1UU7A

Structure of human pdk1 kinase domain in complex with bim-2
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
286
structure length
280
Chain Sequence
QPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPRANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
publication title Interactions of Ly333531 and Other Bisindolyl Maleimide Inhibitors with Pdk1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 280
sequence length 286
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1uu7A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1uu7A02
3E92A 4R5YA 1FVTA 5CSHA 4A9UA 1H27A 3G0EA 3I4BA 3PIXA 4GYIA 4KIPA 4BN1A 2JC6A 4YBKA 4JLCA 4QNYA 2CLXA 4DBNA 4FTTA 3Q60A 3OOGA 4U5JA 5IMEA 4CKIA 2QKRA 2WHBA 4FZDB 1XH9A 4FEVA 2QOOA 3HYHA 2VZ6A 3FZTA 4FG7A 1ZLTA 4M8TA 4OBOA 5AX9A 5EKOA 2VNWA 5C01A 4QYEA 3ORXA 4QMYA 4E4LA 2YIYA 4G3EA 3UODA 4LUDA 2KTYA 3BEGA 4YLKA 1ZY5A 2FGIA 1GNGA 2P3GX 5AA9A 2ZMDA 3R7VA 4MF1A 4CYIA 4YMJA 5M56A 3OF0A 4EJNA 4FBXA 5HQ0A 4DH3A 4GK2A 2FH9A 4H3BA 5JRSA 5LVLA 4ANQA 4EH8A 5M57A 3G15A 2QODA 4KRDA 2VTAA 4FSNA 4K8AA 4MNFA 3IGOA 1KOBA 4FNXA 4RWJA 3VS6A 3ZLYA 4EK8A 2ZB1A 4BGGA 5GJFA 2OF4A 4MYGA 4QMXA 5H9BA 5KKRB 4NUSA 3MFUA 2W5HA 5AP2A 3GCSA 3PSDA 4YHJA 3QQGA 5DLSA 5FTQA 3W2CA 4C02A 4F0FA 3BLRA 1G5SA 2CSNA 4QPMA 4CRLA 1H1QA 3FLNC 4FMQA 4V0GA 3UTOA 5KHXA 2PSQA 4EBWA 1OBGA 5DRBA 2IW8A 4FKTA 4BICA 1XJDA 2WTCA 3E5AA 3TWJA 3SVVA 2FO0A 3I1AA 3A8WA 4NCTA 4RFYA 1QMZA 3ORIA 4FSMA 1UNLA 5AUVA 4KD1A 5CVGA 3W33A 3ZOSA 5CU3A 1U4DA 5CX9A 4WSQA 4RFMA 4I5HA 2VX0A 4HNIA 4QPAA 4UEUA 4ID7A 3ANQA 1X8BA 3QTWA 4ZMEA 1XQZA 3FZ1A 2P2HA 3DJ6A 4TWPA 4RC2A 3N4VA 1T46A 4RX7A 3DB6A 1PXOA 3GC7A 4JRVA 4MAOA 4RFZA 1XBBA 5E1EA 3U87A 4QMVA 2UZBA 4JAIA 4DHFA 3GC8A 1ERKA 1FOTA 2OF2A 3IONA 4HGSA 3VNTA 3RALA 2RGPA 3BV2A 3P79A 2BKKA 1F0QA 4QP4A 3QYZA 2IZTA 3PUPA 4NCTC 1MP8A 5HG9A 1JPAA 5AR5A 1PHKA 4YJRA 2IWIA 3VUTA 2OJGA 5EKNA 1ZYJA 4NM0A 5FBNC 3HX4A 5EW8A 3P86A 1M2PA 2PE1A 3GNIB 5EYCA 1GZ8A 4QP2A 1BMKA 2IO6A 3ZLSA 4C8BA 5HVYA 2XM9A 3DAEA 4LQMA 4H3QA 3MJ2A 3EQDA 2R5TA 2JKOA 4F99A 3ZLWA 1DS5A 4I0TA 3EMGA 3MFRA 4ZTMA 3GXLA 3HA8A 4R3RA 1TQMA 4G5PA 5J5SA 5D7VA 3TNIA 2HY81 2ITWA 2CCIA 3FLWA 5FDPA 3I6UA 3NYVA 4FKWA 4S34A 3FXZA 3SOCA 3DBCA 3KU2A 4GIHA 3CSVA 4YZBA 3C4WA 4I41A 4EKKA 1YI4A 3QUPA 4FL2A 4CFNA 2YIWA 4KAOA 4U3ZA 3AMBA 1OPKA 4L68A 4UMUA 3Q4CA 1H4LA 3LIJA 2X2LA 5EYDA 4MKCA 1H1WA 4ACGA 4IFGA 3PJ1A 2BR1A 4GFGA 4JS8A 4WBOA 5DG5A 5ETIA 4CCUA 4L53A 5IQFA 3THBA 3HEGA 3FMLA 5BUIA 1CKPA 3NZ0A 2BZIB 1O9UA 4Q5HA 3CR0A 2VWXA 1OIUA 4DFZE 4AOTA 3EFLA 4BZDA 1XH6A 4DE4A 4L46A 5DH3A 1JOWB 3Q32A 2CMWA 2SRCA 1Q41A 3C4ZA 4ARKA 2BAKA 2VO7A 2F7ZE 3N4UA 3V5WA 4C38A 3NNUA 3MW1A 2XF0A 2VO6A 1KV1A 4G6NA 1XHAA 1WBNA 2ZOQA 1R78A 4USFA 3IW8A 3KRJA 3CY3A 2VWWA 4G1WA 4XH6A 2J5EA 4RLKA 1YXSA 2PY3A 4PP9A 3IS5A 3ZZWA 4DGGA 2GS6A 3ZSIA 4OR5A 5E9EA 1Q61A 2X7OA 5BVEA 4J7BA 4BTKA 3BBTB 2RFDA 5L8JA 3BBWA 3VUIA 3O51A 2V7AA 3IW7A 4IAKA 5A4TA 2QOLA 4YLJA 2AC5A 3A4OX 3QTRA 5A6NA 2P33A 3S0OA 5LMKC 3FEGA 4FEWA 5AR3A 1GY3A 4X2JA 3FYJX 2A19B 4IB3A 4NFNA 4GCJA 4BDDA 5HU3A 1WVXA 3FHRA 2W0JA 3LFCA 4F9CA 4YTIA 3CY2A 3VJNA 4KBKA 3TT0A 3E87A 4U8ZA 3H0YA 4TWCA 4KWPA 4G17A 5AP0A 4HCTA 2OH4A 4QP1A 1Q8WA 3ACJA 2R3PA 2C5XA 2JKQA 5DOSA 1TQIA 4FTUA 3HMMA 4XS2A 3QCSA 5JGAA 4Y46A 4E3CA 3D5WA 2RF9A 4F6UA 3TM0A 3AT4A 3OD6X 5IUHA 4WNKA 5BYZA 5IU2A 4QTEA 2OO8X 4QMLA 4NKAA 4R7BA 1ZMWA 5AR2A 4NJDA 4BKZA 2F57A 2YACA 3EQPA 4D4VA 2YLEA 4BDCA 4TYIA 2WXVA 5I3OA 1L8TA 2YFXA 2BPMA 4KRCA 3C4FA 4C7TA 3VBVA 4C62A 4CGAA 4M13A 4AA5A 5E8SA 3HRFA 3MS9A 4JQ8A 4JR3A 3Q2JA 3FC2A 3QQHA 3DLSA 2I7QA 5M08A 2BMCA 5DEYA 3ZSGA 3DXPA 5AWMA 3KK8A 4F7LA 2OFUA 4FTKA 4FL1A 5HO7A 3KCFA 2CDZA 3PJ3A 3I79A 4CNHA 2J51A 5DR9A 3W2QA 5HLPA 2XNGA 3O7LB 4BCFA 1SNXA 3U6JA 4KKGA 2OXDA 5EM7A 2DYLA 3UZRA 3RNIA 5KZIA 4WNOA 3L9NA 2B7AA 2JLDA 2WNTA 3GU8A 3KXZA 4BBEA 1OKVA 3I7BA 2QOHA 3LXNA 3SHEA 1JSVA 4UY9A 3DU8A 4XP0A 4KB8A 1URWA 4UYNA 1AD5A 5KBRA 4M15A 3U9NA 3D0EA 4H05A 3RWQA 1UVRA 4NW5A 4O0VA 4EC8A 4ERWA 4UMPA 4Z7HA 3SC1A 4ZZOA 5IQEA 1OECA 4E5BA 5EDRA 3S1HA 4YU2A 1MQBA 2HOGA 2HK5A 3C7QA 1ZOGA 1ZMUA 2BTRA 3MA6A 4V0GB 4FG9A 5D12A 4RJ3A 5HE1A 2JDOA 2QG5A 3F3WA 2GQSA 4EOMA 5M53A 4L7FA 2UW3A 4NEUA 1OM1A 4FKLA 4IIRA 4AT4A 3NIZA 3ORKA 3KRLA 2J90A 5FGKA 3H9FA 4C3RA 3UYTA 3R04A 2PMLX 1AQ1A 4G34A 3LQ3A 2CJMA 5T68A 3R8MA 3GENA 1H0WA 4TNBA 1G8SA 2C6IA 4QMSA 3A99A 3P08A 2WQNA 2ITTA 2XBAA 4GRBA 3NYOA 5DPVA 4F63A 3GI3A 5BQ0A 