1UTNA

Trypsin specificity as elucidated by lie calculations, x-ray structures and association constant measurements
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSINOGEN
publication title Trypsin Specificity as Elucidated by Lie Calculations, X-Ray Structures, and Association Constant Measurements
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utnA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utnA02
4ABIA 1PQ7A 2TIOA 4IMQA 1CT4E 1A46H 4MNWA 1SI5H 1HAVB 4B2AA 4LK4A 1HBTH 4MPWA 2VGCC 2R2WU 2AMQA 1SGQE 4NG9H 5DKMA 2H1UA 1QB9A 4GAWA 1AD8H 1S5SA 2G8TA 1X7AC 1Y5UT 1KXEA 4D7GA 4BNRA 1GMCG 2VWNA 6LPRA 1BTXA 4HI3A 4YZUA 1SB1H 2PUXB 4GCHG 5L2ZH 1A3EH 4XDEA 2EI8A 2ZU2A 5LPFA 1GJ9B 1KIGH 4NIWA 3HK3B 3S9BA 1G36A 2OUAA 2OC8A 3V13A 1ESBA 1ZMNA 5C3NA 1K28D 1XUHA 4TY7A 3UUZA 2BX3A 4MLFB 4FUDA 1SSXA 1TRNA 3TK6A 2QYIA 4HTCH 2W3IA 4FUCA 3KQDA 3LGTA 3MYWA 1O2XA 1EOJA 1FIWA 3HGNA 3BTGE 2VIPA 2GCTC 1UVSH 3EA8A 2CHAB 4QT8C 1W14U 2A4QA 4O3UA 4A1VA 1JRTA 1AUJA 1F0RA 1GJ6A 4CR5A 1ZPCA 3QUMP 1E34B 1K1OA 3K9XB 3UNSA 3P92A 2O8TA 1P2QA 1OPHB 1TMTH 3VXFH 1BQYA 2XWAA 2OBOA 3TJVA 3RM2H 3BIVH 1BITA 2P8OB 2ZFSA 8LPRA 3AAVA 3VFEA 1TX8A 2ZWLH 1SGFG 1TOMH 1DY8A 4X2WA 3S0NA 5FHTA 2AH4X 2D8WA 3TLOA 3A7VA 2GKVE 1AN1E 3ATMA 3F68H 2GV7A 4FU7A 1G30B 4WMEA 3E6PH 5EOKA 1ANEA 1MKWK 1IQNA 6CHAC 2ZDVH 2G81E 1QJ6B 1QQUA 1S82A 3DFJA 2FOEA 3M3TA 2KAIB 1GI3A 1GMDF 4X0WU 2FS8A 1EB1H 2WPKS 1GG6C 4NFFA 2P94A 4ISIH 1HNEE 3T5FH 1P10A 1ACBE 2BZ6H 3TH4H 1BHXB 1AUTC 3FAOA 3SUGA 2A1DB 2BD5A 1NRPH 3UOUA 1TNHA 1UVOA 3QWCH 4IS5A 1T4VH 1LVBA 2PKAA 1RXPA 1SLUB 3LJOA 4Y79A 3TGKE 1CHGA 3VXEH 2QXHA 4SGBE 1MKXH 1YPLH 4OS1A 1FNIA 1TPPA 1QQ4A 1HAOH 3PMJA 1VCPA 3DFLA 2XCNA 2JKHA 2WPIS 3UY9A 2JH6D 1EZQA 3SUDA 4TWWA 4ABHA 2ANWA 1FONA 2AGEX 2F9NA 1EZSC 1AY6H 2EA3A 3UOPA 4OGXA 4YESB 1F92A 1V2KT 3LGYA 3SO3A 2FOGA 3DA9B 8ESTE 1K9OE 5PTPA 1DWCH 2ODYB 1UVTH 1O2UA 2BY9X 3E90B 4CHAC 2FIRH 1DLEA 1GBFA 3EAJA 1FLEE 3T2NA 1QR3E 1SGFA 4NSVA 5SGAE 1Y3VA 2R3YA 2BY5X 1B0EA 5IYTA 4CBNA 1JMOH 2BM2A 1C2GA 2P16A 3LT3A 4JK5A 3RLYH 3URDA 2BDAA 4OS4A 1DE7H 1TNJA 1SQTA 2DE8A 2H9HA 3G01A 1NPMA 1VCWA 4M7GA 1C5XB 2SGEE 1Y3YA 1S0QA 6GCHF 1K1IA 1WUNH 1SQOA 1CT0E 1SOTA 3ODFA 3BEUA 4TY6A 1UCYE 4YOJA 2O8LA 1TALA 3TK9A 4DVAU 1P2JA 3LC5A 3PO1C 4E7NA 2XWBI 4CRAA 2OD3B 4ABDA 1CA8B 4A92A 2AGIX 2OCVB 3RXCA 1YPJH 4CH8B 1E36B 3Q3YA 2FO9A 1UK2A 1AFQC 1P9SA 2SNWA 4PROA 3RU4T 1NT1A 5HM9A 5ESBA 1ELFA 2VU8E 5A09A 3SGAE 4O97A 2JETB 2A7JA 3U1JB 3MWIU 2ZZUH 1QIXB 1ESAA 2OQ5A 1M9UA 1BTPA 4D9RA 3K2UA 1O3NA 2ZDKA 1FXYA 1A0HB 3SNAA 1TMBH 3DD2H 1DXPA 1TONA 3D49H 1C5QA 1J14A 1GHWH 1DXWA 2UWLA 3MMGA 4NA8A 4NZLA 1UTQA 1AFEH 1QRWA 1E37B 1N8OC 1P2IA 1AKSB 1OS8A 1ZHPA 2ZHWH 2FDAA 2GCHF 4A1XA 3SV2H 6ESTA 1RJXB 2VVCA 1GBKA 4R0IA 3SV7A 1P2KA 4YT6H 1A0JA 3QGNB 2WINI 1BBRH 1HAZB 4B1TA 3VPKA 1C2EA 1P8VC 3U9AH 5I46H 2VH6A 3LU9B 1V2MT 1PPGE 2P3UB 2QXGA 2EEKA 4XSKU 2PKSC 3BEFB 3KF2A 4GUXA 1L1GA 2BVSH 2ZKSA 2XBWA 1YCPH 3M7UA 1ZGVA 5EW2H 3RXDA 1HJAC 1O0DH 1TB6H 2O9QA 4ZKRU 2ANYA 1UHBA 2FI3E 2HALA 3H7OA 1BZXE 5GDSH 4DY7B 2O8WA 1W7XH 2ZI2H 1LQEA 3MU5A 3RMLH 1SGEE 2WUBA 1GJ4H 1DWBH 4ISOA 4MPVA 2YNAA 3L3TA 1DUAA 3PV4A 1VITF 4Q2KA 3RXVA 1LPGB 1ZJKA 2A32A 3T25A 2FYRA 1EATA 2BVRH 4WMFA 1C1SA 3OY5U 1SLVB 1IQFA 2GT7A 1PYTC 3MU8A 1DX5M 4ABJA 4NWLA 4IC5A 2UWPA 1FMGA 3UWIA 1MAXA 4Y8ZA 1V2NT 3SI4H 1W0ZU 3MU0A 1V2UT 2FOFA 4HFPB 1UJ1A 3I77A 2BDGA 1KXDA 1AVWA 2R9PA 4NGAH 1O5DH 2F3CE 2H6MA 3ZZ5A 1MTVA 2ZDAH 2QN5T 1HRTH 3MH4A 4Y71A 1BCUH 1HLTH 3NKKA 5ETXA 1NRNH 5T3HA 1ANBA 3ZYEA 1H9LB 1HGTH 2QY0B 4AFUA 2WYJA 2ZA5A 3BIUH 4B74A 1AB9B 3MH5A 1DSUA 3V0XA 3RXEA 2AYWA 3KN2A 1SG8B 1TRYA 4YO9A 3MH6A 1O2MA 1MQ6A 1XKAC 3VB7A 1K1JA 2A7HA 1C2LA 5FPTA 1C5WB 3SI3H 1C4V2 4IGDA 4KP0A 3RXAA 1EPTC 1OWHA 2C8WB 2GV6A 1VGCB 3GCTG 4FUFA 1IOEA 2GMTB 4BAMB 2ODQA 3GY8A 1G2MA 1XXFA 2XC0A 3E0NB 1Q31A 1ELTA 2GZ7A 2SGQE 1KXFA 2ZDLA 3SNEA 1NM6A 2GTBA 3SV8A 1E38B 3E0PB 1C5UA 2XBVA 5GCHF 2BLQA 4Y11E 2BOKA 3ZVDA 1ARBA 3KQBA 3A88A 2ZTXA 7GCHF 5C67A 3PWBA 3P17H 1PPFE 5DP3A 4CRCA 3PROA 1HAIH 3RXOA 4K60A 1GJ7B 1C1WH 4U2WA 2TBSA 1O32A 1HB0B 3AASA 1A4WH 1SVPA 3TITA 1C2HA 2RG3A 5C5OA 3RXRA 3UQOA 1BTHH 1NU7B 2I6QA 3ZVBA 5EGMA 3RXKA 1ELBA 3A82A 1AU8A 2HOBA 3N7OA 5DP8A 4HZHA 1T8MA 4X6NA 2ZHQH 1V2WT 2G4UA 2PR3A 1HJ8A 2WPHS 5JBAS 3GCNA 1QRXA 1O3EA 3ELAH 4KTUA 3MFJA 1ZRKA 4E7RG 3SW2B 1O31A 4DIHH 1FN8A 4RKOB 1P9UA 3FZZA 3LKWA 1D9IA 1ANCA 1D4PB 2F9UA 2VVVA 1J8AA 1TNGA 4MNVA 2CV3A 4AX9H 1ZPZA 2Q6DA 1O5GH 1PPZA 3KQEA 1C1PA 5EPNA 2GT8A 3A7TA 4U30A 2Y5GA 4WXVA 1LCYA 2ZFPH 4FVDA 1BMNH 1TBRH 1VZQH 1Z1IA 1C1VH 3PLPA 3PLBA 1WTGH 1NY22 1TGCA 5LGOA 3RXIA 1L1JA 2UWOA 2BYAX 2QA9E 5FCKA 3Q00A 3ZV9A 1E0FD 1TRMA 2JH0D 1DPOA 2GDEH 4TPIZ 4ZAEA 3VB6A 2FYQA 1HIAB 1YBWA 1QBNA 2Z94A 1VCQA 1YF4A 3M5NA 3QO6A 3EYDA 3LOXA 2NU1E 3BTFE 1SHHB 5AVDA 3AW0A 3F6UH 4ABGA 1KLJH 1ZMLA 3LH3A 3M5LA 1H8DH 2AIQA 4ZHAA 2BZAA 1ZZZA 2Z3EA 1TQ7B 2WPMS 3GCHB 1G3CA 4WJG2 1XVOA 1GMDG 1DFPA 1B7XB 1TLDA 5GPIB 2EC9H 1WQSA 3QGJA 1A2CH 2QV1A 1MCTA 3ZZ4A 2HPQH 