE 1THPB 1O5BB 1L1NA 5JBCS 2H1UA 4WMFA 3RLYH 4DGJA 2VINA 3DCLA 1UVPA 3R0FA 4K1TA 2TPIZ 5ESBA 1FY8E 1EPTA 2VH6A 3MFJA 1S0QA 2OQ5A 5HM2A 2LELA 4M7GA 3P70B 2BDYA 2B0FA 3PMJA 1E38B 6CHAC 4O3TA 4ABIA 6CHAB 4X6PA 2OC0A 4NFEA 5C5NA 3SGQE 2ZGBH 1W0YH 1BBRE 1SGTA 1EX3A 3D49H 4ABBA 5JBBS 3SNCA 3F0OA 2V3MA 1RTKA 4XBCA 3A8DA 3MYWA 3ATLA 2BQ6B 4RSPA 4NIXA 5EXNA 3A7YA 4B76A 3R3GB 1O30A 4FOUC 3GY2A 3A88A 3RXQA 5JB9S 1MTUA 3FOAA 3BTFE 1PQ5A 3BTDE 5DP3A 1ETRH 4Y11E 1AO5A 1O0DH 1O33A 1TQ7B 1ANEA 4IN2A 4BTTB 3PRBA 4UFDH 3RXFA 1YPMH 3MMGA 5DP6A 1GMCG 1XUJA 1FUJA 2HLDD 1MUEB 1E1QD 1UK4A 1HAPH 1EFRD 3UWJH 4HTCH 4X1RU 1AFEH 1D3PB 4JK5A 2W26A 3SUGA 5BRRE 3ZVEA 1SFIA 1OYQA 1P09A 1WUNH 4X0WU 2ZDKA 5HMAA 1EUFA 2G4TA 4YO9A 1DLKB 4AB8A 1A7SA 2OBOA 3W95A 3P8OA 4HGCA 4XBDA 1DWBH 4OGYA 2VIPA 4X6NA 1SOZA 2A0QB 4NIVA 2ZU1A 2Y81A 4I33A 1DICA 1O2LA 8GCHF 3NXPA 1OWEA 1C5QA 1AN1E 3FZZA 2TGAA 1KXCA 1O2VA 1SQTA 2W3IA 1LVOA 3LJJA 4ABDA 2GTBA 1RRKA 1W0KD 2BOHB 1ZMLA 4PROA 3UR9A 4Y10E 1HAZB 1IQGA 2J5UA 4B71A 1MKXK 2ZA5A 3VFEA 5IYTA 4ABFA 1EQ9A 1GI8B 3GY3A 2R2WU 3SJKA 2KZ4A 1BJVA 1ELEE 1RIWC 4U30A 3AW0A 2AMDA 1EAUA 1NFUA 1E36B 1RIWB 4CHAC 5DP9A 2A5AA 2ZGJA 4Z6AH 4AC9A 3T5FH 5F8XA 2VJ1A 3PV4A 3VB4A 4THNH 3LGTA 4BAOB 3KGPA 1HJ8A 1YWUA 2PKAA 5C17A 3BSQA 3SO3A 3LC3A 5K7RA 4UFEH 1AUTC 1XVMA 2W6ID 1SGYE 2Z7FE 1ORFA 1T8LA 2D26C 4JZIA 2CF8H 1BRAA 3SU1A 1QIXB 3SN8A 1GVKB 3U98H 1CHGA 5C0TA 1IQLA 3H7OA 2SNVA 5EJ1A 1MTNC 3L6PA 1O2MA 1BTXA 1YM0A 1ELGA 1C5RA 4JCNA 2PTNA 5JBTA 3FFGA 1QTFA 3P8NA 1YPGH 1O5GH 1TALA 1BHXF 4OGXA 3T2NA 3UB0A 5E2PA 5DP7A 1YF4A 1Z8IB 1ZRKA 3AVZA 3PYHA 2CF9H 2HGTH 1HAHH 2GMTC 2BLQA 1O3LA 1C1QA 1ZTLA 5DP4A 2GMTB 3CNRA 3FP7E 3M5OA 2NU3E 2QXGA 1HGTH 1GI3A 2F9NA 1ARCA 4FUHA 5JBAS 3MNBA 1GBHA 9ESTA 5L30H 2OCVB 1GVZA 3ODDA 3BEFB 3FKSD 4NZQA 1GBTA 3SI4H 2P95A 3PMHB 1P04A 1LVBA 1P2NA 1IQMA 3RXVA 1VJ9U 2XTTB 1H8IH 4NGAH 1GI7B 1V2WT 3GCTF 5DG6A 1O3DA 1TPOA 1XX9A 2V0BA 1O37A 4VGCC 2FOFA 1P3CA 2ALPA 3ZZAA 4VGCB 4AX9H 1ABJH 3A7XA 1K1IA 1L1GA 1V2TT 3DSPA 2BXTH 