1UU7A

Structure of human pdk1 kinase domain in complex with bim-2
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
286
structure length
280
Chain Sequence
b'QPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPRANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
publication title Interactions of Ly333531 and Other Bisindolyl Maleimide Inhibitors with Pdk1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 280
sequence length 286
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1uu7A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1uu7A02
4ZTSA 4I0RA 5FP5A 5TT7A 3HUBA 2WZJA 2C6KA 3F3WA 4LMNA 4YLLA 5EHYA 3CCNA 4RJ3A 4GUBA 4DGLC 5ANKA 5CEKA 2QOOA 4FT3A 1OITA 3KKVA 4ID7A 5HD4A 4EC9A 3RP9A 1P4OA 3AT3A 4FKJA 4Z55A 4ONAA 2WU7A 5KCVA 4AOTA 2PE0A 3P0MA 5ETCA 1A9UA 1WMKA 4HVDA 3T8OA 4FOBA 3U4WA 2YEXA 1UVRA 5JEBA 4O86A 3NUPA 3NDMA 3FKNA 4ITIA 5IUIA 3K5UA 1FMOE 3VBQA 5CI7A 3VUKA 1UA2A 2BIKB 4AW0A 3N4TA 4BBMA 4D2RA 1G3NA 3ULIA 5J7HA 2WPAA 2W05A 3IKAA 5HU3A 3QZFA 4WNKA 2JLDA 5B2LA 4BGQA 4DFXE 3DBDA 5HU9A 4ZZMA 1BL6A 2X7FA 2OGVA 3FZRA 2QCSA 2C1BA 3NMUF 4ACGA 1AGWA 2GNFA 5J9ZA 5AP3A 2WTJA 4FZ6A 2PVLA 1NVQA 2OG8A 4DGMA 2JDSA 2QC6A 1M17A 2QOKA 4FKWA 2WO6A 1VJYA 3BIZA 3O51A 3RHXA 4DITA 4N70A 2B9HA 4NIFA 1AD5A 1XBCA 3S4QA 1IA9A 3QHWA 4W4WA 5KMIA 4YSJA 2XKCA 5H9BA 2ZMDA 4CNHA 2QOHA 3UBDA 3TNHA 2HENA 1JSUA 5T3QA 2ZV7A 3SRVA 3CXWA 4BDKA 1H1SA 2EU9A 3CPCA 4EOSA 5EFQA 3AT4A 4IAZA 3GCQA 2QURA 3THBA 4HVHA 4BTJA 2W9FB 3EQHA 3LXLA 4W4VA 1OIQA 3MS9A 4UYAA 5DWRA 4AACA 2VNYA 2P3GX 2C6LA 1ZLTA 3C9WA 3WE4A 5DPVA 2R2PA 5FD2A 5ANEA 3R2YA 4FL3A 5T6KA 2WAJA 4EL9A 2CKOA 5CSWA 2GCDA 3MH0A 3OWPA 2C1AA 3TZ7A 4DG0E 2CLXA 4KIOA 2J6MA 3LCOA 4W4XA 3G33A 2R3RA 3KULB 4FSTA 4EZ3A 5CSXA 2X2KA 3NWWA 4FKRA 2Q0BA 4O22A 5CY3A 1YQJA 3QKKA 4FMQA 4E6QA 1ZYLA 3F5UA 3DOGA 4YJSA 5I9UA 2WTKC 3CIKA 5KMKA 3OBGA 4AZEA 4QYEA 3IG7A 3DQWA 3O8TA 4CG8A 1PMUA 4FKTA 4IVAA 4FGRA 2X81A 3T9TA 4GVJA 3TJDA 2I0HA 1WCCA 3SXSA 4H1MA 2OFVA 3LPBA 3QGWA 3FZOA 2J9MA 2CHLA 5AA9A 5BVEA 5AR5A 3IW5A 4UMUA 4XRJA 3OEZA 4M67A 3TKHA 4BF2A 3UTOA 3MY1A 5DA3A 4IJPA 2O3PA 5HBEA 2JD5A 4FSYA 3GBZA 4F4PA 3KXNA 4FV6A 3VS6A 1E1VA 3O8PA 3MVLA 4D4YA 3M42A 4N6ZA 3C4CA 3ZCLA 2EWAA 4IVBA 1YI3A 1LEZA 4UZDA 4WRSA 3TJCA 4WNOA 4E93A 4RIWB 1U4DA 5B7VA 3UJGA 5CI6A 3W2PA 4EYMA 4CLJA 2OH4A 1ZMWA 4LGDA 4ZY5A 5BYLA 5L8LA 1U5RA 2OBJA 4JRNA 3OW4A 1CKPA 4I4FA 3EN5A 3GVUA 5M07A 5EQPA 3H9FA 3NNVA 5KHWA 2JKOA 4TYGA 2C6OA 3QAME 1JQHA 3FMDA 4A9TA 4FL2A 4L6QA 2CMWA 2Y4IC 1KSWA 4GRBA 3R01A 4IB1A 5F9EA 5F4NA 1M2QA 4KIKB 3ZBXA 3ZO1A 3OUKA 3OC1A 3V8WA 3E7VA 4DEHA 2FH9A 3UPZA 4J53A 1H4LA 2YM5A 1ERKA 5KUPA 3BGZA 2ZJWA 4IANA 4O7RA 1U59A 4CG9A 2OO8X 4EQMA 2X4ZA 1OIYA 2YHVA 4QO9A 1BI8A 2BKZA 2XK7A 3MFUA 4QQJA 2XNGA 4W9WA 3OT3A 4ZMEA 4JAIA 4RJ6A 4FV0A 1YWRA 1AQ1A 4BCPA 1H8FA 2XNPA 3EKNA 5IQIA 2B55A 4EUTA 5DEYA 2PZPA 4YZDA 5HBJA 4QYFA 4E4XA 3E8DA 2W4JA 3IW7A 5KKRC 5J9LA 2YIXA 3G90X 3NGAA 5E8VA 3U8WA 3CP9A 3IDCA 2YDIA 4O7WA 5E8WA 1YXXA 3MH1A 2JIUA 5HNBA 4F1OA 2ZMCA 5ACKA 3HA8A 5JFWA 3IGGA 4FNZA 4FOCA 3G6HA 4X0MA 4ERWA 4FTNA 3ZUVA 4PPCA 1OL6A 2HZIA 4MEDA 2REIA 3K3JA 4CFFA 5AP7A 2UW6A 1VYZA 2BVAA 3VNTA 3ZRMA 4QQTA 3PWYA 2B7AA 4X2FA 4IM3A 5CTPA 5IA4A 4PL5A 1GZOA 3GC9A 3MPTA 3LFSA 4KBAA 5JGAA 5L2QA 5L2SA 1Y6AA 1YXTA 1IG1A 3WF6A 4QMWA 3QC4A 3SVVA 5CENA 3R73A 5HLWA 3WZUA 1OKWA 1Z5MA 3HP5A 5ETAA 4DH7A 2ZDUA 3F3UA 4J97A 1WBWA 4FKGA 4IZAA 1E1XA 1OL1A 2CGVA 2QU5A 3AC3A 5IU2A 2R7IA 2RFDA 1ZOEA 3D4QA 2VX3A 2DYLA 2JGZA 4UALA 4BCQA 2PU8A 3FYKX 3MIYA 4CVAA 2WQEA 5LOHA 4WOVA 3DPKA 3ENMA 3IOPA 3HV7A 3PLSA 1I44A 3Q52A 4ZSAA 3S3IA 4HGEA 5AMNA 4MWIA 4C2WA 1TQIA 1ZOGA 4GS6A 4JBVA 4YZMA 5TF9A 4C4IA 2PVMA 4EQCA 5IQFA 2PMNX 2XMYA 2YIRA 4FSUA 3MTLA 2JKQA 3ACKA 3FUPA 3QRKA 4J1RA 3MW1A 4R5YA 4EK8A 2PZYA 4JBPA 2UW9A 1ZY5A 2YITA 5FP6A 3L8XA 3ORIA 4X2JA 3SC1A 4L44A 3RAWA 5CWZA 2PK9A 3OTUA 3NYNA 2GNHA 4CZUA 5H2UA 2O65A 5LMAA 3ALNA 4J99A 4HPTE 3AG9A 2R9SA 4X2KA 2CKPA 4U45A 1STCE 3W55A 5I3RA 2HXLA 5M57A 1XO2B 1CKJA 3D0EA 5CEMA 4YC6A 2ZB1A 1DS5A 2A19B 2QU6A 5H8EA 5IDNA 3PVUA 2W5AA 4D58A 1M52A 3E8NA 3TN8A 4I5PA 4I6HA 4FTJA 1W7HA 5I0BA 4CFWA 4CMTA 4G6OA 3FL4A 4O0XA 3R7VA 3ZUTA 2BILB 4ZP5A 4NU1A 5A4QA 5M4CA 4F7SA 2VV9A 3ZZWA 2C5YA 3VRZA 2HZNA 2UW8A 2C0TA 3PVWA 4ORKA 3V6RA 3GFWA 2C6TA 4DINA 1VYWA 2JDTA 3QD0A 4S31A 5IDPA 1UV5A 2O63A 4U81A 3IDPA 2A0CX 2XRUA 3KXGA 1KV1A 3UOKA 4AP7A 1NVRA 4I94A 2XA4A 2UZUE 2YIWA 2ERZE 5EW8A 4AZWA 4DG2E 3A60A 3BYOA 4RIOA 3FKOA 5LQFA 4EH9A 4PMPA 4PNKA 3BHVA 5HNGA 3VHKA 2IVUA 3D5XA 4AT3A 4DFZE 4MNFA 4XG6A 4XH6A 5J79A 3E87A 3VS5A 4QTBA 3B2WA 2Y9QA 4Z7GA 4UMQA 1JKLA 2R3FA 4E5BA 1IRKA 4MK0A 4BWKA 3MY0A 4LGGA 1YVJA 4F0GA 5G1XA 1WVWA 5A6OA 5H8BA 1SM2A 1OZ1A 4DTKA 4E20A 4RJ8A 3BYUA 1QPEA 3NAYA 4P5QA 4YU2A 3NUAA 3AC2A 5C03A 1H1RA 1YHWA 3JR1A 2JIIA 2QD9A 3POOA 3VUHA 2GMXA 3CGFA 3NAXA 3QRIA 4F6SA 3BX5A 3HV4A 5EHOA 4EBWA 2VO6A 4ASXA 4Q9SA 2W1ZA 1DM2A 2BIYA 5LVOA 3EQPA 3LKMA 3OCTA 3KQ7A 3QUEA 4UX9A 4G1WA 1PJKA 3OXIA 1XJDA 4CQEA 4F64A 4YHJA 4FV4A 3A7IA 2XJ0A 4IB0A 