3ZZ7A 1T31A 1MTNB 4X1SU 3PB1E 3SUEA 3RXQA 2UUFB 1CT2E 1W13U 1MAYA 2W3KA 2FOMB 1ORFA 1GPZA 1EAWA 4AZ2B 2GZ8A 1MCVA 3SU4A 1O3KA 1UTLM 3DT0H 3SHAH 1C4U2 2HRVA 3A80A 1GL1A 2SNVA 1UCYH 1N6YA 3BG8A 4YM9A 1PJPA 3PLKA 4YLUA 2VWOA 4Q7YA 2F83A 3NXPA 2XBXA 2AFQB 2CF8H 1NTPA 5DGJA 4DCDA 1GJAB 2BLVA 4ISLA 1P0SH 1EAIA 2VH0A 3MNXA 2A4OA 5GXPA 2OTVA 3UR6A 5A8ZA 5A0AE 2A4GA 1O3GA 3KEEA 4X2XA 3LONA 3RC6A 1NRQH 3BF6H 1BB0B 1O34A 4YOIA 4B73A 2Z3CA 4Q80A 1KXAA 8GCHF 5DP9A 1C5RA 2A0QB 1LPZB 2A5KA 2UUJB 3ITIA 3LDXH 1O2LA 2XW9A 2XNIA 1XUKA 3MU4A 3PTBA 4FU8A 2Y7ZA 1ID5H 3E16B 3BTHE 4GVUA 3RMMH 3RXJA 4BAKB 4KGAA 3HKJB 1SR5C 3SU1A 3W95A 3U8OH 3EQ0H 4X6MA 1FPCH 1GMHF 2G5NA 1TOCB 3UFAA 4WXIA 1ABIH 1GHXH 2FODA 3HK6B 2H2ZA 4INKA 3S69A 1ZHRA 1RIWC 3SQHE 1Y3WA 3GY4A 1TYNA 4RN6A 1A5GH 1OWEA 4FUIA 1TNLA 5EXNA 6GCHG 1WV7H 1GI1A 3RMNH 1L1NA 1TGSZ 2XBYA 1SQAA 2LNCA 4JMYA 3ZZ8A 2ZGHA 3F9FA 5F8XA 1GJ8B 4XOJA 1WQVH 3JZ1B 4K8BA 1LHGH 3L33A 3SNDA 2ZF0H 1GVKB 1INCA 2ZFQH 1GHVH 3MO3A 1V2OT 1W2KH 3R0FA 2O8MA 3OY6U 1G2LA 1BDAA 2RA0A 1SGCA 5JYIA 3S9AA 3MOCA 1JBUH 2ZU5A 1QJ7B 1H1BA 1P05A 2W7UA 1C9PA 3ZVCA 1G3BA 1C5OH 1GHYH 2GD4B 2ZEBA 4AB8A 3AAUA 1P04A 3A87A 4I31A 5E0JA 4IW4E 1D3DB 1EPTA 3GYLB 1UTOA 1BMMH 1NFUA 2G51A 1GHBG 1RTFB 1O30A 2A5IA 3M7TA 3C1KA 3MNBA 4Y6DA 2ZO3H 1F0SA 1V2TT 2QF0A 2GCHG 2R2MB 3RXLA 2AERH 4OS6A 1LPKB 3ATKA 2HLCA 4JZDH 3PTNA 4LZ4B 1O3IA 2WPJS 4UFDH 3C27B 3RXMA 1FPHH 2XC4A 3EA7A 1DWEH 2Y6TA 4UFGH 4J1YA 2BHGA 1YGCH 1MKWH 3ZZ3A 1KDQB 1S83A 3UREA 1F7ZA 1MTSA 5EQSA 2ULLA 5GJ4B 1DICA 3SGQE 3GDUA 5EPYA 3OYPA 4DGJA 3K65B 2CHAC 1QFKH 1TGNA 3PWCA 4FUJA 3ZV8A 2Q6GA 4XBDA 1HXFH 4AFQA 2C93B 2BDHA 3KNXA 3RU4E 1ZRBA 4K5ZA 1AE8H 1UK3A 1SLXB 2ZU1A 2P8OC 2THFB 1IQIA 4ZUHA 2ZPQA 2ZC9H 1IQEA 2VINA 2ZHDA 4KKDA 3ZZ6A 3M7QA 3LJJA 1DY9A 5DP7A 3OSYA 2A4RA 9LPRA 5CMXH 3M3VA 1TNIA 1O38A 3BG4B 1LVYA 1GHAF 1HJ9A 1WSSH 4WVPE 4FU9A 5EXMA 1IAUA 3KGPA 2ZG0H 1NZQH 4HGCA 4X8TH 1Z8IB 2J9NA 3UNRA 4B75A 2K1QA 3PMHB 1K1MA 3ZZ9A 3SQEE 1W3CA 2F9VA 2FPZA 4ZKSU 1U6QA 2C3SA 4Y0ZE 1KXBA 2BDCA 2BY7X 3I78A 2V3HH 2BD9A 4O9VA 1JIRA 3RM0H 3RXFA 4KTCA 3UTUH 1C2FA 4K2YA 2IN2A 3EE0B 1A1RA 1BRAA 1EAUA 1ZSJA 5JDUB 2QC2A 1Z8RA 3A8CA 4XBBA 4MTBA 2TGPZ 2YOLA 1ELCA 2GGVB 1THPB 4K69A 1FI8A 4CR9A 3TPIZ 2H9TH 3P8OA 2LPRA 2OQUA 1O3HA 5C1XA 1O2HA 1WOFA 1TX6A 4VGCB 5HXFA 1S6HA 4A7IB 1VJAU 3VGCB 1FAXA 2IJOB 2BMGB 2FP7B 1HPGA 4ISHH 2B5TB 1QNJA 4H4FA 3GOVB 1SOZA 1ESTA 9ESTA 1A5IA 4WH6A 1GI2A 3NZIA 1GI9B 1OYTH 3BTEE 2Y81A 3S7KB 3D23A 5FBIA 1MZAA 2RCEA 2NU4E 5FBEA 1GBDA 1CA0B 1Q3XA 1CU1A 1FN6A 3FP6E 5C5NA 4GHTA 5TCCA 5GCHG 2TGDA 1EJMA 1TWXB 2BD3A 5HYOA 5F03A 2PSYA 1OWKA 1O2TA 5ESTE 2ZP0H 1GBBA 1AWFH 3E8LA 7GCHG 3BTQE 1BIOA 3Q76A 5J4QA 1QL7A 1BBRK 4X1QU 1Y5BT 1ELGA 2VIVA 5DK1A 1C2MA 4BTTB 1OP0A 3M3SA 5DO4H 3RLWH 3P8NA 2GDDA 4Y10E 5DPAA 3TNTA 3P8FA 1C1MA 3SU0A 3K6ZA 4BTIB 1IHSH 4NA9H 5DP6A 1AE5A 3MO6A 1ZTLA 2ANKH 1CGJE 5LPEA 5C2ZA 1MU8B 1Z6EA 1FV9A 1VJ9U 3U8TH 1V2JT 4UE7H 3LH1A 1P03A 1G3DA 1NESE 3SNCA 3ZZDA 4Y7AA 3IG6B 4O3TA 4UD9H 1H9IE 3GISB 1DOJA 2H5DA 1C1UH 2VIQA 2JETC 2XXLA 2G00A 1S84A 4BOHA 1C5MD 1QRZA 1CQQA 4ABBA 4DOQA 4ZKNU 2FWWA 1VITH 1C2IA 5F6MA 1BMAA 1YCPM 1DT2A 1EX3A 4WMDA 1PQ8A 2PSXA 4GHQA 1T32A 1GJDB 3BTTE 3A84A 5EG4A 1TBQH 2ZPSA 1MQ5A 2HNTF 1YYY1 2OBQA 4A1TA 2ZCKP 3O8RA 3SN8A 2STAE 3LGIA 1O2SA 1W0YH 1NC6A 1GI7B 2TGAA 5DP5A 1TX7A 2XTTB 3IITA 1JXPA 2B8OH 1IQMA 5JBCS 5EQRA 1T8OA 1GJCB 2G52A 1QJ1B 1UK4A 2Z9KA 4F49A 4AYVB 1J16A 2ZQ1A 2PTNA 2FI5E 2J92A 3RXUA 4F4OC 2CJIA 3A8BA 4X6PA 3RXHA 3A85A 1HAVA 1UVPA 1PQ5A 5DG6A 3V3MA 2BB4A 3A7YA 2OINA 1SGYE 3K6YA 1AI8H 4OS7A 1XUFA 2PV9B 3O8BA 1F0UA 3B8JA 3M5OA 1Z71A 5E2OA 1GCTB 1O35A 2ALPA 4X1PU 1ZHMA 1NROH 1MUEB 3EDXB 4JCNA 1C5YB 3FVFB 4BXSA 2ALVA 4CRBA 5A0BA 1SGTA 1EP5A 3CENA 1C5LH 2FOHA 4FVBA 2HPPH 1XUJA 1YPMH 4FUHA 3KQCA 3HKIB 3RC5A 4Z6AH 2BLWA 2SGDE 2C8YB 4H6SB 2RDLA 5FAHA 5FX6A 3F9HA 1OYQA 4B2CA 1G9IE 2OC1A 1S6FA 1V2PT 1Y3UA 1OOKB 1T4UH 1XMNB 3P70B 2XC5A 2BTCE 4INHA 2C90B 1DM4B 2AS9A 3ATLA 3M37A 3M5MA 1NO9H 3TIUA 4MNXA 2Z7FE 4WWYA 2A45B 2F9BH 1P2MA 1EXFA 1ETSH 3KIDU 1NN6A 3H7TA 2OC0A 4ABEA 1TNKA 2C4FH 2VIOA 4BAQB 4ZKOU 3ATWA 1RS0A 1O3LA 2ZFFH 2V0BA 5EQQA 3TH3H 8GCHG 3LC3A 1G3EA 1F0TA 4WH8A 2ODPA 1TAWA 1O3DA 1TGBA 3QZQA 3MHWU 3SJOA 1AB9C 1ZGIA 2WV4A 2O8UA 1RRKA 2BVXH 4NWKA 1DITH 1LHEH 2F9OA 1V2VT 1YPHE 3SOSA 3TU7H 1GWAA 1KXCA 5CE1A 1SBWA 3A7WA 1SLWB 2EI6A 1QY6A 1J9CH 5BPEA 2KAIA 3ZZCA 3PM3A 1GMHG 1O3CA 1Y3XA 1P3CA 1P09A 5J4SA 1VGCC 3KL6A 4WF8A 1TPOA 1GI6A 3ATIA 4ZXXH 1WU1A 3FP7E 2GMTC 5E8EH 1BMLA 2AMDA 2PTCE 3L6PA 4Y76A 2ESTE 4D8NA 1EJNA 1C1QA 1C5PA 3RP2A 1V6DA 2ZHEH 2ZGCA 2J38A 4JYTA 2PWXA 1UTPA 5EODA 1ZMJA 1O2IA 1O2QA 5HM2A 3TVJB 2FX4A 2A5AA 2H9EH 3BSQA 5L2YH 2RA3A 2G4TA 1HFDA 3V12A 4MPUA 4JZ1A 4O03A 2EI7A 3AW1A 4R8TB 3VEQB 2ZDNA 2J2UA 2IOTA 3F9GA 1VR1H 3Q77A 4XBCA 4AGJA 3SNBA 3A81A 1C9TA 3MH7A 4I8JA 1QB1A 3EGKH 1ELAA 4K3JA 1ETRH 1GDQA 2PLXA 1OSSA 2TRMA 4KELA 3RUOA 1L0ZA 1HAHH 2ZCLP 4X2YA 1K1PA 2D26C 1OP8A 4X8UH 1ZSLA 3T27A 2ZGXH 3DUXH 4I8KA 4CREA 3LGUA 5E0GA 