4GW8A 1SVGA 5J9ZA 2BAQA 4AN9A 4G6LA 2JKMA 4EQUA 2WTKC 1J91A 5CEKA 3KN5A 5CAQA 1CDKA 5AP5A 3R8VA 4H39A 4I4EA 4HZRA 4WT6A 1B6CB 3QUDA 4GSBA 5HTBA 1GAGA 3NVMB 2QD9A 4YTCA 2I1MA 4RX9A 4E26A 4RIWA 3H10A 2P0CA 3QC9A 5DI1A 4FK3A 4IDVA 3TTJA 4E4XA 4FOCA 4L42A 1H1PA 3CTQA 4GG7A 3MVHA 1NA7A 1H28A 1ZOEA 4YNEA 4F7NA 4FF8A 4L43A 1OPJA 5IA3A 3JY0A 5IQAA 5HTIA 2EUFB 5HBJA 3NNWA 3AC5A 1O6YA 5AM7A 3RCDA 5CF8A 2QHNA 4FVRA 3ACKA 2OGVA 4J97A 3VS5A 3PXFA 2Z60A 4ZJIA 4HVGA 3FUPA 3L1SA 4XLIA 5TKDA 4AGUA 2ONLC 3UNKA 3HDMA 3GCVA 2GDOA 2H34A 5CSXA 2ITOA 2OJIA 3HA6A 4DINA 4R78A 4FSZA 3FLSA 5FTOA 3BZ3A 3VW8A 2I0VA 3IK3A 3OT3A 5J7HA 3TUDA 3C4CA 5FM2A 2R3IA 3MH0A 4I0RA 4FV0A 5L6PA 5L8LA 4YSJA 2RG6A 3C50A 3RPVA 4ZTHA 3OXIA 3DFCB 1PKDA 2PZRA 5E8ZA 3T3VA 4AWIA 4NH1A 5FG8A 4CD0A 1OI9A 1WBTA 2BUJA 2CGVA 3PWYA 4JNWA 3TTIA 3ZBFA 3ENMA 5A4EA 4RBLA 4RPVA 4FICA 2BVAA 2GNJA 5CENA 3UVRA 5I4NA 1KUTA 3P4KA 4DC2A 2FSTX 3QTQA 4FZAB 4O86A 1JKLA 5HE0A 4FV7A 2EB3A 2PWLA 2WB8A 4QMUA 2W1DA 4O27B 4O6EA 1H25A 3LLTA 4AS0A 4JXFA 1XO2B 5KUPA 4A7CA 5IMXA 3QKMA 3Q04A 5M07A 1W84A 3FDNA 4PDOA 5K5XA 5AJQA 4C59A 3D83A 3ENHA 3JR1A 1OUYA 1WZYA 4QTAA 1QPJA 3BHTA 3OVVA 4QQCA 3TV6A 4IW0A 5CTPA 1ZARA 3HV5A 4FIEA 4HGTA 5DA3A 3VN9A 3O0GA 1ZZLA 4CZTA 3R8ZA 3ZC6A 4XG7A 3NAYA 5J1WA 4QP6A 3MFSA 4CFFA 4DAWA 2HCKA 4J1RA 4R7IA 3CE3A 3CGFA 4QYFA 4C2VA 3BIZA 4X3FC 5CI6A 4D2RA 3HMPA 1SVEA 3DLZA 5FEEA 2UUEA 2GTMA 4TYGA 1YKRA 4AN3A 4IC7A 3BEAA 4J52A 3EN4A 4FT0A 4FL3A 3R7OA 2WFYA 3UP7A 2O0UA 4I5PA 4ITIA 4PPAA 4FA2A 4GU6A 4BGHA 3UIMA 3QF9A 4USEA 3QQLA 1XWSA 2QQ7A 4FSUA 3O71A 4XNEA 5AP3A 5GHVA 4PPCA 2R3RA 4ZP5A 2GFCA 3S00A 1SNUA 1P2AA 2EVAA 5HIBA 3ZO2A 1OPLA 2V22A 2XJ0A 5CU0A 3NNVA 4MVFA 2HAKA 1Y57A 3OTVA 1BLXA 4QMZA 2WQOA 3ZM4A 1KSWA 3VVHA 4DF3A 5HZNA 5EDQA 5CXZA 4DG2E 2E9VA 1M2RA 2BRBA 4Z55A 3PWDA 3QL8A 4XEYA 5F20A 3I0OA 3QD4A 2AUHA 3EWHA 4DFXE 3I81A 3FLYA 3VBTA 3ZSHA 3F5PA 4RIXA 3PSCA 3QRUA 3K54A 4YC8A 3UDBA 3Q9ZA 3OT8A 3EZVA 4EH4A 4ZTQA 5BUJA 3T9IA 5CALA 5KMJA 4QRCA 5DEWA 4OTRA 5KHWA 3ZFMA 4IZAA 4AT5A 4CLIA 4DGNA 5L8KA 4DT8A 3LHJA 5GZAA 2QLQA 4C2WA 4LOQA 5DNRA 3IW5A 3R9DA 3W8QA 5HG7A 5D10A 4E6CA 1PY5A 3COMA 3E8EA 3ZM9A 1NVRA 4P7EA 1BL6A 2QU6A 1Q62A 3HZTA 4YSMA 5K0KA 5DWRA 3FY2A 5J9YA 3OP5A 1P4FA 3ZUVA 4BCQA 4C0TA 3I5ZA 1KWPA 4GG5A 3V5QA 1SYKA 2VTIA 3O50A 4AT3A 5JGBA 3RP9A 4PWNA 3COHA 1NXKA 1Q97A 2DS1A 4QTBA 4EOQA 4TTHB 1H8FA 5AP6A 5LWMA 5M06A 2JBPA 2RKUA 1P14A 3PE1A 2Z7SA 3CTHA 3GOKA 3NUPA 4X2GA 2OJ9A 1YWNA 4P2KA 3QWKA 2ITXA 2UW4A 3AD5A 3LCOA 4AFJA 4DFLA 5JFWA 4ZY4A 3TZMA 4BKYA 3NR9A 5JRQA 3QQKA 2W1HA 3FAAA 4Q5EA 2WMSA 4CFWA 2Z7LA 4XG9A 5HLNA 4DFYA 1FPUA 3D7TA 5E4HA 2R3QA 1M7QA 2VWBA 1KV2A 3NUUA 4EH3A 4TWNA 2W1IA 4IB1A 2F7XE 3MI9A 1RW8A 2BAJA 3GCQA 3MA3A 4U80A 4YZ9A 1A06A 4IFCA 1TVOA 3V04A 2BDFA 4EOLA 4FV2A 4FK6A 5FD2A 3MFTA 4EORA 1F3MC 2XA4A 3QKLA 3SDJA 5IQGA 3BE9A 3DKFA 5AV2A 2W1FA 3EH9A 4Y73A 2C6OA 2PUPA 3IGGA 5HIEA 3FLQA 4E8AA 3H3CA 4F7JA 5JFXA 3MYGA 3ZHPC 1WAKA 5I0BA 3OCTA 4DFNA 4E93A 5CVFA 5DR2A 3DQWA 2AYPA 2C6TA 2IJMA 4FTAA 5JT2A 3LFQA 4FEXA 4QMQA 3CJGA 5EYMA 2C30A 4RIWB 2X9EA 2WQEA 3BCEA 3OUKA 5AUXA 4C3FA 3F3VA 3OTUA 4RJ5A 4FIIA 3E7OA 3GT8A 3HV3A 2WMXA 2X6EA 4O0SA 3C4EA 4EWQA 3CXWA 5EOBA 4QYYA 5BVDA 4OTIA 3R9OA 4D5HA 3FWQA 3W55A 5CNNA 1ZAOA 2IZUA 5BNJA 3I0QA 5LMBA 3GCPA 4XG4A 2XRUA 2XNPA 3MH1A 5AV1A 4O91A 2A0CX 2WTIA 2ZB0A 4O82A 2XNBA 4LI5A 1UWJA 3LVPA 4QO9A 3WE8A 1REKA 2VTLA 1H0VA 3F2RA 5HD4A 1MUOA 3DXNA 3EN5A 3QX2A 2BILB 3RPOA 5ITAA 3LCSA 4EH9A 3S95A 4ZY5A 3HDNA 4C57A 4FV9A 5CASA 4XG8A 5F4NA 5H3QA 3D2KA 1JKTA 3ZRKA 4AZEA 2VTMA 4DTAA 4MX9A 4X2FA 3RINA 3DAJA 4CMOA 3F9NA 1H07A 3R63A 1Q8TA 5HTCA 1MRVA 3G6GA 3LJ0A 2UV2A 4F9BA 1PW2A 2JDSA 2OXXA 1XH8A 1GZKA 2FUMA 4JDHA 4U42A 2R2PA 4IADA 2A2AA 1XH5A 3A7GA 4ZMFA 4IZYA 4ZJVA 4O2ZA 4O0UA 2OIBA 3OC1A 3VBYA 1E1VA 3VS3A 4E20A 1OIQA 5EI6A 3DV3A 3RK9A 4CEGA 4D58A 2RIOA 5L3AA 1Q99A 4AZWA 4JG6A 2PZPA 3W16A 4GK3A 2X6DA 1NW1A 4BF2A 3LOKA 5K3YA 3CTJA 3OFMA 2PMIA 3WI6A 4CFMA 2YWVA 1MQ4A 2R3MA 4HVHA 2YDIA 4AGDA 4UX9A 3F3TA 2IW6A 2XKFA 2F9GA 4HVSA 3BGPA 4D1SA 4HZSA 2VRXA 4I3ZA 5DHJA 3KXXA 2X39A 3LXPA 3ANRA 3MSSA 4RSSA 3EJ1A 4JIAA 4X3JA 4K9YA 1UU8A 2C5YA 4LOPA 5J5TA 3PZHA 2C6LA 4ZIMA 4FV1A 3U8WA 4OUCA 3TNWA 3QGWA 5H2UA 3H9RA 2X81A 3PPJA 4LFIA 3RM7A 3AGLA 4BI0A 4D9TA 1P4OA 3N9XA 5E8UA 2XK8A 4MD8E 1R39A 5M4FA 1UNGA 4LG4A 4LL0A 4RVMA 3WARA 2JDTA 3QRJA 4B9DA 4CQGA 5H8EA 5T3QA 3QZFA 4GFMA 4W4YA 2EXCX 3FZPA 3LKMA 3DS6A 5C4KA 1FMOE 3CEKA 