1UTZA

Crystal structure of mmp-12 complexed to (2r)-3-({[4-[(pyridin-4-yl)phenyl]-thien-2-yl}carboxamido)(phenyl)propanoic acid
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
159
structure length
159
Chain Sequence
b'GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDFHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MACROPHAGE METALLOELASTASE
publication title Crystal Structures of Novel Non-Peptidic, Non-Zinc Chelating Inhibitors Bound to Mmp-12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 46
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2003-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1utzA00
4AUOA 4G0DA 2O36A 5D1UA 5D3CA 1I1IP 3LJTA 2EROA 2Y6CA 4XM6A 2JT6A 3I7GA 3F15A 2SRTA 3O2XA 3DL1A 3LKAA 2AYKA 3EHXA 1B8YA 3EDHA 1GE5A 3G5CA 2Y6DA 3G42A 1OMJA 5D7WA 2JNPA 3KECA 1GXDA 1MMQA 1OO9A 3HDBA 3TSKA 3LK8A 4JIJA 5I0LA 1ROSA 1XFWA 1K7GA 1JK3A 1KUIA 1KAPP 4PKQA 2OW0A 4IUWA 1GO7P 1D7XA 2OXWA 1JIZA 1OS2A 1FLSA 5L79A 3WV3A 2MZEA 3WV2A 4DPEA 2ERPA 3Q2HA 3TT4A 2MLSA 2D1NA 1DMTA 1GE7A 2N8RA 3N2UA 5D1TA 1FM1A 2OVZA 2CKIA 1G49A 3EDIA 3HB2P 1AF0A 1Y0VA 5BOYA 3BA0A 2WOAA 830CA 1EUBA 1QUAA 3DWBA 4I03A 4GWNA 966CA 4G9LA 3LJZA 2FV9A 2JSDA 1I73A 3KRYA 4A7BA 3K7NA 4PKWA 4GR3A 5CXAA 2DW0A 3DPEA 1R1JA 1BUDA 4WKEA 1YQYA 2RJQA 1KUGA 1CGLA 4FXQA 2JIHA 1CGEA 5I3MA 1UTZA 1UMSA 2DDYA 3I7IA 3WV1A 4A3WA 1EAKA 4WZVA 1AKLA 5LABA 2QPJA 1GE6A 4PKVA 1PWQA 1BIWA 4L63A 2WO8A 1R55A 2FV5A 2O3EA 2L0RA 1BQQM 1JANA 4IJOA 2OW1A 1Y8JA 1MNCA 1XUCA 3EWJA 3EHYA 2OXUA 3ELMA 3LIRA 1EB6A 4GR0A 4J4MA 3AYKA 3ZVSA 1GKDA 2WO9A 1CAQA 1G05A 2K2GA 4JP4A 2XS3A 2TCLA 1MMPA 1K7QA 4AXQA 2ERQA 1WNIA 2OY4A 1C7KA 2OW9A 1ND1A 5CUHA 1R1IA 2K9CA 1UEAA 2RJPA 3LGPA 3DSLA 3DNGA 1OM6A 4JA1A 3EDGA 1BZSA 1A85A 4XM7A 2DDFA 1YP1A 2DW1A 1CGFA 4H84A 1IAAA 3P1VA 1B3DA 3LEAA 1FBLA 1SLMA 3KMEA 4Q1LA 1KUFA 1C8TA 3VI1A 3AYUA 1ZP5A 5I2ZA 2A8HA 3K7LA 4FU4A 1ASTA 1JAPA 2W13A 3LUMA 4XBHA 2OI0A 3F17A 1UTTA 1IAGA 2X3CA 3NX7A 1BQOA 1BUVM 1CXVA 4I35A 1IACA 3U1RA 5JMYA 3USNA 4JQGA 3KEJA 3KEKA 2I47A 2MZHA 4IN9A 5B5OA 1BM6A 4GQLA 1AYKA 4XM8A 1A86A 456CA 3TVCA 3TS4A 4ILWD 5H8XA 1CQRA 1BKCA 1ZXVA 3F16A 3F1AA 1SU3A 2OXZA 1ZXCA 4WK7A 1UMTA 3KMCA 5I4OA 4FVLA 5CZMA 3ZUKA 3GBOA 3ZXHA 1XFUA 1QICA 3HY7A 1JAQA 2X3AA 3N2VA 2W15A 1XFXA 1XFYA 2PJTA 1ZTQA 2XS4A 2X7MA 3LE9A 1YOUA 1D5JA 4PKRA 4JPAA 3P24A 3LQBA 2YB9A 1GKCA 3KHIA 1HFCA 3HYGA 5BPAA 1XFZA 1CIZA 1BKCE 2MLRA 4ON1A 4GWMA 1HTDA 5D1SA 2CLTA 1JKYA 1OS9A 1QIBA 3E8RA 1D8FA 3LJGA 1KUHA 1QIAA 2W0DA 2HU6A 4PKUA 4DD8A 2V4BA 3HBUP 3LQ0A 4GF1A 2OZRA 2AIGP 4H30A 4HX3A 1D8MA 3Q2GA 1KBCA 1O0TA 1XUDA 2MZIA 2USNA 3RTSA 3HY9A 1HV5A 4H2EA 5BOTA 1J7NA 3F18A 1O0QA 4FXYP 1YCMA 4AIGA 5I43A 2Z2DA 2D1OA 4QKZA 4AYKA 1L6JA 1R1HA 3V96B 3L0VA 2J0TA 2X3BA 3B92A 