3RXSA 1QBVH 1BRUP 1GGDB 3UR9A 4RKJB 3SU3A 2VVUA 3FFGA 1L2EA 4I8LA 2SFAA 3KHVA 4BAHB 1FIZA 4AFZA 4MQAA 4ZHLU 1C1RA 1BT7A 2VGCB 1PYTD 1IHTH 2Y5HA 1K2I1 1MTWA 5K0HA 1ABJH 1GDNA 1C2KA 1SMFE 2FI4E 1ELDE 3M35A 1C5NH 5AF9H 3O8CA 3O8DA 4MVNA 2Z3DA 1ELEE 1A0LA 4B2BA 2CGAA 1HDTH 1RTLA 5HGGA 1UCYK 4NSYA 4LXBH 4UFFH 1EZUC 1YLDA 1ZYOA 4NCYA 3SORA 1EQ9A 2R0KA 1O2NA 4ZHMU 2P3FH 1FY4A 2ZGBH 1OKXA 1XM1A 2HNTE 2XYAA 3SJKA 1RTKA 2GCTB 1KY9A 2HNTC 1GBTA 1W11U 4OS2A 4ASHA 1UVUH 1DVAH 1T8NA 2ZNKH 4YOGA 2PHBA 1JOUB 2FMJA 1GHAG 3DHKH 4Y8YA 1MZDA 1P2NA 2ZTZA 5C20A 2VWLA 1S85A 3A7ZA 4JK6A 2B7DH 3NWUA 2FEQH 3GCHC 2W7SA 1UTMA 2YNBA 1UTJA 4JZFH 1BJVA 2Y7XA 1ZLRA 2J95A 5EXLA 3U1IB 1BUIA 3BTKE 2Q1JA 1AKSA 1MTNC 4THNH 1WBGB 4CRGA 1YPEH 2Z9LA 1W12U 3S9CA 2J34A 3QTVH 1O2JA 4TWYA 1RGQA 1O3BA 3T28A 6CHAB 1FY5A 1GDUA 3SGBE 3NK8A 4MNYA 4KTSA 1TBZH 2WYGA 1QGFA 4UONA 1O5EH 2FTLE 3R3GB 3A8DA 3CS0A 1GG6B 5F8ZA 1CE5A 3E3TA 3P8GA 1F2SE 1YLCA 4BTUB 2M5TA 2XCFA 1Y8TA 4NA7A 4UDWH 4ABFA 4I8HA 3IWMA 1GJBB 1QA0A 1FDPA 3QDZB 1SGRE 1KTSB 3RXBA 1DLKB 2ZPRA 1YC0A 2TGTA 2Z9IA 4U32A 5C1UA 5JBBS 3STJA 1SFIA 2FLRH 4AB9A 1BJUA 2CXVA 2P3TB 2SGFE 1CVWH 5BRRE 4LOYH 4J2YB 1MTUA 1QTFA 2J94A 2R3UA 1HUTH 1CHOF 1ZSKA 2ZTYA 2OC7A 1ZJDA 1WTHD 5E0HA 2NWNA 3ZVGA 4AGKA 1O2WA 3MNSA 1Z6JH 3ZZAA 3UQVA 3SBKA 4K1EA 4D7FA 2G55A 2STBE 4Q7ZA 5FX5A 1K1NA 1RFNA 2WPLS 1ELVA 5EU8A 1MD7A 2QIQA 3D65E 1P06A 4CHAB 3U69H 4H42U 1HAXB 1THSH 2Z9GA 4I32A 1D3QB 3RMOH 1GVZA 3SHCH 3GICB 1T7CA 3TK5A 1THRH 4Q7XA 1DSTA 1V2ST 2Z9JA 2Y5FA 1KYNA 4NIXA 1AIXH 5L6NH 4I33A 5L30H 1A3BH 1JWTA 1MKXK 2BDYA 1P57B 2VJ1A 2ILNA 2PFEA 4MPXA 1LQDB 1P01A 4IN1A 1KTTB 3GDSA 4D76A 3NCLA 1UO6A 2VB0A 1EAXA 3TJUA 1D3PB 2C8ZB 5CHAB 3GCOA 4A6LA 2SGPE 5GWZA 2CF9H 4NFEA 4FXGH 1V2RT 3TNSA 1TPSA 3STIA 2NU2E 2FESH 1GI8B 1SL3A 1O5AB 1EZXC 1NFYA 1VITG 1G32B 3GY3A 5IDKA 3PO1B 1EASA 3OU0A 1PFXC 1Z8JB 1E35B 1GHZA 4B71A 3SU2A 4FUEA 5TJXA 1AFQB 2BQWB 3OTJE 1YPGH 3ZYDA 1IQHA 2V35A 3A83A 1NRSH 3A86A 4OS5A 1LHFH 5TCAA 4AFSA 4X8SH 1N1LA 2ZFTA 3CP7A 3GY5A 1A61H 2JH5D 2WV5A 2B0FA 1W8BH 4FUGA 1MBQA 1DS2E 3GY6A 2D1JA 1O2RA 4WY3A 2A31A 3KCGH 1MU6B 1XXDA 1YM0A 1KSNA 1TPAE 1EKBB 1GMCF 2A2XH 1N8OB 3A89A 3BV9B 4DURA 1D3TB 1YPKH 4GCHF 1SGPE 2CN0H 2XRCA 4OGYA 3UIRA 4X2VA 3GYMA 2BD2A 3JZ2B 1AVGH 1AMHA 3UWJH 5AFYH 5K7RA 4DT7B 7KMEH 5LPRA 5G4BA 1HAYB 1BRCE 1GBCA 1O2GH 3UPEA 1SFQB 4DW2U 1WCZA 4INLA 4NIVA 5GIBA 3QN7A 2OLGA 4IMZA 1DUEA 2P95A 3LGVA 1O39A 4X1NU 1CO7E 4NIYA 1ZTJA 1B0FA 2PKSB 5CHAC 3VB5A 4K8YA 2G5VA 4D9QA 4DIIH 3CS7A 5T6DA 3BG4C 1C1TA 4H6TA 5A2MH 2HWLB 1HJAB 2P93A 1ZOMA 3PMBB 1TGTA 4K1SA 2J4IA 1W7GH 3GY7A 4CH2B 1XKBC 3LPRA 4BAOB 1GCDA 2OXSA 1IQJA 2QXJA 1NRRH 5H4IB 5DJ7A 1XUIA 3UNQA 3ENSB 1A7SA 4AYYB 5EW1H 1CGHA 4Y7BA 2UUYA 1YKTA 4I8GA 3TJOA 3T29A 5F8TA 1ANDA 1GI0A 1BA8B 4MDSA 3GDVA 5JB9S 3SJ8A 2BDBA 4AN7A 5FPSA 1GHBF 2FOCA 2ZU3A 3MO9A 2C8XB 1O3OA 8KME2 1D6RA 4NZQA 1ARCA 2SGAA 1HIAA 2DE9A 4TYDA 1UMAH 1P12E 1C2JA 2QCYA 1Y59T 4JZIA 3BTME 1YCPK 4ZH8A 2FXRA 1O5CB 3AVZA 3SUFA 1LKBA 3SU6A 4VGCC 2V6NA 3VGCC 1FUJA 3TGIE 1Z7KA 1BOQA 1HYLA 1QBOA 1QHRB 2QAAA 1T8LA 4CBOA 4GLYA 1C4Y2 1OWIA 3QK1A 1QL9A 1MD8A 1P02A 5B6OA 1BTUA 1PPCE 1V3XA 1XVMA 1Y5AT 2DUCA 3BTWE 4X1RU 1FZZA 1S0RA 1BRBE 1V2LT 1HXEH 1XUGA 1DANH 4SGAE 2BDIA 5A8XA 1CA0C 3TH2H 1NFXA 1O3PB 1TQ0B 4ISNA 2BXUH 2BX4A 2VWMA 3FP8E 3HATH 1GI4A 1QURH 2ZFRH 3D62A 1Q2WA 1TA2A 1GBIA 1EB2A 1MMJN 2VIDA 4ESTE 1AGJA 4JZEH 3I29A 4Y8XA 1P3EA 1EPTB 3MNCA 3LGWA 4Z0KA 1SGDE 2NU3E 1KLTA 3QLPH 3Q3XA 2AEIH 3ODDA 2P59A 5I25A 1FY1A 1AWHB 1G37A 5E2PA 1SGNE 1YP9A 2ZHFH 1TFXA 1HV7A 1OXGA 3RU4D 2Y80A 1O5FH 3VB4A 4X6OA 1CGIE 1L4DA 2PGBB 1LVMA 4YT7H 5JBTA 3S7HB 4I7YH 4XFQA 1GBJA 1BTYA 1DWDH 4AG1A 2FOAA 3V7TA 2HGTH 3QZRA 1F5RA 3PYHA 1GI5A 4CRFA 1UTNA 1GBHA 1TA6A 3ZVFA 1GJ5H 2BXTH 2PKAB 1EUFA 1PPHE 2ANMH 3BEIB 4JYVH 2VNTA 3M36A 3RXPA 3F1SB 3ZVEA 4LZ1H 1EOLA 2V3OH 3FZDA 1OWDA 1K1LA 1LKAA 3U98H 1O2PA 2BD8A 2ZDMA 4YTAA 3RXGA 2WUCA 3TJNA 2HVXA 1UTKA 2CMYA 3PMAB 3SJ9A 2BD4A 1J17T 1AZ8A 1IQLA 2FZZA 1A5HA 2ZGJA 3B9FH 3QX5H 1NU9A 1F5LA 2BQ6B 1J15A 2OP9A 1CBWB 1CSOE 4BANB 4UEHH 4IC6A 3MTYA 4AORA 3A8AA 1P11E 1FJSA 1O33A 3FANA 3QTOH 3WY8A 1C5VA 4MG3A 3SJIA 1O2YA 2GP9B 1O3MA 1QB6A 3VB3A 3MU1A 1F5KU 4AG2A 3SV6A 2ZQ2A 2PUQH 1EJAA 1AHTH 2BLOA 2AGGX 1ZTKA 4E05H 1O5BB 1TABE 2AIPA 1N6XA 2GZ9A 3BN9A 1K21H 1SPJA 5JB8S 4A5TS 1O36A 1W10U 7ESTE 1Z8GA 1C2DA 4IN2A 1C1OA 2IPHA 1GVLA 4ABAA 2FOBA 2Z6BD 1QCPA 1V2QT 2R0LA 2GX4A 1GCTC 1LTOA 2Y82A 1YPHC 2ZECA 2FM2A 1AO5A 1C5TA 2AMPA 5A0CA 4CRDA 1BTWA 4BXWA 1L4ZA 4E06H 3MI4A 3Q3KA 3B23B 2GVFA 2BOHB 1WAYB 2BD7A 3T26A 1O37A 2QF3A 1BTZA 1HAPH 3EA9A 2ZIQH 1O2KA 1KDQA 3P95A 1SHYA 5AFZH 4X8VH 4U01A 5JPMH 2A7CA 4DJZB 5T6GA 1D6WA 1SGIB 1CBWC 1K22H 1LHDH 3SV9A 1JIMA 2FS9A 1QA7A 1PPBH 3HPTB 1LHCH 2F91A 2W26A 1O2ZA 2QGRA 1TIOA 1LO6A 3P6ZB 4B76A 3RC4A 1C1NA 3SU5A 1PPEE 3NPSA 5C1YA 2Q6FA 1PQAA 2NU0E 3TGJE 3E1XB 2FTMA 4ZROA 1ETTH 2ZU4A 1IQGA 3A7XA 3BTDE 3SZNA 2FLBH 1SC8U 1JRSA 1CHOG 3HGPA 1FY8E 1O3JA 2BY6X 4ZXYH 5HMAA 1OWJA 4DG4A 1BBRE 2H5CA 1FY3A 5LH8A 5FCRA 1GBEA 4RSPA 1MBMA 1FAKH 5T6FA 3W94A 4IBLH 1Z1JA 1GL0E 2A2QH 4ZMAH 1ZR0A 3ESTA 2B9LA 1DDJA 3M61U 3LIWA 2W5EA 4JYUH 2BY8X 1OP2A 3T62A 1TMUH 1GBLA 1UHBB 4XE4A 3ZZBA 7LPRA 1XX9A 5A8YA 1MH0A 2I6SA 1KLIH 1NFWA 3RDZA 4UFEH 5AHGH 1HAGE 1BHXF 1LMWB 3RXTA 2ZCHP 1H8IH 1H9HE 1HCGA 1O2OA 1IQKA 2FX6A 4YLQH 3URCA 2VIWA 1C5SA 3ZVAA 1TE0A 1P2OA 1GBMA 1GBAA 1S81A 3H5CB 3GCTF 1O3AA 4TPYA 1AQ7A 1FQ3A 5DP4A 1RIWB 2QXIA 3NUMA 4GSOA 1LVOA 2PGQB 4AOQA 3U8RH 1NS3A 1O2VA 2PW8H 5FXLA 1ZPBA 1WYKA 5ABWA 1LDTT 1QL8A 1O3FA 4K1TA 1C5ZB 3E91A 5FPYA 1H4WA 3GY2A 4GPGA 4FUBA 2BQ7B 3OX7U 1B5GH 2ASUB 3F9EA 1OX1A 1AZZA 1AVXA 1EP6A 1GGDC 2D2DA 1RD3B 2F9PA 2UUKB 2TPIZ 4Y0YE