5CQWA 4FVQA 3N51A 1YOJA 4KS7A 2JFLA 3R9RA 3EL7A 4P90A 1YQJA 5KMOA 4EBVA 4P5ZA 3NGAA 1A48A 1Y6AA 4JG7A 4A4LA 3HAMA 4N57A 1PF8A 4MCVA 3CJFA 3ROCA 1PYEA 4XG6A 4F9YA 1PKGA 2UVXA 4M14A 4RIXB 4E4NA 3WBLA 4FZFB 4PTCA 4YLLA 1YXUA 3OXTA 4QQJA 4WSYA 1A9UA 1ZYLA 2W1CA 3QZGA 2BIYA 3ETAA 3BU3A 4IACA 1JSTA 3FMHA 3F5XA 2YCFA 4MD7E 3A61A 5EYKA 3U6IA 5KO1A 2G2FA 2XYUA 2HWPA 1Y6BA 2WELA 1M7NA 4V04A 5KBQA 5E92A 3UNJA 3E8NA 3FQSA 5HCZA 3PVWA 4YZCA 4FKJA 4J95A 3ZC5A 3DJ7A 4FV5A 4JBQA 1Q8UA 4K6ZA 3PSBA 4MBJA 4D55A 3VUMA 3C0IA 2BRGA 2E9OA 5KCVA 3MVLA 4Q9ZA 4U6RA 3PG1A 5BYYA 2GMXA 2VWUA 3BWJA 3K5VA 3LMGA 4YC3A 3HLLA 2X8EA 4N6YA 3VHEA 5KMLA 3ATTA 1I09A 3SW7A 5JZJA 4U0IA 4WRSA 2B53A 3UPXA 4I24A 2Q0NA 4L67A 4RZVA 4YURA 3Q4TA 3BV3A 5HOAA 4FTNA 2XIKA 1WCCA 4QP7A 4S30A 5HICA 5K0XA 4R3PA 3V5JA 3NUSA 4ACHA 3PJ2A 4JBOA 3KK9A 4IJPA 4FV8A 2GU8A 4OBPA 4RVKA 3U9CA 3ZYAA 2O8YA 4JX7A 4TYHA 4UXQA 4KSQA 5HD7A 4ALUA 4MQ1A 5AP7A 4FTLA 4E1ZA 3R7EA 5DT4A 4QT1A 3D7TB 3QRTA 4XBRA 4CTBA 3HNGA 2OWBA 5B2LA 4EZ7A 4DEHA 4LUEA 5I9YA 5E8XA 1ATPE 3R2BA 2HW7A 2WMRA 3V6RA 5C1QB 1YRPA 2B9FA 3A62A 2Z7RA 3DY7A 3Q4UA 2CGUA 3Q9YA 3QAME 3R8PA 3TG1A 3TZ9A 1L3RE 2OU7A 4FTRA 4R8QA 2XKEA 2YAKA 5IZFA 3NVKI 2O65A 2QOKA 4FKSA 1ZZ2A 1ZXEA 3ZDIA 3QCYA 2WU6A 4YNOA 4I20A 5TF9A 2Z02A 4ASXA 1PXLA 3AC2A 3MPMA 2J0JA 4XBUA 4YHFA 3MVMA 3SRVA 5K5NA 3FHIA 5HESA 5M51A 5HO8A 3ELJA 2BALA 4GUBA 4FI1A 4H1JA 2C5NA 2WD1A 4ZLOA 3R7UA 1Y8YA 2OG8A 2ZV9A 1ZRZA 2YCRA 4FTCA 4GT5A 1IG1A 2UW6A 4EHGA 3BHHA 3Q2MA 4XV9A 3QTUA 2W1ZA 4XP2A 5CQUA 3VF8A 1J1CA 1J7UA 3F61A 5IUIA 4IANA 1XH4A 2J5FA 4AA0A 3FXXA 2VGOA 3EKKA 3FQEA 2QI8A 2A4LA 2XZSA 3EZRA 3V8WA 3K5UA 4NTSA 4YP8A 3UQGA 4EL9A 2VTQA 5BUEA 3O2MA 3G90X 1H08A 3FMJA 5HI2A 1FGKA 3VUHA 3WZEA 4F0IA 2W5BA 3W2SA 1DAWA 2EXEA 4ZTSA 2B0QA 4HVIA 1PMEA 2C3IB 2J50A 4MXYA 1WBOA 2F7EE 2GHLA 3KXMA 2QOFA 4FSYA 5GZ9A 2E2BA 3ZONA 2G9XA 4EHVA 5CANA 4EI4A 2RG5A 2P4IA 4DFUA 4KA3A 4O1PA 4IZ7A 2WO6A 3LXLA 3O17A 4XP3A 1QPDA 3TNHA 3A7HA 4Y8DA 3VAPA 1BI8A 4AUAA 4EH5A 2PUUA 4W4VA 3TCPA 2Y4IB 5DGZA 3ZDUA 4CG9A 2EWAA 5C9CA 5IEVA 4EYMA 3R7IA 1W83A 5CAPA 2WAJA 4JOAA 5LCJA 4RQKA 4CYJA 4FSRA 5ACBC 2R7BA 2C4GA 2XK7A 3EKNA 3O8PA 4EOJA 1KOAA 3ORPA 3COKA 5I3RA 2I6LA 4TXCA 2XVDA 4R6VA 1OKZA 4IAZA 1PXKA 3DK7A 4S33A 1OL2A 2ZVAA 4GMYA 4JAJA 3T3UA 3U55A 2JEDA 2QURA 1H00A 5AR8A 2PZYA 1H01A 2Q0BA 3PLSA 3GU5A 4L3PA 1Z57A 3NUNA 3UBDA 1PXPA 2V7OA 5FP5A 5LMKA 2YM8A 3B2TA 5TO8A 4MWIA 2Y8OA 2J0LA 3HMOA 3POZA 2JD5A 4YJTA 3BHYA 2ITQA 2ETRA 2JKKA 1OIRA 4L00A 3V6SA 1J7LA 1M17A 2J7TA 2VN9A 4OTWA 3ROYA 1FVVA 1W8CA 2XNNA 5DN3A 3GOPA 4IBMA 4U81A 4W9WA 2G2IA 3P23A 3ZRLA 3CS9A 3OCBA 4XV2A 3UIXA 3UZTA 3PXQA 3MIAA 2E9PA 2HXQA 4EOIA 5BVNA 1Q8ZA 3LCKA 2OW3A 4YJNA 4A9YA 3E8DA 4BR3A 4DCAA 4ZK5A 4DG3E 1FMKA 4F9AA 2QOQA 3L8PA 3RHXA 2R0IA 3BLQA 3HV4A 5DVRA 4TYEA 4FE2A 4DN5A 4EQMA 3ODZX 2NRYA 5HLWA 5EH0A 3CD8A 4O1OA 3SOAA 3BX5A 3RZBA 2WTVA 4PP7A 2JBOA 4KSPA 2JFMA 3D5UA 3QKKA 2CKEA 4ZTRA 5JQ8A 5K9IA 1MRYA 5B2MA 3OWLA 3ORZA 4DA5A 4Z16A 2XKDA 3DXQA 2JAVA 3JXWA 1UNHA 2I0HA 5HVJA 5FXQA 3VJOA 1E9HA 1R0PA 3NSZA 5AM6A 2Y6MA 3GC9A 3RZFA 4JR7A 4ZS0A 4NWMA 4NM7A 3KXHA 4UMQA 4DG0E 2H8HA 2YAAA 4NW6A 3D5VA 4L7SA 4NKSA 1JKKA 4YO6A 2GQRA 5HO6A 4BCOA 3TIZA 4ANOA 4ZAUA 4FT3A 1F5QA 2UZLA 4GKIA 4I4FA 3UQCA 4C4FA 3GFEA 4IVBA 3R8LA 2B52A 5AV3A 4BHNA 4C61A 3OWJA 4APPA 4BCGA 4M69A 5IA4A 3R7YA 4ACCA 3PXZA 5ANKA 4CSVA 4ZOGA 4WBBB 2C1BA 4EZ3A 4ALVA 2G2HA 4M0YA 4DBXA 1APME 2Y4PA 4IH8A 5EOLA 5ETAA 4EUUA 1GIJA 3U4WA 4CLJA 2PL0A 2GNLA 1SMHA 4AGCA 4E5WA 2PU8A 3A7JA 3OW4A 4MBIA 4A4XA 4IEBA 4DLIA 2IVUA 4IQ6A 3D5XA 4JX3A 2OIQA 2C3KA 1WBWA 3DQXA 3AC3A 4IB0A 2ZM4A 3OEZA 4L44A 4PV0A 3QCXA 3RAIA 3IDCA 4QYGA 4YO4A 5IG1A 3DBEA 5AAFA 5AUUA 5IA0A 4GV1A 5KMKA 3VBWA 4QQ5A 4MXAA 4RJ4A 3AXWA 3K2LA 3V8TA 4IHPA 4ZS4A 4FIFA 3VS2A 4HW7A 3NNXA 1UKIA 3FZOA 3H0ZA 4M3QA 5AUYA 5L6WL 1K9AA 2W9ZB 2XK6A 2XK4A 5E8VA 2JIIA 3VQHA 2WQMA 4ENYA 2Y9QA 4AP7A 4MWHA 3KB7A 3KVWA 2WGJA 3VS4A 3A7IA 3UO5A 4F1MA 5T6KA 3ZZEA 3COIA 3IQ7A 3SG9A 4QD6A 5IDPA 3R1NA 2BHHA 3K3IA 1SVHA 3HAVA 2ACXA 2CN5A 3DPKA 4FTIA 2C3LA 2J4ZA 2UW7A 4B8MA 4E7WA 2OZOA 3G9LX 5IA2A 4EK5A 2WOUA 1VZOA 3OY3A 3TKIA 2GNGA 3ZXTA 4F0GA 3SRVB 4EOSA 5C03A 3F7ZA 2WMQA 5HG8A 3EQHA 5GNKA 2W7XA 2C6DA 3PRFA 3JS2A 4LL5A 4D2SA 3L8SA 3TJCA 5LARA 4UWYA 4Y72A 4FNWA 2NO3A 1YDSE 2QU5A 4EJ7A 4FKQA 3VF9A 1IEPA 4QYHA 5CNOA 3Q5IA 2H96A 3IECA 4OTPA 2J2IB 4EH7A 4GT4A 5F1ZA 5ANGA 4G31A 3UIUA 4D5KA 5A9UA 4FT7A 5AIKA 4ZTLA 3KA0A 2ONLA 