1H8ED 5ESTE 3TGKE 4O03A 4CH8B 1C5SA 4CRCA 1TB6H 2R0KA 1NO9H 2C93B 3U9AH 1VITG 2A7JA 5KEDA 1YCPH 1YY3A 4X1QU 2FS9A 2TIOA 2FDAA 1C2JA 2HNTC 4K1SA 5PTPA 3SJ8A 2A2XH 1CE5A 3C1KA 1C1OA 1THSH 2WV9A 2BZ6H 4JYVH 3KF2A 5G4BA 3U1JB 2CXVA 1KMHB 2V35A 4FUCA 2F9PA 3NZIA 5EQRA 3ELAH 1C5VA 3RXMA 2QC2A 1B0EA 4ZH8A 4ZKNU 4GPGA 2P94A 4J2YB 3STIA 4INHA 1KXAA 1PPBH 3SQEE 4BTIB 1Y5BT 5C1UA 3ATIA 1AVWA 1F2SE 2HVXA 1ZTJA 1EZSC 2HOBA 1EOLA 1GBMA 3CP7A 3CS0A 1A0LA 1DUEA 4FUEA 5HIZA 1IQFA 3WWBA 1EPTC 1P10A 2J4IA 4ZXXH 2LPRA 4FU8A 3BN9A 2BB4A 1EAXA 4ZHMU 1EPTB 1GJ8B 1MU8B 1BB0B 2H9EH 1G36A 1SC8U 4FETA 2ZCKP 4NA8A 3PRDA 4YLQH 1J8AA 2Z9GA 1D6WA 1UTLM 2WPHS 5EPYA 1AWFH 1SGIB 4AGJA 1FY3A 1P0SH 5H4IB 1P2IA 1S84A 1O2QA 3EGKH 1C2MA 2FOAA 4YOJA 1P06A 2ZTYA 3H5CB 1G3BA 4FUGA 4CR5A 1K22H 2G4UA 2Z9JA 4BXSA 2UWOA 1AD8H 1GCTC 2GT7A 2XBVA 1C2EA 1EKBB 1GCTB 1UVTH 3MQKC 3EE7A 2ZQ1A 2G5NA 4R0IA 2Z9KA 5EXLA 1QGFA 1WQSA 2OC7A 3S7HB 1OP0A 5DPAA 5DK1A 1MKWH 4MPWA 5GDSH 5TCAA 3MU5A 1O5DH 1EJAA 2TGDA 1JIRA 1PYTC 3UPEA 3TU7H 1W7XH 1NT1A 1GWAA 2R3YA 1CHOG 3SU5A 1TGSZ 4RI0A 1O3HA 1UVOA 3M37A 2ZP0H 3P17H 4TY6A 2IJOB 5A2MH 2ZHQH 5EGMA 3UREA 5BPEA 1ZJDA 3UTUH 4XE4A 1C2HA 1H8HD 3KQBA 4B2CA 1FAXA 3TGIE 2KAIB 4FUFA 3TJVA 2WUBA 4ISLA 3T25A 2VWOA 2J34A 2J92A 1NS3A 1ZHPA 2FYQA 2FM2A 5EG4A 5CDFE 1HAVA 3KN2A 4HFPB 3DT0H 1YLNA 1C5UA 1Q31A 3LPRA 2ZGXH 1JWTA 3LJOA 1GI2A 2NU0E 2C8XB 1AIXH 1PYTD 4RN6A 4LK4A 4B75A 3S69A 3FANA 1YPEH 2D2DA 5EJZA 3LIWA 3SU4A 2XCNA 1DOJA 5LGOA 4A1TA 4ZXYH 2Z3EA 1LDTT 3U8TH 1TNHA 3M5NA 1AHTH 2ZFTA 2O8LA 1WDIA 2H9HA 2ZCHP 3TK6A 4D7GA 4J1YA 2ANYA 4CREA 1KLIH 2AEIH 1AFQC 1AFQB 3E0NB 1KXEA 1NM6A 2GZ8A 3A7VA 3P8GA 1EASA 1TGBA 2R0LA 4A92A 4O9VA 1O2NA 1WBGB 4BAQB 1O31A 4KP0A 1H9IE 2BLWA 3GDVA 4OS2A 1N6YA 2PKAB 2FOBA 3MO9A 1PQ7A 1K1JA 1UTMA 1ZSJA 2J94A 1GHXH 1TPSA 1SGDE 4OS1A 1FJSA 4NIYA 5GNDA 3OTJE 2ZQ2A 1O2TA 1MMJN 1H9LB 1JOUB 1VZQH 2GKVE 2KCYA 1C4V2 2Z94A 4UFFH 2AS9A 1YLDA 4A1XA 3VPKA 3KYFA 1AU8A 3Q3XA 1C1MA 5F8ZA 1WOFA 4AFUA 1W13U 2AGEX 1S81A 2ZWLH 3MH6A 