chains in the Genus database with same CATH superfamily
4ABIA 1WXRA 1PQ7A 2TIOA 4IMQA 1CT4E 1A46H 4MNWA 1SI5H 1HAVB 4B2AA 4LK4A 1HBTH 4MPWA 2VGCC 2R2WU 2AMQA 1SGQE 4NG9H 5DKMA 2H1UA 1QB9A 4GAWA 1AD8H 1S5SA 2G8TA 1X7AC 1Y5UT 1KXEA 4D7GA 4BNRA 1GMCG 2VWNA 6LPRA 1BTXA 4HI3A 4YZUA 1SB1H 2PUXB 4GCHG 5L2ZH 1A3EH 4XDEA 2EI8A 2ZU2A 5LPFA 1GJ9B 1KIGH 3OAAD 4NIWA 3HK3B 3S9BA 1G36A 2OUAA 2OC8A 3V13A 1ESBA 1ZMNA 5C3NA 1K28D 1XUHA 4TY7A 3UUZA 2BX3A 4Q63A 4MLFB 4FUDA 1SSXA 1TRNA 3TK6A 2QYIA 4HTCH 2W3IA 4FUCA 3KQDA 3LGTA 3MYWA 1O2XA 1EOJA 1FIWA 3HGNA 3BTGE 2VIPA 2GCTC 1UVSH 3EA8A 2CHAB 4QT8C 1W14U 2A4QA 4O3UA 4A1VA 1JRTA 1AUJA 1F0RA 1GJ6A 4CR5A 1ZPCA 3QUMP 1E34B 1K1OA 3K9XB 3UNSA 3P92A 2O8TA 1E79D 1OPHB 1P2QA 1TMTH 3VXFH 1BQYA 2XWAA 2OBOA 3TJVA 3RM2H 3F0PA 3BIVH 1BITA 2P8OB 2ZFSA 8LPRA 3AAVA 3VFEA 2L6OA 1TX8A 2ZWLH 1SGFG 1TOMH 1DY8A 4X2WA 3S0NA 5FHTA 2AH4X 2D8WA 3TLOA 4ZCNA 3A7VA 2GKVE 1AN1E 3ATMA 3F68H 2GV7A 4FU7A 1G30B 4WMEA 3E6PH 5EOKA 4FOUC 1YY3A 1ANEA 1MKWK 1IQNA 6CHAC 2ZDVH 2G81E 1QJ6B 1QQUA 1S82A 3DFJA 2FOEA 3M3TA 2KAIB 1GI3A 1GMDF 4X0WU 2FS8A 1EB1H 2WPKS 1GG6C 3PRDA 4NFFA 2P94A 4ISIH 1HNEE 3T5FH 1EFRD 1P10A 1ACBE 2BZ6H 3TH4H 1BHXB 1AUTC 3FAOA 3SUGA 2A1DB 2BD5A 1SKYE 1NRPH 3UOUA 1TNHA 1UVOA 3QWCH 4IS5A 1T4VH 1LVBA 2PKAA 1RXPA 1SLUB 3LJOA 4Y79A 3TGKE 1CHGA 3VXEH 3DSGA 2QXHA 4SGBE 1MKXH 1YPLH 4OS1A 1FNIA 1TPPA 1QQ4A 1HAOH 3OE7D 3PMJA 1VCPA 3DFLA 2XCNA 2JKHA 2WPIS 3UY9A 2JH6D 1EZQA 3SUDA 4TWWA 4ABHA 2ANWA 1FONA 2XNDD 2AGEX 2F9NA 1EZSC 1AY6H 2EA3A 3UOPA 4OGXA 4YESB 1F92A 1V2KT 3LGYA 3SO3A 2FOGA 3DA9B 8ESTE 1K9OE 5PTPA 1DWCH 2ODYB 1UVTH 1O2UA 2BY9X 3E90B 4CHAC 2FIRH 1DLEA 4XRNA 1GBFA 3EAJA 1FLEE 3T2NA 1QR3E 1SGFA 4NSVA 3PRBA 5SGAE 1Y3VA 2R3YA 2BY5X 1B0EA 2VBCA 5IYTA 4CBNA 1JMOH 2BM2A 1C2GA 2P16A 3LT3A 4JK5A 3RLYH 3URDA 2BDAA 4OS4A 1DE7H 1TNJA 1SQTA 2DE8A 2H9HA 3G01A 1NPMA 1VCWA 4M7GA 1C5XB 2SGEE 1Y3YA 1S0QA 6GCHF 1K1IA 1WUNH 1SQOA 1CT0E 1SOTA 2RDEA 3BEUA 3ODFA 1UCYE 4TY6A 4YOJA 2O8LA 2K0QA 1TALA 3TK9A 4DVAU 3N7EA 1P2JA 3LC5A 3PO1C 4E7NA 2XWBI 4CRAA 2OD3B 4ABDA 1CA8B 4DT4A 4A92A 2AGIX 2OCVB 3RXCA 1YPJH 4CH8B 1E36B 3Q3YA 2FO9A 1UK2A 2RFKC 1AFQC 1P9SA 2SNWA 4PROA 3RU4T 1NT1A 5HM9A 5ESBA 1ELFA 3KYGA 2K8IA 2VU8E 3SGAE 5A09A 4O97A 2JETB 2A7JA 3U1JB 3MWIU 2ZZUH 1QIXB 1ESAA 2OQ5A 1M9UA 3WWBA 2XOKD 1BTPA 4D9RA 3K2UA 1O3NA 2ZDKA 1FXYA 1A0HB 3SNAA 1TMBH 3DD2H 1DXPA 1TONA 3D49H 1C5QA 1J14A 1GHWH 1DXWA 2UWLA 3MMGA 4NA8A 4NZLA 1UTQA 1AFEH 1QRWA 1E37B 1N8OC 1P2IA 1AKSB 1OS8A 1ZHPA 2ZHWH 2FDAA 2GCHF 4A1XA 3SV2H 6ESTA 1RJXB 4M9FA 2VVCA 1GBKA 4R0IA 3SV7A 1P2KA 4YT6H 1A0JA 3QGNB 2WINI 1BBRH 1HAZB 4B1TA 3VPKA 1C2EA 1P8VC 3U9AH 5I46H 2VH6A 3LU9B 1V2MT 1PPGE 2P3UB 2QXGA 2EEKA 4XSKU 2PKSC 3BEFB 3KF2A 4GUXA 1L1GA 2BVSH 2ZKSA 2XBWA 1YCPH 3M7UA 1ZGVA 5EW2H 3RXDA 1HJAC 1O0DH 1TB6H 2O9QA 4ZKRU 2HLDD 2ANYA 1UHBA 2FI3E 2HALA 3H7OA 3OEHD 1BZXE 3F2FA 5GDSH 4DY7B 2O8WA 1W7XH 2ZI2H 1LQEA 3MU5A 3RMLH 1SGEE 2WUBA 1GJ4H 4FETA 1DWBH 4ISOA 4MPVA 2YNAA 3L3TA 1DUAA 3PV4A 1VITF 4Q2KA 3RXVA 1LPGB 1ZJKA 2A32A 3T25A 2FYRA 1EATA 2BVRH 4WMFA 2JIZD 1C1SA 1SLVB 1IQFA 3OY5U 2GT7A 1PYTC 3MU8A 5GNDA 1DX5M 4ABJA 4NWLA 4IC5A 2UWPA 1FMGA 5EIYA 3UWIA 1MAXA 4Y8ZA 1V2NT 3SI4H 1W0ZU 3MU0A 3WWFA 1V2UT 1NBME 2YMSC 2FOFA 4HFPB 1UJ1A 3I77A 2BDGA 1KXDA 1AVWA 2R9PA 4NGAH 1O5DH 2F3CE 2H6MA 4HG6A 3ZZ5A 1MTVA 2ZDAH 2QN5T 1HRTH 3MH4A 4Y71A 1BCUH 1HLTH 1MABB 3NKKA 1NRNH 5ETXA 5T3HA 1ANBA 3ZYEA 1H9LB 1HGTH 2QY0B 4AFUA 2WYJA 2GJGA 2ZA5A 3BIUH 4B74A 1AB9B 3MH5A 1DSUA 3V0XA 3RXEA 2AYWA 3KN2A 1SG8B 1TRYA 4YO9A 3MH6A 1O2MA 1MQ6A 1XKAC 3VB7A 1K1JA 2A7HA 1C2LA 5FPTA 1C5WB 3SI3H 1C4V2 4IGDA 2IJD1 4KP0A 3RXAA 1EPTC 1OWHA 2C8WB 2QF4A 2GV6A 1VGCB 3GCTG 4FUFA 1IOEA 2GMTB 4BAMB 2ODQA 3F3BA 1G2MA 3GY8A 1XXFA 2J5UA 2XC0A 3E0NB 1Q31A 1ELTA 2GZ7A 2SGQE 1KXFA 2ZDLA 3SNEA 1NM6A 2GTBA 3SV8A 3UAIC 1E38B 3E0PB 1C5UA 2XBVA 5GCHF 2BLQA 4Y11E 2BOKA 3ZVDA 1ARBA 3KQBA 3A88A 2ZTXA 7GCHF 5C67A 3PWBA 3P17H 1PPFE 5DP3A 4CRCA 3PROA 1HAIH 3RXOA 4K60A 1GJ7B 1C1WH 4U2WA 2TBSA 1O32A 1HB0B 3AASA 1A4WH 1SVPA 3TITA 1C2HA 2RG3A 5C5OA 3RXRA 3UQOA 1BTHH 1NU7B 2I6QA 3ZVBA 5EGMA 3RXKA 1ELBA 5KECA 3A82A 1AU8A 2HOBA 3N7OA 5DP8A 4HZHA 1T8MA 4X6NA 2ZHQH 1COWD 1V2WT 2G4UA 2PR3A 1HJ8A 2WPHS 5EJZA 5JBAS 3GCNA 1QRXA 1O3EA 3ELAH 4KTUA 3MFJA 1ZRKA 2KX4A 4E7RG 3SW2B 1O31A 4DIHH 1FN8A 4RKOB 1P9UA 3FZZA 3LKWA 1D9IA 