4QP9A 2QQ7A 3KB7A 4CCUA 2WGJA 2X9EA 2HAKA 4PWNA 1XBAA 4PMSA 2YWPA 3RPSA 1JKSA 2DQ7X 4GK3A 2PZRA 4GW8A 3LCKA 4F08A 5A4TA 4Y5HA 3U9CA 1DAYA 2C6EA 3R8LA 3QYZA 3UC3A 4FKOA 4Y73A 3QXPA 3OBJA 4C4EA 3A8WA 4MYGA 2A4LA 2I7QA 4NFNA 3GCVA 4AFEA 1H0VA 4CV8A 3IGOA 4GSBA 2ITVA 3S95A 4C7TA 4RC2A 2WMTA 3JVSA 3MVMA 4FTAA 4YJPA 4PP7A 2XUUA 2CN8A 2UVXA 4MKCA 3PZEA 5CEPA 4DN5A 3ORPA 2RSVA 2W1DA 3COIA 5AR3A 1JSTA 4L3PA 1PRYA 2OZAB 3SGCA 3UIUA 2OIBA 2DWBA 3P79A 4IWQA 3VUIA 4EH6A 2QO7A 5B2KA 5JFVA 4FE2A 2VWYA 3HRFA 4YZCA 4GFGA 4AT4A 3KRRA 2UW0A 5ANDA 3P5KA 1M7NA 5BQ0A 2GTNA 3UQGA 3UO5A 3DFCB 3D5VA 4X21A 4YC8A 1XH6A 3NR9A 4AW2A 5JH6A 3PJ2A 4K11A 3PIYA 3QD3A 5JK3A 4DA5A 3TCPA 5C4LA 4RIYA 4YZ9A 1ND4A 2R3QA 1LEWA 3DKGA 4JVGA 3WARA 4F9BA 4FODA 2UZBA 4MXXA 4QQ5A 4ZTQA 1ZYCA 2EVAA 3FLSA 4QMNA 4O82A 1YXUA 1H25A 1R3CA 5CEIA 4ZZOA 3VUGA 3QL8A 2H8HA 1XKKA 2X9FA 3BLQA 3UOHA 3F9NA 3L9MA 3ZMMA 1NW1A 4U42A 3CLYA 3HNGA 5TOZA 2IW8A 3ZLWA 3FMJA 2WNTA 2FSTX 2SRCA 3BQCA 1OMWA 4GEOA 2Y6OA 4S30A 4LV5A 3ZLXA 1XR1A 2OZOA 2YN8A 4RWJA 3RPVA 3VJOA 5DI1A 1CSNA 1BX6A 2UZVA 2R5TA 4L52A 2WD1A 2Z2WA 4M13A 4DH5A 2HCKA 5L4QA 2Q83A 3LCTA 1JAMA 2JDOA 4Q5EA 3D5WA 4QYGA 4XNEA 3S0OA 2C3LA 4MNEB 1TQPA 5BMMA 3OY3A 3FI2A 3EQCA 5FM3A 4QD6A 2R0UA 2WMBA 2UW7A 4JQ8A 4WUNA 3FQEA 2F49A 3WZKA 4XG8A 4X6QC 4YJTA 1PMVA 5EK7A 2VU3A 3NEWA 3SXRA 3DB6A 3R8PA 4NTSA 4YJNA 4FI1A 4EZ5A 4I41A 3AC5A 4FSQA 4HNIA 4I1ZA 4B9DA 4OTDA 2XIRA 4R3RA 1OI9A 2Y4IB 4KWPA 3NW6A 2NO3A 5E1SA 3UMXA 1W0XC 4AW5A 4BHZA 5L6WL 5IMEA 2VTPA 3C0HA 4R7HA 2R3KA 2I0YA 2FA2A 3TV7A 1J1CA 4CEGA 5K5NA 2BMCA 5BMSA 4KAOA 3GCPA 1OGUA 4ACDA 2JC6A 4NWMA 4F9WA 3EQGA 2J0KA 4OGRA 3CR0A 3EB0A 3P7CA 1Y6BA 3RMFA 3DTWA 4GFOA 3SW4A 1PXIA 4JIAA 5CU6A 1REKA 3QTXA 2I1MA 3SQQA 4FSZA 4QP2A 4AGCA 3CQWA 4FV2A 4NKSA 3BPRA 5KKRB 5HO7A 3CTHA 3BV2A 5HTIA 3D7TA 3R9RA 3A62A 5EOLA 3QFVA 4XG4A 4QMQA 2PUUA 4EEVA 1ZMVA 3R1QA 4E73A 2R4BA 5I4NA 1OECA 4XUFA 3ZC6A 5CU0A 3PG1A 4PNIA 5IQHA 5KBRA 4BIEA 3C4WA 3Q4UA 1OKVA 1M7QA 3AMAA 1PXMA 4NIFB 4UWYA 4YURA 5IQBA 4OR5A 2J2IB 3ZUUA 2ETRA 4M69A 2QO2A 3QKMA 2WB8A 4USEA 4ACHA 1FVTA 5E8YA 3OP5A 4M14A 4APCA 3MJ2A 3D83A 5A4EA 4RLLA 3OVVA 5HE1A 1Q61A 3QZHA 3NYXA 4ZSEA 1QMZA 4NSTA 3B8RA 1BL7A 2XYNA 2Z7QA 1BUHA 3CBLA 5IH6A 2VTMA 3D7ZA 5M06A 2ITWA 2PTKA 4FG9A 3AD4A 3DJ7A 2UZLA 4I22A 4QNAA 3FC2A 2ITTA 4TNBA 4MH7A 4IH8A 4UXLA 3TNPC 2YDKA 4FIIA 3LFBA 5HG8A 5E4HA 1OUKA 4QPMA 3NZ0A 4B99A 3ZXTA 3E88A 4BDBA 4FEVA 3GP0A 4C61A 3VF8A 3KVXA 4NK9A 5IZFA 2R3IA 1BYGA 2XCHA 4IXPA 3ACJA 3EN4A 3Q4ZA 1KOBA 3ORMA 4IMYA 3VBYA 5HZNA 4YLKA 4M0YA 2I6LA 2VRXA 3RINA 1GOLA 3DBCA 2GTMA 2WOUA 2DUVA 5E8SA 3N4UA 4U40A 3TNWA 4BGHA 3FV8A 4AE6A 4ALVA 4NM7A 2C47A 4YTCA 2B1PA 5GJGA 3JY9A 5EW3A 3RBWA 4L01A 3V5PA 1KUTA 5IUHA 2X39A 1Z9XA 3R2BA 4F09A 4ZOGA 2NP8A 3A99A 5ETFA 3WZEA 5L8JA 3HGKA 5DNRA 1UKHA 3TV4A 2F9GA 1CDKA 2BAQA 2ZM3A 3EN7A 5AUUA 1J7IA 2Z02A 3DJ5A 2W7XA 5AP4A 2OJ9A 4FBXA 4FV9A 2OJGA 1JWHA 1XQZA 2OXXA 3SDJA 4C3PA 4GG7A 3W2SA 1PKDA 4EOQA 4RFZA 3EQFA 2XIYA 3ODZX 4G3CA 1PW2A 4TWNA 3ZS5A 4ACMA 1BI7A 5CYIA 5F95A 4D2WA 3ZFMA 4JG8A 4OTIA 4G6NA 4TYIA 1Q8TA 1H07A 3NLBA 5IA0A 3PLAE 5BYYA 4WUAA 3LCDA 5HD7A 4NL0A 1LPUA 2XKFA 2YIQA 3BYMA 4BICA 5DG5A 3RVGA 3GU7A 3PXRA 4FTQA 4AAAA 5M44A 5E90A 4DCAA 2RFNA 5AUWA 3PDTA 3HL7A 4F65A 3MYGA 3E8CA 3V8TA 4NW5A 4IFCA 3RM7A 4M0ZA 5DT4A 2Y7JA 3A7JA 3GQLA 5HLPA 3LM0A 2CCHA 4RZVA 2PUPA 2WHBA 4I4EA 3O17A 4Y95A 1PYEA 5D7AA 5FRIA 3VS1A 4JS8A 2BTSA 4U8ZA 1W8CA 5BVKA 3CSVA 4ZTHA 5CX9A 4N4SA 3DKOA 3VWAA 1IAJA 3QC9A 5KNJA 1APME 5EKNA 2CNQA 2Q0NA 2WMAA 3OCGA 4NTTA 4U6RA 3UZRA 3O96A 3CE3A 4NCTA 4RX7A 1MQ4A 4FA2A 1URWA 2X6EA 3OROA 3TDWA 4AA4A 1W98A 5HQ0A 5A54A 3D9VA 3EZVA 3QTWA 5E8UA 4C35A 2X8DA 4D4RA 1Y8YA 1WBVA 3NUSA 2XP2A 4O0RA 4X3FA 4CRLA 4CLIA 1PY5A 5AJQA 5JZNA 3Q04A 5LWMA 4WO5A 4TPTA 4O7NA 5T68A 4QP3A 2X2LA 5AAEA 4OTPA 3LQ8A 2XBAA 3FZPA 4OBPA 4KB8A 3DXPA 3C0GA 4LL5A 1ZAOA 2WMVA 5DT3A 4FTMA 1P14A 4QP7A 3U9NA 5AIRA 2PUNA 4RFYA 3H9OA 4YZNA 4C4JA 4DFUA 2QVSE 3R8MA 2YZLA 4JL9A 1Y57A 2PZIA 1KE9A 3L8SA 3SLSA 3DK7A 4G6LA 4Z16A 2P33A 3UQCA 3BQRA 3AGMA 1UU3A 2B9IA 2WXVA 4ZSLA 4FKLA 4ZTLA 3WIGA 3G5DA 5LCKA 4B8LA 4A9SA 1Q8ZA 1PXPA 5BVNA 3E3PA 1QPCA 1OPLA 1PXLA 2RG6A 1YKRA 4JOAA 4X6RA 4CZYB 2V5QA 3NCGA 5KO1A 4D2VA 3E3BX 5EYMA 5C27A 1ZY4A 3QTQA 5FXRA 3R1NA 3LFAA 4IAAA 4EJNA 3VBXA 4XG9A 3TTIA 1B39A 1H27A 1RDQE 5FXSA 2IZSA 4FV8A 2YCFA 4D2PA 3ATSA 4G16A 3I79A 4XP3A 4FT7A 5HCZA 4ASEA 2YFXA 4U41A 4EH7A 5CU3A 4WNMA 4E8AA 3BHUA 2JIVA 4QTAA 3Q6WA 3NUXA 4XV3A 4R3PA 3O7LB 4EK5A 3CY3A 5EYCA 5JFXA 1MQBA 3MA3A 4NM5A 4QTDA 4BCIA 4FT5A 4YO6A 4ZJVA 1P4FA 2IG7A 2ONLC 1XHAA 5EM7A 4OTQA 3VW8A 5DFPA 5EM6A 3FI8A 4NJ3A 4FTOA 5CF4A 1IAHA 4RX8A 4QP1A 4WA9A 4XG2A 2BZHB 4E26A 3TZ9A 3FEGA 4IC8A 1Q3WA 2RF9A 2X2MA 4JR3A 4ZTMA 4BDIA 2XNEA 3ZDIA 3LJ2A 3D14A 4DGNA 4I20A 4IJ9A 4BDFA 5LMBA 3WF7A 2HY0A 1XH7A 2OIDA 1TQMA 2GHGA 4O2PA 5AAFA 3SOAA 4AZTA 1UNLA 2ITUA 3KEXA 2EXEA 2G9XA 3WI6A 2F4JA 4HYSA 2HWPA 2W1GA 3PJ1A 3CQUA 5TO8A 2YM3A 3QU0A 4PQNA 4XRLA 4AGUA 3NW7A 5CASA 4MXOA 1YHVA 5D9HA 2X4FA 2XK8A 