2POJA 4R3VA 1XURA 3SHIA 1Z3JA 3MA2A 1PWWA 1SMPA 1G9KA 3OHOA 1H71P 1BSWA 2J83A 4HMAA 1USNA 4CTHA 5L7FA 1RMZA 3VTGA 4DV8A 1CK7A 1G4KA 3UVCA 4GUYA 2E3XA 2E2DA 1ZVXA 2YIGA 1I76A 1JJ9A 5B5PA 1IAEA 4H49A 1XFVA 1IABA 4DF9A 3EDZA 1DTHA 1C3IA 1JH1A 3HBVP 4GR8A 1HFSA 2W12A 3LIKA 3LUNA 1JAOA 2KRJA 3B8ZA 1SRPA 1QJIA 1Y93A 1ZS0A 3O64A 1PWVA 4WKIA 1BKCI 2OVXA 4PKTA 1GO8P 1IADA 1OM7A 4EFSA 4L19A 1HY7A 1OM8A 5I12A 1SLNA 1PWPA 1SATA 4H1QA 3HDAP 5D2BA 1RM8A 3KWVC 4ZR5A 1G12A 2DW2A 3LMCA 4WF6A 1MMRA 3B2ZA 1KUKA 1MMBA 1R54A 1PWUA 3CKIA 1ATLA 2JT5A 1S4BP 1JIWP 4H82A 3F19A 3OHLA 4H76A 4XCTA 1Q3AA 2W14A 2OW2A 1HOVA 4L6TA 3L0TA 3RTTA 2OY2A 3LILA 3DPFA 1K7IA 3AIGA 1QJJA 4H3XA 4PKSA
chains in the Genus database with same CATH superfamily
4AUOA 4G0DA 2O36A 5D1UA 5D3CA 1I1IP 3LJTA 2EROA 2Y6CA 4XM6A 2JT6A 3I7GA 3F15A 2SRTA 3O2XA 3DL1A 3LKAA 2AYKA 3EHXA 1B8YA 3EDHA 1GE5A 3G5CA 2Y6DA 3G42A 1OMJA 5D7WA 2JNPA 3KECA 1GXDA 1MMQA 1OO9A 3HDBA 3TSKA 3LK8A 4JIJA 5I0LA 1ROSA 1XFWA 1K7GA 1JK3A 1KUIA 1KAPP 4PKQA 2OW0A 4IUWA 1GO7P 1D7XA 2OXWA 1JIZA 1OS2A 1FLSA 5L79A 3WV3A 2MZEA 3WV2A 4DPEA 2ERPA 3Q2HA 3TT4A 2MLSA 2D1NA 1DMTA 1GE7A 2N8RA 3N2UA 5D1TA 1FM1A 2OVZA 2CKIA 1G49A 3EDIA 3HB2P 1AF0A 1Y0VA 5BOYA 3BA0A 2WOAA 830CA 1EUBA 1QUAA 3DWBA 4I03A 4GWNA 966CA 4G9LA 3LJZA 2FV9A 2JSDA 1I73A 3KRYA 4A7BA 3K7NA 4PKWA 4GR3A 5CXAA 2DW0A 3DPEA 1R1JA 1BUDA 4WKEA 1YQYA 2RJQA 1KUGA 1CGLA 4FXQA 2JIHA 1CGEA 5I3MA 1UTZA 1UMSA 2DDYA 3I7IA 3WV1A 4A3WA 1EAKA 4WZVA 1AKLA 5LABA 2QPJA 1GE6A 4PKVA 3DTIA 1PWQA 1BIWA 4L63A 2WO8A 1R55A 2FV5A 2O3EA 2L0RA 1BQQM 1JANA 4IJOA 2OW1A 1Y8JA 1MNCA 1XUCA 3EWJA 3EHYA 2OXUA 3ELMA 3LIRA 1EB6A 4GR0A 4J4MA 3AYKA 3ZVSA 1GKDA 2WO9A 1CAQA 1G05A 2K2GA 4JP4A 2XS3A 2TCLA 1MMPA 1K7QA 4AXQA 2ERQA 1WNIA 2OY4A 1C7KA 2OW9A 1ND1A 5CUHA 1R1IA 2K9CA 1UEAA 2RJPA 3LGPA 3DSLA 1XAXA 3DNGA 1OM6A 4JA1A 3EDGA 1BZSA 1A85A 4XM7A 2DDFA 1YP1A 2DW1A 1CGFA 4H84A 1IAAA 3P1VA 1B3DA 3LEAA 1FBLA 1SLMA 3KMEA 4Q1LA 1KUFA 1C8TA 3VI1A 3AYUA 1ZP5A 5I2ZA 2A8HA 3K7LA 4FU4A 1ASTA 1JAPA 2W13A 3LUMA 4XBHA 2OI0A 3F17A 1UTTA 1IAGA 2X3CA 3NX7A 1BQOA 1BUVM 1CXVA 4I35A 1IACA 3U1RA 5JMYA 3USNA 4JQGA 3KEJA 3KEKA 2I47A 2MZHA 4IN9A 5B5OA 1BM6A 4GQLA 1AYKA 4XM8A 1A86A 456CA 3TVCA 3TS4A 4ILWD 5H8XA 1CQRA 1BKCA 1OZ9A 1ZXVA 3F16A 3F1AA 1SU3A 2OXZA 1ZXCA 4WK7A 1UMTA 3KMCA 5I4OA 4FVLA 5CZMA 3ZUKA 3GBOA 3ZXHA 1XFUA 1QICA 3HY7A 1JAQA 2X3AA 3N2VA 2W15A 1XFXA 1XFYA 2PJTA 1ZTQA 2XS4A 2X7MA 3LE9A 1YOUA 1D5JA 4PKRA 4JPAA 3P24A 2YUFA 3LQBA 2YB9A 1GKCA 3KHIA 1HFCA 3HYGA 5BPAA 1XFZA 1CIZA 1BKCE 2MLRA 3DTEA 4ON1A 4GWMA 1HTDA 5D1SA 2CLTA 1JKYA 1OS9A 1QIBA 3E8RA 1D8FA 3LJGA 1KUHA 1QIAA 2W0DA 2HU6A 4PKUA 4DD8A 2V4BA 3HBUP 3LQ0A 4GF1A 1XM5A 2OZRA 2AIGP 4H30A 4HX3A 1D8MA 3Q2GA 1KBCA 1O0TA 1XUDA 2MZIA 2USNA 3RTSA 3HY9A 1HV5A 4H2EA 