4F55A 1ANCA 1D4PB 2F9UA 2VVVA 1J8AA 1TNGA 3FOAA 4MNVA 2CV3A 4AX9H 1ZPZA 2Q6DA 1O5GH 1PPZA 3KQEA 1C1PA 5EPNA 2GT8A 3A7TA 3SYJA 4U30A 2Y5GA 2QE7D 1LCYA 2ZFPH 4WXVA 3GS9A 4FVDA 1BMNH 1TBRH 2LELA 1VZQH 3F0OA 1Z1IA 1C1VH 3PLPA 3PLBA 1WTGH 1NY22 1TGCA 5LGOA 3RXIA 4RT0A 1L1JA 2UWOA 2BYAX 2QA9E 5FCKA 3Q00A 3ZV9A 5B6LA 1E0FD 1TRMA 2JH0D 1DPOA 2GDEH 4TPIZ 4ZAEA 3VB6A 4I86A 4RT1A 2FYQA 1HIAB 1YBWA 1QBNA 2Z94A 1VCQA 1YF4A 3M5NA 3QO6A 3EYDA 3LOXA 2NU1E 3BTFE 1SHHB 5AVDA 3AW0A 5HIZA 3F6UH 4ABGA 5CDFE 1KLJH 1ZMLA 3LH3A 3M5LA 1H8DH 2AIQA 5C0TA 4ZHAA 2BZAA 1ZZZA 2Z3EA 1TQ7B 2WPMS 3GCHB 1G3CA 4WJG2 1XVOA 2HVYB 1GMDG 1DFPA 1B7XB 1TLDA 5GPIB 2EC9H 1WQSA 3QGJA 1A2CH 2QV1A 1MCTA 3ZZ4A 2HPQH 3ZZ7A 1T31A 1MTNB 4X1SU 3PB1E 3SUEA 3RXQA 2UUFB 1CT2E 1W13U 1MAYA 2W3KA 2FOMB 1ORFA 1GPZA 1EAWA 4AZ2B 2GZ8A 1MCVA 3SU4A 1O3KA 1UTLM 3DT0H 3SHAH 1C4U2 2HRVA 3A80A 1GL1A 2SNVA 1UCYH 1N6YA 3BG8A 4YM9A 1PJPA 3PLKA 2PP6A 4YLUA 2VWOA 4Q7YA 2F83A 3NXPA 2XBXA 2AFQB 2CF8H 1NTPA 5DGJA 4DCDA 1GJAB 2BLVA 4ISLA 1P0SH 1EAIA 2VH0A 3MNXA 2A4OA 5GXPA 2OTVA 3UR6A 4B6FA 5A8ZA 5A0AE 2A4GA 1O3GA 3KEEA 4B6EA 4X2XA 3LONA 3RC6A 1NRQH 3BF6H 1BB0B 1O34A 4YXWD 4YOIA 4B73A 2Z3CA 4Q80A 1KXAA 8GCHF 3WW7A 5DP9A 1C5RA 2A0QB 1LPZB 2A5KA 2UUJB 3ITIA 3LDXH 1O2LA 2XW9A 2XNIA 1XUKA 3MU4A 3PTBA 4FU8A 2JJ2D 2Y7ZA 1ID5H 3E16B 3BTHE 4GVUA 1E1QD 3RMMH 3RXJA 4BAKB 4KGAA 3HKJB 1SR5C 3SU1A 3W95A 3U8OH 3EQ0H 4X6MA 5EJLA 1FPCH 3N7DA 1GMHF 2G5NA 1TOCB 3UFAA 4WXIA 1ABIH 1GHXH 2FODA 3HK6B 2H2ZA 4INKA 3S69A 1ZHRA 1RIWC 5C0UA 3SQHE 1Y3WA 3GY4A 1TYNA 4RN6A 1A5GH 1OWEA 4FUIA 1TNLA 5EXNA 6GCHG 1WV7H 1GI1A 3RMNH 1L1NA 1TGSZ 2XBYA 1SQAA 2LNCA 4JMYA 3ZZ8A 2ZGHA 3F9FA 5F8XA 1GJ8B 3W1EA 4XOJA 1WQVH 3JZ1B 4K8BA 1LHGH 3L33A 3SNDA 2ZF0H 2J98A 1GVKB 1INCA 2ZFQH 1GHVH 3MO3A 1V2OT 1W2KH 3R0FA 2O8MA 3OY6U 2QF5A 1G2LA 1BDAA 2RA0A 1SGCA 5JYIA 3S9AA 3MOCA 1JBUH 2ZU5A 1QJ7B 1H1BA 1P05A 2W7UA 1C9PA 3ZVCA 1G3BA 1C5OH 1GHYH 2GD4B 2ZEBA 4AB8A 3AAUA 2F4LA 1P04A 3A87A 4I31A 5E0JA 4IW4E 1D3DB 1EPTA 3GYLB 1UTOA 1BMMH 1NFUA 2G51A 1GHBG 1RTFB 1O30A 2A5IA 3M7TA 3NRLA 3C1KA 3MNBA 3FKSD 2ZO3H 1F0SA 1V2TT 2QF0A 4Y6DA 3UB0A 3DSOA 2GCHG 2R2MB 3RXLA 2AERH 4OS6A 1LPKB 3ATKA 2HLCA 4JZDH 3PTNA 4LZ4B 4F48B 1O3IA 2WPJS 4UFDH 3C27B 3RXMA 1FPHH 2XC4A 3EA7A 1DWEH 2Y6TA 4UFGH 4J1YA 2BHGA 1YGCH 1MKWH 3ZZ3A 1KDQB 1S83A 3UREA 1F7ZA 1MTSA 3KQ5A 5EQSA 2ULLA 5GJ4B 1DICA 3SGQE 3GDUA 5EPYA 3OYPA 4DGJA 3K65B 2CHAC 1QFKH 1TGNA 3PWCA 4FUJA 3ZV8A 2Q6GA 4XBDA 1HXFH 4AFQA 2C93B 2BDHA 2WV9A 2V7QD 3KNXA 3RU4E 1ZRBA 4K5ZA 1AE8H 1UK3A 1SLXB 2ZU1A 2P8OC 2THFB 3KYFA 1IQIA 4ZUHA 2ZPQA 2ZC9H 1IQEA 2VINA 2ZHDA 4KKDA 3ZZ6A 3M7QA 2AHME 3LJJA 1DY9A 5DP7A 3OSYA 2A4RA 9LPRA 5CMXH 3M3VA 1TNIA 1O38A 3BG4B 1LVYA 3CNRA 1GHAF 1HJ9A 1WSSH 4WVPE 4FU9A 5EXMA 1IAUA 3KGPA 2ZG0H 1NZQH 4HGCA 4X8TH 1Z8IB 2J9NA 3UNRA 4B75A 2K1QA 3PMHB 1K1MA 3ZZ9A 3SQEE 1W3CA 2F9VA 2FPZA 3OFND 4ZKSU 1U6QA 2C3SA 4Y0ZE 1KXBA 2BDCA 2BY7X 3I78A 2V3HH 2BD9A 4O9VA 1JIRA 3RM0H 3RXFA 4KTCA 3UTUH 1C2FA 4K2YA 2IN2A 3EE0B 1A1RA 1BRAA 1EAUA 1ZSJA 5JDUB 2QC2A 1Z8RA 3A8CA 2EQNA 2WSSD 4MTBA 4XBBA 2TGPZ 2YOLA 1ELCA 2GGVB 1THPB 4K69A 1FI8A 4CR9A 3TPIZ 2H9TH 3P8OA 2LPRA 2OQUA 1O3HA 5C1XA 1O2HA 1WOFA 1TX6A 4VGCB 5HXFA 1S6HA 4A7IB 1VJAU 3VGCB 1FAXA 2IJOB 2BMGB 2FP7B 1HPGA 4ISHH 2B5TB 1QNJA 4H4FA 3GOVB 1SOZA 1ESTA 9ESTA 1A5IA 4WH6A 1GI2A 3NZIA 1GI9B 1OYTH 3BTEE 2Y81A 3S7KB 3D23A 5FBIA 1MZAA 2RCEA 2NU4E 5FBEA 2WPDD 1GBDA 1CA0B 1Q3XA 1CU1A 1FX0B 3PV5A 1FN6A 3FP6E 5T1VA 5C5NA 4GHTA 5TCCA 5GCHG 2TGDA 1EJMA 1TWXB 2BD3A 1UW7A 2F43B 5HYOA 5F03A 2PSYA 1OWKA 1O2TA 5ESTE 2ZP0H 1GBBA 1AWFH 3E8LA 7GCHG 3BTQE 1BIOA 3Q76A 2KCPA 5J4QA 1QL7A 1BBRK 4X1QU 1Y5BT 1ELGA 2VIVA 5DK1A 1C2MA 4BTTB 1OP0A 3M3SA 5DO4H 3RLWH 3P8NA 2GDDA 4Y10E 5DPAA 3TNTA 3P8FA 1C1MA 3SU0A 3K6ZA 4BTIB 1IHSH 4NA9H 5DP6A 1AE5A 3MO6A 1ZTLA 2ANKH 5IK2D 1CGJE 5LPEA 5C2ZA 1MU8B 1Z6EA 1FV9A 1VJ9U 3U8TH 1V2JT 4UE7H 3LH1A 1P03A 1G3DA 1NESE 3SNCA 3ZZDA 4Y7AA 3IG6B 4O3TA 4UD9H 1H9IE 3GISB 1DOJA 2H5DA 1C1UH 2VIQA 2JETC 2XXLA 4TT3D 2G00A 1S84A 4BOHA 1C5MD 1QRZA 1CQQA 4ABBA 4DOQA 3U28C 4ZKNU 2FWWA 1VITH 1C2IA 5F6MA 1BMAA 1YCPM 1DT2A 1EX3A 4WMDA 1PQ8A 2PSXA 4GHQA 1T32A 1GJDB 3BTTE 3A84A 5EG4A 1TBQH 2ZPSA 1MQ5A 2HNTF 1YYY1 2OBQA 4A1TA 2ZCKP 3O8RA 3DSPA 3SN8A 2STAE 3LGIA 1O2SA 1W0YH 1NC6A 1GI7B 2TGAA 5DP5A 1TX7A 2XTTB 3IITA 1JXPA 2B8OH 1IQMA 5JBCS 2CK3D 1T8OA 1GJCB 2G52A 1QJ1B 1UK4A 2Z9KA 4F49A 5EQRA 3SZEA 4AYVB 1J16A 2ZQ1A 2PTNA 2FI5E 2J92A 3RXUA 4F4OC 1VKYA 2CJIA 3A8BA 4X6PA 3RXHA 3A85A 1HAVA 1UVPA 1PQ5A 5DG6A 3V3MA 2BB4A 3A7YA 2OINA 1SGYE 3K6YA 1AI8H 4OS7A 1XUFA 2WZQA 2PV9B 3O8BA 1F0UA 3B8JA 3M5OA 1Z71A 5E2OA 1GCTB 1O35A 2ALPA 3OTPA 4X1PU 1ZHMA 5C94A 1NROH 1MUEB 3EDXB 2LP6A 4JCNA 1C5YB 3FVFB 4BXSA 2ALVA 4CRBA 5A0BA 1SGTA 1EP5A 3CENA 1C5LH 2FOHA 4FVBA 2HPPH 1XUJA 1YPMH 4FUHA 4P02A 3KQCA 3HKIB 3RC5A 4Z6AH 2BLWA 2SGDE 2C8YB 4H6SB 2RDLA 5FAHA 5FX6A 3F9HA 1OYQA 4B2CA 1G9IE 2OC1A 1S6FA 1V2PT 1Y3UA 1OOKB 1T4UH 1WDIA 1XMNB 3P70B 2XC5A 2BTCE 4INHA 2C90B 1DM4B 2AS9A 3ATLA 3M37A 3M5MA 1NO9H 3TIUA 