2RFNA 3S3IA 5LJJA 3FXWA 3LFFA 1SM2A 4G9CA 2CCHA 4ACDA 4HGLA 4IVCA 4WNMA 2GNIA 2VAGA 1Z9XA 2BZKB 1IAJA 4KBCA 1OGUA 2GNHA 5IEXA 2YZAA 4M67A 4RX5A 3BWFA 4DEIA 5L2TA 3GBZA 1S9JA 3Q6WA 3F82A 3PVUA 4XJ0A 5ANJA 5DT3A 4OLIA 4U3YA 4G9RA 3AMYA 3FMNA 3R01A 3CQWA 3GQLA 3NDMA 4MXOA 2IVVA 2AC3A 4AZVA 1B38A 3PYYA 4EHEA 3OOMA 1Z5MA 3R0TA 4FSQA 4KKHA 3FSFA 3TNPC 4EZ5A 3LZBA 3PXRA 3DNEA 3RK5A 4J53A 2X8DA 4I5MA 3RMFA 3VO3A 4EH2A 3O7LD 2CNUA 2QG7A 3CLYA 3W8LA 3MTFA 1DM2A 4O0RA 3ZH8A 2ZYBA 4F6SA 3BKBA 1Y8GA 2EB2A 2FVDA 1WFCA 2X1NA 3Q96A 5JFSA 2WMWA 2XIYA 3TDVA 2WTWA 4HCUA 3FPMA 2YITA 4U41A 1VYZA 4DH5A 1U59A 5CWZA 3BQRA 4IE9A 5BVKA 1WVWA 2YCQA 5HVKA 4AW0A 4B0GA 3EFWA 4CT2A 2F2CB 2BFXA 5CI7A 3EFJA 3PY1A 4C4EA 4DH7A 4X3FA 5FXRA 4J71A 4FYOA 4BDFA 5I5ZA 2YIRA 3FZSA 5LOHA 2GFSA 4TW9A 5F94A 3QD0A 3DBQA 4GU9A 4YC6A 4I22A 4QP8A 2OJFE 1JBPE 3W18A 3KFAA 4BDGA 5L4QA 3IW4A 3LQ5A 3QTSA 1BKXA 4BIBA 3GGFA 4EH6A 4L9IA 3LLAA 2PK9A 5JMSA 1M2QA 3KCKA 3LQ8A 3VBQA 3AC1A 4RIYA 4MXXA 3VQUA 1PXMA 2R3JA 3PP0A 2PUIA 1RJBA 4XYFA 5HG5A 3RPYA 4D2VA 2XMYA 4YTHA 2UVZA 4FKOA 4II5A 4C4IA 4O7RA 3MESA 4YJQA 1Q3WA 1Q5KA 4GVAA 5L6OA 4RMZA 1GZNA 2PE2A 4KS8A 5HU9A 4D1ZA 3NX8A 3F7WA 4IM0A 4M0ZA 3MBLA 4CZYB 2CKPA 3BI6A 5HHWA 2IPXA 1VYWA 2VV9A 4ASDA 2R9SA 5CT0A 3NUAA 3I6WA 5GJDA 3R00A 4AFEA 3UNZA 3KEXA 2W99B 4WG5A 3W2PA 3FJQE 2UZUE 3L8VA 2YISA 3F2NA 4O0WA 3ZBXA 1XH7A 4DEBA 1CSNA 4CMUA 3EQIA 2O63A 3QC4A 1ZYDA 3P9JA 2C1AA 2JDRA 3AT3A 4PUZA 4QPSA 4P4CA 3H4JA 4V01A 2PVFA 4QMMA 2HWOA 2C3JA 3AD6A 4QQTA 2PVJA 4HGEA 4L01A 4G5JA 3VC4A 2QO7A 5A3XA 3UGCA 4EK3A 5KMNA 4M69B 3DGKA 2HZNA 3QXOA 2QR8A 3R21A 3C0GA 4I5CA 1HCLA 3EB0A 1XR1A 2UZEA 4FKUA 5GJGA 1BI7A 4C58A 3JUHA 4H36A 4IDTA 4CFXA 3DB8A 4K0YA 5CF6A 1AGWA 4YUQA 2VWVA 5IPJA 4HNFA 4E5AX 4ALWA 2QOBA 4ZLYA 3R28A 4LOOA 3VRZA 5J95A 2VX3A 4K33A 4IAFA 3A8XA 1UA2A 1JLUE 4XRLA 5JH6A 2R64A 5BPYA 4OT6A 2F49A 2WIHA 4AXAA 4IVDA 4BWPA 4C4JA 3OZ6A 4NSTA 4I0SA 5D9HA 4I6FA 3D7ZA 2X4FA 3LPBA 4YPSA 1XBAA 3EQFA 2WPAA 5GIOE 2CKOA 2ZV2A 3PTGA 4XG2A 4FEUA 3P1AA 3O96A 4NU1A 4K1BA 3Q9WA 3BYSA 2VO3A 4DCEA 3MY5A 3IW6A 3LJ1A 4FV3A 2O2UA 4FZ7A 4M84A 3REPA 5KE0A 3T9TA 4DEDA 5CAUA 2NPQA 3G6HA 3NRMA 1NT2A 3T8OA 4A4OA 2W5AA 2WTKB 3SD0A 2ESMA 4H58A 4GT3A 1U5RA 3PA5A 3FKLA 3RTPA 1RDQE 1W7HA 3NCZA 4IWDA 1MRUA 2HZ4A 4WD5A 2X2KA 4AE6A 3UPZA 3QGYA 3Q4ZA 4LYNA 3Q52A 4G3FA 4O7VA 5CS6A 1GZOA 5D11A 1LUFA 3UE4A 3WF7A 4L8MA 4AZSA 1KE9A 5CF5A 4RX8A 4QNAA 3BHUA 3QX4A 4HPUE 5LQFA 1YHVA 1LEWA 2O5KA 2X8IA 4HYUA 4KINA 5FBOA 3MY1A 5JKGA 3G5DA 2X7FA 3PY0A 1PJKA 5CU2A 4U97A 3NIEA 3R22A 3HVCA 3LFEA 5KNJA 4BCMA 2QC6A 3ALNA 2VTSA 3AOXA 3Q3BA 4GJ3A 4V05A 2QVSE 1YI3A 3MPTA 2KULA 4TNDA 3U51A 4FIHA 5AAGA 2VWYA 4O7SA 2J0KA 2XJ1A 4CZUA 4FKVA 3VBXA 5CEOA 4AW5A 4O96A 1JQHA 4JRNA 1W98A 3EQRA 2PULA 1S9IA 3C9WA 2GCDA 2VTOA 4UALA 5C26A 3LMHA 1CKIA 4Z9LA 3NLBA 4N6ZA 3ZEWA 4K77A 3QA0A 4UWCA 3I7CA 5B2KA 5DIAA 5EG3A 2IW9A 2GS7A 4RC3A 3SKCA 1BX6A 3QLFA 3HL7A 3C1XA 3TDWA 4GS6A 5C4LA 2Z2WA 3LM5A 4YJOA 5DMZA 1REJA 2YM3A 2PVNA 3HUCA 4F70A 3PJCA 3RGFA 4KBAA 5M4CA 5KKRC 4Q9SA 1LEZA 3BYUA 3NW6A 2C6MA 1VEBA 3TZ8A 4E6DA 3E62A 2LAVA 3ORLA 4Y85A 3P7BA 3P7AA 4FUYA 5LVPA 4BTJA 1LPUA 3TUBA 4GJ2A 4PMPA 1OL7A 2HZ0A 3EN6A 4O7TA 4NFMA 4OAUC 3RKBA 2WTJA 4QMWA 3EL8A 3MV5A 4TKSA 2QR7A 3KMWA 4BCJA 1YDTE 3E7VA 3KRWA 5LVOA 2G01A 3TIYA 2A1AB 5CF4A 1K3AA 2C69A 2HW6A 2ZDUA 3EN7A 4JI9A 4BFMA 3E88A 4AOJA 5A46A 5CEMA 4USDA 3UOHA 4O7ZA 4E6AA 4Y95A 4IAAA 4AF3A 5M55A 2UZDA 4GYGA 4J99A 3SQQA 2ITVA 4LGDA 4X3FB 4JDJA 3NYNA 3RM6A 2YZLA 4PL3A 3HRCA 3WYYA 5CLPA 4NL0A 2CHLA 4F1OA 4XG3A 2IG7A 3HMIA 3M2WA 3FLZA 4IAYA 4J8NA 4KIQA 3RPSA 3E93A 5E90A 1R1WA 2Z8CA 3AT2A 5G6VA 1YOMA 2JIVA 5FEDA 2DUVA 2PZ5A 3QTIA 4PMSA 3EYGA 5ICPA 4IJ9A 5EHYA 4RIYB 2OLCA 3FSKA 4D4RA 5AIRA 3KRXA 2OH0E 5G1XA 4G3DA 1YWVA 4C37A 5CAOA 2XCKA 3U4UA 2YM7A 3GFWA 2GPHA 4KNBA 4A9TA 3U54A 4IM2A 2PHKA 1WBSA 4BKJA 4D2PA 4RA5A 3OCSA 4L3JA 4GEOA 2C0OA 4U79A 4ERKA 2ITPA 4ITJA 1DI9A 5JGDA 4WO5A 4UBAA 2QKWB 3UO6A 3QA8A 4F64A 3R73A 2W1EA 3KL8A 3LJ2A 3VW6A 4F9WA 3KC3A 4ZSGA 2PVKA 4BL1A 4EHZA 4M66A 3MPAA 3OROA 5JZNA 3BYVA 4FYNA 3SXFA 4JVGA 4FIJA 3QZIA 3DAKA 3WZJA 4BWKA 3OY1A 5HIDA 4ASZA 5ANDA 1BYGA 2R7IA 4IXPA 4CKRA 3VS7A 3PP1A 2B9IA 3ERKA 4S31A 1IA8A 2C0IA 4PDYA 4DH8A 4YHTA 4PNKA 3ZS5A 1WMKA 3KGAA 4DFBA 4ZSLA 5CYIA 4JT3A 4BCIA 5BVOA 5FTGA 4BTMA 1W0XC 4I92A 3VUDA 4WHZA 2BDJA 5AR7A 4YPDA 2NNWB 3FMMA 3TKHA 3P7CA 3SGCA 4CV8A 3ODYX 4FTMA 4RJ6A 3DFAA 1TKIA 4ONAA 3GEQA 3MB7A 