4OT6A 4O91A 5BUEA 5EOBA 3UVQA 3A2CA 3R0TA 4KKHA 5HLNA 4TW9A 4KIPA 3RK9A 3BHTA 3ORTA 3EOCA 3P08A 2E2BA 2AUHA 4C4FA 3QQFA 2VWXA 2ITOA 4XV9A 3UDBA 2ZAZA 4AT5A 2C4GA 5DN3A 4BI0A 2HWOA 4YUQA 3QWKA 1RW8A 2JEDA 2VO3A 3JS2A 3KXHA 1H1QA 2P55A 3ZZEA 3PXZA 4G17A 5KMMA 3OW3A 3R7YA 1YOJA 3W16A 4CMUA 3OUNB 3BEGA 4NCTC 1XH9A 3R30A 4CFXA 4D1XA 3OXTA 4EWQA 4F0IA 4TYHA 3TZ8A 3OF0A 3LVPA 3TZMA 5IKWA 4F7JA 1Q5KA 4I5HA 5ANGA 2VTOA 3RCJA 3U87A 4BCJA 1J7UA 3N4VA 4DC2A 3MI9A 5AP6A 3C4ZA 3GNIB 4PTCA 3CEKA 3UO6A 4QYYA 2ITPA 4AUAA 5CAVA 3I5ZA 1QL6A 3O0GA 3ANRA 3EJ1A 3QUPA 5BNJA 4J95A 5M55A 3HP2A 2Y6MA 3ORLA 4BDEA 3SD0A 4BKJA 4O0VA 2F57A 4AXAA 4RQKA 5AP1A 4QPSA 1GJOA 4GJ3A 3C4FA 3F5GA 1BKXA 1F0QA 2BDJA 5FDXA 3KU2A 1S9IA 2W4KA 3TT0A 5HVJA 1H1PA 4F7NA 3EFWA 4B0GA 2ETMA 4HNFA 4FVRA 3VBTA 1ZZ2A 2XCKA 4BTMA 3MTFA 5HGIA 2WTDA 5CNOA 2B0QA 2XIKA 4OTFA 2F2CB 4BZNA 1FVVA 3G51A 5GJDA 4LV8A 4FZ7A 5HE2A 3GQIA 1YDSE 4O0YA 1PYXA 4LL0A 5E1EA 3DKCA 3GENA 3P7BA 4EBVA 2OF2A 2XEZA 5JRSA 2UW5A 4RX5A 5DH3A 3UP7A 4HGSA 2QR8A 2P4IA 2XK3A 3IQ7A 1K9AA 1XH4A 4IVDA 3QCXA 5M53A 4CKJA 4ZLOA 4FKVA 2C30A 5C1QB 3PY0A 3CD3A 4XCUA 3ANQA 4APPA 3PXKA 3QLGA 3HECA 3GCSA 3PRFA 3HZTA 4FKUA 5FLFA 2IW9A 2NRYA 1BLXA 2CDZA 2QHMA 4KS7A 4MF1A 4ASZA 2KTYA 3A61A 5AV4A 4BKZA 4AU8A 2C6MA 4JDIA 4IZ7A 3CQEA 4O81A 4FIFA 3LM5A 3BEAA 1T45A 1K3AA 3C5UA 3DCVA 3WBLA 2CGXA 1B6CB 4EKKA 5AV1A 2YM6A 5CT0A 4ZY4A 5HTCA 4D1SA 3I0QA 4RIYB 4QMLA 2PVYA 2BFXA 4GT3A 5HO8A 3UODA 4R7IA 4F9AA 4IACA 4QQCA 5D7VA 4JLCA 4CZTA 1ZMUA 3NPCA 1F5QA 3VQHA 4NJDA 5DGZA 5CXZA 2WQOA 4UMRA 2QONA 2EUFB 5C9CA 3V5LA 1OBDA 3ZSHA 3RAKA 3QRUA 3VULA 3ENHA 3I0OA 3KRLA 3QD4A 2UV2A 4MXCA 4WD5A 5DRDA 4ENYA 3U51A 1CM8A 1FGKA 3MY5A 3L9NA 3PIXA 2OJFE 4FNYA 5DEWA 4ZEGA 3PP0A 3TIZA 3A7HA 4AW1A 5CALA 3OT8A 3CJGA 5D12A 3V5WA 3VRYA 4DHFA 3I6WA 3OS3A 3IW8A 2PL0A 2J0LA 4GK2A 5E91A 5HIDA 3GU4A 3GI3A 3BE9A 5CXHA 5AEPA 5AUZA 4TWPA 4CFUA 3DBEA 1SVGA 2W1HA 1VR2A 4L43A 2ZDTA 3R9DA 3R83A 4C57A 3COMA 3E93A 4CT1A 4A9RA 3QA0A 2JBOA 4V04A 2GPHA 2PHKA 4YTFA 4E6AA 1FINA 2XNOA 2GQRA 4LRKA 2NNWB 1LP4A 2XIXA 4JNWA 4NT4A 5D11A 5HVKA 4NM3A 3V51A 2VUWA 1KE5A 3C7QA 3PE2A 4LGHA 4RVKA 3ZDUA 4AE9A 4BWXA 3I7BA 3BE2A 1V0OA 2H34A 3VJNA 4FTRA 2WQMA 1YOMA 4G34A 5HNIX 2VTTA 2XNNA 2I40A 2YCQA 2A2AA 3QTUA 4DAWA 4EOKA 4O7LA 3W18A 4EONA 3EIDA 3W2CA 4ANSA 4TTHB 3FL5A 4BZDA 3C13A 4XP0A 2R3GA 4Y8DA 2B9FA 2C5XA 2BRBA 4FX3A 1JPAA 3VO3A 1GZ8A 3DU8A 3R63A 3REPA 3ULZA 5FG8A 3UZTA 3CTQA 3PPZA 4GJ2A 1NY3A 5H8GA 3D7TB 4EH8A 2XM9A 2XS0A 3EFKA 4RZWA 5FWKK 4PDYA 5IQEA 3UC4A 3QQUA 3LFQA 4JG6A 3LJ0A 4S34A 2XEYA 4OTRA 1Q62A 2HYYA 4DG3E 4H1JA 5FUTA 3PVBA 4FT9A 4J8MA 2HZ4A 2HW6A 4TY1A 2DS1A 3QTIA 3HMNA 2GQGA 4NH1A 4M69B 5FEQA 3ZFXA 4D1ZA 3AOXA 4D4VA 2UZEA 3QX4A 2QG5A 4RFMA 3QD2B 1H0WA 1HOWA 3ZRKA 4A7CA 2BKKA 2YAAA 1E9HA 4AF3A 3HVCA 3BWFA 5EQEA 4L3JA 4UMTA 3PFQA 3NRMA 4RSSA 5CSPA 1J3HA 4B4LA 3RPRA 4XG3A 2HOGA 2O8YA 4FV5A 5ICPA 1WFCA 3FKLA 3GU5A 3RZBA 2VX1A 4AGDA 3KRWA 3PYYA 4JX3A 2XIZA 3FLNC 3JY0A 5CT7A 2VO0A 3DJ6A 3QQHA 3UOJA 4MVFA 3VBVA 3H4JA 2UUEA 4OBOA 4XOZA 3AD6A 5E8XA 3UO4A 3SXFA 3ZH8A 3QZIA 3ZO2A 4K9YA 4FR4A 3KGAA 3BELA 4FSMA 4G3DA 4I21A 5EHLA 5GHVA 5AV0A 2BALA 5F94A 1XH5A 2IZRA 4HJOA 1KE7A 2IN6A 3H0ZA 5J7BA 1OIUA 5GZAA 2CSNA 5C8MA 2ZVAA 3P7AA 2ZM1A 3MB7A 4CKIA 4DYMA 3D2IA 2QOCA 5L2IA 4CYIA 3U54A 2FUMA 3E92A 3AC8A 5BYZA 4L46A 3PXFA 3WF9A 5AFVA 4MD7E 3QQKA 3DDPA 4EH3A 2GU8A 2WMQA 5AR2A 5IEXA 4EHVA 2YABA 3FXWA 4EK4A 2RFSA 1WZYA 4PV0A 3ZO4A 3UNJA 3PJ8A 4ZLZA 5CEOA 2BAJA 2CNVA 2PVFA 2Z8CA 4ANLA 1QPJA 2XNMA 3LAUA 3F3TA 4BGGA 3OFMA 2WEIA 2XK9A 1WBTA 4EOOA 5CAOA 2PPQA 2BDWA 3D2KA 4JRVA 3PSCA 1KOAA 1L3RE 3ZLYA 3PPKA 4BCFA 2W5BA 4WBOA 3P23A 5CVFA 3RNYA 3ZEPA 4B6LA 4KD1A 4BCOA 4PPBA 4OUCA 4D9UA 3POZA 4RWLA 3PE1A 3QHRA 4RJ5A 4NW6A 2O2UA 3OWLA 5AM6A 3IK3A 4L7FA 4USDA 3EH9A 4GCJA 3H9RA 4RVLA 1REJA 4JDKA 5GJFA 3ZHPC 4E6CA 4YC3A 4EYJA 3S1HA 1JNKA 4KBKA 5FBNC 4YTIA 5J1VA 3I4BA 3Q96A 3VVHA 1NA7A 5I9YA 4FK6A 5LMKA 2W06A 3EN6A 4NKAA 1ZARA 3R02A 3G0FA 4PDPA 4YJVA 4A9UA 4C0TA 4OAVB 4E4NA 4HVGA 3F82A 4AOIA 3F69A 2H9VA 4WHZA 4TXCA 3SKCA 3OY1A 3I5NA 3TNQB 3LZBA 5C26A 2WIPA 3ZM9A 5ANJA 1FOTA 3RNIA 1SNUA 2R3LA 1B38A 3GU6A 3WE8A 4F70A 3F2RA 4FV1A 4DE4A 2OLCA 3HMIA 4RMZA 4O7YA 5J87A 5HICA 3PSDA 5CZHA 2C6IA 4MXYA 3ZU7A 2B9JA 2ESMA 1H01A 5FDPA 3BHYA 3FMEA 4ANMA 1ZOHA 4D5KA 3BYVA 3TKUA 5K5XA 3ORZA 3R00A 1ATPE 2G2FA 5CS6A 1ZYJA 3LQ3A 3F5PA 3HMPA 3KCKA 1SNXA 2VZ6A 3NS9A 2GQSA 1JSVA 4O7SA 4JI9A 4JG7A 4D55A 4GT4A 2C3JA 4QTEA 2R7BA 5CSVA 3ZXZA 2JAVA 4U3ZA 3R6XA 4MD8E 5EW9A 1VEBA 5DVRA 2H6DA 2IW6A 4X3FB 5CF6A 3FXXA 4JBQA 3VQUA 4F1TA 4Q9ZA 3SG8A 3DLZA 4K77A 5JFSA 4CMOA 1IEPA 5M4UA 3MESA 3QQJA 4CTBA 5TR6A 3OMVA 1Q99A 3Q4CA 4FSNA 3IO7A 3MVJA 4V0GA 3SAYA 5HOAA 1OL2A 3DBQA 2X7GA 4M3QA 3R22A 3VS4A 3FMKA 4WSQA 3EMGA 3TM0A 4EZ7A 4LM5A 2FB8A 4QYHA 3ORKA 3KXXA 4LYNA 3TL8A 4CD0A 3PJCA 2R3NA 4PMMA 3C4XA 4JDJA 3RWPA 3DA6A 3LIJA 2IVSA 3FQSA 3O50A 3AC1A 1R1WA 3HV5A 4KUJA 3BHHA 4BYJA 3U55A 1UKIA 5EKOA 1OB3A 2QR7A 3GCUA 3JVRA 5BVFA 4YJRA 5CQWA 4IEBA 2ZV2A 4D28A 