4MNXA 2Z7FE 4WWYA 2A45B 2F9BH 1P2MA 5DN6D 1EXFA 1ETSH 3KIDU 1NN6A 3H7TA 2OC0A 4ABEA 1TNKA 2C4FH 2VIOA 4BAQB 4ZKOU 3ATWA 2KM0A 1RS0A 1O3LA 2ZFFH 2V0BA 5EQQA 3TH3H 8GCHG 3LC3A 1G3EA 1F0TA 4WH8A 2ODPA 1TAWA 1O3DA 1TGBA 3QZQA 3MHWU 3SJOA 1AB9C 1OHHD 1ZGIA 2O8UA 1RRKA 2WV4A 2BVXH 4NWKA 1DITH 1LHEH 2F9OA 1V2VT 1YPHE 3SOSA 1E1RD 2W6ID 3TU7H 5C17A 1GWAA 2KCYA 1KXCA 5CE1A 1SBWA 3A7WA 1SLWB 2EI6A 1QY6A 1J9CH 5BPEA 2KAIA 3ZZCA 3PM3A 1GMHG 1O3CA 1Y3XA 1P3CA 1P09A 5J4SA 1VGCC 3KL6A 4WF8A 1TPOA 1GI6A 3ATIA 4ZXXH 1WU1A 3FP7E 2GMTC 1H8ED 5E8EH 1BMLA 2AMDA 2PTCE 3L6PA 4Y76A 2ESTE 4D8NA 1EJNA 1C1QA 1C5PA 3RP2A 1V6DA 2ZHEH 2ZGCA 2J38A 4JYTA 2PWXA 1UTPA 5EODA 1ZMJA 1O2IA 5HIYA 2KCOA 1O2QA 5HM2A 3TVJB 2FX4A 2A5AA 2H9EH 3BSQA 5L2YH 2RA3A 2G4TA 1HFDA 3V12A 4MPUA 4JZ1A 4O03A 2EI7A 3AW1A 4R8TB 3VEQB 2ZDNA 2J2UA 2IOTA 3F9GA 1VR1H 3Q77A 3MQKC 4XBCA 4AGJA 3SNBA 3A81A 1C9TA 3MH7A 4I8JA 1QB1A 3EGKH 1ELAA 4K3JA 1ETRH 1GDQA 2PLXA 1SQRA 1OSSA 2TRMA 4KELA 3RUOA 4ASUD 1W0KD 1L0ZA 1HAHH 2ZCLP 4X2YA 1K1PA 2D26C 1OP8A 4X8UH 1ZSLA 3T27A 2ZGXH 3DUXH 4I8KA 4CREA 3LGUA 5E0GA 3RXSA 1QBVH 1BRUP 1GGDB 3UR9A 4RKJB 3SU3A 2VVUA 3FFGA 1L2EA 4I8LA 2SFAA 3KHVA 4BAHB 1FIZA 4AFZA 4MQAA 4ZHLU 1C1RA 1BT7A 2VGCB 1PYTD 1IHTH 2Y5HA 1K2I1 1MTWA 5K0HA 1ABJH 1GDNA 1C2KA 1SMFE 2FI4E 1ELDE 3M35A 1C5NH 5AF9H 3O8CA 2YMSD 3O8DA 4MVNA 2Z3DA 1ELEE 1A0LA 4B2BA 2KCAA 1W0JD 2CGAA 1HDTH 1RTLA 5HGGA 1UCYK 4NSYA 4LXBH 4UFFH 1EZUC 1YLDA 1ZYOA 4NCYA 3SORA 1EQ9A 2R0KA 1O2NA 4ZHMU 2P3FH 1FY4A 2ZGBH 1OKXA 1XM1A 2HNTE 1BMFD 2XYAA 3SJKA 1RTKA 2GCTB 1KY9A 2HNTC 1GBTA 1W11U 4OS2A 4ASHA 1UVUH 5KGOA 1DVAH 1T8NA 2ZNKH 4YOGA 2PHBA 1JOUB 2FMJA 1GHAG 3DHKH 4Y8YA 1MZDA 1P2NA 2ZTZA 5C20A 2VWLA 1S85A 3A7ZA 4JK6A 2B7DH 3NWUA 2FEQH 3GCHC 2W7SA 1UTMA 2YNBA 1UTJA 4JZFH 1BJVA 2Y7XA 1ZLRA 2J95A 5EXLA 3U1IB 1BUIA 3BTKE 2Q1JA 1AKSA 1MTNC 4THNH 1WBGB 4CRGA 1YPEH 2Z9LA 1W12U 2JJ1D 3S9CA 2J34A 3QTVH 1O2JA 4TWYA 1RGQA 1O3BA 3T28A 6CHAB 1FY5A 3PV2A 1GDUA 3SGBE 3NK8A 4MNYA 4KTSA 1TBZH 2WYGA 1QGFA 4UONA 1O5EH 2FTLE 3R3GB 3A8DA 3CS0A 1GG6B 5F8ZA 1CE5A 3E3TA 3P8GA 1F2SE 1YLCA 4BTUB 2M5TA 3EE7A 2XCFA 1Y8TA 4NA7A 4UDWH 4ABFA 4I8HA 3IWMA 1GJBB 3H09A 1QA0A 1FDPA 3QDZB 1SGRE 1KTSB 3RXBA 1YLNA 1DLKB 2ZPRA 2L74A 1YC0A 2TGTA 2Z9IA 4U32A 5C1UA 5JBBS 3STJA 1SFIA 2FLRH 4AB9A 1BJUA 2CXVA 2KR7A 2P3TB 2SGFE 1CVWH 5BRRE 4LOYH 4J2YB 3OEED 1MTUA 1QTFA 2J94A 2R3UA 2OK5A 1HUTH 1CHOF 1ZSKA 2ZTYA 2OC7A 1ZJDA 1WTHD 5E0HA 2NWNA 3ZVGA 4AGKA 1O2WA 3MNSA 1Z6JH 4Q4LA 3ZZAA 3UQVA 3SBKA 4K1EA 4D7FA 2G55A 2STBE 4Q7ZA 5FX5A 1K1NA 1RFNA 2WPLS 1ELVA 5EU8A 1MD7A 2QIQA 3D65E 1P06A 4CHAB 3U69H 4H42U 1HAXB 1THSH 2Z9GA 4I32A 1D3QB 3RMOH 1GVZA 3SHCH 3GICB 1T7CA 3TK5A 1THRH 4Q7XA 1DSTA 1V2ST 2Z9JA 2Y5FA 1KYNA 4NIXA 1AIXH 5L6NH 4I33A 5L30H 1A3BH 1JWTA 1MKXK 2BDYA 1P57B 2VJ1A 2ILNA 2PFEA 4OM9A 4MPXA 1LQDB 1P01A 4IN1A 1KTTB 3GDSA 4D76A 3NCLA 1UO6A 2VB0A 1EAXA 3TJUA 1D3PB 2C8ZB 5CHAB 3GCOA 4A6LA 2SGPE 5GWZA 2CF9H 4NFEA 2EY4C 4FXGH 1V2RT 3TNSA 1TPSA 3STIA 2NU2E 2FESH 1GI8B 1SL3A 1O5AB 1EZXC 1NFYA 1VITG 1G32B 3GY3A 5F53A 3PO1B 1EASA 3OU0A 1PFXC 1Z8JB 1E35B 5IDKA 1GHZA 4B71A 3SU2A 4FUEA 5TJXA 1AFQB 2BQWB 3OTJE 1YPGH 3ZYDA 1IQHA 2V35A 3A83A 1NRSH 3A86A 4OS5A 1LHFH 5TCAA 4AFSA 4X8SH 1N1LA 2ZFTA 3CP7A 3GY5A 1A61H 2JH5D 2WV5A 2B0FA 1W8BH 4FUGA 1MBQA 1DS2E 3GY6A 2D1JA 1O2RA 1K0HA 4WY3A 2A31A 3KCGH 1MU6B 1KMHB 1XXDA 1YM0A 1KSNA 3FN8A 1TPAE 1EKBB 1GMCF 2A2XH 1N8OB 3A89A 3BV9B 4DURA 1D3TB 1YPKH 4GCHF 1SGPE 2CN0H 2XRCA 4OGYA 3UIRA 4X2VA 3GYMA 2BD2A 3JZ2B 1AVGH 1AMHA 3UWJH 5AFYH 5K7RA 4DT7B 7KMEH 5LPRA 5G4BA 1HAYB 1BRCE 1GBCA 1O2GH 3UPEA 1SFQB 4DW2U 1WCZA 4INLA 4NIVA 5GIBA 3QN7A 2OLGA 4IMZA 1DUEA 2P95A 3LGVA 1O39A 4X1NU 3VG8A 1CO7E 4NIYA 1ZTJA 1B0FA 2PKSB 5CHAC 3VB5A 4K8YA 2G5VA 4D9QA 4DIIH 3CS7A 5T6DA 5HKKD 3BG4C 1C1TA 4H6TA 5A2MH 2HWLB 1HJAB 2P93A 1ZOMA 3PMBB 1TGTA 4K1SA 2J4IA 4P00A 1W7GH 3GY7A 4CH2B 1XKBC 3LPRA 4BAOB 1GCDA 2OXSA 1IQJA 2QXJA 1NRRH 5H4IB 5DJ7A 1XUIA 3UNQA 3ENSB 1A7SA 4AYYB 5EW1H 2J97A 1CGHA 4Y7BA 2UUYA 1YKTA 4I8GA 3TJOA 3T29A 5F8TA 1ANDA 1GI0A 1BA8B 4MDSA 3GDVA 5JB9S 3SJ8A 2BDBA 4AN7A 5FPSA 1GHBF 2FOCA 2ZU3A 3MO9A 2C8XB 1O3OA 2WHXA 8KME2 1D6RA 4NZQA 1ARCA 2SGAA 1HIAA 2DE9A 2YMSB 4TYDA 1UMAH 1P12E 1C2JA 2QCYA 1Y59T 4JZIA 3BTME 1YCPK 4ZH8A 2FXRA 1O5CB 3AVZA 3SUFA 1LKBA 3SU6A 4VGCC 2V6NA 3VGCC 1FUJA 3TGIE 1Z7KA 4AC9A 1BOQA 1HYLA 1QBOA 1QHRB 2QAAA 1T8LA 4CBOA 4GLYA 1C4Y2 1OWIA 3QK1A 1QL9A 1MD8A 1P02A 5B6OA 1BTUA 1PPCE 1V3XA 1XVMA 1Y5AT 2DUCA 3BTWE 3DCLA 4X1RU 2J98B 1FZZA 1S0RA 1BRBE 1V2LT 1HXEH 1XUGA 1DANH 4SGAE 2BDIA 5A8XA 1CA0C 3TH2H 1NFXA 1O3PB 1TQ0B 4ISNA 2BXUH 5KEDA 2BX4A 2VWMA 3FP8E 3HATH 1GI4A 1QURH 5CHBA 2ZFRH 3D62A 1Q2WA 1TA2A 1GBIA 1EB2A 1MMJN 2VIDA 4ESTE 2KZ4A 1AGJA 4JZEH 3I29A 4Y8XA 1P3EA 1EPTB 3MNCA 3LGWA 3ZIAD 4Z0KA 1SGDE 2NU3E 1KLTA 3QLPH 3Q3XA 2AEIH 3ODDA 2P59A 5I25A 1FY1A 1AWHB 1G37A 5E2PA 1SGNE 1YP9A 2ZHFH 1TFXA 1HV7A 5DSFA 1OXGA 3RU4D 2Y80A 1O5FH 1S6LA 3VB4A 4X6OA 3AK5A 1CGIE 1L4DA 2PGBB 1LVMA 4YT7H 5JBTA 3S7HB 4I7YH 4XFQA 1GBJA 5FL7D 1BTYA 1DWDH 4AG1A 