1GI6A 2HLCA 2HPPH 2R2MB 1AQ7A 1D3TB 1TBZH 2VIWA 1G37A 5C5OA 4F48B 1CU1A 3A81A 2ZECA 3T62A 2AIQA 1C5MD 1Z8JB 2BLOA 3PTNA 7ESTE 1S5SA 4ABAA 4INKA 1FPCH 3SHAH 1C1RA 4B73A 1C5PA 1C2DA 1BCUH 1P3EA 2PV9B 2WPMS 2VWLA 3L33A 5F53A 5F8TA 2UUFB 2VWNA 4XDEA 1Y8TA 2P3FH 3ZZ9A 2GV6A 4R8TB 5EODA 2WINI 2A4GA 1O3KA 1SHYA 1KLTA 1O32A 3V13A 1GCDA 2GCTB 2GCHF 3VXFH 5ABWA 2OINA 3RMNH 1J14A 1GBKA 1NBME 3SJ9A 1MTSA 3SUEA 5DKMA 3PROA 4B74A 2BX3A 1HJ9A 1HAOH 1ZPZA 1TMUH 1WAYB 5DGJA 4CRGA 3KYGA 3SOSA 2B8OH 1BBRK 2FX6A 1GHAF 1AB9C 2QGRA 1K2I1 1Z8RA 1C1UH 1TYNA 2G52A 2QCYA 1COWD 1XXFA 2P3UB 3B8JA 1CBWC 7LPRA 5LH8A 1QBNA 4NCYA 2Q1JA 3BTTE 1CBWB 1P05A 4Q7ZA 1ANBA 3IITA 1O2IA 1MZDA 5TCCA 1ZLRA 1DANH 3MU1A 3NWUA 4NWLA 1BMMH 1E35B 2ZU5A 4DT7B 2YOLA 3LC5A 5DSFA 1S85A 2TBSA 2A4QA 1TNKA 1RXPA 1AY6H 1OWDA 1DY9A 2Z9LA 3PV5A 3EA8A 1VR1H 3SV8A 3RXJA 1GHBG 2C4FH 2BXUH 3QO6A 2KCPA 5AFYH 1GJAB 1WXRA 1GI4A 1GHWH 2BDIA 3W94A 2AHME 3SGAE 1K21H 3SORA 5LPRA 1FI8A 1VITH 3A84A 3TITA 3KHVA 1NRNH 3P6ZB 4CBOA 1GJDB 1EZXC 5FL7D 1XXDA 1GI1A 3BIVH 1LVYA 2SFAA 1EZUC 2FLRH 3PMBB 1X7AC 1V2ST 1XM1A 2EI7A 5C3NA 1DWEH 4UDWH 2GT8A 5E0GA 4Q7YA 1ELTA 1DE7H 4DCDA 4I8GA 1O5EH 3M3TA 3S7KB 3UQOA 3VXEH 1GJ7B 3N7EA 1NFXA 1MTWA 3OYPA 4X2YA 1JMOH 1Y3UA 4Y6DA 1BTZA 6GCHG 1GGDC 2XNDD 3E8LA 2ODYB 1HXEH 2DUCA 1VJAU 1BBRH 3VEQB 1QCPA 4LZ1H 2ANWA 5LPEA 3D23A 3GCOA 2RA0A 2FLBH 2SGDE 3SNAA 1B0FA 4TWYA 4ACBA 1ANCA 2GVFA 3OEED 4KTCA 1OS8A 1TX8A 3KQ5A 2YMSD 2G81E 1GMCF 5FXLA 2K1QA 1K0HA 1DT2A 1EAWA 5EQQA 1DPOA 2J38A 1N6XA 3DFLA 3ENSB 3PLKA 2VVUA 3O8BA 2FOCA 3AAVA 4ZAEA 4ESTE 1TOCB 2QV1A 4HZHA 4K5ZA 3BEUA 3E91A 4AFSA 2PR3A 2QF4A 1CT4E 3PWBA 1INCA 1BRUP 1GDUA 1GBEA 2EI6A 1K1OA 3D65E 3E1XB 4Y0ZE 1T4VH 1YPJH 1QR3E 2H9TH 1F0SA 1TABE 4H4FA 4X8VH 4WWYA 4O3UA 1GBFA 3GY5A 2BD3A 2O8UA 4NG9H 1IAUA 1OWHA 3ZZ3A 3E6PH 3HGPA 2XWBI 3ZVAA 3GS9A 3EQ0H 2EEKA 2JJ2D 3T27A 3V3MA 3FAOA 4ABEA 1IQIA 1UMAH 1YBWA 4Y7BA 3U8RH 1VCWA 2FTMA 3DHKH 1IHTH 1NROH 4NFFA 2F3CE 4ABGA 3PWCA 5JYIA 4E06H 4K2YA 1GI5A 1ZRBA 2CK3D 4NIWA 