2VWZA 1RE8A 3LE6A 4N6YA 2IPXA 2R3MA 1Q97A 4IAFA 5F1ZA 3R21A 5IF1A 2C68A 3LMHA 1GIJA 4RC3A 5AM7A 1Q8WA 1Q41A 3UYSA 4JBOA 4BDHA 5B0XA 4BN1A 4YBJA 3OZ6A 4FNXA 3I6UA 3QCQA 4RJ4A 4XBRA 5AIKA 5IMXA 1O6KA 3MB6A 3VC4A 3VUTA 2VTQA 4LOPA 4R5SA 5M4IA 3BU6A 2XF0A 3LXPA 3KFAA 4ZSJA 4C37A 4ZJIA 4Y83A 4HW7A 4XP2A 4AA0A 4Z7HA 5E8TA 3M2WA 5AUTA 5CAUA 4CSVA 2YISA 1OPJA 2G15A 5AUVA 1YWNA 5CEQA 4PRJA 4FKIA 1H00A 1URCA 2VTAA 4M12A 3EKKA 3FE3A 1MP8A 2C6DA 5AWMA 3UNZA 5I3OA 3C1XA 4CXAA 2UZOA 3QF9A 2H96A 4DBXA 1U54A 2GFSA 4O21A 4FL1A 4K6ZA 4O7ZA 3EFJA 2PWLA 3HX4A 5EI8A 1U5QA 4A4OA 4DT9A 4FUYA 4D0XA 4AFJA 4O0UA 4U3YA 4D2TA 4FYOA 2Y4PA 3COHA 4RBLA 4PY1A 5AX9A 4MTAA 3A4PA 1ZYSA 3QLFA 2J0MB 2YZAA 2J4ZA 4O2ZA 2W9ZB 4CTCA 3Q3BA 3A7GA 4LG4A 4PF4A 2VTSA 3ZLSA 2G2IA 3SRVB 4FK3A 4QPAA 4D9TA 5LMKC 1H24A 2JFMA 4DH8A 3HDMA 4BB4A 1DI9A 3F2NA 5FXQA 4JDHA 3NNXA 3BLHA 1JVPP 1U46A 2V7OA 4BI2A 2R3PA 5A6NA 3S2PA 5ITAA 1JKTA 5C8NA 2GNIA 5EG3A 3JPVA 2CGWA 4AS0A 2VWVA 2RFEA 4FC0A 5CU4A 4MBIA 5L8KA 4K2RA 4F0FA 3FXZA 1V0BA 3V6SA 1M2PA 2JBPA 2YA9A 4NZWB 4YHTA 4BVUA 4L8MA 3D15A 2YIYA 2VO7A 4DFBA 3BU5A 3JUHA 4YSMA 2BAKA 4W8DA 4BCNA 4FSRA 4QOXA 4AG8A 3E5AA 5A9UA 3H0YA 3TUCA 2W1EA 4ZS4A 5IH5A 4IX4A 4HVIA 4IFGA 4KKGA 4MBJA 2BPMA 2PVNA 3FLZA 3EQIA 3LFFA 3JYAA 2FVDA 5DR2A 4I5CA 3KK9A 4GK4A 3IONA 4JT3A 5LXMA 3A8XA 2PULA 2G1TA 2C0OA 4ALWA 2HZ0A 5FTGA 2ACXA 3QQGA 3GXLA 4IIRA 1JLUE 5DMZA 4F99A 4GUEA 4I24A 5JT2A 1A06A 3FZTA 3D94A 5IEVA 3JXWA 4FTCA 4HPUE 1H1WA 4LOOA 3BRBA 2J0JA 4QRCA 3KMWA 3VS2A 1PKGA 3ZRLA 3V5QA 1UWHA 3O8UA 2ITQA 5AA8A 2VTNA 3H3CA 3ITZA 4Q5HA 3PVGA 4O6LA 4R3CA 2C69A 3W32A 3ODYX 3DY7A 3OEFX 4H36A 4L53A 2HELA 4GVAA 4RRVA 5LVPA 1G8SA 5J5SA 3DLSA 4IAKA 3LMIA 4BDGA 4HGTA 3V5JA 2FSMX 5DR6A 3AC4A 5A46A 4R6VA 3E8EA 2RG5A 4KBCA 1YHSA 2B54A 2C5OA 5DLSA 5CAPA 5I9XA 5H3QA 3DBFA 1OKYA 2BRHA 3LW0A 4I0TA 3RPOA 3UQFA 4U44A 3MV5A 1H08A 2WMSA 1J91A 3KK8A 3QZGA 4KS8A 4FTLA 5CSHA 4ZS0A 5HTBA 2G2HA 4XV2A 3UNKA 2BZKB 1FMKA 2CJMA 3EZRA 4JQEA 5HE0A 3UP2A 4IZYA 2CGUA 3RALA 3V8SA 4TWCA 5CANA 3OCBA 2ZV9A 5EM5A 4ANQA 3CC6A 4EH2A 4H3QA 2OU7A 5IA1A 4RC4A 4AN3A 4ANOA 3QKLA 3R7OA 3UG1A 1RJBA 3UE4A 4O0WA 4G3EA 1K2PA 3DAJA 2QLQA 5M56A 2VGPA 4S33A 4KRDA 3PZHA 5LVLA 2GHMA 5JGBA 4DGOA 3TV6A 3QGYA 2E9OA 4BKYA 2ITYA 3CKWA 3F2AA 1DI8A 1OVEA 4DLJA 3MDYA 1X8BA 4KIQA 4BWPA 3EQBA 4KSPA 4LMUA 4XLVA 1GIHA 1MRVA 1WBSA 4U80A 2CKQA 4YGAA 5KMJA 4M68A 4GT5A 4LI5A 3UGCA 1ZWSA 3VN9A 4WG3A 3UVPA 3FMNA 5AX3A 4ASDA 5IA5A 4EH5A 3DQXA 3F6XA 5CF5A 2PVJA 4O1PA 3LFNA 5CAQA 5KZIA 4NYEA 3BGPA 2CCIA 4L3LA 4PTGA 3KRXA 3W10A 2WTCA 2VGOA 2A27A 3CKXA 4AWIA 4CKRA 1HCKA 1W83A 5LARA 3MGYA 3MJ1A 3R9NA 5D10A 4FGBA 3SOCA 3LMGA 4GIHA 2R64A 3GU8A 5CLPA 3B8QA 4YNEA 3UG2A 4BIDA 4EOLA 4MX9A 5AP0A 5J95A 5IQDA 4MCVA 3OG7A 1A48A 5BVWA 4O7TA 2RIOA 3KXZA 4C62A 1UU8A 1XBBA 1YWVA 4TKSA 3ZC5A 2JKMA 2C0IA 3DNDA 2NPQA 4W8EA 3KN6A 5AV3A 3UMWA 5EI6A 4ANNA 4O27B 3ORNA 2IVTA 3SA0A 1NVSA 4IWPA 3AQVA 4H3BA 1H28A 3RCDA 2CNUA 2IZTA 1S9JA 3AT2A 4XEYA 3MFSA 4H39A 2UZNA 4WT6A 2VD5A 4M84A 4O96A 3TIYA 3PA3A 4AX8A 3MA6A 4E6DA 4L7SA 4Y5QA 1ZRZA 2OICA 1H26A 2X0GA 3QTZA 3UOLA 3NUUA 4UXQA 5A4LA 3RPYA 3ZSGA 2QOIA 2PE2A 4YBKA 3W1FA 2QOFA 3A4OX 3R8VA 3MPMA 2X6DA 4QT1A 2VTLA 3QCYA 3HUCA 4RIXA 3RM6A 3GGFA 3IW4A 5LWNA 2E9VA 4FIJA 4L45A 3RZFA 3ZYAA 2YCSA 3DV3A 4UBAA 5IG1A 4CGAA 3BI6A 3L8PA 2VTRA 4AA5A 2WTWA 3CS9A 3K3IA 4ZXTA 3FY2A 5FM2A 4QMOA 2CKEA 4YTHA 4GMYA 3BBWA 2QHNA 3P78A 3UIMA 2XKEA 4JXFA 4AN2A 4ZLYA 3FLQA 3MWUA 4O6EA 1G5SA 2GS2A 1UNHA 3DK6A 3HYHA 1TVOA 2G01A 3HDNA 2OXDA 2P2IA 3G15A 3MFRA 1SZMA 3OHTA 5JKGA 2XZSA 4PDOA 4OLIA 4D2SA 4ZK5A 2PMOX 2GS6A 1KWPA 4YZBA 5AP5A 1EH4A 5HO6A 3Q9YA 4I93A 4BTKA 3NNUA 3R7IA 2FO0A 4AZFA 4BY9E 2WMWA 4A4XA 4BCHA 2UW3A 4XS2A 1R78A 2GS7A 4O1OA 3W8LA 4MWHA 3NVKI 2YJRA 3VIDA 3ZSIA 4KABA 3ZFYA 4TL0A 4J52A 4RWKA 1OBGA 2QOBA 1QCFA 4LQMA 4OAUC 4FZFB 3B2TA 1YXVA 3PWDA 2GDOA 4WSYA 4GU9A 4QMTA 2ITZA 1WVXA 1G8AA 4R1YA 4TRLA 4FVQA 4BDAA 4S32A 3R9OA 4BFMA 3KCFA 4X7QA 4G31A 3HMOA 1HCLA 3AGLA 3KMMA 4YJUA 1R0EA 3Q60A 3RK7A 2PVHA 4G5PA 2WTIA 4F7LA 3ALOA 4RLKA 3U6IA 5BUJA 1Q4LA 2B53A 5KBQA 2WTVA 4BBFA 4YMJA 5AADA 1FGIA 4X3FC 3HV3A 5CNNA 2P2HA 1WBOA 4IHPA 3RI1A 2R3JA 1ZXEA 3MH3A 4Z3VA 4O7VA 3TTJA 5E9EA 4IB3A 3BCEA 5DBXA 4PL4A 1WBNA 3PSBA 4IX6A 2AYPA 3DZQA 1DAWA 3OXZA 3K5VA 3PP1A 3QUDA 2WEVA 5C01A 5GIOE 3D5UA 4RGJA 3DXQA 5AR4A 4KSQA 2XM8A 3W2OA 1V1KA 4ITJA 4FV3A 4DLIA 3IECA 4FYNA 3SV0A 1GZKA 2VWBA 4LUDA 4EOIA 3QTRA 2V62A 3G9NA 3NX8A 1SYKA 4IZ5A 4Y85A 5AV2A 5LVMA 3A7FA 3W8QA 1PHKA 2XK4A 4YP8A 5HBHA 4QMPA 3O23A 2ETKA 4EHEA 2E9UA 5J1WA 4AZVA 3RGFA 4DEAA 4EK3A 3H30A 5GZ9A 5DYJA 5GIPE 4C4HA 1JOWB 2B52A 4RT7A 3KN5A 2J5EA 3S00A 4IAIA 4A4LA 1R0PA 2WU6A 3FI3A 2V22A 4M7IA 4ZAUA 3C51A 4MQ2A 4P4CA 5FBOA 2R3HA 4IC7A 4K0YA 3DS6A 3R9HA 4UEUA 5HG9A 3MSSA 4FKPA 4Z9LA 4YO4A 4IX3A 5LVNA 4FZDB 2WOTA 2EB2A 4HGLA 3OCSA 4IWDA 3NVMB 4EORA 4DT8A 2JDRA 4FG8A 3M11A 5HIEA 1GAGA 4WBBB 3RHKA 2UVZA 3FHRA 4F9YA 2JITA 1UWJA 4PX6A 2BUJA 5TE0A 3HEGA 2F7XE 3WF8A 4HCUA 2C5VA 4OBQA 2GNGA 4IM2A 4AN9A 4V0GB 