5BOTA 1J7NA 3F18A 1O0QA 4FXYP 1YCMA 4AIGA 5I43A 2Z2DA 2D1OA 4QKZA 4AYKA 1L6JA 1R1HA 3V96B 4L7AA 3L0VA 2J0TA 2X3BA 3B92A 2POJA 4R3VA 1XURA 3SHIA 1Z3JA 3MA2A 1PWWA 1SMPA 1G9KA 3OHOA 1H71P 1BSWA 2J83A 4HMAA 1USNA 4CTHA 5L7FA 1RMZA 3VTGA 3DTKA 4DV8A 1CK7A 1G4KA 3UVCA 4GUYA 2E3XA 2E2DA 1ZVXA 2YIGA 1I76A 1JJ9A 5B5PA 1IAEA 4H49A 1XFVA 1IABA 4DF9A 3EDZA 1DTHA 1C3IA 1JH1A 3HBVP 4GR8A 1HFSA 2W12A 3LIKA 3LUNA 1JAOA 2KRJA 3B8ZA 1SRPA 1QJIA 1Y93A 1ZS0A 3O64A 1PWVA 4WKIA 1BKCI 2OVXA 4PKTA 1GO8P 1IADA 1OM7A 4EFSA 4L19A 1HY7A 1OM8A 5I12A 1SLNA 1PWPA 1SATA 4H1QA 3HDAP 5D2BA 1RM8A 3KWVC 4ZR5A 1G12A 2DW2A 3LMCA 4WF6A 1MMRA 3B2ZA 1KUKA 1MMBA 1R54A 1PWUA 3CKIA 1ATLA 1TVIA 2JT5A 1S4BP 1JIWP 4H82A 3F19A 3OHLA 4H76A 4XCTA 1Q3AA 2W14A 2OW2A 1HOVA 4L6TA 3L0TA 3RTTA 2OY2A 3LILA 3DPFA 1K7IA 3AIGA 1QJJA 4H3XA 4PKSA
chains in the Genus database with same CATH topology
4AUOA 4G0DA 2O36A 5D1UA 5D3CA 1I1IP 3LJTA 2EROA 2Y6CA 4XM6A 2JT6A 3I7GA 3F15A 2SRTA 3O2XA 3DL1A 3LKAA 2AYKA 3EHXA 1B8YA 3EDHA 1GE5A 3G5CA 2Y6DA 3G42A 1OMJA 5D7WA 2JNPA 3KECA 1GXDA 1MMQA 1OO9A 3HDBA 3TSKA 3LK8A 4JIJA 5I0LA 1ROSA 1XFWA 1K7GA 1JK3A 1KUIA 1KAPP 4PKQA 2OW0A 4IUWA 1GO7P 1D7XA 2OXWA 1JIZA 1OS2A 1FLSA 5L79A 3WV3A 2MZEA 3WV2A 4DPEA 2ERPA 3Q2HA 3TT4A 2MLSA 2D1NA 1DMTA 1GE7A 2N8RA 3N2UA 5D1TA 1FM1A 2OVZA 2CKIA 1G49A 3EDIA 3HB2P 1AF0A 1Y0VA 5BOYA 3BA0A 2WOAA 830CA 1EUBA 1QUAA 3DWBA 4I03A 4GWNA 966CA 4G9LA 3LJZA 2FV9A 2JSDA 1I73A 3KRYA 4A7BA 3K7NA 4PKWA 4GR3A 5CXAA 2DW0A 3DPEA 1R1JA 1BUDA 4WKEA 1YQYA 2RJQA 1KUGA 1CGLA 4FXQA 2JIHA 1CGEA 5I3MA 1UTZA 1UMSA 2DDYA 3I7IA 3WV1A 4A3WA 1EAKA 4WZVA 1AKLA 5LABA 2QPJA 1GE6A 4PKVA 3DTIA 1PWQA 1BIWA 4L63A 2WO8A 1R55A 2FV5A 2O3EA 2L0RA 1BQQM 1JANA 4IJOA 2OW1A 1Y8JA 1MNCA 1XUCA 3EWJA 3EHYA 2OXUA 3ELMA 3LIRA 1EB6A 4GR0A 4J4MA 3AYKA 3ZVSA 1GKDA 2WO9A 1CAQA 1G05A 2K2GA 4JP4A 2XS3A 2TCLA 1MMPA 1K7QA 4AXQA 2ERQA 1WNIA 2OY4A 1C7KA 2OW9A 1ND1A 5CUHA 1R1IA 2K9CA 1UEAA 2RJPA 3LGPA 3DSLA 3DNGA 1OM6A 4JA1A 3EDGA 1BZSA 1A85A 4XM7A 2DDFA 1YP1A 2DW1A 1CGFA 4H84A 1IAAA 3P1VA 1B3DA 3LEAA 1FBLA 1SLMA 3KMEA 4Q1LA 1KUFA 1C8TA 3VI1A 3AYUA 1ZP5A 5I2ZA 2A8HA 3K7LA 4FU4A 1ASTA 1JAPA 2W13A 3LUMA 4XBHA 2OI0A 3F17A 1UTTA 1IAGA 2X3CA 3NX7A 1BQOA 1BUVM 1CXVA 4I35A 1IACA 3U1RA 5JMYA 3USNA 4JQGA 3KEJA 3KEKA 2I47A 2MZHA 4IN9A 5B5OA 1BM6A 4GQLA 1AYKA 4XM8A 1A86A 456CA 3TVCA 3TS4A 4ILWD 5H8XA 1CQRA 1BKCA 1ZXVA 3F16A 3F1AA 1SU3A 2OXZA 1ZXCA 4WK7A 1UMTA 3KMCA 5I4OA 4FVLA 5CZMA 3ZUKA 3GBOA 3ZXHA 1XFUA 1QICA 3HY7A 1JAQA 2X3AA 3N2VA 2W15A 1XFXA 1XFYA 2PJTA 1ZTQA 2XS4A 2X7MA 3LE9A 1YOUA 1D5JA 4PKRA 4JPAA 3P24A 2YUFA 3LQBA 2YB9A 1GKCA 3KHIA 1HFCA 3HYGA 5BPAA 1XFZA 1CIZA 1BKCE 2MLRA 3DTEA 4ON1A 4GWMA 1HTDA 5D1SA 2CLTA 1JKYA 1OS9A 1QIBA 3E8RA 1D8FA 3LJGA 1KUHA 1QIAA 2W0DA 2HU6A 4PKUA 4DD8A 2V4BA 