1AVXA 1AMHA 1HV7A 1ACBE 2B5TB 1ID5H 4OS6A 2VH0A 3E16B 3A83A 3H09A 1G3EA 1GPZA 3ZZBA 2TGPZ 2ZFPH 2C8YB 3ZVGA 1BTWA 1A5GH 3RM2H 2FPZA 2XC4A 4ZUHA 3DD2H 3RC5A 3F3BA 3RXUA 2FO9A 5LPFA 3RXBA 4D76A 1XUIA 2BY9X 1V2RT 1GBAA 2Q6GA 2TGTA 1C9TA 1SLXB 2VVCA 3SGBE 4IC6A 5A8YA 1GJCB 5KGOA 3MNXA 4ABJA 1G3CA 1SOTA 3M36A 1O3PB 1DXPA 3QLPH 1ZHMA 1T8NA 2IPHA 3OY6U 1NU7B 4INLA 1CA0C 1D3QB 1SL3A 1CA0B 3AK5A 2ZHFH 2ULLA 1MZAA 1THRH 1V2JT 1PPFE 2FZZA 3V12A 1QL8A 1OX1A 1O2HA 4FVDA 2EA3A 4ISNA 1HJAC 3ZVFA 1O2XA 5T3HA 1YPKH 2HNTF 3SNBA 4A5TS 1Q3XA 3BG8A 4WMEA 5DJ7A 1AWHB 3OU0A 1EZQA 4WH8A 1CT2E 4MQAA 1ZGIA 3QGJA 2FIRH 1HYLA 2ZIQH 1SGQE 1TIOA 1O2YA 4JZDH 5A8ZA 5SGAE 3ZZ8A 1F5KU 2ZPSA 1YPHC 1O5CB 4CHAB 1B7XB 2Y5HA 1GMDG 1A0HB 1J15A 1P2KA 5A0AE 2KFWA 4DIHH 1EATA 8LPRA 1O5FH 4NA7A 1O35A 3ZIAD 1C1TA 4OM9A 2C8ZB 5JDUB 2ZHDA 4H6SB 1VITF 4X2WA 1P12E 2VBCA 1C2GA 4H6TA 1C5XB 1S6LA 1CA8B 1QY6A 4IW4E 5FBEA 1YP9A 5FX5A 1HRTH 5FPTA 8ESTE 1MTNB 2GV7A 6ESTA 2P59A 3GCHC 1LKBA 1BTYA 3PLBA 5GCHG 1NFYA 1ELDE 3GCHB 5I25A 2Z6BD 1PJPA 4FUIA 3SU3A 2VU8E 4Y71A 3LOXA 1RD3B 4HG6A 3M61U 1QB1A 2OC1A 1FONA 2OC8A 2Y6TA 1RFNA 4I8HA 4X6MA 1B5GH 4GCHG 3KIDU 3RMLH 5ETXA 1C9PA 4CRFA 3LDXH 1KYNA 1NBMD 1V6DA 1SLWB 3W1EA 2ASUB 2XRCA 4ZHAA 2ZFSA 2ZO3H 4E7NA 2QIQA 2ZU3A 1E34B 1UK3A 3SUDA 2RA3A 1DLEA 2ZNKH 2WYJA 2KR7A 3QZRA 3Q77A 1UTNA 3OTPA 2AMQA 1ETTH 1MKXH 5C0UA 1TLDA 3ODFA 3UUZA 1O3AA 3SU0A 5E8EH 2JH5D 2FP7B 3GY7A 2WPJS 1L2EA 1OWKA 2WZQA 3FZDA 4F55A 1T31A 3KL6A 2G51A 1M9UA 3LU9B 1L4DA 1UW7A 3MNSA 5AVDA 1NRQH 1W0JD 3UWIA 3B23B 3M3SA 3M5LA 4NSYA 3B9FH 2G8TA 1KXBA 1GBBA 1HCGA 1BTUA 1QL9A 1KDQA 1SI5H 2CN0H 3LONA 2R3UA 1T4UH 4HI3A 2QF3A 4U2WA 1ELAA 2ZGHA 1GBLA 1C1PA 3MO3A 1LKAA 2O8MA 4ISIH 1HNEE 2BD7A 1D9IA 2PUQH 1J16A 1G32B 1YLCA 4OS5A 2WPIS 1ABIH 4XFQA 2LNCA 4GLYA 1CHOF 1KIGH 1BITA 2J98A 3KQDA 2ZTXA 3ZVCA 3A87A 1NC6A 7KMEH 2ZFQH 5JB8S 3D62A 1G9IE 4ZKRU 1LHFH 1RJXB 3BF6H 5GPIB 4OS7A 1O2ZA 2BOKA 4O97A 1TNLA 2GDDA 4MNYA 3A8CA 2EC9H 4RT0A 2V6NA 1MBQA 2XBYA 3QN7A 1D3DB 1SGRE 4B2BA 3DSOA 1DSUA 2JJ1D 4AYYB 4LXBH 3MU0A 5HKKD 3DUXH 3I77A 1T7CA 2A7HA 4F49A 4WF8A 2FI4E 2SGEE 3SUFA 3AAUA 2XOKD 1ZGVA 3UOUA 2AYWA 2W5EA 1HAGE 2GJGA 5A0BA 3NPSA 2L6OA 2I6SA 3SNEA 5A0CA 1O2KA 1E1RD 1MD7A 2ZC9H 3Q3KA 3TH3H