2FOAA 3V7TA 2HGTH 3QZRA 1F5RA 3PYHA 1GI5A 4CRFA 1UTNA 1GBHA 1TA6A 3ZVFA 1GJ5H 2BXTH 2PKAB 1EUFA 1PPHE 2ANMH 3BEIB 4JYVH 2VNTA 3M36A 3RXPA 3F1SB 4RI0A 3ZVEA 4LZ1H 1EOLA 2V3OH 3FZDA 1OWDA 1K1LA 1LKAA 3U98H 1O2PA 2BD8A 2ZDMA 4YTAA 3RXGA 2WUCA 3TJNA 2HVXA 1UTKA 2CMYA 3PMAB 3SJ9A 2BD4A 1J17T 1AZ8A 1IQLA 2FZZA 1A5HA 2ZGJA 3B9FH 3QX5H 1NU9A 1YWUA 1F5LA 2BQ6B 1J15A 2OP9A 1CBWB 1CSOE 4BANB 4UEHH 4IC6A 1H8HD 3MTYA 4AORA 3A8AA 1P11E 1FJSA 1O33A 3FANA 3QTOH 3WY8A 1C5VA 4MG3A 3SJIA 1O2YA 2GP9B 1O3MA 2M2AA 1QB6A 3VB3A 3MU1A 1F5KU 4AG2A 3SV6A 2ZQ2A 2PUQH 1EJAA 1AHTH 2BLOA 2AGGX 1ZTKA 4E05H 1O5BB 1TABE 2AIPA 1N6XA 2GZ9A 3BN9A 1K21H 1QZ8A 1SPJA 5JB8S 3N99A 4A5TS 1O36A 1W10U 7ESTE 1Z8GA 1C2DA 4IN2A 1C1OA 2IPHA 1GVLA 4ABAA 2FOBA 2Z6BD 1QCPA 1V2QT 2R0LA 2GX4A 1GCTC 1LTOA 2Y82A 1YPHC 2ZECA 2FM2A 1AO5A 1C5TA 2AMPA 5A0CA 4CRDA 4Z1MD 1BTWA 4BXWA 1L4ZA 4E06H 3MI4A 3Q3KA 3B23B 4TSFD 2GVFA 2BOHB 1WAYB 2BD7A 3T26A 1O37A 2QF3A 1BTZA 2KFWA 1HAPH 3EA9A 2ZIQH 1O2KA 1KDQA 3P95A 1SHYA 4XD7D 5AFZH 4X8VH 4U01A 5JPMH 2A7CA 4DJZB 5T6GA 1D6WA 1SGIB 1CBWC 1K22H 2IPQX 1LHDH 3SV9A 1JIMA 2FS9A 1QA7A 1PPBH 3HPTB 1LHCH 2F91A 2W26A 1O2ZA 2QGRA 1TIOA 1LO6A 2JDID 3P6ZB 4B76A 3RC4A 1C1NA 5EJ1A 3SU5A 1PPEE 3NPSA 5C1YA 2Q6FA 1PQAA 2NU0E 3TGJE 3E1XB 2FTMA 4ZROA 1ETTH 2ZU4A 1IQGA 3A7XA 3BTDE 3SZNA 2FLBH 1SC8U 1JRSA 1CHOG 3HGPA 1FY8E 1O3JA 2BY6X 4ZXYH 5HMAA 1OWJA 4DG4A 1BBRE 2H5CA 1FY3A 5LH8A 5FCRA 1GBEA 4RSPA 1MBMA 1FAKH 5T6FA 3W94A 4IBLH 1Z1JA 1GL0E 2A2QH 2V3MA 4ZMAH 1ZR0A 3ESTA 2B9LA 1DDJA 3M61U 3LIWA 2W5EA 4JYUH 2BY8X 1OP2A 3T62A 1TMUH 1GBLA 1UHBB 3FO8D 4XE4A 3ZZBA 7LPRA 1XX9A 2W6JD 5A8YA 1MH0A 2I6SA 1NBMD 1KLIH 1NFWA 3RDZA 4UFEH 3F2HA 5AHGH 1HAGE 1BHXF 1LMWB 3RXTA 4ACAA 2ZCHP 1H8IH 1H9HE 1HCGA 1O2OA 1IQKA 2FX6A 4YLQH 3URCA 2VIWA 1C5SA 3ZVAA 1TE0A 1P2OA 1GBMA 1GBAA 1S81A 3H5CB 3GCTF 1O3AA 4TPYA 1AQ7A 1FQ3A 3F2GA 5DP4A 1RIWB 2QXIA 3NUMA 4GSOA 1LVOA 2PGQB 4AOQA 3U8RH 1NS3A 1O2VA 2PW8H 5FXLA 1ZPBA 1WYKA 5ABWA 1LDTT 1QL8A 1O3FA 4K1TA 1C5ZB 3E91A 5FPYA 1H4WA 3GY2A 4GPGA 4FUBA 2BQ7B 3OX7U 1B5GH 2ASUB 3F9EA 1OX1A 1AZZA 1AVXA 1EP6A 1GGDC 2D2DA 4ACBA 1RD3B 2F9PA 2UUKB 2TPIZ 4Y0YE
chains in the Genus database with same CATH topology
4ABIA 1PQ7A 2TIOA 4IMQA 1CT4E 1A46H 4MNWA 1SI5H 1HAVB 4B2AA 4LK4A 1HBTH 4MPWA 2VGCC 2R2WU 2AMQA 1SGQE 4NG9H 5DKMA 2H1UA 1QB9A 4GAWA 1AD8H 1S5SA 2G8TA 1X7AC 1Y5UT 1KXEA 4D7GA 4BNRA 1GMCG 2VWNA 6LPRA 1BTXA 4HI3A 4YZUA 1SB1H 2PUXB 4GCHG 5L2ZH 1A3EH 4XDEA 2EI8A 2ZU2A 5LPFA 1GJ9B 1KIGH 4NIWA 3HK3B 3S9BA 1G36A 2OUAA 2OC8A 3V13A 1ESBA 1ZMNA 5C3NA 1K28D 1XUHA 4TY7A 3UUZA 2BX3A 4MLFB 4FUDA 1SSXA 1TRNA 3TK6A 2QYIA 4HTCH 2W3IA 4FUCA 3KQDA 3LGTA 3MYWA 1O2XA 1EOJA 1FIWA 3HGNA 3BTGE 2VIPA 2GCTC 1UVSH 3EA8A 2CHAB 4QT8C 1W14U 2A4QA 4O3UA 4A1VA 1JRTA 1AUJA 1F0RA 1GJ6A 4CR5A 1ZPCA 3QUMP 1E34B 1K1OA 3K9XB 3UNSA 3P92A 2O8TA 1P2QA 1OPHB 1TMTH 3VXFH 1BQYA 2XWAA 2OBOA 3TJVA 3RM2H 3BIVH 1BITA 2P8OB 2ZFSA 8LPRA 3AAVA 3VFEA 1TX8A 2ZWLH 1SGFG 1TOMH 1DY8A 4X2WA 3S0NA 5FHTA 2AH4X 2D8WA 3TLOA 3A7VA 2GKVE 1AN1E 3ATMA 3F68H 2GV7A 4FU7A 1G30B 4WMEA 3E6PH 5EOKA 1ANEA 1MKWK 1IQNA 6CHAC 2ZDVH 2G81E 1QJ6B 1QQUA 1S82A 3DFJA 2FOEA 3M3TA 2KAIB 1GI3A 1GMDF 4X0WU 2FS8A 1EB1H 2WPKS 1GG6C 4NFFA 2P94A 4ISIH 1HNEE 3T5FH 1P10A 1ACBE 2BZ6H 3TH4H 1BHXB 1AUTC 3FAOA 3SUGA 2A1DB 2BD5A 1NRPH 3UOUA 1TNHA 1UVOA 3QWCH 4IS5A 1T4VH 1LVBA 2PKAA 1RXPA 1SLUB 3LJOA 4Y79A 3TGKE 1CHGA 3VXEH 2QXHA 4SGBE 1MKXH 1YPLH 4OS1A 1FNIA 1TPPA 1QQ4A 1HAOH 3PMJA 1VCPA 3DFLA 2XCNA 2JKHA 2WPIS 3UY9A 2JH6D 1EZQA 3SUDA 4TWWA 4ABHA 2ANWA 1FONA 2AGEX 2F9NA 1EZSC 1AY6H 2EA3A 3UOPA 4OGXA 4YESB 1F92A 1V2KT 3LGYA 3SO3A 2FOGA 3DA9B 8ESTE 1K9OE 5PTPA 1DWCH 2ODYB 1UVTH 1O2UA 2BY9X 3E90B 4CHAC 2FIRH 1DLEA 1GBFA 3EAJA 1FLEE 3T2NA 1QR3E 1SGFA 4NSVA 5SGAE 1Y3VA 2R3YA 2BY5X 1B0EA 5IYTA 4CBNA 1JMOH 2BM2A 1C2GA 2P16A 3LT3A 4JK5A 3RLYH 3URDA 2BDAA 4OS4A 1DE7H 1TNJA 1SQTA 2DE8A 2H9HA 3G01A 1NPMA 1VCWA 4M7GA 1C5XB 2SGEE 1Y3YA 1S0QA 6GCHF 1K1IA 1WUNH 1SQOA 1CT0E 1SOTA 3ODFA 3BEUA 4TY6A 1UCYE 4YOJA 2O8LA 1TALA 3TK9A 4DVAU 1P2JA 3LC5A 3PO1C 4E7NA 2XWBI 4CRAA 2OD3B 4ABDA 1CA8B 4A92A 2AGIX 2OCVB 3RXCA 1YPJH 4CH8B 1E36B 3Q3YA 2FO9A 1UK2A 1AFQC 1P9SA 2SNWA 4PROA 3RU4T 1NT1A 5HM9A 5ESBA 1ELFA 2VU8E 5A09A 3SGAE 4O97A 2JETB 2A7JA 3U1JB 3MWIU 2ZZUH 1QIXB 1ESAA 2OQ5A 1M9UA 1BTPA 4D9RA 3K2UA 1O3NA 2ZDKA 1FXYA 1A0HB 3SNAA 1TMBH 3DD2H 1DXPA 1TONA 3D49H 1C5QA 1J14A 1GHWH 1DXWA 2UWLA 3MMGA 4NA8A 4NZLA 1UTQA 1AFEH 1QRWA 1E37B 1N8OC 1P2IA 1AKSB 1OS8A 1ZHPA 2ZHWH 2FDAA 2GCHF 4A1XA 3SV2H 6ESTA 1RJXB 2VVCA 1GBKA 4R0IA 3SV7A 1P2KA 4YT6H 1A0JA 3QGNB 2WINI 1BBRH 1HAZB 4B1TA 3VPKA 1C2EA 1P8VC 3U9AH 5I46H 2VH6A 3LU9B 1V2MT 1PPGE 2P3UB 2QXGA 2EEKA 4XSKU 2PKSC 3BEFB 3KF2A 4GUXA 1L1GA 2BVSH 2ZKSA 2XBWA 1YCPH 3M7UA 1ZGVA 5EW2H 3RXDA 1HJAC 1O0DH 1TB6H 2O9QA 4ZKRU 2ANYA 1UHBA 2FI3E 2HALA 3H7OA 1BZXE 5GDSH 4DY7B 2O8WA 1W7XH 2ZI2H 1LQEA 3MU5A 3RMLH 1SGEE 2WUBA 1GJ4H 1DWBH 4ISOA 4MPVA 2YNAA 3L3TA 1DUAA 3PV4A 1VITF 4Q2KA 3RXVA 1LPGB 1ZJKA 2A32A 3T25A 2FYRA 1EATA 2BVRH 4WMFA 1C1SA 