5IKWA 3DK3A 5GINE 4RIOA 4YJVA 3L9MA 1KE7A 2Y7JA 3G0FA 2FSOX 4ANMA 4BDAA 4EKLA 3OW3A 4R7HA 3BGQA 4AG8A 4F4PA 4PRJA 5CAVA 3AMAA 2XP2A 4IWPA 4N70A 4XLVA 4U40A 3SAYA 3KMMA 2XH5A 1YOLA 2CN8A 2OKRA 5FXSA 4AZFA 4WRGA 3R8UA 3V5PA 3WF8A 2IVTA 2HY0A 5EM6A 4UMRA 3DT1A 3GUBA 3F2AA 4BB4A 5E8WA 4BI2A 4DGMA 5AADA 4TL0A 1FGIA 1OMWA 2GHGA 5B7VA 3DJ5A 3A60A 1R3CA 3OXZA 2YJSA 3WIGA 1YHWA 3V3VA 2BCJA 3KMUA 3VUKA 4MNEA 4MBLA 4KUJA 3AQVA 4TY1A 4JQ7A 3B8QA 2CNQA 2BRNA 2RL5A 4F65A 3LM0A 2IZRA 2OZAA 3AG9A 4J8MA 4YJSA 2JDVA 1V0BA 4B7TA 4MF0A 1H24A 2QOCA 4BDHA 4RQVA 1U5QA 2ERZE 5AA8A 3BYOA 2PPQA 2Q83A 4K18A 2FYSA 1I44A 3N4TA 4E4MA 4IWOA 2V0DA 3PA4A 3BELA 3F3ZA 4AW1A 4BDKA 2VTRA 3FBVA 3PJ8A 5J9LA 4U43A 3LFAA 4RJ7A 4BCPA 4C34A 4FV6A 2R3GA 2UZWE 4FT9A 4O6LA 4B4LA 2VTJA 4R3CA 2IVSA 3KQ7A 5FEQA 3WIKA 4BBMA 3EYHA 3F5UA 5IQHA 1KE5A 3QRIA 5F9EA 1J1BA 3ZO1A 2W9FB 1BUHA 4FR4A 2I40A 4R1VA 4OTDA 2QO9A 3QQJA 5AFVA 3SXRA 2YWPA 4BZNA 1J7IA 2ZJWA 5HEZA 4RWLA 1WBPA 4RA4A 3GCUA 4R1YA 2XNOA 2UW9A 3Q53A 3ORNA 4CCBA 3AGMA 3MH2A 4QMOA 1QPEA 2OXYA 3WZUA 1LR4A 3UVQA 1OZ1A 2W06A 3G51A 3QHRA 3ZU7A 4NIFA 3WZKA 2R3KA 5AUWA 3VHKA 5E1SA 2XIXA 5CEQA 4L3LA 4O7WA 4O38A 4X2KA 4EYJA 2PZIA 3HP5A 5HKMA 5K4JA 3CP9A 4D4YA 4ORKA 5E91A 5BYLA 4KIOA 1OL5A 1ZYCA 3RAWA 4TZRA 4YTFA 2B54A 3E3BX 3SV0A 4I6HA 1YXXA 4FSWA 5TE0A 3FMEA 3TL8A 3EIDA 3BHVA 4WA9A 3Q9XA 5A4QA 3CKXA 3WF6A 3FMDA 5EHOA 3O8UA 3F88A 4C36A 1ZYSA 2YIQA 4JJRA 4IAIA 5GIPE 3DK6A 2WKMA 1V1KA 4UZHA 4F1TA 1K2PA 4FG8A 4RWKA 4JDIA 4XOZA 3D14A 4UYAA 1Q24A 1Q3DA 3MVJA 4RVTA 2JITA 4M7IA 3NCGA 3PG3A 4RT7A 4AAAA 4CFVA 3LCTA 3OCGA 3QQFA 2YA9A 3CCNA 5DYJA 3IPHA 4G16A 2VWIA 4JG8A 3BGZA 5DE2A 4EOPA 1XKKA 4O0YA 3GU6A 3W32A 3PXKA 4FV4A 4UB7A 5IEYA 4KABA 4FKRA 5C8KA 4EEVA 1JAMA 3BPRA 3TI1A 3EHAA 2HXLA 2C5OA 2W4JA 3UP2A 2QHMA 3CC6A 5IQDA 1PMNA 2GSFA 4YR8A 4RC4A 4C35A 4CXAA 1OKWA 2UW0A 3NUYA 5F95A 1Q8YA 5IA5A 1QCFA 4TT7A 1URCA 2BDWA 3RNYA 3C5UA 2REIA 2NP8A 5M09A 1FBNA 1U54A 2J0IA 2C47A 4OTQA 3WOWA 1GIIA 4U9AA 5JFVA 4DEAA 2XB7A 5JEBA 1V0PA 2ETKA 2QONA 5KMMA 2PYWA 3NEWA 3UG2A 2OI4X 1H1SA 2FSMX 2PTKA 3O8TA 4BCNA 4IZ5A 5J1VA 3R7GA 2BHEA 4G6OA 3ULZA 3K3JA 4AACA 4Z3VA 3BYMA 1FINA 2QLUA 3OWKA 3DZOA 4XCUA 4D2WA 2F4JA 5ACKA 3R1SA 2ITUA 3UC3A 4ZY6A 3CPBA 3HV7A 3TJDA 5HCYA 3C4XA 4FSTA 5B0XA 3C0HA 2FA2A 4X6QC 4YZNA 2E9UA 3BQCA 4MTAA 4ANSA 2ITYA 4FNYA 3QTZA 1PXNA 3TNQB 5K4IA 4BCHA 3CGOA 4DGOA 3VRYA 1OBDA 2XS0A 2WTDA 1NVSA 4ENXA 4AX8A 2OIDA 3TKUA 3ULIA 1RQQA 2W1GA 2WOTA 4P5QA 5DBXA 3C51A 4BYJA 2JAMA 5I9ZA 1H1RA 4ANNA 2VUWA 3C13A 1YI6A 3CPCA 3PFQA 5DRDA 2OK1A 2W96B 3TEIA 3DA6A 4AQCA 5HE3A 5D41A 3G33A 5IDNA 2XNMA 3NPCA 4TYJA 3HUBA 4CT1A 3NMUF 5HBEA 3ZEPA 1WBVA 5TT7A 4TRLA 2BFYA 4W8EA 3R30A 3PIZA 4YGAA 4DTKA 3EOCA 4Q2AA 3UYSA 4FOBA 4GVJA 3UC4A 3R6XA 4OTGA 4O7LA 1NY3A 5EQYA 3OMVA 3JY9A 2B1PA 1FQ1B 3DBDA 1OL6A 4D9UA 3FL5A 3NW5A 3EQCA 4M12A 3DTCA 4X2NA 4PDSA 5GZ8A 4NYEA 3UOKA 2B55A 2Z7QA 5AUTA 4JIKA 2CLQA 3FI2A 3QFVA 5J7BA 4W4WA 1PMUA 2QO2A 4O0TA 3DOGA 4ZLZA 1PXJA 2W4KA 1W82A 5CT7A 2XCHA 3SLSA 1G8AA 4UWBA 3KKVA 4D1XA 4LRKA 2X9FA 3JYAA 1YXVA 2RFEA 1O6KA 4X21A 4YZMA 2X2MA 2PVMA 4BGQA 4HOKA 4ITHA 2R3FA 5A6OA 4PMTA 4CV9A 2YEXA 3QXPA 3ZO3A 4BBFA 2ITZA 3V5TA 4DEGA 4UN0C 4S2ZA 4O84A 3R1YA 2YM6A 4MNEB 5CY3A 5FLFA 1PXIA 1FVRA 2P2IA 2XBJA 4FZ6A 4BYIA 1IA9A 2YM5A 3PZEA 2QCSA 1UKHA 3CKWA 2V55A 4BWXA 3PIYA 1QPCA 2OZAB 5CXHA 3EQBA 4TYHB 1JSUA 3IDBA 3C5IA 3IOPA 4ZSAA 4YJUA 4ASEA 2CNVA 3LFSA 1UV5A 2B9HA 4W9XA 4GK4A 5A54A 1GOLA 3KXGA 4TPTA 3HRBA 5EDPA 3QRKA 1J3HA 1OL1A 2CPKE 2H6DA 4E6QA 4UMTA 5LWNA 3FQHA 3UJGA 4U7ZA 5E7RA 4IC8A 4H3PA 3KULA 4O21A 2GTNA 3MJ1A 3RAKA 3A4PA 1CMKE 3ZRMA 4ZXTA 2ZDTA 5I9WA 4RRVA 2BZHB 3OEFX 2XK9A 4ZEGA 4BRXA 4I94A 3B2WA 1ZY4A 4QMTA 5IH5A 4Y5HA 2YM4A 3F3UA 4UZDA 5LVMA 2C6EA 5JSMA 4U44A 3H9OA 4K11A 5IISA 3IG7A 2XKCA 3TN8A 3HGKA 4MK0A 3TV4A 3DNDA 1JWHA 2R3LA 4FTJA 4JL9A 2GNFA 3AC4A 4NIFB 4LMUA 3BU5A 5I9UA 3EFKA 3E3PA 4F6WA 1QL6A 3QTXA 4BI1A 2ERKA 4RWIA 2C5VA 3W2OA 4I6QA 3CQEA 3UQFA 1YW2A 4O83A 4EUTA 4TN6A 3PDTA 5IQBA 2YCSA 2R3OA 3II5A 4EK4A 3UG1A 4HYSA 3QBNA 4PL5A 3ID6C 5AV0A 3D4QA 4OT5A 3LW0A 3ZO4A 2PMOX 5AEPA 3ZFYA 4WG3A 3PY3A 4GKHA 2VTPA 2HELA 5EM8A 3VULA 2BRMA 4CQEA 4KKEA 2WEVA 1E1XA 1G3NA 5D7AA 5AV4A 2OJJA 4IX3A 1YVJA 3JPVA 2YJRA 4FKPA 3MGYA 5E8TA 4O7NA 2JGZA 3TZ7A 3FI3A 5EW3A 5HNBA 3ZTXA 2A27A 3UMWA 2G15A 4ANBA 1HOWA 5CVHA 4AOIA 4N0SA 3W1FA 3A2CA 4DITA 1KE6A 4F08A 3F66A 3MN3A 3KF7A 4KIKA 5C27A 2ZAZA 1KE8A 4OAVB 4M97A 3D9VA 