5L3AA 2BZJA 2ZB0A 4GKHA 3C5IA 4L68A 2P0CA 4GIIA 4RA5A 4QMYA 3VAPA 1IR3A 3I60A 5DHJA 5A14A 2FYSA 2PY3A 4C2VA 3NSZA 3ZM4A 4BRXA 2BRNA 4HCTA 3FZ1A 3LFCA 4FNWA 4QP8A 2HIWA 1YI4A 1OPKA 4I6FA 1VZOA 4C34A 3EQRA 1I09A 2YJSA 3F66A 3P86A 4IBMA 3I7CA 4UY9A 4WIHA 5DIAA 4EH4A 5FGKA 3QRTA 3UPXA 5HG7A 4AOJA 3NNWA 4U7ZA 3V04A 5IA3A 1OM1A 4R77A 4BZOA 3G2FA 4ALUA 3LXNA 4MQ1A 2PMIA 3BU3A 2ZYBA 2V7AA 3CJFA 4TT7A 4HYUA 4I3ZA 5G6VA 3NIZA 3CTJA 4L00A 4QMZA 3KREA 5J5TA 3F7ZA 3FSFA 3LCSA 4S2ZA 2GFCA 3KVWA 4ENXA 1OL7A 4BL1A 3O2MA 3G6GA 3NUYA 2RKUA 3ORXA 4IX5A 4FEUA 3GEQA 3NYVA 4MBLA 3FPQA 3T3UA 4DEBA 4H05A 4U43A 3FSKA 4FIEA 4XX9A 3KA0A 3BLRA 3V3VA 1YDTE 5DR9A 4UN0C 4USFA 3G9LX 4I6QA 2W1CA 5HESA 5BVOA 3L1SA 5C8KA 2F7ZE 3QALE 2BRGA 4U79A 4UV0A 3TKIA 4DEGA 4JIKA 3KL8A 5ANIA 4RPVA 5KMLA 4FTIA 3MPAA 1U54B 3FHIA 4MF0A 4XG7A 5FTQA 3EHAA 4DFYA 2UZTA 3FZSA 5IISA 2QO9A 4B7TA 2HY81 2W1FA 3F3VA 4DEEA 3V5TA 3MFTA 3KF7A 4B8MA 4BHNA 3SX9A 2OIQA 2XYUA 1F3MC 4AGWA 4A06A 3AD5A 5L2WA 1O9UA 5E7RA 1PMNA 4TNDA 3Q4TA 4FSWA 3N9XA 2GSFA 5KMOA 3BYSA 3R04A 2PE1A 4F6UA 2BROA 4JQ7A 4TN6A 3R28A 5EDRA 2UZWE 3ID6C 4MD9E 3IOKA 4W9XA 4E5AX 3FMMA 5EDQA 1OUYA 4TZRA 4OTGA 4FEWA 3LFEA 4K1BA 4HZRA 3BV3A 3LLTA 3Q9ZA 2OJIA 2OW3A 1SVEA 5EQYA 1CMKE 1YOLA 2W4OA 4G5JA 4R8QA 4W4YA 2BHHA 2NRUA 3NUNA 4G3GA 3WYYA 3R7GA 2GHLA 4DEIA 4CV9A 3BGQA 3P4KA 3K54A 3QX2A 4LRMA 3ROYA 3Q9WA 5L2TA 3TWJA 3Q6UA 3T9IA 3NW5A 3U4UA 1GIIA 3PTGA 4YR8A 2J7TA 4X2GA 3ETAA 3TEIA 4BDCA 1O6LA 3LOKA 4Y72A 5KZ0A 2QOQA 5HE3A 2WKMA 3LLAA 5HI2A 4FF8A 5C4KA 2C3IB 3QBNA 1PXKA 4EOJA 3ZEWA 4BCMA 1OL5A 3O7LD 4LFIA 2FSLX 4GL9A 4NUSA 4RX9A 3TNIA 1W84A 4DBNA 2XRWA 4FTKA 3QRJA 4QMVA 4XOYA 2E9NA 3WIKA 5EI2A 4ANBA 4HYIA 4FEQA 5JQ8A 4H3PA 1OIRA 4BTFA 4D4SA 3GC8A 4IM0A 4RJ7A 3VBWA 5M51A 5K4JA 4DF3A 3RK5A 3PXQA 2OK1A 2W5HA 3PJ3A 4C4GA 3VS7A 3N51A 4IQ6A 3F5XA 3E62A 2A1AB 4ZTRA 4GV1A 2O5KA 2VTJA 3CPBA 4OTHA 3II5A 2JKKA 5A4CA 2EXCX 3LFDA 4FVPA 5JQ5A 4ERKA 1YXSA 5I9WA 3PRIA 1YDRE 4EUUA 2BTRA 3FLWA 3KULA 3VUMA 2WIHA 4OT5A 5CQUA 5EH0A 5JGDA 3WOWA 4C33A 4ARKA 5BPYA 1Y91A 1XH8A 1LR4A 3FAAA 3PY1A 2RL5A 3R8ZA 2EB3A 3T3VA 2WMXA 3GC7A 4V05A 2ERKA 4ZTNA 3OTVA 4K18A 4BYIA 2BHEA 2VWWA 4R78A 4C3FA 4DFNA 1SVHA 4EI4A 3U6HA 4C38A 3TUBA 5BVDA 1ZZLA 2XK6A 4M15A 3IS5A 4HZSA 2O64A 4J8NA 1QPDA 4TYJA 4G9CA 4XV1A 5DRBA 1PXNA 3RWQA 1FBNA 3H10A 5EM8A 4BDDA 4FIHA 5HCYA 2OJJA 3WILA 4N0SA 2W0JA 4LOQA 3OWKA 3W2RA 3DZOA 2C3KA 3AMYA 1CKIA 3TG1A 3C4EA 2KULA 2GNJA 3ZOSA 4MHAA 4DGGA 5D1JA 4RIWA 2I0EA 5AP2A 1W82A 4HOKA 5E92A 3C50A 3PUPA 4O0TA 2Z7LA 4HCVA 5HVYA 4FT0A 4E3CA 1KE8A 2OF4A 3GC0A 3L9PA 1TKIA 4KRCA 4RA4A 5BX0A 4LUEA 1UU9A 5HHWA 3FMLA 5KE0A 5FEEA 2FSOX 1WBPA 4JJRA 4ZMFA 3WF5A 2X8IA 4II5A 1IA8A 3QXOA 2WQBA 2YAKA 4XYFA 3GT8A 5HG5A 2QKRA 1CTPE 1SMHA 4P5ZA 4KIKA 4C02A 1PMEA 2JAMA 4C59A 4IADA 3R71A 4G9RA 1YRPA 3VUDA 4IAYA 2YACA 4KA3A 2IVVA 4GH2A 5ANOA 3VW6A 2WTKB 3GFEA 1FPUA 3EQDA 5A3XA 5ETIA 4C36A 3HA6A 5KMNA 3QQLA 3RAHA 2XH5A 4A07A 4CYJA 3EL8A 5I9ZA 4MAOA 4I5MA 3ATTA 4HVSA 2XB7A 5FTOA 3SHEA 4ZSGA 4RVMA 4A9YA 4HYHA 5HX8A 4D5HA 1KE6A 5TKDA 2J51A 4G3FA 3E63A 4JR7A 2VNWA 4RWIA 1KV2A 3FPMA 2WQNA 4P90A 4FUXA 4EKLA 3AMBA 2FGIA 4U0IA 3Q2JA 4CRSA 3FMHA 3C0IA 3F3ZA 4FIGA 2UZDA 3F88A 4QMUA 4EHZA 4L42A 3SG9A 2VTHA 3BBTB 4J71A 2XKDA 3FC1X 4O0SA 3HMMA 2BDFA 3KRJA 5EYDA 2X7OA 4J7BA 3UVRA 1NT2A 2BFYA 5EDPA 4X3JA 3VHEA 5IEYA 5DT0A 3WYXA 4UWBA 3I1AA 1M14A 1RQQA 2IJMA 4GG5A 4WRGA 1J7LA 2OI4X 4YNOA 2X1NA 3IDBA 3L9LA 3PXYA 4UWCA 4EWHA 5M4FA 4E4MA 1UNGA 2I0VA 2J50A 4U97A 4XMOA 2OXYA 1PXJA 3TACA 3EYGA 3COKA 3ZTXA 2QKWB 3Q2MA 4RIXB 5FEDA 4EQUA 3QYWA 4F6WA 2CPKE 1J1BA 3DKFA 5I5ZA 4FV7A 1T46A 2AC5A 4I23A 5K0XA 4CCBA 1MRUA 5K9IA 5L6OA 3KMUA 2QNJA 2OH0E 5AR8A 3M1SA 5DOSA 5HCXA 3TXOA 5B2MA 5K4IA 5ACBC 2Z7SA 4IDVA 3FJQE 3WZDA 2XJ2A 4GFMA 4DFLA 2Z7RA 1P5EA 2IZUA 2YCRA 2XJ1A 2ITNA 4XLIA 3TUDA 3DAKA 4DCEA 4E4LA 1YI6A 3Q53A 2VWIA 2Y0AA 1JBPE 1Q3DA 3DK3A 3ELJA 3TDVA 3KC3A 3G0EA 4X2NA 4CFNA 1Q8YA 3CY2A 5JN2A 5I9VA 3RJCA 5GINE 1O6YA 2GNLA 4RG0A 5K3YA 5EYKA 4CFMA 4YPDA 4BI1A 2VTIA 3GOKA 2R0IA 5GZ8A 1FQ1B 3NCZA 4RQVA 4DEDA 1R39A 4XBUA 2ZOQA 4UMPA 3R7UA 4DTAA 3ZONA 4QMMA 3HAMA 4WKQA 2PMLX 4WG4A 2OWBA 4PMTA 3OWJA 2X8EA 5IQAA 4BBEA 3P1AA 4XJ0A 1Q8UA 4GU6A 2W17A 4YLJA 5AUXA 4BDJA 1PXOA 4QNYA 5KX8A 4U5JA 3VS0A 5IPJA 1GY3A 4PP9A 2CN5A 3ET7A 3QCSA 4OW8A 5JSMA 4BIBA 5IQGA 3DT1A 4Q2AA 4I6BA 5HIBA 5J8IA 3EN9A 3NIEA 3ERKA 4C58A 4J96A 3RAIA 2YERA 4FICA 4BCKA 3LXKA 3DTCA 4IDTA 3PPJA 3F61A 5JMSA 3E7OA 5IUGA 4QTCA 3DNEA 4K8AA 5CVHA 4ZJJA 2IWIA 2YWVA 4R1VA 3NYOA 4I0SA 4TYHB 4D0WA 4O83A 4ACCA 5AAGA 2IO6A 3AXWA 5K0KA 2ZM4A 3K2LA 4YPSA 3VF9A 3RKBA 4ZZNA 5HEZA 4ZY6A 2QLUA 4BC6A 1MUOA 4GKIA 3UIXA 4FTUA 4QP6A 2ITXA 3IW6A 4OTWA 4C3RA 4EOMA 1MRYA 4PDSA 2J0IA 4CQGA 4R7BA 3GB2A 3UZPA 4QP4A 2VX0A 4YJQA 5AR7A 4I92A 4V01A 4F1MA 4WG5A 4J98A 4JX7A 4UZHA 2BRMA 3FYJX 3LHJA 4KNBA 3Q5ZA 4TWOA 4UB7A 5GNKA 3KY2A 4DTBA 4PTEA 3QA8A 4DH1A 3PG3A 4UYNA 3UYTA 2WMUA 1P2AA 3FI4A 3HLLA 4RVTA 3HRCA 3ZO3A 3R1YA 2CLQA 1UU7A 1FVRA 4E1ZA 4BR3A 4FKSA 5CU2A 2QI8A 3HAVA 