chains in the Genus database with same CATH topology
1Q2WA 2VIQA 2QYIA 1DY8A 1JIMA 1FAKH 4X1NU 2BDHA 6LPRA 1P57B 3RXIA 1T32A 2OP9A 2BD9A 2BX4A 3HKIB 1FY4A 2SNWA 3E3TA 1XKAC 2ZU4A 1HPGA 1SLUB 3H7TA 1MQ5A 3GY6A 1QQUA 2AERH 2HPQH 2F9VA 1OYTH 1E37B 1JRSA 4XBBA 2Y7ZA 2D8WA 5DP8A 1SVPA 3M7UA 4E05H 1HB0B 4CH2B 7GCHG 4K8BA 1HFDA 5GIBA 1ELCA 4WH6A 1FQ3A 1LVMA 1SGCA 2WYGA 1L4ZA 3FP6E 4ZKOU 1Y5UT 3BG4C 1W7GH 1P8VC 3BG4B 4YTAA 2SGPE 3MH7A 4SGBE 3O8RA 4CRDA 1GHYH 2CV3A 3F1SB 3GICB 1ELVA 2Y7XA 1GBJA 3OSYA 1DITH 3BTME 3RMOH 4KELA 2BMGB 3SI3H 1WQVH 3KNXA 2SGQE 1QBOA 4ASHA 1ELBA 3BTHE 1QJ1B 1OPHB 3TPIZ 3C27B 4Y8ZA 2BQ7B 3E90B 1Z71A 3P92A 1W14U 5JPMH 3RXGA 3SW2B 1TGTA 3LT3A 3A7TA 4ZROA 4X8SH 1C4U2 4MDSA 2DE8A 4MLFB 3M7TA 4Y76A 4AN7A 4AG2A 1DWCH 2QXHA 2PWXA 3RXSA 1PPGE 1C2IA 3NUMA 2P8OC 4GAWA 1CT0E 1YGCH 4K8YA 2A45B 1QQ4A 3VB5A 2XC5A 3S0NA 2A5KA 4YOIA 4FU7A 3PM3A 4YT6H 3TGJE 2PUXB 1TMBH 1TNJA 2B9LA 1A61H 1AGJA 3I29A 5GJ4B 1MH0A 2QXIA 1CGIE 3ZZDA 2OD3B 1DS2E 1AUJA 2RG3A 2M5TA 1DUAA 1ANDA 1F5LA 1HAIH 1NTPA 5F03A 4TPIZ 1KLJH 1Z1JA 5E0JA 1V3XA 2FMJA 2PKSC 1S0RA 2PKSB 1Z8GA 4Y0YE 5DO4H 1QRWA 2ZF0H 3MH4A 2J9NA 1LHDH 3BTKE 3OY5U 2F83A 1DXWA 2UUKB 2ZKSA 3QK1A 3SHCH 3T28A 1ESAA 1P2JA 4LZ4B 1LHEH 1SQAA 3OX7U 3UR6A 4JYUH 4MVNA 1C1SA 4I7YH 1GHBF 1YPHE 3RXPA 1EB1H 2XBWA 3GY8A 1HAXB 3S9BA 1PQ8A 1LHGH 3NKKA 1MQ6A 1FMGA 2XBXA 3EA7A 2BY7X 1YYY1 1SGFA 4DY7B 1MTVA 1XUHA 3LH1A 4YT7H 5A8XA 4IGDA 3P8FA 1A1RA 1ZMNA 1O2RA 2BM2A 1TNIA 3ATKA 2UWPA 1ZSLA 5HYOA 4YESB 3K9XB 3LGUA 4Q2KA 1AB9B 1TRNA 2FS8A 2ZI2H 3M7QA 6GCHF 2BD8A 5EXMA 5L2ZH 1CGHA 1SFQB 4TWWA 5IDKA 4WVPE 3U1IB 3A7WA 2GD4B 1K1LA 4YZUA 3EE0B 1OKXA 2FOMB 3A8BA 1C5OH 2ODQA 1EB2A 1BIOA 2OTVA 3MH5A 3KCGH 1PFXC 1ZJKA 3RLWH 2XCFA 3ESTA 4WMDA 3BTWE 3URCA 3QWCH 3BTEE 1GI0A 1U6QA 1KTTB 1UO6A 