4FC0A 3QD2B 4FTQA 3DDPA 1PMVA 5LCKA 2VD5A 3ZUTA 3CIKA 4D4SA 2IZSA 3NWWA 5FRIA 5CZHA 2C6KA 4BC6A 4EOOA 3W2RA 1ZMVA 3MWUA 4BDJA 4BVUA 2PVLA 2XUUA 4ZJJA 2XYNA 1U54B 2VGPA 2ZV7A 3HMNA 4JQEA 4HVDA 3F5GA 4IX6A 4B99A 5M4UA 4X0MA 4BTFA 3DZQA 4K2RA 5KX8A 1UU3A 4MQ2A 1PRYA 5IH4A 3QQUA 2UZNA 1ND4A 2XRWA 4U45A 5C8MA 3FPQA 1T45A 3PA3A 4NK9A 5FWKK 1GJOA 5BVWA 3WILA 4HYIA 4O81A 2CGXA 4FGRA 5IQCA 2XK3A 3UIBA 2YN8A 5DFPA 3JVSA 3SX9A 5E8YA 4CVAA 2GS2A 2BZJA 2PUNA 3TV7A 5C8NA 4W8DA 4CFUA 4CG8A 4FUXA 1ZOHA 3BU6A 2W4OA 3FY0A 4WIHA 4O22A 4A07A 2VTHA 5IUGA 4RG0A 4ZSEA 5LVNA 2VU3A 3DKOA 3I60A 4ZZNA 4WNPA 2O3PA 4QP9A 5HBHA 3R9NA 5CZIA 2IN6A 3LFDA 3FV8A 5IH6A 3KRRA 3GP0A 3QALE 4APCA 3DBFA 4DH1A 3PLAE 4G2FA 3GB2A 5KMIA 3QD3A 4EONA 2VX1A 3POOA 1ZWSA 3L9PA 3RWPA 3UMXA 4R77A 3RPRA 3ZCLA 4MXZA 4OTHA 5FDXA 3SA0A 4LV5A 4A06A 4FX3A 4XRJA 5AR4A 2YDKA 3R2YA 4PDPA 5J8IA 3PPKA 4RVLA 3VS0A 3Q5ZA 3LFBA 5ANEA 4D2TA 5A4CA 1DI8A 3AC8A 3MB6A 3IO7A 4PMMA 4O7YA 2I0YA 3L8XA 3FZRA 3RK7A 5EI8A 3ZXZA 4GH2A 5H8BA 3HV6A 1VJYA 3MH3A 4OTFA 2WMUA 3PE2A 3UO4A 5CEPA 5M4IA 3H30A 3IKAA 4I21A 3OBJA 1GIHA 4PNIA 2UZVA 5AAEA 2R3NA 3ORMA 5AX3A 4EC9A 1H26A 4DEEA 4IWQA 2PVYA 2UVYA 4HCVA 1JVPP 4RJ8A 5HX6A 1WVYA 4IM3A 4NJ3A 3TXOA 3P78A 5M44A 2BRHA 2B4SB 3GU7A 4IVAA 4FKIA 3M42A 4NT4A 4I23A 4RZWA 3V01A 4D0XA 4FNZA 4IX5A 3B8RA 3LE6A 4NZWB 5BVFA 2ZV8A 4JBVA 3ZFXA 2W17A 4LMNA 3QCQA 2WMVA 4F09A 1M52A 2PVHA 4H1MA 4MD9E 4ZTNA 5TOZA 3QYWA 4BDIA 3BRBA 5HX8A 2J6MA 3ALOA 5I9XA 3P0MA 3OHTA 4AE9A 5CSWA 2ZM1A 2VO0A 4X6RA 2XEZA 1IRKA 3KF4A 5FP6A 3A7FA 1LP4A 2UZTA 3CQUA 3KN6A 4PY1A 2WQBA 2J9MA 5HGIA 1B39A 5L2IA 4BCKA 2F2UA 3U6HA 2QNJA 3ET7A 3L9LA 5AP4A 5HNGA 2E9NA 1JKSA 2FSLX 4PTEA 4NM5A 3KULB 4YJPA 3V51A 4C4HA 4Y5QA 4F7SA 2R4BA 3R9HA 2V5QA 3OWPA 3WF5A 4MXCA 1JNKA 1V0OA 2R3HA 2WEIA 1SZMA 2HENA 3UVPA 4LGHA 3RVGA 4HYHA 4OW8A 1IASA 3I5NA 4XOYA 4BDEA 4PF4A 1TQPA 5CEIA 4J98A 3QU0A 3HKOA 3QWJA 1DAYA 3BLHA 3MTLA 2H9VA 2WMBA 3R1QA 4WUNA 4AA4A 3RCJA 2X7GA 1CKJA 4PQNA 3TUCA 4FGBA 3E63A 3GC0A 5ANIA 3RHKA 4Y83A 2HYYA 4XX9A 3VUGA 4BIEA 3ZUUA 3LAUA 5L2QA 3HP2A 5FM3A 3FMKA 4LRMA 4GFOA 4PL4A 4LRJA 3UOJA 5EW9A 4FIGA 4FTOA 4LV8A 3NS9A 1UWHA 3MIYA 3NYXA 5HE2A 2C68A 4CKJA 1OIYA 4G3GA 4QTDA 5KZ0A 3OUNB 4JBPA 4QOXA 4RGJA 1NVQA 2UW8A 2I0EA 2ZM3A 3DKGA 5IQIA 4EWHA 5J79A 5AUZA 2W05A 2R0UA 2QOIA 4G3CA 4E73A 4CTCA 4Z7GA 3NW7A 4BDBA 5L2SA 3QZHA 2BKZA 3WZDA 1R0EA 3DDQA 4IB5A 5ETCA 4GL9A 5TR6A 1UU7A 3OG7A 5DR6A 5DT0A 4MH7A 4L45A 3M1SA 1XBCA 5JQ5A 1YHSA 3IDPA 4HJOA 4UV0A 1STCE 2UW5A 3RAHA 3Q6UA 5BX0A 2PE0A 1OKYA 3QHWA 4XV1A 3LMIA 1YWRA 2PMNX 4PPBA 4WUAA 3V5LA 3FC1X 4TWOA 4KIKB 4C33A 4CMTA 4QP3A 3EQGA 2PVRA 5CU4A 3GU4A 2X0GA 3LXKA 1M14A 3DCVA 3PPZA 3R71A 1P5EA 4FODA 4PX6A 4BZOA 5LXMA 2EXMA 3OS3A 4OBQA 5HNIX 3D94A 4JDKA 3FI8A 4QMNA 2VWZA 3HECA 3FE3A 2FB8A 3VIDA 3G2FA 2ETMA 4ZSJA 2WU7A 4W4XA 4B8LA 4EQCA 4QMPA 5EI2A 5I9VA 5HCXA 4YBJA 2B9JA 1CM8A 3GVUA 2XNEA 4LM5A 2WIPA 1Y91A 5CU6A 4EK6A 3DTWA 2Y0AA 4MEDA 1PYXA 2G1TA 3PVBA 2GHMA 3M11A 5BMSA 3IOKA 3F6XA 4BIDA 3FKNA 3FKOA 3SG8A 4I1ZA 3ORTA 5J87A 2XIRA 1Q4LA 2BTSA 3NAXA 5ETFA 3S2PA 4AW2A 3JVRA 5A14A 4NTTA 5EM5A 4FEQA 4ACMA 4AGWA 2RFSA 4PTGA 1U46A 3RJCA 2XM8A 3QLGA 2P55A 3PXYA 5ANOA 2JIUA 3PRIA 4FT5A 3F69A 3D15A 2VTTA 4MHAA 3R83A 3P5KA 3MY0A 4GIIA 5IA1A 3SW4A 4J96A 4M68A 4YZDA 2WMTA 3G9NA 4L6QA 4WKQA 2DWBA 3KY2A 1IAHA 2YHVA 3FI4A 3E8CA 3S4QA 2LGCA 4WOVA 3WE4A 2OBJA 4IMYA 5BMMA 4C4GA 3MDYA 4I93A 3W10A 1OUKA 3RI1A 3AD4A 1YDRE 3CD3A 4BY9E 4O2PA 5EQEA 2RSVA 3PVGA 2Y4IC 2YIXA 2XJ2A 5EK7A 4D0WA 3ZLXA 5EHLA 3WF9A 1OB3A 3O23A 1O6LA 2XIZA 3FL4A 4L52A 4WG4A 4HPTE 2V62A 4XHKB 2OFVA 5FQDC 3VS1A 3RBWA 5JN2A 5A4LA 2DQ7X 1EH4A 1YXTA 3FYKX 3ZMMA 2CKQA 5EQPA 1RE8A 2ZMCA 4DLJA 1BL7A 2ITNA 4I6BA 2HIWA 5JK3A 3E64A 4X7QA 3D2IA 4D28A 3NUXA 4AN2A 3SXSA 3CBLA 2EU9A 5CSVA 4XV3A 3KREA 5AP1A 4DTBA 4DT9A 2NRUA 4CRSA 2OICA 2YLFA 5HORA 5LMAA 3R02A 1CTPE 4A9RA 3ATSA 2CGWA 4A9SA 4S32A 4AZTA 1OVEA 2BROA 3GQIA 5FUTA 3OBGA 2XEYA 4ANLA 4FKGA 5EFQA 4GUEA 3BE2A 3ITZA 2WMAA 1VR2A 2X4ZA 4UXLA 4XUFA 4LGGA 2Y6OA 4BHZA 4IX4A 3EN9A 2YERA 4DYMA 4N4SA 3VWAA 5IF1A 3QUEA 4C3PA 4AU8A 3KXNA 4XMOA 4EOKA 1IR3A 4ZZMA 4OGRA 2O64A 3LFNA 3V8SA 2UZOA 3LCDA 2VTNA 3WYXA 5D1JA 5L2WA 4R5SA 3TACA 2J0MB 4FVPA 2WZJA 2HZIA 5AMNA 3KVXA 4RLLA 2GQGA 2YDJA 4NM3A 3UOLA 5H8GA 4DGLC 4O0XA 1UU9A 5CSPA 4QTCA 2YABA 3UZPA 2VNYA 4B6LA 1HCKA 2OSCA 1OITA 2BIKB 2C0TA 3DKCA
chains in the Genus database with same CATH superfamily