5IA2A 3DAEA 3SW7A 2YM8A 1PF8A 3Q5IA 5LCJA 1WAKA 3KF4A 4G2FA 4NEUA 3P9JA 4H58A 5HKMA 3RTPA 3BWJA 4KKEA 5D41A 3FBVA 1ZYDA 3EFLA 3EYHA 4O38A 2W1IA 2J90A 4IW0A 4PPAA 4BCGA 4EC8A 2ONLA 2VAGA 5HX6A 5CVGA 3DFAA 2PUIA 2W99B 2BZIB 2F2UA 5IH4A 2OSCA 5DE2A 2HK5A 4EOPA 3OOGA 3OOMA 4QMXA 3PIZA 4WNPA 1OKZA 1YW2A 3EWHA 1WVYA 4M66A 3R8UA 4C8BA 1XWSA 4E5WA 4MXAA 4Y46A 3I81A 3TI1A 5M08A 2HXQA 2OKRA 3MVHA 3BZ3A 2XNBA 3V01A 4KINA 1Z57A 2JFLA 4F9CA 3DGKA 2RGPA 2QG7A 2XVDA 2YM7A 1V0PA 4CFVA 3R1SA 5FQDC 3MN3A 3WZJA 5BUIA 4FTTA 4EJ7A 3FQHA 3HKOA 4M97A 4P2KA 3DXNA 2UVYA 2QODA 2B4SB 3MBLA 4L67A 5CZIA 2WFYA 3OD6X 2O0UA 3PY3A 3MH2A 2LAVA 1LUFA 3F7WA 3KXMA 4JAJA 4N57A 3UIBA 4EK6A 3Q32A 4IWOA 4M8TA 3GUBA 3E64A 1M2RA 2V55A 1Y8GA 2C5NA 2YDJA 4YHFA 1IASA 2HW7A 2JDVA 3BKBA 3QWJA 3FLYA 1GZNA 2J5FA 4FG7A 4ZIMA 2BR1A 5JRQA 2OZAA 2ZV8A 2PVRA 3W33A 2Z60A 4F63A 2OFUA 3CGOA 3LQ5A 4CT2A 4FZAB 5L6PA 1L8TA 3O71A 3DDQA 4ITHA 2E9PA 4IVCA 4PL3A 3Q9XA 4P7EA 4IB5A 4XHKB 5J9YA 5M09A 4U9AA 4MXZA 4O84A 4LRJA 4DH3A 3FWQA 2EXMA 2WELA 3EL7A 5E8ZA 3U6JA 3R7EA 5IQCA 3FDNA 4PUZA 3MIAA 2W96B 4QMSA 4GYIA 2BCJA 2V0DA 3CD8A 4IE9A 3HRBA 5CF8A 2F7EE 3LJ1A 4L9IA 3PA4A 3W2QA 4E7WA 2PZ5A 4FKQA 4TYEA 2UW4A 2AC3A 2PVKA 1GNGA 3QTSA 2VN9A 4FEXA 3ZBFA 2Y8OA 1NXKA 5KHXA 5LJJA 2XBJA 3IPHA 3PA5A 2PYWA 3HV6A 4AZSA 4EHGA 2LGCA 4NFMA 1BMKA 2YLEA 4K33A 4AQCA 2VWUA 5HORA 3L8VA 2YM4A 5F20A 2PSQA 2WMRA 3GOPA 3VS3A 3DB8A 1Q24A 2R3OA 4NM0A 4MNEA 4GYGA 5JZJA 1JKKA 3ROCA 4YJOA 2YLFA 2QOLA 3FY0A 5AUYA
chains in the Genus database with same CATH superfamily
4ZTSA 4I0RA 5FP5A 5TT7A 3HUBA 2WZJA 2C6KA 3F3WA 4LMNA 4YLLA 5EHYA 3CCNA 4RJ3A 4GUBA 4DGLC 5ANKA 5CEKA 2QOOA 4FT3A 1OITA 3KKVA 4ID7A 5HD4A 4EC9A 3RP9A 1P4OA 3AT3A 4FKJA 4Z55A 4ONAA 2WU7A 5KCVA 4AOTA 2PE0A 3P0MA 5ETCA 1A9UA 1WMKA 4HVDA 3T8OA 4FOBA 3U4WA 2YEXA 1UVRA 5JEBA 4O86A 3NUPA 3NDMA 3FKNA 4ITIA 5IUIA 3K5UA 1FMOE 3VBQA 5CI7A 3VUKA 1UA2A 2BIKB 4AW0A 3N4TA 4BBMA 4D2RA 1G3NA 3ULIA 5J7HA 2WPAA 2W05A 3IKAA 5HU3A 3QZFA 4WNKA 2JLDA 5B2LA 4BGQA 4DFXE 3DBDA 5HU9A 4ZZMA 1BL6A 2X7FA 1TFFA 2OGVA 3FZRA 2QCSA 2C1BA 3NMUF 4ACGA 1AGWA 2GNFA 5J9ZA 5AP3A 2WTJA 4FZ6A 2PVLA 1NVQA 2OG8A 4DGMA 2JDSA 2QC6A 4LDTA 1M17A 2QOKA 4FKWA 4BJJB 2WO6A 1VJYA 3BIZA 3O51A 3RHXA 4DITA 4N70A 2B9HA 4NIFA 1AD5A 1XBCA 3S4QA 1IA9A 3QHWA 4W4WA 5KMIA 4YSJA 2XKCA 5H9BA 2ZMDA 4CNHA 2QOHA 3UBDA 3TNHA 2HENA 1JSUA 5T3QA 2ZV7A 3SRVA 3CXWA 4BDKA 1H1SA 2EU9A 3CPCA 4EOSA 5EFQA 3AT4A 2XANA 4IAZA 3GCQA 2QURA 3THBA 4HVHA 4BTJA 2W9FB 3EQHA 3LXLA 4W4VA 1OIQA 3MS9A 4UYAA 5DWRA 4AACA 2VNYA 2P3GX 2C6LA 1ZLTA 3C9WA 3WE4A 5DPVA 2R2PA 5FD2A 5ANEA 3R2YA 4FL3A 5T6KA 2WAJA 4EL9A 2CKOA 5CSWA 2GCDA 3MH0A 3OWPA 2C1AA 3TZ7A 4DG0E 2CLXA 4KIOA 2J6MA 3LCOA 4W4XA 3G33A 2R3RA 3KULB 4FSTA 4EZ3A 2XAMA 5CSXA 2X2KA 3NWWA 4FKRA 2Q0BA 4O22A 5CY3A 1YQJA 3QKKA 4FMQA 4E6QA 1ZYLA 3F5UA 3DOGA 4YJSA 5I9UA 3TMOA 2WTKC 3CIKA 5KMKA 3OBGA 4AZEA 4QYEA 3IG7A 3DQWA 3O8TA 4CG8A 1PMUA 4FKTA 4IVAA 4FGRA 2X81A 3T9TA 4GVJA 3TJDA 2I0HA 1WCCA 3SXSA 4H1MA 2OFVA 3LPBA 3QGWA 3FZOA 1ST0A 2J9MA 2CHLA 5AA9A 5BVEA 5AR5A 3IW5A 4UMUA 4XRJA 3OEZA 4M67A 4O4EA 3TKHA 3UTOA 4BF2A 3MY1A 5DA3A 4IJPA 2O3PA 5HBEA 2JD5A 4FSYA 3GBZA 4F4PA 3KXNA 4FV6A 3VS6A 1E1VA 3O8PA 3MVLA 4D4YA 3M42A 4N6ZA 3C4CA 3ZCLA 2EWAA 4IVBA 3W0SA 1YI3A 1LEZA 4UZDA 4WRSA 3TJCA 4WNOA 4E93A 4RIWB 1U4DA 5B7VA 3UJGA 5CI6A 3W2PA 4EYMA 4CLJA 2OH4A 1ZMWA 4LGDA 4ZY5A 5BYLA 5L8LA 1U5RA 2OBJA 4JRNA 3OW4A 1CKPA 4I4FA 3EN5A 3GVUA 5M07A 5EQPA 3H9FA 3NNVA 5KHWA 2JKOA 4TYGA 2C6OA 3QAME 1JQHA 3FMDA 4A9TA 4FL2A 4L6QA 2CMWA 2Y4IC 1KSWA 4GRBA 3R01A 4IB1A 5F9EA 5F4NA 1M2QA 4KIKB 3ZBXA 3ZO1A 3OUKA 3OC1A 3V8WA 3E7VA 4DEHA 2FH9A 3UPZA 4J53A 1H4LA 3BLAA 2YM5A 1ERKA 5KUPA 3BGZA 2ZJWA 4IANA 4O7RA 1U59A 4CG9A 2OO8X 4EQMA 2X4ZA 1OIYA 2YHVA 4QO9A 1BI8A 2BKZA 2XK7A 3MFUA 4QQJA 2XNGA 4W9WA 3OT3A 4ZMEA 4JAIA 4RJ6A 4FV0A 1YWRA 1AQ1A 4BCPA 1H8FA 2XNPA 3EKNA 5IQIA 2B55A 4EUTA 5DEYA 2PZPA 4YZDA 5HBJA 4QYFA 4E4XA 3E8DA 2W4JA 3IW7A 5KKRC 5J9LA 2YIXA 3G90X 3NGAA 4AAYA 5E8VA 3U8WA 3CP9A 3IDCA 3BL7A 2YDIA 4O7WA 5E8WA 1YXXA 3MH1A 2JIUA 5HNBA 4F1OA 2ZMCA 5ACKA 3HA8A 5JFWA 3IGGA 4FNZA 4FOCA 3G6HA 4X0MA 4ERWA 4FTNA 3ZUVA 4PPCA 1OL6A 2HZIA 4MEDA 2AEGA 2REIA 3K3JA 4CFFA 5AP7A 2UW6A 1VYZA 2BVAA 3VNTA 3ZRMA 4QQTA 3PWYA 2B7AA 4X2FA 4IM3A 5CTPA 5IA4A 4PL5A 1GZOA 3GC9A 3MPTA 3LFSA 4KBAA 5JGAA 5L2QA 5L2SA 1Y6AA 1YXTA 1IG1A 3WF6A 4O4DA 4QMWA 3QC4A 3SVVA 4AXDA 5CENA 3R73A 5HLWA 3WZUA 1XMMA 1OKWA 1Z5MA 3HP5A 5ETAA 4DH7A 2ZDUA 3F3UA 4J97A 1WBWA 4FKGA 4IZAA 1E1XA 1OL1A 2CGVA 2QU5A 3AC3A 5IU2A 2R7IA 2RFDA 1ZOEA 3D4QA 2VX3A 2DYLA 2JGZA 4UALA 4BCQA 2PU8A 3FYKX 3MIYA 4CVAA 2WQEA 5LOHA 4WOVA 3DPKA 3ENMA 3IOPA 3HV7A 3PLSA 1I44A 3Q52A 4ZSAA 3S3IA 4HGEA 5AMNA 4MWIA 4C2WA 1TQIA 1ZOGA 4GS6A 4JBVA 4YZMA 5TF9A 4C4IA 2PVMA 4EQCA 5IQFA 2PMNX 2XMYA 2YIRA 4FSUA 3MTLA 2JKQA 3ACKA 3FUPA 3QRKA 4J1RA 3MW1A 4R5YA 4EK8A 2PZYA 4JBPA 2UW9A 1ZY5A 2YITA 5FP6A 3L8XA 3ORIA 4X2JA 3SC1A 4L44A 3RAWA 5CWZA 2PK9A 3OTUA 3NYNA 2GNHA 4CZUA 5H2UA 2O65A 5LMAA 3ALNA 4J99A 4HPTE 3AG9A 2R9SA 4X2KA 2CKPA 