3HBUP 3LQ0A 4GF1A 2OZRA 2AIGP 4H30A 4HX3A 1D8MA 3Q2GA 1KBCA 1O0TA 1XUDA 2MZIA 2USNA 3RTSA 3HY9A 1HV5A 4H2EA 5BOTA 1J7NA 3F18A 1O0QA 4FXYP 1YCMA 4AIGA 5I43A 2Z2DA 2D1OA 4QKZA 4AYKA 1L6JA 1R1HA 3V96B 4L7AA 3L0VA 2J0TA 2X3BA 3B92A 2POJA 4R3VA 1XURA 3SHIA 1Z3JA 3MA2A 1PWWA 1SMPA 1G9KA 3OHOA 1H71P 1BSWA 2J83A 4HMAA 1USNA 4CTHA 5L7FA 1RMZA 3VTGA 3DTKA 4DV8A 1CK7A 1G4KA 3UVCA 4GUYA 2E3XA 2E2DA 1ZVXA 2YIGA 1I76A 1JJ9A 5B5PA 1IAEA 4H49A 1XFVA 1IABA 4DF9A 3EDZA 1DTHA 1C3IA 1JH1A 3HBVP 4GR8A 1HFSA 2W12A 3LIKA 3LUNA 1JAOA 2KRJA 3B8ZA 1SRPA 1QJIA 1Y93A 1ZS0A 3O64A 1PWVA 4WKIA 1BKCI 2OVXA 4PKTA 1GO8P 1IADA 1OM7A 4EFSA 4L19A 1HY7A 1OM8A 5I12A 1SLNA 1PWPA 1SATA 4H1QA 3HDAP 5D2BA 1RM8A 3KWVC 4ZR5A 1G12A 2DW2A 3LMCA 4WF6A 1MMRA 3B2ZA 1KUKA 1MMBA 1R54A 1PWUA 3CKIA 1ATLA 2JT5A 1S4BP 1JIWP 4H82A 3F19A 3OHLA 4H76A 4XCTA 1Q3AA 2W14A 2OW2A 1HOVA 4L6TA 3L0TA 3RTTA 2OY2A 3LILA 3DPFA 1K7IA 3AIGA 1QJJA 4H3XA 4PKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AUO A;  4G0D A;  2O36 A;  5D1U A;  5D3C A;  1I1I P;  3LJT A;  2ERO A;  2Y6C A;  4XM6 A;  2JT6 A;  3I7G A;  3F15 A;  2SRT A;  3O2X A;  3DL1 A;  3LKA A;  2AYK A;  3EHX A;  1B8Y A;  3EDH A;  1GE5 A;  3G5C A;  2Y6D A;  3G42 A;  1OMJ A;  5D7W A;  2JNP A;  3KEC A;  1GXD A;  1MMQ A;  1OO9 A;  3HDB A;  3TSK A;  3LK8 A;  4JIJ A;  5I0L A;  1ROS A;  1XFW A;  1K7G A;  1JK3 A;  1KUI A;  1KAP P;  4PKQ A;  2OW0 A;  4IUW A;  1GO7 P;  1D7X A;  2OXW A;  1JIZ A;  1OS2 A;  1FLS A;  5L79 A;  3WV3 A;  2MZE A;  3WV2 A;  4DPE A;  2ERP A;  3Q2H A;  3TT4 A;  2MLS A;  2D1N A;  1DMT A;  1GE7 A;  2N8R A;  3N2U A;  5D1T A;  1FM1 A;  2OVZ A;  2CKI A;  1G49 A;  3EDI A;  3HB2 P;  1AF0 A;  1Y0V A;  5BOY A;  3BA0 A;  2WOA A;  830C A;  1EUB A;  1QUA A;  3DWB A;  4I03 A;  4GWN A;  966C A;  4G9L A;  3LJZ A;  2FV9 A;  2JSD A;  1I73 A;  3KRY A;  4A7B A;  3K7N A;  4PKW A;  4GR3 A;  5CXA A;  2DW0 A;  3DPE A;  1R1J A;  1BUD A;  4WKE A;  1YQY A;  2RJQ A;  1KUG A;  1CGL A;  4FXQ A;  2JIH A;  1CGE A;  5I3M A;  1UTZ A;  1UMS A;  2DDY A;  3I7I A;  3WV1 A;  4A3W A;  1EAK A;  4WZV A;  1AKL A;  5LAB A;  2QPJ A;  1GE6 A;  4PKV A;  1PWQ A;  1BIW A;  4L63 A;  2WO8 A;  1R55 A;  2FV5 A;  2O3E A;  2L0R A;  1BQQ M;  1JAN A;  4IJO A;  2OW1 A;  1Y8J A;  1MNC A;  1XUC A;  3EWJ A;  3EHY A;  2OXU A;  3ELM A;  3LIR A;  1EB6 A;  4GR0 A;  4J4M A;  3AYK A;  3ZVS A;  1GKD A;  2WO9 A;  1CAQ A;  1G05 A;  2K2G A;  4JP4 A;  2XS3 A;  2TCL A;  1MMP A;  1K7Q A;  4AXQ A;  2ERQ A;  1WNI A;  2OY4 A;  1C7K A;  2OW9 A;  1ND1 A;  5CUH A;  1R1I A;  2K9C A;  1UEA A;  2RJP A;  3LGP A;  3DSL A;  3DNG A;  1OM6 A;  4JA1 A;  3EDG A;  1BZS A;  1A85 A;  4XM7 A;  2DDF A;  1YP1 A;  2DW1 A;  1CGF A;  4H84 A;  1IAA A;  3P1V A;  1B3D A;  3LEA A;  1FBL A;  1SLM A;  3KME A;  4Q1L A;  