3E92A 4R5YA 1FVTA 5CSHA 4A9UA 1H27A 3G0EA 3I4BA 3PIXA 4GYIA 4KIPA 4BN1A 2JC6A 4YBKA 4JLCA 4QNYA 2CLXA 4DBNA 4FTTA 3Q60A 3OOGA 4U5JA 5IMEA 4CKIA 2QKRA 2WHBA 4FZDB 1XH9A 4FEVA 2QOOA 3HYHA 2VZ6A 3FZTA 4FG7A 1ZLTA 4M8TA 4OBOA 5AX9A 4I6LA 5EKOA 2VNWA 5C01A 4QYEA 3ORXA 4QMYA 4E4LA 2YIYA 4G3EA 3UODA 4LUDA 2KTYA 3BEGA 4YLKA 1ZY5A 2FGIA 1GNGA 2P3GX 5AA9A 2ZMDA 3R7VA 4MF1A 4CYIA 4YMJA 5M56A 3OF0A 4EJNA 4FBXA 5HQ0A 4DH3A 4GK2A 2FH9A 4H3BA 5JRSA 5LVLA 4ANQA 4EH8A 5M57A 3G15A 2QODA 4KRDA 2VTAA 4FSNA 4K8AA 4MNFA 3IGOA 1KOBA 4FNXA 4RWJA 3VS6A 3ZLYA 4EK8A 2ZB1A 4BGGA 5GJFA 2OF4A 4MYGA 4QMXA 5H9BA 5KKRB 4NUSA 3MFUA 2W5HA 5AP2A 3GCSA 3PSDA 4YHJA 3QQGA 5DLSA 5FTQA 3W2CA 4C02A 4F0FA 3BLRA 1G5SA 2CSNA 4QPMA 4CRLA 1H1QA 3FLNC 4FMQA 4V0GA 3UTOA 5KHXA 2PSQA 4EBWA 1OBGA 5DRBA 2IW8A 3ML1A 4FKTA 4BICA 1XJDA 2WTCA 3E5AA 3TWJA 4DDGA 3SVVA 2FO0A 3I1AA 3A8WA 4NCTA 4RFYA 1QMZA 3ORIA 4FSMA 1UNLA 5AUVA 2AQXA 4KD1A 5CVGA 3W33A 3ZOSA 5CU3A 1U4DA 5CX9A 4WSQA 4RFMA 4I5HA 2VX0A 4HNIA 4QPAA 4UEUA 4ID7A 3ANQA 1X8BA 3QTWA 4ZMEA 1XQZA 3FZ1A 2P2HA 3DJ6A 4TWPA 4RC2A 3N4VA 1T46A 4RX7A 3DB6A 1PXOA 3GC7A 4JRVA 4MAOA 4RFZA 1XBBA 5E1EA 3U87A 4QMVA 2UZBA 4JAIA 4DHFA 3GC8A 1ERKA 1FOTA 2OF2A 3IONA 4HGSA 3VNTA 3RALA 2RGPA 3BV2A 3P79A 2BKKA 1F0QA 4QP4A 3QYZA 2IZTA 3PUPA 4NCTC 1MP8A 5HG9A 1JPAA 5AR5A 1PHKA 4YJRA 2IWIA 3VUTA 2OJGA 5EKNA 1ZYJA 4NM0A 5FBNC 3HX4A 5EW8A 3P86A 1M2PA 2PE1A 3GNIB 5EYCA 1GZ8A 4QP2A 1BMKA 2IO6A 3ZLSA 4C8BA 5HVYA 2XM9A 3DAEA 4LQMA 4H3QA 3MJ2A 3EQDA 2R5TA 2JKOA 4F99A 3ZLWA 1DS5A 4I0TA 3EMGA 3MFRA 4ZTMA 3GXLA 3HA8A 4R3RA 1TQMA 4G5PA 5J5SA 5D7VA 3TNIA 2HY81 2ITWA 2CCIA 3FLWA 5FDPA 3I6UA 3NYVA 4FKWA 4S34A 3FXZA 3SOCA 3DBCA 3KU2A 4GIHA 3CSVA 4YZBA 3C4WA 4I41A 4EKKA 1YI4A 3QUPA 4FL2A 4CFNA 2YIWA 4KAOA 4U3ZA 3AMBA 1OPKA 4L68A 4UMUA 4BJJB 3Q4CA 1H4LA 3LIJA 2X2LA 5EYDA 4MKCA 1H1WA 4ACGA 4IFGA 3PJ1A 2BR1A 4GFGA 4JS8A 4WBOA 5DG5A 5ETIA 4CCUA 4L53A 5IQFA 3THBA 3HEGA 3FMLA 5BUIA 1CKPA 3NZ0A 2BZIB 1O9UA 4Q5HA 3CR0A 2VWXA 1OIUA 4DFZE 4AOTA 3EFLA 4BZDA 1XH6A 4DE4A 4L46A 5DH3A 1JOWB 3Q32A 2CMWA 2SRCA 1Q41A 3C4ZA 4ARKA 2BAKA 2VO7A 2F7ZE 3N4UA 3V5WA 4C38A 3NNUA 3MW1A 2XF0A 2VO6A 1KV1A 4G6NA 1XHAA 1WBNA 2ZOQA 1R78A 4USFA 3IW8A 3KRJA 3CY3A 2VWWA 2IEWA 4G1WA 4XH6A 2J5EA 4RLKA 1YXSA 2PY3A 4PP9A 3IS5A 3ZZWA 4DGGA 2GS6A 3ZSIA 4OR5A 5E9EA 1Q61A 2X7OA 5BVEA 4J7BA 4BTKA 3BBTB 2RFDA 5L8JA 3BBWA 3VUIA 3O51A 2V7AA 3IW7A 4IAKA 5A4TA 2QOLA 4YLJA 2AC5A 3A4OX 3QTRA 5A6NA 2P33A 3S0OA 5LMKC 3FEGA 4FEWA 5AR3A 1GY3A 4X2JA 3FYJX 2A19B 4IB3A 4NFNA 4GCJA 4BDDA 5HU3A 1WVXA 3FHRA 2W0JA 3LFCA 4F9CA 4YTIA 3CY2A 3VJNA 4KBKA 3TT0A 3E87A 4U8ZA 3H0YA 4TWCA 4KWPA 4G17A 5AP0A 4HCTA 2OH4A 4QP1A 1Q8WA 3ACJA 2R3PA 2C5XA 2JKQA 5DOSA 1TQIA 4FTUA 3HMMA 4XS2A 3QCSA 5JGAA 4Y46A 4E3CA 3D5WA 2RF9A 4F6UA 3TM0A 3AT4A 3OD6X 5IUHA 4WNKA 5BYZA 5IU2A 4QTEA 2OO8X 4QMLA 4NKAA 4R7BA 1ZMWA 5AR2A 4NJDA 4BKZA 2F57A 2YACA 3EQPA 4D4VA 2YLEA 4BDCA 4TYIA 2WXVA 5I3OA 1L8TA 2YFXA 2BPMA 4KRCA 3C4FA 4C7TA 3VBVA 4C62A 4CGAA 4M13A 4AA5A 5E8SA 3HRFA 3MS9A 4JQ8A 4JR3A 3Q2JA 3FC2A 3QQHA 3DLSA 2I7QA 5M08A 2BMCA 5DEYA 3ZSGA 3DXPA 5AWMA 3KK8A 4F7LA 2OFUA 4FTKA 4FL1A 5HO7A 3KCFA 2CDZA 3PJ3A 3I79A 4CNHA 2J51A 5DR9A 3W2QA 5HLPA 2XNGA 3O7LB 4BCFA 1SNXA 3U6JA 4KKGA 2OXDA 5EM7A 2DYLA 3UZRA 3RNIA 5KZIA 4WNOA 3L9NA 2B7AA 2JLDA 2WNTA 3GU8A 3KXZA 4BBEA 1OKVA 3I7BA 2QOHA 3LXNA 3SHEA 1JSVA 4UY9A 3DU8A 4XP0A 4KB8A 1URWA 4UYNA 1AD5A 5KBRA 4M15A 3U9NA 3D0EA 4H05A 3RWQA 1UVRA 4NW5A 4O0VA 4EC8A 4ERWA 4UMPA 4Z7HA 3SC1A 4ZZOA 5IQEA 1OECA 4E5BA 5EDRA 3S1HA 4YU2A 1MQBA 2HOGA 2HK5A 3C7QA 1ZOGA 1ZMUA 2BTRA 3MA6A 4V0GB 4FG9A 5D12A 4RJ3A 5HE1A 2JDOA 2QG5A 3F3WA 2GQSA 4EOMA 5M53A 4L7FA 2UW3A 4NEUA 1OM1A 4FKLA 4IIRA 4AT4A 3NIZA 3ORKA 3KRLA 2J90A 5FGKA 3P5JC 3H9FA 4C3RA 3UYTA 3R04A 2PMLX 1AQ1A 4G34A 3LQ3A 2CJMA 5T68A 3R8MA 3GENA 1H0WA 4TNBA 1G8SA 2C6IA 4QMSA 3A99A 3P08A 2WQNA 2ITTA 2XBAA 4GRBA 3NYOA 5DPVA 4F63A 3GI3A 5BQ0A 4GW8A 1SVGA 5J9ZA 2BAQA 4AN9A 4G6LA 2JKMA 4EQUA 2WTKC 1J91A 5CEKA 3KN5A 5CAQA 1CDKA 5AP5A 3R8VA 4H39A 4I4EA 4HZRA 4WT6A 1B6CB 3QUDA 4GSBA 5HTBA 1GAGA 3NVMB 2QD9A 4YTCA 2I1MA 4RX9A 4E26A 4RIWA 3H10A 2P0CA 3QC9A 5DI1A 4FK3A 4IDVA 3TTJA 4E4XA 4FOCA 4L42A 1H1PA 3CTQA 4GG7A 3MVHA 1NA7A 1H28A 1ZOEA 4YNEA 4F7NA 4FF8A 4L43A 1OPJA 5IA3A 3JY0A 5IQAA 5HTIA 2EUFB 4DHZA 5HBJA 3NNWA 3AC5A 1O6YA 5AM7A 3RCDA 5CF8A 2QHNA 4FVRA 3ACKA 2OGVA 4J97A 3VS5A 3PXFA 2Z60A 4ZJIA 4HVGA 3FUPA 3L1SA 4XLIA 5TKDA 4AGUA 2ONLC 3UNKA 3HDMA 3GCVA 2GDOA 2H34A 