4U45A 1STCE 3W55A 5I3RA 2HXLA 5M57A 1XO2B 1CKJA 3D0EA 5CEMA 4YC6A 4JMQA 2ZB1A 1DS5A 2A19B 2QU6A 5H8EA 5IDNA 3PVUA 2W5AA 4D58A 1M52A 3E8NA 3TN8A 4I5PA 4I6HA 4FTJA 1W7HA 5I0BA 4CFWA 4CMTA 4G6OA 3FL4A 4O0XA 3R7VA 3ZUTA 2BILB 4ZP5A 4NU1A 5A4QA 5M4CA 4F7SA 2VV9A 3ZZWA 2C5YA 3VRZA 2HZNA 2UW8A 2C0TA 3PVWA 4ORKA 3V6RA 3GFWA 2C6TA 4DINA 3PUFC 1VYWA 2JDTA 3QD0A 4S31A 5IDPA 1UV5A 2O63A 4U81A 3IDPA 2A0CX 2XRUA 3KXGA 1KV1A 3UOKA 4AP7A 1NVRA 4I94A 2XA4A 2UZUE 2YIWA 2ERZE 5EW8A 4AZWA 4DG2E 3A60A 3BYOA 4RIOA 3FKOA 5LQFA 4EH9A 4PMPA 4PNKA 3BHVA 5HNGA 3VHKA 2IVUA 3D5XA 4AT3A 4DFZE 4MNFA 4XG6A 4XH6A 5J79A 3E87A 3VS5A 2X0QA 3B2WA 2Y9QA 4QTBA 4Z7GA 4UMQA 1JKLA 2R3FA 4E5BA 1IRKA 4MK0A 4BWKA 3MY0A 4LGGA 1YVJA 4F0GA 5G1XA 1WVWA 5A6OA 5H8BA 1SM2A 1OZ1A 4DTKA 4E20A 4RJ8A 3BYUA 4O4FA 1QPEA 3NAYA 4P5QA 4YU2A 3NUAA 3AC2A 5C03A 1H1RA 1YHWA 3JR1A 2JIIA 2QD9A 3POOA 3VUHA 2GMXA 3CGFA 3NAXA 3QRIA 4F6SA 3BX5A 3HV4A 5EHOA 4EBWA 2VO6A 4ASXA 4Q9SA 2W1ZA 1DM2A 2BIYA 5LVOA 3EQPA 3LKMA 3OCTA 3KQ7A 3QUEA 4UX9A 4G1WA 1PJKA 3OXIA 1XJDA 4CQEA 4F64A 4YHJA 4FV4A 3A7IA 2XJ0A 4IB0A 4QP9A 2QQ7A 3KB7A 4CCUA 2WGJA 2X9EA 2HAKA 4PWNA 1XBAA 4PMSA 2YWPA 3RPSA 1JKSA 2DQ7X 4GK3A 2PZRA 4GW8A 3LCKA 4F08A 5A4TA 4Y5HA 3U9CA 1DAYA 2C6EA 3R8LA 3QYZA 3UC3A 4FKOA 4Y73A 3QXPA 3OBJA 4C4EA 3A8WA 4MYGA 2A4LA 2I7QA 4NFNA 4QEBA 3GCVA 4AFEA 1H0VA 4CV8A 3IGOA 3UDSA 4GSBA 2ITVA 2IEWA 3S95A 4C7TA 4RC2A 2WMTA 3JVSA 3MVMA 4FTAA 4YJPA 4PP7A 2XUUA 2CN8A 2UVXA 4MKCA 3PZEA 5CEPA 4DN5A 3ORPA 2RSVA 2W1DA 3COIA 5AR3A 1JSTA 4L3PA 1PRYA 2OZAB 3SGCA 3UIUA 2OIBA 2DWBA 3P79A 4IWQA 3VUIA 4EH6A 2QO7A 5B2KA 5JFVA 4FE2A 2VWYA 3HRFA 4YZCA 4GFGA 4AT4A 3W0PA 3KRRA 2UW0A 5ANDA 3P5KA 1M7NA 5BQ0A 2GTNA 3UQGA 3UO5A 3DFCB 3D5VA 4X21A 4YC8A 1XH6A 3NR9A 4AW2A 5JH6A 3PJ2A 4K11A 3PIYA 3QD3A 5JK3A 4DA5A 3TCPA 5C4LA 4RIYA 4YZ9A 1ND4A 2R3QA 1LEWA 3DKGA 4JVGA 3WARA 4F9BA 4FODA 2UZBA 4MXXA 4QQ5A 4ZTQA 1ZYCA 2EVAA 3FLSA 4QMNA 4O82A 1YXUA 1H25A 1R3CA 5CEIA 4ZZOA 3VUGA 3QL8A 2H8HA 1XKKA 2X9FA 3BLQA 3UOHA 3F9NA 3L9MA 3ZMMA 1NW1A 4U42A 3CLYA 3HNGA 5TOZA 2IW8A 3ZLWA 3FMJA 2WNTA 2FSTX 2SRCA 3BQCA 1OMWA 4GEOA 2Y6OA 4S30A 4LV5A 3ZLXA 1XR1A 2OZOA 2YN8A 4RWJA 3RPVA 3VJOA 5DI1A 1CSNA 1BX6A 2UZVA 2R5TA 4L52A 2WD1A 2Z2WA 4M13A 4DH5A 2HCKA 5L4QA 2Q83A 3LCTA 1JAMA 2JDOA 4Q5EA 3D5WA 4QYGA 4XNEA 3S0OA 2C3LA 4MNEB 1TQPA 5BMMA 3OY3A 3FI2A 3EQCA 5FM3A 4QD6A 2R0UA 2WMBA 2UW7A 4JQ8A 4WUNA 3FQEA 2F49A 3WZKA 4XG8A 4X6QC 4YJTA 1PMVA 5EK7A 2VU3A 3NEWA 3SXRA 3DB6A 3R8PA 4NTSA 4YJNA 4FI1A 4EZ5A 4I41A 3AC5A 4FSQA 4HNIA 4I1ZA 4B9DA 4OTDA 2XIRA 4R3RA 1OI9A 2Y4IB 4KWPA 3NW6A 2NO3A 5E1SA 3UMXA 1W0XC 4AW5A 4BHZA 5L6WL 5IMEA 2VTPA 3C0HA 3AKLA 3NFFB 4R7HA 2R3KA 2I0YA 2FA2A 3TV7A 1J1CA 4CEGA 5K5NA 2BMCA 5BMSA 4KAOA 3GCPA 1OGUA 4ACDA 2JC6A 4NWMA 4F9WA 3EQGA 2J0KA 4OGRA 3CR0A 3EB0A 3P7CA 1Y6BA 3RMFA 3DTWA 3AKKA 4GFOA 3SW4A 1PXIA 4JIAA 5CU6A 1REKA 3QTXA 2I1MA 3SQQA 4FSZA 4QP2A 4AGCA 3CQWA 4FV2A 4NKSA 3BPRA 5KKRB 5HO7A 3CTHA 3BV2A 5HTIA 3D7TA 2ZFYA 3A62A 5EOLA 3R9RA 3QFVA 4XG4A 4QMQA 2PUUA 4EEVA 1ZMVA 3R1QA 4E73A 2R4BA 5I4NA 1OECA 2IF8A 4XUFA 3ZC6A 3PG1A 4PNIA 5CU0A 5IQHA 5KBRA 4BIEA 3C4WA 3Q4UA 1OKVA 1M7QA 3AMAA 1PXMA 4NIFB 4UWYA 4YURA 5IQBA 4OR5A 2J2IB 3ZUUA 2ETRA 4M69A 2QO2A 3QKMA 2WB8A 4USEA 4ACHA 1FVTA 5E8YA 3OP5A 4M14A 4APCA 3MJ2A 3D83A 5A4EA 4RLLA 3OVVA 5HE1A 1Q61A 3QZHA 3NYXA 4ZSEA 1QMZA 4NSTA 3B8RA 1BL7A 2XYNA 2Z7QA 1BUHA 3CBLA 5IH6A 2VTMA 3D7ZA 5M06A 2ITWA 2PTKA 4FG9A 3AD4A 3DJ7A 2UZLA 4I22A 4QNAA 3FC2A 2ITTA 4TNBA 4MH7A 4IH8A 4UXLA 3TNPC 2YDKA 4FIIA 3LFBA 5HG8A 5E4HA 1OUKA 4QPMA 3NZ0A 4B99A 3ZXTA 3E88A 4BDBA 4FEVA 3GP0A 4C61A 3VF8A 3KVXA 4NK9A 5IZFA 2R3IA 1BYGA 2XCHA 4IXPA 3ACJA 3EN4A 3Q4ZA 1KOBA 3ORMA 4IMYA 1W2DA 3VBYA 5HZNA 4YLKA 1OGYA 4M0YA 2I6LA 2VRXA 3RINA 1GOLA 3DBCA 2GTMA 2WOUA 2DUVA 5E8SA 3N4UA 4U40A 3TNWA 4BGHA 3FV8A 4AE6A 4ALVA 4NM7A 2C47A 4YTCA 2B1PA 5GJGA 3JY9A 5EW3A 3RBWA 4L01A 3V5PA 1KUTA 5IUHA 2X39A 1Z9XA 3R2BA 4F09A 4ZOGA 2NP8A 3A99A 5ETFA 3WZEA 5L8JA 3HGKA 5DNRA 1UKHA 3TV4A 2F9GA 1CDKA 2BAQA 2ZM3A 3EN7A 5AUUA 1J7IA 2Z02A 3DJ5A 2W7XA 5AP4A 2OJ9A 4FBXA 4FV9A 2OJGA 1JWHA 1XQZA 2OXXA 1XMLA 3SDJA 4C3PA 4GG7A 3W2SA 1PKDA 4EOQA 4RFZA 3EQFA 2XIYA 3ODZX 4G3CA 1PW2A 4TWNA 3ZS5A 4ACMA 1BI7A 5CYIA 5F95A 4D2WA 3ZFMA 4JG8A 4OTIA 4G6NA 4TYIA 1Q8TA 1H07A 3NLBA 5IA0A 3PLAE 5BYYA 4WUAA 3LCDA 5HD7A 4NL0A 1LPUA 2XKFA 2YIQA 3BYMA 4BICA 5DG5A 3RVGA 3GU7A 3PXRA 4FTQA 4AAAA 5M44A 5E90A 4DCAA 2RFNA 5AUWA 3PDTA 3HL7A 4F65A 3MYGA 3E8CA 3V8TA 4NW5A 4IFCA 3RM7A 4M0ZA 5DT4A 2Y7JA 3A7JA 3GQLA 5HLPA 3LM0A 2CCHA 4RZVA 2PUPA 2WHBA 4I4EA 3O17A 4Y95A 1PYEA 5D7AA 5FRIA 3VS1A 4JS8A 2BTSA 4U8ZA 1W8CA 5BVKA 3NFGB 3CSVA 4ZTHA 5CX9A 4N4SA 3DKOA 3VWAA 1IAJA 3QC9A 5KNJA 1APME 5EKNA 2CNQA 2Q0NA 2WMAA 3OCGA 4NTTA 4U6RA 3UZRA 3O96A 3CE3A 4NCTA 4RX7A 1MQ4A 4FA2A 1URWA 4DDGA 2X6EA 3OROA 3TDWA 4AA4A 1W98A 5HQ0A 5A54A 3D9VA 3EZVA 3QTWA 5E8UA 4C35A 2X8DA 4D4RA 1Y8YA 1WBVA 3NUSA 2XP2A 4O0RA 4X3FA 4CRLA 4O4CA 4CLIA 1PY5A 5AJQA 5JZNA 3Q04A 5LWMA 4WO5A 4TPTA 4O7NA 5T68A 4QP3A 2X2LA 5AAEA 4OTPA 3LQ8A 2XBAA 