1GJ4H 1PPEE 3MOCA 1TPAE 3QX5H 4UFGH 2PSXA 1CQQA 3ZZ5A 3HGNA 4A6LA 1O3EA 1BTHH 1RTFB 1G2MA 1ZZZA 1EJMA 4IBLH 5C1XA 3UNRA 2WPKS 1Z1IA 2F91A 2GZ9A 5E2OA 1QBVH 4IC5A 1MD8A 4ZKSU 1OP2A 5T6GA 3TK5A 1A4WH 4X2XA 2ZU2A 2BY5X 4Y8XA 2FEQH 2QXJA 2XC0A 2WV5A 5GXPA 2IN2A 4ISOA 1C2FA 4MPVA 5FBIA 4IN1A 1HXFH 3JZ2B 2XXLA 4F4OC 1DVAH 4DIIH 2JETC 3RU4T 5HM9A 2JETB 3KQCA 1TA2A 2B7DH 3A7ZA 3ZV8A 1GGDB 2BVXH 1XUKA 1Y3YA 1KXDA 1GG6C 5J4QA 1Y3VA 4DURA 3GYMA 1NRPH 2AGIX 4I8JA 3MNCA 1P03A 1NU9A 1SPJA 2QA9E 1O36A 3A80A 3I78A 1J17T 3UOPA 1GHAG 2FI5E 4MTBA 1TBQH 1TGCA 3Q3YA 1V2VT 1O38A 1SGNE 1F0RA 4KTUA 2C8WB 5L2YH 2ZEBA 4QT8C 2VIVA 1V2KT 1KSNA 1OWIA 5K0HA 4NSVA 3QUMP 1HAVB 3RXAA 1S6FA 5FCRA 2WV4A 1BDAA 2XYAA 3HKJB 1HLTH 1C1NA 2G55A 4BAMB 1KY9A 4KTSA 9LPRA 1TBRH 1VCQA 4TYDA 5FPSA 1EP5A 2FXRA 4WXVA 1GVLA 1LPKB 5C67A 2SGFE 4X6OA 1H4WA 3L3TA 3KEEA 4B1TA 4UD9H 2C90B 3TIUA 1OXGA 3PLPA 2H2ZA 5EW1H 1FPHH 2OUAA 1K9OE 2D1JA 2FOHA 3LGIA 1G3DA 2BDCA 2UUYA 1W12U 4FUDA 1OP8A 4BANB 4MNWA 2F9UA 1ZMJA 1H1BA 3K6YA 1SGEE 3A8AA 2PLXA 1O2JA 1TX7A 1GBCA 4U32A 3NK8A 1O2SA 3UY9A 2BVSH 3BIUH 4NA9H 1E0FD 1PPCE 1DX5M 2BVRH 1S83A 2QAAA 1HAYB 3ZVDA 1O39A 3QDZB 1K1MA 4GVUA 4JZFH 2V3HH 2GP9B 1W3CA 1UCYE 1GMDF 1QJ7B 1GMHG 2CHAC 2PHBA 3CS7A 3LGWA 3GCNA 2CHAB 1LQEA 2HWLB 5CMXH 1BZXE 4U01A 1P02A 5L6NH 2STBE 4K60A 3RXLA 2AGGX 4AFQA 4GHQA 1BQYA 2ZFRH 5TJXA 1BUIA 3LH3A 2Y5GA 1SGFG 4JZ1A 4Q80A 1Y3WA 2BY6X 1O3JA 3F9EA 3HK6B 5FHTA 1FY1A 1P2MA 2OLGA 3HK3B 2AMPA 2FX4A 2VB0A 1EOJA 5GCHF 2R9PA 3QTOH 4BAHB 1YPLH 1K1PA 2CGAA 3P95A 4D9RA 5GWZA 2KAIA 1TA6A 2AH4X 1C5LH 3E0PB 2ZDLA 1KTSB 2UUJB 8KME2 4FUBA 4GCHF 3Q00A 1T8OA 3TVJB 1H9HE 5FCKA 5I46H 1O3MA 1HJAB 2VWMA 3UQVA 1IHSH 3SJIA 3UNSA 2P3TB 1O5AB 5AFZH 4GHTA 1CO7E 1ESBA 1W0ZU 1XVOA 3TNSA 1MCTA 3PTBA 3EAJA 1UTOA 4WXIA 4B2AA 1N1LA 1AZZA 2QN5T 2O8WA 4DOQA 2ZCLP 4MNVA 1A5IA 1QA0A 2Y82A 3A86A 2NU1E 3IWMA 1FDPA 1O2GH 5T6DA 3PB1E 3FVFB 2OBQA 1G30B 1IQNA 1FXYA 1F7ZA 3PMAB 2J2UA 1YCPK 3DA9B 4JMYA 3BTGE 1F0TA 1O34A 4E7RG 2BD5A 1LPZB 2PTCE 1BT7A 