1KUF A;  1C8T A;  3VI1 A;  3AYU A;  1ZP5 A;  5I2Z A;  2A8H A;  3K7L A;  4FU4 A;  1AST A;  1JAP A;  2W13 A;  3LUM A;  4XBH A;  2OI0 A;  3F17 A;  1UTT A;  1IAG A;  2X3C A;  3NX7 A;  1BQO A;  1BUV M;  1CXV A;  4I35 A;  1IAC A;  3U1R A;  5JMY A;  3USN A;  4JQG A;  3KEJ A;  3KEK A;  2I47 A;  2MZH A;  4IN9 A;  5B5O A;  1BM6 A;  4GQL A;  1AYK A;  4XM8 A;  1A86 A;  456C A;  3TVC A;  3TS4 A;  4ILW D;  5H8X A;  1CQR A;  1BKC A;  1ZXV A;  3F16 A;  3F1A A;  1SU3 A;  2OXZ A;  1ZXC A;  4WK7 A;  1UMT A;  3KMC A;  5I4O A;  4FVL A;  5CZM A;  3ZUK A;  3GBO A;  3ZXH A;  1XFU A;  1QIC A;  3HY7 A;  1JAQ A;  2X3A A;  3N2V A;  2W15 A;  1XFX A;  1XFY A;  2PJT A;  1ZTQ A;  2XS4 A;  2X7M A;  3LE9 A;  1YOU A;  1D5J A;  4PKR A;  4JPA A;  3P24 A;  3LQB A;  2YB9 A;  1GKC A;  3KHI A;  1HFC A;  3HYG A;  5BPA A;  1XFZ A;  1CIZ A;  1BKC E;  2MLR A;  4ON1 A;  4GWM A;  1HTD A;  5D1S A;  2CLT A;  1JKY A;  1OS9 A;  1QIB A;  3E8R A;  1D8F A;  3LJG A;  1KUH A;  1QIA A;  2W0D A;  2HU6 A;  4PKU A;  4DD8 A;  2V4B A;  3HBU P;  3LQ0 A;  4GF1 A;  2OZR A;  2AIG P;  4H30 A;  4HX3 A;  1D8M A;  3Q2G A;  1KBC A;  1O0T A;  1XUD A;  2MZI A;  2USN A;  3RTS A;  3HY9 A;  1HV5 A;  4H2E A;  5BOT A;  1J7N A;  3F18 A;  1O0Q A;  4FXY P;  1YCM A;  4AIG A;  5I43 A;  2Z2D A;  2D1O A;  4QKZ A;  4AYK A;  1L6J A;  1R1H A;  3V96 B;  3L0V A;  2J0T A;  2X3B A;  3B92 A;  2POJ A;  4R3V A;  1XUR A;  3SHI A;  1Z3J A;  3MA2 A;  1PWW A;  1SMP A;  1G9K A;  3OHO A;  1H71 P;  1BSW A;  2J83 A;  4HMA A;  1USN A;  4CTH A;  5L7F A;  1RMZ A;  3VTG A;  4DV8 A;  1CK7 A;  1G4K A;  3UVC A;  4GUY A;  2E3X A;  2E2D A;  1ZVX A;  2YIG A;  1I76 A;  1JJ9 A;  5B5P A;  1IAE A;  4H49 A;  1XFV A;  1IAB A;  4DF9 A;  3EDZ A;  1DTH A;  1C3I A;  1JH1 A;  3HBV P;  4GR8 A;  1HFS A;  2W12 A;  3LIK A;  3LUN A;  1JAO A;  2KRJ A;  3B8Z A;  1SRP A;  1QJI A;  1Y93 A;  1ZS0 A;  3O64 A;  1PWV A;  4WKI A;  1BKC I;  2OVX A;  4PKT A;  1GO8 P;  1IAD A;  1OM7 A;  4EFS A;  4L19 A;  1HY7 A;  1OM8 A;  5I12 A;  1SLN A;  1PWP A;  1SAT A;  4H1Q A;  3HDA P;  5D2B A;  1RM8 A;  3KWV C;  4ZR5 A;  1G12 A;  2DW2 A;  3LMC A;  4WF6 A;  1MMR A;  3B2Z A;  1KUK A;  1MMB A;  1R54 A;  1PWU A;  3CKI A;  1ATL A;  2JT5 A;  1S4B P;  1JIW P;  4H82 A;  3F19 A;  3OHL A;  4H76 A;  4XCT A;  1Q3A A;  2W14 A;  2OW2 A;  1HOV A;  4L6T A;  3L0T A;  3RTT A;  2OY2 A;  3LIL A;  3DPF A;  1K7I A;  3AIG A;  1QJJ A;  4H3X A;  4PKS A; 
#chains in the Genus database with same CATH topology