3OY5U 1SLVB 1IQFA 2GT7A 1PYTC 3MU8A 1DX5M 4ABJA 4NWLA 4IC5A 2UWPA 1FMGA 3UWIA 1MAXA 4Y8ZA 1V2NT 3SI4H 1W0ZU 3MU0A 1V2UT 2FOFA 4HFPB 1UJ1A 3I77A 2BDGA 1KXDA 1AVWA 2R9PA 4NGAH 1O5DH 2F3CE 2H6MA 3ZZ5A 1MTVA 2ZDAH 2QN5T 1HRTH 3MH4A 4Y71A 1BCUH 1HLTH 3NKKA 5ETXA 1NRNH 5T3HA 1ANBA 3ZYEA 1H9LB 1HGTH 2QY0B 4AFUA 2WYJA 2ZA5A 3BIUH 4B74A 1AB9B 3MH5A 1DSUA 3V0XA 3RXEA 2AYWA 3KN2A 1SG8B 1TRYA 4YO9A 3MH6A 1O2MA 1MQ6A 1XKAC 3VB7A 1K1JA 2A7HA 1C2LA 5FPTA 1C5WB 3SI3H 1C4V2 4IGDA 4KP0A 3RXAA 1EPTC 1OWHA 2C8WB 2GV6A 1VGCB 3GCTG 4FUFA 1IOEA 2GMTB 4BAMB 2ODQA 3GY8A 1G2MA 1XXFA 2XC0A 3E0NB 1Q31A 1ELTA 2GZ7A 2SGQE 1KXFA 2ZDLA 3SNEA 1NM6A 2GTBA 3SV8A 1E38B 3E0PB 1C5UA 2XBVA 5GCHF 2BLQA 4Y11E 2BOKA 3ZVDA 1ARBA 3KQBA 3A88A 2ZTXA 7GCHF 5C67A 3PWBA 3P17H 1PPFE 5DP3A 4CRCA 3PROA 1HAIH 3RXOA 4K60A 1GJ7B 1C1WH 4U2WA 2TBSA 1O32A 1HB0B 3AASA 1A4WH 1SVPA 3TITA 1C2HA 2RG3A 5C5OA 3RXRA 3UQOA 1BTHH 1NU7B 2I6QA 3ZVBA 5EGMA 3RXKA 1ELBA 3A82A 1AU8A 2HOBA 3N7OA 5DP8A 4HZHA 1T8MA 4X6NA 2ZHQH 1V2WT 2G4UA 2PR3A 1HJ8A 2WPHS 5JBAS 3GCNA 1QRXA 1O3EA 3ELAH 4KTUA 3MFJA 1ZRKA 4E7RG 3SW2B 1O31A 4DIHH 1FN8A 4RKOB 1P9UA 3FZZA 3LKWA 1D9IA 1ANCA 1D4PB 2F9UA 2VVVA 1J8AA 1TNGA 4MNVA 2CV3A 4AX9H 1ZPZA 2Q6DA 1O5GH 1PPZA 3KQEA 1C1PA 5EPNA 2GT8A 3A7TA 4U30A 2Y5GA 4WXVA 1LCYA 2ZFPH 4FVDA 1BMNH 1TBRH 1VZQH 1Z1IA 1C1VH 3PLPA 3PLBA 1WTGH 1NY22 1TGCA 5LGOA 3RXIA 1L1JA 2UWOA 2BYAX 2QA9E 5FCKA 3Q00A 3ZV9A 1E0FD 1TRMA 2JH0D 1DPOA 2GDEH 4TPIZ 4ZAEA 3VB6A 2FYQA 1HIAB 1YBWA 1QBNA 2Z94A 1VCQA 1YF4A 3M5NA 3QO6A 3EYDA 3LOXA 2NU1E 3BTFE 1SHHB 5AVDA 3AW0A 3F6UH 4ABGA 1KLJH 1ZMLA 3LH3A 3M5LA 1H8DH 2AIQA 4ZHAA 2BZAA 1ZZZA 2Z3EA 1TQ7B 2WPMS 3GCHB 1G3CA 4WJG2 1XVOA 1GMDG 1DFPA 1B7XB 1TLDA 5GPIB 2EC9H 1WQSA 3QGJA 1A2CH 2QV1A 1MCTA 3ZZ4A 2HPQH 3ZZ7A 1T31A 1MTNB 4X1SU 3PB1E 3SUEA 3RXQA 2UUFB 1CT2E 1W13U 1MAYA 2W3KA 2FOMB 1ORFA 1GPZA 1EAWA 4AZ2B 2GZ8A 1MCVA 3SU4A 1O3KA 1UTLM 3DT0H 3SHAH 1C4U2 2HRVA 3A80A 1GL1A 2SNVA 1UCYH 1N6YA 3BG8A 4YM9A 1PJPA 3PLKA 4YLUA 2VWOA 4Q7YA 2F83A 3NXPA 2XBXA 2AFQB 2CF8H 1NTPA 5DGJA 4DCDA 1GJAB 2BLVA 4ISLA 1P0SH 1EAIA 2VH0A 3MNXA 2A4OA 5GXPA 2OTVA 3UR6A 5A8ZA 5A0AE 2A4GA 1O3GA 3KEEA 4X2XA 3LONA 3RC6A 1NRQH 3BF6H 1BB0B 1O34A 4YOIA 4B73A 2Z3CA 4Q80A 1KXAA 8GCHF 5DP9A 1C5RA 2A0QB 1LPZB 2A5KA 2UUJB 3ITIA 3LDXH 1O2LA 2XW9A 2XNIA 1XUKA 3MU4A 3PTBA 4FU8A 2Y7ZA 1ID5H 3E16B 3BTHE 4GVUA 3RMMH 3RXJA 4BAKB 4KGAA 3HKJB 1SR5C 3SU1A 3W95A 3U8OH 3EQ0H 4X6MA 1FPCH 1GMHF 2G5NA 1TOCB 3UFAA 4WXIA 1ABIH 1GHXH 2FODA 3HK6B 2H2ZA 4INKA 3S69A 1ZHRA 1RIWC 3SQHE 1Y3WA 3GY4A 1TYNA 4RN6A 1A5GH 1OWEA 4FUIA 1TNLA 5EXNA 6GCHG 1WV7H 1GI1A 3RMNH 1L1NA 1TGSZ 2XBYA 1SQAA 2LNCA 4JMYA 3ZZ8A 2ZGHA 3F9FA 5F8XA 1GJ8B 4XOJA 1WQVH 3JZ1B 4K8BA 1LHGH 3L33A 3SNDA 2ZF0H 1GVKB 1INCA 2ZFQH 1GHVH 3MO3A 1V2OT 1W2KH 3R0FA 2O8MA 3OY6U 1G2LA 1BDAA 2RA0A 1SGCA 5JYIA 3S9AA 3MOCA 1JBUH 2ZU5A 1QJ7B 1H1BA 1P05A 2W7UA 1C9PA 3ZVCA 1G3BA 1C5OH 1GHYH 2GD4B 2ZEBA 4AB8A 3AAUA 1P04A 3A87A 4I31A 5E0JA 4IW4E 1D3DB 1EPTA 3GYLB 1UTOA 1BMMH 1NFUA 2G51A 1GHBG 1RTFB 1O30A 2A5IA 3M7TA 3C1KA 3MNBA 4Y6DA 2ZO3H 1F0SA 1V2TT 2QF0A 2GCHG 2R2MB 3RXLA 2AERH 4OS6A 1LPKB 3ATKA 2HLCA 4JZDH 3PTNA 4LZ4B 1O3IA 2WPJS 4UFDH 3C27B 3RXMA 1FPHH 2XC4A 3EA7A 1DWEH 2Y6TA 4UFGH 4J1YA 2BHGA 1YGCH 1MKWH 3ZZ3A 1KDQB 1S83A 3UREA 1F7ZA 1MTSA 5EQSA 2ULLA 5GJ4B 1DICA 3SGQE 3GDUA 5EPYA 3OYPA 4DGJA 3K65B 2CHAC 1QFKH 1TGNA 3PWCA 4FUJA 3ZV8A 2Q6GA 4XBDA 1HXFH 4AFQA 2C93B 2BDHA 3KNXA 3RU4E 1ZRBA 4K5ZA 1AE8H 1UK3A 1SLXB 2ZU1A 2P8OC 2THFB 1IQIA 4ZUHA 2ZPQA 2ZC9H 1IQEA 2VINA 2ZHDA 4KKDA 3ZZ6A 3M7QA 3LJJA 1DY9A 5DP7A 3OSYA 2A4RA 9LPRA 5CMXH 3M3VA 1TNIA 1O38A 3BG4B 1LVYA 1GHAF 1HJ9A 1WSSH 4WVPE 4FU9A 5EXMA 1IAUA 3KGPA 2ZG0H 1NZQH 4HGCA 4X8TH 1Z8IB 2J9NA 3UNRA 4B75A 2K1QA 3PMHB 1K1MA 3ZZ9A 3SQEE 1W3CA 2F9VA 2FPZA 4ZKSU 1U6QA 2C3SA 4Y0ZE 1KXBA 2BDCA 2BY7X 3I78A 2V3HH 2BD9A 4O9VA 1JIRA 3RM0H 3RXFA 4KTCA 3UTUH 1C2FA 4K2YA 2IN2A 3EE0B 1A1RA 1BRAA 1EAUA 1ZSJA 5JDUB 2QC2A 1Z8RA 3A8CA 4XBBA 4MTBA 2TGPZ 2YOLA 1ELCA 2GGVB 1THPB 4K69A 1FI8A 4CR9A 3TPIZ 2H9TH 3P8OA 2LPRA 2OQUA 1O3HA 5C1XA 1O2HA 1WOFA 1TX6A 4VGCB 5HXFA 1S6HA 4A7IB 1VJAU 3VGCB 1FAXA 2IJOB 2BMGB 2FP7B 1HPGA 4ISHH 2B5TB 1QNJA 4H4FA 3GOVB 1SOZA 1ESTA 9ESTA 1A5IA 4WH6A 1GI2A 3NZIA 1GI9B 1OYTH 3BTEE 2Y81A 3S7KB 3D23A 5FBIA 1MZAA 2RCEA 2NU4E 5FBEA 1GBDA 1CA0B 1Q3XA 1CU1A 1FN6A 3FP6E 5C5NA 4GHTA 5TCCA 5GCHG 2TGDA 1EJMA 1TWXB 2BD3A 5HYOA 5F03A 2PSYA 1OWKA 1O2TA 5ESTE 2ZP0H 1GBBA 1AWFH 3E8LA 7GCHG 3BTQE 1BIOA 3Q76A 5J4QA 1QL7A 1BBRK 4X1QU 1Y5BT 1ELGA 2VIVA 5DK1A 1C2MA 4BTTB 1OP0A 3M3SA 5DO4H 3RLWH 3P8NA 2GDDA 4Y10E 5DPAA 3TNTA 3P8FA 1C1MA 3SU0A 3K6ZA 4BTIB 1IHSH 4NA9H 5DP6A 1AE5A 3MO6A 1ZTLA 2ANKH 1CGJE 5LPEA 5C2ZA 1MU8B 1Z6EA 1FV9A 1VJ9U 3U8TH 1V2JT 4UE7H 3LH1A 1P03A 1G3DA 1NESE 3SNCA 3ZZDA 4Y7AA 3IG6B 4O3TA 4UD9H 1H9IE 3GISB 1DOJA 2H5DA 1C1UH 2VIQA 2JETC 2XXLA 2G00A 1S84A 4BOHA 1C5MD 1QRZA 1CQQA 4ABBA 4DOQA 4ZKNU 2FWWA 1VITH 1C2IA 5F6MA 1BMAA 1YCPM 1DT2A 1EX3A 4WMDA 1PQ8A 2PSXA 4GHQA 1T32A 1GJDB 3BTTE 3A84A 5EG4A 1TBQH 2ZPSA 1MQ5A 2HNTF 1YYY1