1QA7A 1C2LA 4K69A 3BEIB 3GDUA 1P2QA 1G2LA 1C5YB 3HATH 2CMYA 4I8LA 1UTPA 1RTLA 3ZYDA 2ZZUH 1GBDA 5C2ZA 3EDXB 2W7SA 1ESTA 3JZ1B 1TAWA 2WPLS 1WV7H 3RDZA 1RS0A 4CRAA 3MI4A 1P9SA 2ZPQA 8GCHG 1UVUH 4DJZB 3K65B 3GDSA 1P11E 2BHGA 3TH2H 2XNIA 1LQDB 1O3NA 4X2VA 3RC4A 1GJBB 1BRBE 2F9OA 2HRVA 1BA8B 1BJUA 1SB1H 2RDLA 2A4OA 3ZZ4A 1DFPA 2ZDVH 3K6ZA 2BTCE 2BYAX 2SGAA 2WUCA 1CGJE 4NZLA 1W11U 2AFQB 4UE7H 1ZSKA 1WU1A 1O3CA 4DW2U 3EYDA 1NY22 1A3EH 1C1VH 1CSOE 3N7OA 1OSSA 1XKBC 3RXKA 1DSTA 1IQEA 2VIOA 4SGAE 1HBTH 3GY4A 1A5HA 3O8DA 1GHVH 4YLUA 5C20A 1V2QT 1QRXA 4CRBA 1L0ZA 4RKJB 1O2UA 3DFJA 3T29A 1PPZA 4I8KA 1GJ6A 3RU4E 1MKWK 2VIDA 2NU2E 2ZG0H 3VGCC 3T26A 2BY8X 3VGCB 2BQWB 3F6UH 2QY0B 1A46H 4AFZA 1CVWH 1ZPCA 3MO6A 1NRRH 1XUFA 4LOYH 3TNTA 1LMWB 2PGQB 1GL0E 2PW8H 4AG1A 4D9QA 1SSXA 7GCHF 5CHAC 3V7TA 1HIAA 2V3OH 3MTYA 2A31A 5CHAB 3RXCA 3LGYA 3ATWA 1EJNA 4BTUB 1SQOA 1SG8B 1UTQA 1F0UA 1JXPA 1C4Y2 1AVGH 1BMLA 4JYTA 3AASA 2PSYA 2YNAA 3TJNA 2OQUA 1W10U 3GCTG 3UIRA 5A09A 1LHCH 2THFB 4GUXA 1JBUH 3ZVBA 1VCPA 1WYKA 2RCEA 4Z0KA 1AI8H 3QGNB 1K1NA 5AHGH 2H6MA 1BHXB 3S9AA 2H5DA 2JKHA 2A7CA 1GHZA 2ALVA 3A82A 1FN8A 2DE9A 2VGCC 5EQSA 4DVAU 3TLOA 2VGCB 1AKSA 4X1SU 3SU2A 1LTOA 4K1EA 3A89A 2Q6FA 1V2OT 4MPXA 2HALA 4AB9A 1TFXA 1ELFA 1GI9B 3KQEA 2Z3CA 3MHWU 1TE0A 3K2UA 3ZYEA 5E0HA 1QB6A 1GDNA 4FVBA 1J9CH 2NWNA 1V2MT 4ABHA 2IOTA 1FNIA 2BDAA 3U8OH 2C3SA 1TRYA 2G5VA 1UHBA 3SV6A 2BDGA 3SZNA 1V2UT 1Y5AT 2A4RA 4MPUA 1HUTH 1SGPE 2GGVB 2I6QA 4X8TH 1FIZA 1SHHB 1VGCC 2OXSA 3F68H 1VGCB 1MAYA 4AZ2B 2BZAA 3CENA 3F9HA 3SQHE 1C5TA 1QRZA 3TH4H 1EAIA 2ZDNA 4MG3A 1ZOMA 1C5NH 1TONA 3ITIA 1SBWA 1ZR0A 3QZQA 1QB9A 4ZHLU 5HGGA 2ZHEH 1KXFA 3M35A 1EXFA 2ZTZA 2GX4A 1D6RA 1IQHA 2BLVA 3STJA 2BD4A 1NFWA 3IG6B 1ETSH 2A32A 3M5MA 1PQAA 3O8CA 1QFKH 3TJOA 4IS5A 4ZMAH 1WTHD 1V2PT 4FXGH 3SBKA 4FU9A 4FUJA 2FI3E 1AZ8A 3RP2A 2P8OB 3BTQE 1UJ1A 4BAKB 1A3BH 1GDQA 4WJG2 1QJ6B 1FIWA 2ZHWH 3SV9A 5AF9H 1MAXA 3GYLB 2ZPRA 1YC0A 3RMMH 2ESTE 1O3OA 3S9CA 5EU8A 3RXDA 1NRSH 3ATMA 1A2CH 3PO1C 4YOGA 1Y59T 2FOEA 