 4AUO A;  4G0D A;  2O36 A;  5D1U A;  5D3C A;  1I1I P;  3LJT A;  2ERO A;  2Y6C A;  4XM6 A;  2JT6 A;  3I7G A;  3F15 A;  2SRT A;  3O2X A;  3DL1 A;  3LKA A;  2AYK A;  3EHX A;  1B8Y A;  3EDH A;  1GE5 A;  3G5C A;  2Y6D A;  3G42 A;  1OMJ A;  5D7W A;  2JNP A;  3KEC A;  1GXD A;  1MMQ A;  1OO9 A;  3HDB A;  3TSK A;  3LK8 A;  4JIJ A;  5I0L A;  1ROS A;  1XFW A;  1K7G A;  1JK3 A;  1KUI A;  1KAP P;  4PKQ A;  2OW0 A;  4IUW A;  1GO7 P;  1D7X A;  2OXW A;  1JIZ A;  1OS2 A;  1FLS A;  5L79 A;  3WV3 A;  2MZE A;  3WV2 A;  4DPE A;  2ERP A;  3Q2H A;  3TT4 A;  2MLS A;  2D1N A;  1DMT A;  1GE7 A;  2N8R A;  3N2U A;  5D1T A;  1FM1 A;  2OVZ A;  2CKI A;  1G49 A;  3EDI A;  3HB2 P;  1AF0 A;  1Y0V A;  5BOY A;  3BA0 A;  2WOA A;  830C A;  1EUB A;  1QUA A;  3DWB A;  4I03 A;  4GWN A;  966C A;  4G9L A;  3LJZ A;  2FV9 A;  2JSD A;  1I73 A;  3KRY A;  4A7B A;  3K7N A;  4PKW A;  4GR3 A;  5CXA A;  2DW0 A;  3DPE A;  1R1J A;  1BUD A;  4WKE A;  1YQY A;  2RJQ A;  1KUG A;  1CGL A;  4FXQ A;  2JIH A;  1CGE A;  5I3M A;  1UTZ A;  1UMS A;  2DDY A;  3I7I A;  3WV1 A;  4A3W A;  1EAK A;  4WZV A;  1AKL A;  5LAB A;  2QPJ A;  1GE6 A;  4PKV A;  3DTI A;  1PWQ A;  1BIW A;  4L63 A;  2WO8 A;  1R55 A;  2FV5 A;  2O3E A;  2L0R A;  1BQQ M;  1JAN A;  4IJO A;  2OW1 A;  1Y8J A;  1MNC A;  1XUC A;  3EWJ A;  3EHY A;  2OXU A;  3ELM A;  3LIR A;  1EB6 A;  4GR0 A;  4J4M A;  3AYK A;  3ZVS A;  1GKD A;  2WO9 A;  1CAQ A;  1G05 A;  2K2G A;  4JP4 A;  2XS3 A;  2TCL A;  1MMP A;  1K7Q A;  4AXQ A;  2ERQ A;  1WNI A;  2OY4 A;  1C7K A;  2OW9 A;  1ND1 A;  5CUH A;  1R1I A;  2K9C A;  1UEA A;  2RJP A;  3LGP A;  3DSL A;  1XAX A;  3DNG A;  1OM6 A;  4JA1 A;  3EDG A;  1BZS A;  1A85 A;  4XM7 A;  2DDF A;  1YP1 A;  2DW1 A;  1CGF A;  4H84 A;  1IAA A;  3P1V A;  1B3D A;  3LEA A;  1FBL A;  1SLM A;  3KME A;  4Q1L A;  1KUF A;  1C8T A;  3VI1 A;  3AYU A;  1ZP5 A;  5I2Z A;  2A8H A;  3K7L A;  4FU4 A;  1AST A;  1JAP A;  2W13 A;  3LUM A;  4XBH A;  2OI0 A;  3F17 A;  1UTT A;  1IAG A;  2X3C A;  3NX7 A;  1BQO A;  1BUV M;  1CXV A;  4I35 A;  1IAC A;  3U1R A;  5JMY A;  3USN A;  4JQG A;  3KEJ A;  3KEK A;  2I47 A;  2MZH A;  4IN9 A;  5B5O A;  1BM6 A;  4GQL A;  1AYK A;  4XM8 A;  1A86 A;  456C A;  3TVC A;  3TS4 A;  4ILW D;  5H8X A;  1CQR A;  1BKC A;  1OZ9 A;  1ZXV A;  3F16 A;  3F1A A;  1SU3 A;  2OXZ A;  1ZXC A;  4WK7 A;  1UMT A;  3KMC A;  5I4O A;  4FVL A;  5CZM A;  3ZUK A;  3GBO A;  3ZXH A;  1XFU A;  1QIC A;  3HY7 A;  1JAQ A;  2X3A A;  3N2V A;  2W15 A;  1XFX A;  1XFY A;  2PJT A;  1ZTQ A;  2XS4 A;  2X7M A;  3LE9 A;  1YOU A;  1D5J A;  4PKR A;  4JPA A;  3P24 A;  2YUF A;  3LQB A;  2YB9 A;  1GKC A;  3KHI A;  1HFC A;  3HYG A;  5BPA A;  1XFZ A;  1CIZ A;  1BKC E;  2MLR A;  3DTE A;  4ON1 A;  4GWM A;  1HTD A;  5D1S A;  2CLT A;  1JKY A;  1OS9 A;  1QIB A;  3E8R A;  1D8F A;  3LJG A;  1KUH A;  1QIA A;  2W0D A;  2HU6 A;  4PKU A;  4DD8 A;  2V4B A;  3HBU P;  3LQ0 A;  4GF1 A;  1XM5 A;  2OZR A;  2AIG P;  4H30 A;  4HX3 A;  1D8M A;  3Q2G A;  1KBC A;  1O0T A;  1XUD A;  2MZI A;  2USN A;  3RTS A;  3HY9 A;  1HV5 A;  4H2E A;  5BOT A;  1J7N A;  3F18 A;  1O0Q A;  4FXY P;  