3FZPA 4OBPA 4KB8A 3DXPA 3C0GA 4LL5A 1ZAOA 2WMVA 5DT3A 4FTMA 1P14A 4QP7A 3U9NA 5AIRA 2PUNA 4RFYA 3H9OA 4YZNA 4C4JA 4DFUA 2QVSE 3R8MA 4QDVA 2YZLA 4JL9A 1Y57A 2PZIA 1KE9A 3L8SA 3SLSA 3DK7A 4G6LA 4Z16A 2P33A 3UQCA 3BQRA 3AGMA 3AKJA 1UU3A 2B9IA 2WXVA 4ZSLA 4FKLA 4ZTLA 3WIGA 3G5DA 5LCKA 4B8LA 4A9SA 1Q8ZA 3PFYA 1PXPA 5BVNA 3E3PA 1QPCA 1OPLA 1PXLA 2RG6A 1YKRA 4JOAA 4X6RA 4CZYB 2V5QA 3NCGA 5KO1A 4D2VA 3E3BX 5EYMA 5C27A 1ZY4A 3QTQA 5FXRA 3R1NA 3LFAA 4IAAA 4EJNA 3VBXA 4XG9A 2X0OA 3TTIA 1B39A 1H27A 1RDQE 5FXSA 2IZSA 4FV8A 2YCFA 4D2PA 3ATSA 4G16A 3I79A 4XP3A 4FT7A 5HCZA 4ASEA 2YFXA 4U41A 4EH7A 5CU3A 4WNMA 4E8AA 3BHUA 2JIVA 4QTAA 3Q6WA 3NUXA 4XV3A 4R3PA 3O7LB 4EK5A 3CY3A 5EYCA 5JFXA 1MQBA 3MA3A 4NM5A 4QTDA 4BCIA 4FT5A 4YO6A 4ZJVA 1P4FA 2IG7A 2ONLC 1XHAA 5EM7A 4OTQA 3VW8A 5DFPA 5EM6A 3FI8A 4NJ3A 4FTOA 5CF4A 1IAHA 4RX8A 4QP1A 4WA9A 4XG2A 2BZHB 4E26A 3TZ9A 3FEGA 4IC8A 1Q3WA 2RF9A 2X2MA 4JR3A 4ZTMA 4BDIA 2XNEA 3ZDIA 3LJ2A 3D14A 4DGNA 4I20A 4IJ9A 4BDFA 5LMBA 3WF7A 2HY0A 1XH7A 2OIDA 1TQMA 2GHGA 4O2PA 5AAFA 3SOAA 4AZTA 1UNLA 2ITUA 3KEXA 2EXEA 2G9XA 3WI6A 2F4JA 4HYSA 2HWPA 2W1GA 3PJ1A 3CQUA 5TO8A 2YM3A 3QU0A 4PQNA 4XRLA 4AGUA 3NW7A 5CASA 4MXOA 1YHVA 5D9HA 2X4FA 2XK8A 4OT6A 4O91A 5BUEA 5EOBA 3UVQA 3A2CA 3R0TA 4KKHA 5HLNA 4TW9A 4KIPA 3RK9A 3BHTA 3ORTA 3EOCA 3P08A 2E2BA 2AUHA 4C4FA 3QQFA 2VWXA 2ITOA 4XV9A 3UDBA 2ZAZA 4AT5A 2C4GA 5DN3A 4BI0A 2HWOA 4YUQA 3QWKA 1RW8A 2JEDA 2VO3A 3JS2A 3KXHA 1H1QA 2P55A 3ZZEA 3PXZA 4G17A 5KMMA 3OW3A 3R7YA 1YOJA 3W16A 4CMUA 3OUNB 3BEGA 4NCTC 1XH9A 3R30A 1W2CA 4CFXA 4D1XA 5BV3A 3OXTA 4EWQA 4F0IA 4TYHA 3TZ8A 3UDZA 3OF0A 3LVPA 3TZMA 5IKWA 4F7JA 1Q5KA 4I5HA 5ANGA 2VTOA 3RCJA 3U87A 4BCJA 1J7UA 3N4VA 4DC2A 3MI9A 5AP6A 3C4ZA 3GNIB 4PTCA 3CEKA 3UO6A 4QYYA 2ITPA 4AUAA 5CAVA 3I5ZA 1QL6A 3O0GA 3ANRA 3EJ1A 3QUPA 5BNJA 4J95A 5M55A 3HP2A 2Y6MA 3ORLA 4BDEA 3SD0A 4BKJA 4O0VA 2F57A 4AXAA 4RQKA 5AP1A 4QPSA 1GJOA 4GJ3A 3C4FA 3F5GA 1BKXA 1F0QA 2BDJA 5FDXA 3KU2A 1S9IA 2W4KA 3TT0A 5HVJA 1H1PA 4F7NA 3EFWA 4B0GA 2ETMA 4HNFA 4FVRA 3VBTA 1ZZ2A 2XCKA 4BTMA 3MTFA 5HGIA 2WTDA 5CNOA 2B0QA 2XIKA 4OTFA 2F2CB 4BZNA 1FVVA 3G51A 5GJDA 4LV8A 4FZ7A 5HE2A 3GQIA 1YDSE 4O0YA 1PYXA 4LL0A 5E1EA 3DKCA 3GENA 3P7BA 4EBVA 2OF2A 2XEZA 5JRSA 2UW5A 4RX5A 5DH3A 3UP7A 4HGSA 2QR8A 2P4IA 2XK3A 3IQ7A 1K9AA 1XH4A 4IVDA 3QCXA 5M53A 4CKJA 4ZLOA 4FKVA 2C30A 5C1QB 3PY0A 3CD3A 4XCUA 3ANQA 4APPA 3PXKA 3QLGA 3HECA 3GCSA 3PRFA 3HZTA 4FKUA 5FLFA 2IW9A 2NRYA 1BLXA 2CDZA 2QHMA 4KS7A 4MF1A 4ASZA 2KTYA 3A61A 5AV4A 4BKZA 4AU8A 2C6MA 4JDIA 4IZ7A 3CQEA 4O81A 4FIFA 3LM5A 3BEAA 1T45A 1K3AA 3C5UA 3DCVA 3WBLA 2CGXA 1B6CB 4EKKA 5AV1A 2YM6A 5CT0A 4ZY4A 5HTCA 4D1SA 3I0QA 4RIYB 4QMLA 2PVYA 2BFXA 4GT3A 5HO8A 3UODA 4R7IA 4F9AA 4IACA 4QQCA 5D7VA 4JLCA 2XALA 4CZTA 1ZMUA 3NPCA 1F5QA 3VQHA 4NJDA 5DGZA 5CXZA 2WQOA 4UMRA 2QONA 2EUFB 5C9CA 3V5LA 1OBDA 3ZSHA 3RAKA 3QRUA 3VULA 3ENHA 3I0OA 3KRLA 3QD4A 2UV2A 4MXCA 4WD5A 5DRDA 4ENYA 3U51A 1CM8A 1FGKA 3MY5A 3L9NA 3PIXA 2OJFE 4FNYA 5DEWA 4ZEGA 3PP0A 3TIZA 3A7HA 4AW1A 5CALA 3OT8A 3CJGA 5D12A 3V5WA 3VRYA 4DHFA 3I6WA 3OS3A 3IW8A 2PL0A 2J0LA 4GK2A 5E91A 5HIDA 3GU4A 3GI3A 3BE9A 5CXHA 5AEPA 5AUZA 4TWPA 4CFUA 1ST4A 3DBEA 1SVGA 2W1HA 1VR2A 4L43A 2ZDTA 3R9DA 3R83A 4C57A 3COMA 3E93A 4CT1A 4A9RA 3QA0A 2JBOA 4V04A 2GPHA 2PHKA 4YTFA 4E6AA 1FINA 2XNOA 2GQRA 4LRKA 2NNWB 1LP4A 2XIXA 4JNWA 4NT4A 5D11A 5HVKA 4NM3A 3V51A 2VUWA 1KE5A 3C7QA 3PE2A 4LGHA 4RVKA 3ZDUA 4AE9A 4BWXA 3I7BA 3BE2A 1V0OA 2H34A 3VJNA 4FTRA 2WQMA 1YOMA 4G34A 5HNIX 2VTTA 2XNNA 2I40A 2YCQA 2A2AA 3QTUA 4DAWA 4EOKA 4O7LA 3W18A 4EONA 3EIDA 3W2CA 4ANSA 4TTHB 3FL5A 4BZDA 3C13A 4XP0A 2R3GA 4Y8DA 2B9FA 2C5XA 2BRBA 4FX3A 1JPAA 3VO3A 1GZ8A 3DU8A 3R63A 3REPA 3ULZA 5FG8A 3UZTA 3CTQA 3PPZA 4GJ2A 1NY3A 5H8GA 3D7TB 4EH8A 2XM9A 2XS0A 3EFKA 4RZWA 5FWKK 4PDYA 5IQEA 3UC4A 3QQUA 3LFQA 4JG6A 3LJ0A 4S34A 2XEYA 4OTRA 1Q62A 2HYYA 4DG3E 4H1JA 5FUTA 3PVBA 4FT9A 4J8MA 2HZ4A 2HW6A 4TY1A 2DS1A 3QTIA 3HMNA 2GQGA 4NH1A 4M69B 5FEQA 3ZFXA 4D1ZA 3AOXA 4D4VA 2UZEA 3QX4A 2QG5A 4RFMA 3QD2B 1H0WA 1HOWA 3ZRKA 4A7CA 2BKKA 2YAAA 1E9HA 4AF3A 3HVCA 3BWFA 5EQEA 4L3JA 4UMTA 3PFQA 3NRMA 4RSSA 5CSPA 1J3HA 4B4LA 3RPRA 4XG3A 2HOGA 2O8YA 4FV5A 5ICPA 1WFCA 3FKLA 3GU5A 3RZBA 2VX1A 4AGDA 3KRWA 3PYYA 4JX3A 2XIZA 3FLNC 3JY0A 5CT7A 2VO0A 3DJ6A 3QQHA 4FRFA 4MVFA 3UOJA 3VBVA 3H4JA 2UUEA 4OBOA 4XOZA 3AD6A 5E8XA 3UO4A 3SXFA 3ZH8A 3QZIA 3ZO2A 2XAOA 4K9YA 4FR4A 3KGAA 3BELA 4FSMA 4G3DA 4I21A 5EHLA 5GHVA 5AV0A 2BALA 5F94A 1XH5A 2IZRA 4HJOA 1KE7A 2IN6A 3H0ZA 5J7BA 1OIUA 5GZAA 2CSNA 5C8MA 2ZVAA 3P7AA 2ZM1A 3MB7A 4CKIA 4DYMA 3D2IA 2QOCA 5L2IA 4CYIA 3U54A 2FUMA 3E92A 3AC8A 5BYZA 4L46A 3PXFA 3WF9A 5AFVA 4MD7E 3QQKA 3DDPA 4EH3A 2GU8A 2WMQA 1W2FA 5AR2A 5IEXA 4EHVA 2YABA 3FXWA 4EK4A 2RFSA 1WZYA 4PV0A 3ZO4A 3UNJA 3PJ8A 4ZLZA 5CEOA 2BAJA 2CNVA 2PVFA 2Z8CA 4ANLA 1QPJA 2XNMA 4F78A 3LAUA 3F3TA 4BGGA 3OFMA 4QDEA 2WEIA 2XK9A 1WBTA 4EOOA 5CAOA 2PPQA 2BDWA 3D2KA 4JRVA 3PSCA 1KOAA 1L3RE 3ZLYA 3PPKA 4BCFA 2W5BA 4WBOA 3P23A 5CVFA 3RNYA 3ZEPA 4B6LA 4KD1A 4BCOA 4PPBA 4OUCA 4D9UA 3POZA 4AXFA 4RWLA 3PE1A </