3Q76A 2YNBA 3PO1B 2H5CA 4AYVB 2ANKH 3SV2H 1NESE 3RXHA 3QTVH 4TY7A 3HPTB 1RGQA 1BMAA 2JH0D 1TRMA 2FYRA 5HXFA 2P16A 1IQKA 1QNJA 3RC6A 1GJ9B 2ODPA 2G00A 1V2LT 2PGBB 1QL7A 1EP6A 1YKTA 3EA9A 2O9QA 1A0JA 4A1VA 5EPNA 1XUGA 3LKWA 3ZZ7A 2ZDMA 3GOVB 1UTJA 4NWKA 1TMTH 2ANMH 1LCYA 3A85A 5FAHA 4AGKA 4GSOA 2BDBA 1O3IA 2JH6D 4OS4A 4Q7XA 1PPHE 3URDA 1WSSH 1V2NT 1ZTKA 3UNQA 1OOKB 1AE8H 4XSKU 1F5RA 1F92A 3MWIU 2A2QH 1FV9A 1P2OA 1QHRB 4MNXA 4D8NA 1GL1A 1DM4B 4I32A 1LPGB 3SV7A 3ZZCA 2ZFFH 4WY3A 4Y79A 3RM0H 3UFAA 2GCTC 2BD2A 3MU4A 1KDQB 4Y8YA 3M3VA 1O2OA 4IMZA 3V0XA 2Z9IA 3SNDA 4AORA 1W2KH 5B6OA 2W7UA 1FLEE 3BV9B 4KGAA 1DWDH 1FY5A 4TPYA 1N8OC 5CE1A 4A7IB 3TJUA 2A5IA 1ZYOA 1N8OB 1XMNB 2STAE 1LO6A 1GBIA 1BTPA 1T8MA 2XW9A 3GISB 1WTGH 1IQJA 3G01A 3RUOA 1W8BH 3VB3A 1FN6A 3ZZ6A 3FP8E 1BMNH 2GZ7A 2ZGCA 4XOJA 2CJIA 1FZZA 2VVVA 4JZEH 1GJ5H 1TPPA 2Z3DA 1TX6A 5T6FA 1QURH 4JK6A 4I31A 1OWJA 2Y80A 5EW2H 3TK9A 3WY8A 1C5WB 3LGVA 1Y3XA 2ILNA 1HIAB 4DG4A 2Y5FA 2O8TA 1UCYK 1MCVA 1BRCE 2QF0A 4ISHH 4X1PU 1Z7KA 1Z6EA 1NZQH 1P01A 2F9BH 1S82A 4RKOB 3ZV9A 2A1DB 1S6HA 1K28D 1SLVB 2FTLE 3MU8A 1TGNA 2XWAA 1JRTA 2VNTA 1MU6B 1IOEA 2ZDAH 2J95A 3NCLA 3RXOA 1NPMA 4YM9A 5J4SA 5F6MA 2TRMA 3RXRA 3RXEA 1TNGA 2GCHG 1UVSH 1P9UA 1L1JA 1O2WA 4AOQA 2P93A 3RU4D 4CBNA 1AKSB 3VB6A 1MBMA 4UEHH 5DP5A 1D4PB 2NU4E 1HDTH 2EI8A 1C1WH 4IMQA 1O3BA 2HNTE 1ARBA 1GG6B 2W3KA 1O2PA 3F9FA 3SJOA 1TOMH 1H8DH 1C5ZB 4H42U 4KKDA 1AE5A 1C2KA 4X8UH 1DDJA 1WCZA 1ZPBA 2FWWA 2AIPA 3VB7A 5FPYA 1GMHF 3U69H 3RXTA 1Z6JH 2Q6DA 5FX6A 4D7FA 2FODA 2PFEA 4Y7AA 3AW1A 1TWXB 2FOGA 1UTKA 1UHBB 1NN6A 2GDEH 3SU6A 2UWLA 3F9GA 5C1YA 1SR5C 4K3JA 1UK2A 4BXWA 1BOQA 1TQ0B 2FESH 4CR9A 1O3FA 1YCPM 1ZHRA 4UONA 5EOKA 4BOHA 1UCYH 1O3GA 4BNRA 1SMFE 1THPB 1O5BB 1L1NA 5JBCS 2H1UA 4WMFA 3RLYH 4DGJA 2VINA 1UVPA 3R0FA 4K1TA 2TPIZ 5ESBA 1FY8E 1EPTA 2VH6A 3MFJA 1S0QA 2OQ5A 5HM2A 4M7GA 3P70B 2BDYA 2B0FA 3PMJA 1E38B 6CHAC 4O3TA 4ABIA 6CHAB 4X6PA 2OC0A 4NFEA 5C5NA 3SGQE 2ZGBH 1W0YH 1BBRE 1SGTA 1EX3A 3D49H 4ABBA 5JBBS 3SNCA 1RTKA 4XBCA