1YCM A;  4AIG A;  5I43 A;  2Z2D A;  2D1O A;  4QKZ A;  4AYK A;  1L6J A;  1R1H A;  3V96 B;  4L7A A;  3L0V A;  2J0T A;  2X3B A;  3B92 A;  2POJ A;  4R3V A;  1XUR A;  3SHI A;  1Z3J A;  3MA2 A;  1PWW A;  1SMP A;  1G9K A;  3OHO A;  1H71 P;  1BSW A;  2J83 A;  4HMA A;  1USN A;  4CTH A;  5L7F A;  1RMZ A;  3VTG A;  3DTK A;  4DV8 A;  1CK7 A;  1G4K A;  3UVC A;  4GUY A;  2E3X A;  2E2D A;  1ZVX A;  2YIG A;  1I76 A;  1JJ9 A;  5B5P A;  1IAE A;  4H49 A;  1XFV A;  1IAB A;  4DF9 A;  3EDZ A;  1DTH A;  1C3I A;  1JH1 A;  3HBV P;  4GR8 A;  1HFS A;  2W12 A;  3LIK A;  3LUN A;  1JAO A;  2KRJ A;  3B8Z A;  1SRP A;  1QJI A;  1Y93 A;  1ZS0 A;  3O64 A;  1PWV A;  4WKI A;  1BKC I;  2OVX A;  4PKT A;  1GO8 P;  1IAD A;  1OM7 A;  4EFS A;  4L19 A;  1HY7 A;  1OM8 A;  5I12 A;  1SLN A;  1PWP A;  1SAT A;  4H1Q A;  3HDA P;  5D2B A;  1RM8 A;  3KWV C;  4ZR5 A;  1G12 A;  2DW2 A;  3LMC A;  4WF6 A;  1MMR A;  3B2Z A;  1KUK A;  1MMB A;  1R54 A;  1PWU A;  3CKI A;  1ATL A;  1TVI A;  2JT5 A;  1S4B P;  1JIW P;  4H82 A;  3F19 A;  3OHL A;  4H76 A;  4XCT A;  1Q3A A;  2W14 A;  2OW2 A;  1HOV A;  4L6T A;  3L0T A;  3RTT A;  2OY2 A;  3LIL A;  3DPF A;  1K7I A;  3AIG A;  1QJJ A;  4H3X A;  4PKS A; 
#chains in the Genus database with same CATH homology
 4AUO A;  4G0D A;  2O36 A;  5D1U A;  5D3C A;  1I1I P;  3LJT A;  2ERO A;  2Y6C A;  4XM6 A;  2JT6 A;  3I7G A;  3F15 A;  2SRT A;  3O2X A;  3DL1 A;  3LKA A;  2AYK A;  3EHX A;  1B8Y A;  3EDH A;  1GE5 A;  3G5C A;  2Y6D A;  3G42 A;  1OMJ A;  5D7W A;  2JNP A;  3KEC A;  1GXD A;  1MMQ A;  1OO9 A;  3HDB A;  3TSK A;  3LK8 A;  4JIJ A;  5I0L A;  1ROS A;  1XFW A;  1K7G A;  1JK3 A;  1KUI A;  1KAP P;  4PKQ A;  2OW0 A;  4IUW A;  1GO7 P;  1D7X A;  2OXW A;  1JIZ A;  1OS2 A;  1FLS A;  5L79 A;  3WV3 A;  2MZE A;  3WV2 A;  4DPE A;  2ERP A;  3Q2H A;  3TT4 A;  2MLS A;  2D1N A;  1DMT A;  1GE7 A;  2N8R A;  3N2U A;  5D1T A;  1FM1 A;  2OVZ A;  2CKI A;  1G49 A;  3EDI A;  3HB2 P;  1AF0 A;  1Y0V A;  5BOY A;  3BA0 A;  2WOA A;  830C A;  1EUB A;  1QUA A;  3DWB A;  4I03 A;  4GWN A;  966C A;  4G9L A;  3LJZ A;  2FV9 A;  2JSD A;  1I73 A;  3KRY A;  4A7B A;  3K7N A;  4PKW A;  4GR3 A;  5CXA A;  2DW0 A;  3DPE A;  1R1J A;  1BUD A;  4WKE A;  1YQY A;  2RJQ A;  1KUG A;  1CGL A;  4FXQ A;  2JIH A;  1CGE A;  5I3M A;  1UTZ A;  1UMS A;  2DDY A;  3I7I A;  3WV1 A;  4A3W A;  1EAK A;  4WZV A;  1AKL A;  5LAB A;  2QPJ A;  1GE6 A;  4PKV A;  3DTI A;  1PWQ A;  1BIW A;  4L63 A;  2WO8 A;  1R55 A;  2FV5 A;  2O3E A;  2L0R A;  1BQQ M;  1JAN A;  4IJO A;  2OW1 A;  1Y8J A;  1MNC A;  1XUC A;  3EWJ A;  3EHY A;  2OXU A;  3ELM A;  3LIR A;  1EB6 A;  4GR0 A;  4J4M A;  3AYK A;  3ZVS A;  1GKD A;  2WO9 A;  1CAQ A;  1G05 A;  2K2G A;  4JP4 A;  2XS3 A;  2TCL A;  1MMP A;  1K7Q A;  4AXQ A;  2ERQ A;  1WNI A;  2OY4 A;  1C7K A;  2OW9 A;  1ND1 A;  5CUH A;  1R1I A;  2K9C A;  1UEA A;  2RJP A;  3LGP A;  3DSL A;  3DNG A;  1OM6 A;  4JA1 A;  3EDG A;  1BZS A;  1A85 A;  4XM7 A;  2DDF A;  1YP1 A;  2DW1 A;  1CGF A;  4H84 A;  1IAA A;  3P1V A;  1B3D A;  3LEA A;  1FBL A;  1SLM A;  3KME A;  4Q1L A;  1KUF A;  1C8T A;  3VI1 A;  3AYU A;  1ZP5 A;  5I2Z A;  2A8H A;  3K7L A;  4FU4 A;  1AST A;  1JAP A;  2W13 A;  3LUM A;  4XBH A;  2OI0 A;  3F17 A;  1UTT A;  1IAG A;  2X3C A;  3NX7 A;  1BQO A;  1BUV M;  1CXV A;  4I35 A;  1IAC A;  3U1R A;  5JMY A;  3USN A;  4JQG A;  3KEJ A;  3KEK A;  2I47 A;  2MZH A;  4IN9 A;  5B5O A;  1BM6 A;  4GQL A;  1AYK A;  4XM8 A;  1A86 A;  456C A;  3TVC A;  3TS4 A;  4ILW D;  5H8X A;  1CQR A;  1BKC A;  1ZXV A;  3F16 A;  3F1A A;  1SU3 A;  2OXZ A;  1ZXC A;  4WK7 A;  1UMT A;  3KMC A;  5I4O A;  4FVL A;  5CZM A;  3ZUK A;  3GBO A;  3ZXH A;  1XFU A;  1QIC A;  3HY7 A;  1JAQ A;  2X3A A;  3N2V A;  2W15 A;  1XFX A;  1XFY A;  2PJT A;  1ZTQ A;  2XS4 A;  2X7M A;  3LE9 A;  1YOU A;  1D5J A;  4PKR A;  4JPA A;  3P24 A;  2YUF A;  3LQB A;  2YB9 A;  1GKC A;  3KHI A;  1HFC A;  3HYG A;  5BPA A;  1XFZ A;  1CIZ A;  1BKC E;  2MLR A;  3DTE A;  4ON1 A;  4GWM A;  1HTD A;  5D1S A;  2CLT A;  1JKY A;  1OS9 A;  1QIB A;  3E8R A;  1D8F A;  3LJG A;  1KUH A;  1QIA A;  2W0D A;  2HU6 A;  4PKU A;  4DD8 A;  2V4B A;  3HBU P;  3LQ0 A;  4GF1 A;  2OZR A;  2AIG P;  4H30 A;  4HX3 A;  1D8M A;  3Q2G A;  1KBC A;  1O0T A;  1XUD A;  2MZI A;  2USN A;  3RTS A;  3HY9 A;  1HV5 A;  4H2E A;  5BOT A;  1J7N A;  3F18 A;  1O0Q A;  4FXY P;  1YCM A;  4AIG A;  5I43 A;  2Z2D A;  2D1O A;  4QKZ A;  4AYK A;  1L6J A;  1R1H A;  3V96 B;  4L7A A;  3L0V A;  2J0T A;  2X3B A;  3B92 A;  2POJ A;  4R3V A;  1XUR A;  3SHI A;  1Z3J A;  3MA2 A;  1PWW A;  1SMP A;  1G9K A;  3OHO A;  1H71 P;  1BSW A;  2J83 A;  4HMA A;  1USN A;  4CTH A;  5L7F A;  1RMZ A;  3VTG A;  3DTK A;  4DV8 A;  1CK7 A;  1G4K A;  3UVC A;  4GUY A;  2E3X A;  2E2D A;  1ZVX A;  2YIG A;  1I76 A;  1JJ9 A;  5B5P A;  1IAE A;  4H49 A;  1XFV A;  1IAB A;  4DF9 A;  3EDZ A;  1DTH A;  1C3I A;  1JH1 A;  3HBV P;  4GR8 A;  1HFS A;  2W12 A;  3LIK A;  3LUN A;  1JAO A;  2KRJ A;  3B8Z A;  1SRP A;  1QJI A;  1Y93 A;  1ZS0 A;  3O64 A;  1PWV A;  4WKI A;  1BKC I;  2OVX A;  4PKT A;  1GO8 P;  1IAD A;  1OM7 A;  4EFS A;  4L19 A;  1HY7 A;  1OM8 A;  5I12 A;  1SLN A;  1PWP A;  1SAT A;  4H1Q A;  3HDA P;  5D2B A;  1RM8 A;  3KWV C;  4ZR5 A;  1G12 A;  2DW2 A;  3LMC A;  4WF6 A;  1MMR A;  3B2Z A;  1KUK A;  1MMB A;  1R54 A;  1PWU A;  3CKI A;  1ATL A;  2JT5 A;  1S4B P;  1JIW P;  4H82 A;  3F19 A;  3OHL A;  4H76 A;  4XCT A;  1Q3A A;  2W14 A;  2OW2 A;  1HOV A;  4L6T A;  3L0T A;  3RTT A;  2OY2 A;  3LIL A;  3DPF A;  1K7I A;  3AIG A;  1QJJ A;  4H3X A;  4PKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...