5CSXA 2ITOA 2OJIA 3HA6A 4DINA 4R78A 4FSZA 3FLSA 5FTOA 3BZ3A 3VW8A 2I0VA 3IK3A 3OT3A 5J7HA 3TUDA 3C4CA 5FM2A 2R3IA 3MH0A 4I0RA 4FV0A 5L6PA 5L8LA 4YSJA 2RG6A 3C50A 3RPVA 4ZTHA 3OXIA 3DFCB 1PKDA 2PZRA 5E8ZA 3T3VA 4AWIA 4NH1A 5FG8A 4CD0A 1OI9A 1WBTA 2BUJA 2CGVA 3PWYA 4JNWA 3TTIA 3ZBFA 3ENMA 5A4EA 4RBLA 4RPVA 4FICA 2BVAA 2GNJA 5CENA 3UVRA 5I4NA 1KUTA 3P4KA 4DC2A 2FSTX 3QTQA 4FZAB 4O86A 1JKLA 5HE0A 4FV7A 2EB3A 2PWLA 2WB8A 4QMUA 2W1DA 4O27B 4DHIB 4O6EA 1H25A 3LLTA 4AS0A 4JXFA 1XO2B 5KUPA 4A7CA 5IMXA 3QKMA 3Q04A 5M07A 1W84A 3FDNA 4PDOA 5K5XA 5AJQA 4C59A 3D83A 3ENHA 3JR1A 1OUYA 1WZYA 4QTAA 1QPJA 3BHTA 3OVVA 4QQCA 3TV6A 4IW0A 5CTPA 1ZARA 3HV5A 4FIEA 4HGTA 5DA3A 3VN9A 3O0GA 1ZZLA 4CZTA 3R8ZA 3ZC6A 4XG7A 3NAYA 5J1WA 4QP6A 3MFSA 4CFFA 4DAWA 2HCKA 4J1RA 4R7IA 3CE3A 3CGFA 4QYFA 4C2VA 3BIZA 4X3FC 5CI6A 4D2RA 3HMPA 1SVEA 3DLZA 1W2CA 5FEEA 2UUEA 2GTMA 4TYGA 1YKRA 4AN3A 4IC7A 3BEAA 4J52A 3EN4A 4FT0A 4FL3A 3R7OA 2WFYA 3UP7A 2O0UA 4I5PA 4ITIA 4PPAA 4FA2A 4GU6A 4BGHA 3UIMA 3QF9A 4USEA 3QQLA 1XWSA 2QQ7A 4FSUA 3O71A 4XNEA 5AP3A 5GHVA 4PPCA 2R3RA 4ZP5A 2GFCA 3S00A 1SNUA 1P2AA 2EVAA 5HIBA 3ZO2A 1OPLA 2V22A 2XJ0A 5CU0A 3NNVA 4MVFA 2HAKA 1Y57A 3OTVA 1BLXA 4QMZA 2WQOA 3ZM4A 1KSWA 3VVHA 4DF3A 5HZNA 5EDQA 5CXZA 4DG2E 2E9VA 1M2RA 2BRBA 4Z55A 3PWDA 3QL8A 4XEYA 5F20A 3I0OA 3QD4A 2AUHA 3EWHA 4DFXE 3I81A 3FLYA 3VBTA 3ZSHA 3F5PA 4RIXA 3PSCA 4AAYA 3QRUA 3K54A 4YC8A 3UDBA 3Q9ZA 3OT8A 3EZVA 4EH4A 4ZTQA 5BUJA 3T9IA 5CALA 5KMJA 4QRCA 5DEWA 4OTRA 5KHWA 3ZFMA 4IZAA 4AT5A 4CLIA 4DGNA 5L8KA 4DT8A 3LHJA 5GZAA 2QLQA 4C2WA 4LOQA 2A98A 5DNRA 3IW5A 3R9DA 3W8QA 5HG7A 5D10A 4E6CA 1PY5A 3COMA 3E8EA 3ZM9A 1NVRA 4P7EA 1BL6A 2QU6A 1Q62A 3HZTA 4YSMA 5K0KA 5DWRA 3FY2A 5J9YA 3OP5A 1P4FA 3ZUVA 4BCQA 4C0TA 3I5ZA 1KWPA 4GG5A 3V5QA 4F78A 1SYKA 2VTIA 3O50A 4AT3A 5JGBA 3RP9A 4PWNA 3COHA 1NXKA 1Q97A 2DS1A 4QTBA 4EOQA 4TTHB 1H8FA 5AP6A 5LWMA 5M06A 2JBPA 2RKUA 1P14A 3PE1A 2Z7SA 3CTHA 3GOKA 3NUPA 4X2GA 2OJ9A 1YWNA 4P2KA 3QWKA 2ITXA 2UW4A 3AD5A 3LCOA 4AFJA 4DFLA 5JFWA 4ZY4A 3TZMA 4BKYA 3NR9A 5JRQA 3QQKA 2W1HA 3FAAA 4Q5EA 2WMSA 4CFWA 2Z7LA 4XG9A 5HLNA 4DFYA 1FPUA 3D7TA 5E4HA 2R3QA 1M7QA 2VWBA 1KV2A 3NUUA 4EH3A 4TWNA 2W1IA 4IB1A 2F7XE 3MI9A 1RW8A 2BAJA 3GCQA 3MA3A 4U80A 4YZ9A 1A06A 4IFCA 1TVOA 3V04A 2BDFA 4EOLA 4FV2A 4FK6A 5FD2A 3MFTA 4EORA 1F3MC 2XA4A 3QKLA 3SDJA 3AKLA 5IQGA 3BE9A 3DKFA 5AV2A 2W1FA 3EH9A 4Y73A 2C6OA 2PUPA 3IGGA 5HIEA 3FLQA 4E8AA 3H3CA 4F7JA 5JFXA 3MYGA 3ZHPC 1WAKA 5I0BA 3OCTA 4DFNA 4E93A 5CVFA 5DR2A 3DQWA 2AYPA 2C6TA 2IJMA 4FTAA 5JT2A 3LFQA 4FEXA 4QMQA 3W0NA 3CJGA 5EYMA 2C30A 4RIWB 2X9EA 2WQEA 3BCEA 3OUKA 5AUXA 4C3FA 3F3VA 3OTUA 4RJ5A 4FIIA 3E7OA 3GT8A 3HV3A 2WMXA 2X6EA 4O0SA 3C4EA 4EWQA 3CXWA 5EOBA 4QYYA 5BVDA 4OTIA 3R9OA 4D5HA 3FWQA 3W55A 5CNNA 1ZAOA 2IZUA 5BNJA 3I0QA 5LMBA 3GCPA 4XG4A 2XRUA 2XNPA 3MH1A 5AV1A 4O91A 2A0CX 2WTIA 2ZB0A 4O82A 2XNBA 4LI5A 1UWJA 3LVPA 4QO9A 3WE8A 1REKA 2VTLA 1H0VA 3F2RA 5HD4A 1MUOA 3DXNA 3EN5A 3QX2A 2BILB 3RPOA 5ITAA 3LCSA 4EH9A 3S95A 4ZY5A 3HDNA 4C57A 4FV9A 5CASA 4XG8A 5F4NA 5H3QA 3D2KA 1JKTA 3ZRKA 4AZEA 2VTMA 4DTAA 4MX9A 4X2FA 3RINA 3DAJA 4CMOA 3F9NA 1G8JA 1H07A 3R63A 1Q8TA 5HTCA 1MRVA 3G6GA 3LJ0A 2UV2A 4F9BA 1PW2A 2JDSA 2OXXA 1XH8A 1GZKA 2FUMA 4JDHA 4U42A 2R2PA 4IADA 2A2AA 1XH5A 3A7GA 4ZMFA 4IZYA 4ZJVA 4O2ZA 4O0UA 2OIBA 3OC1A 3VBYA 1E1VA 3VS3A 4E20A 1OIQA 5EI6A 3DV3A 3RK9A 4CEGA 4D58A 2RIOA 5L3AA 1Q99A 4AZWA 4JG6A 2PZPA 3W16A 4GK3A 3NFGB 2X6DA 1NW1A 4BF2A 3LOKA 5K3YA 3CTJA 3OFMA 2PMIA 3WI6A 4CFMA 2YWVA 1MQ4A 2R3MA 4HVHA 2YDIA 4AGDA 4UX9A 3F3TA 2IW6A 2XKFA 2F9GA 4HVSA 3BGPA 4D1SA 4HZSA 4O4DA 2VRXA 4I3ZA 5DHJA 3KXXA 2X39A 3LXPA 3ANRA 3MSSA 4RSSA 3EJ1A 4JIAA 4X3JA 4K9YA 1UU8A 2C5YA 4LOPA 5J5TA 3PZHA 2C6LA 4ZIMA 4FV1A 3U8WA 4OUCA 3TNWA 3QGWA 5H2UA 3H9RA 2X81A 3PPJA 4LFIA 3RM7A 3AGLA 4BI0A 4D9TA 1P4OA 3N9XA 5E8UA 2XK8A 4MD8E 1R39A 5M4FA 1UNGA 4LG4A 4LL0A 4RVMA 3WARA 2JDTA 3QRJA 4B9DA 4CQGA 4QDEA 5H8EA 5T3QA 3QZFA 4GFMA 4W4YA 2EXCX 3FZPA 3LKMA 3DS6A 5C4KA 1FMOE 3CEKA 5CQWA 4FVQA 3N51A 1YOJA 4KS7A 2JFLA 3R9RA 3EL7A 4P90A 1YQJA 5KMOA 4EBVA 4P5ZA 3NGAA 1A48A 1Y6AA 4JG7A 4A4LA 3HAMA 4N57A 1PF8A 4MCVA 3CJFA 3ROCA 1PYEA 4XG6A 4F9YA 1PKGA 2UVXA 4M14A 4RIXB 4E4NA 3WBLA 4FZFB 4PTCA 3VONA 4YLLA 1YXUA 3OXTA 4QQJA 4WSYA 1A9UA 1ZYLA 2W1CA 3QZGA 2BIYA 3ETAA 3BU3A 4IACA 1JSTA 3FMHA 3F5XA 2YCFA 4MD7E 3A61A 5EYKA 3U6IA 5KO1A 2G2FA 2XYUA 2HWPA 1Y6BA 2WELA 1M7NA 4V04A 5KBQA 5E92A 3UNJA 3E8NA 3FQSA 5HCZA 3PVWA 4YZCA 4FKJA 4J95A 3ZC5A 3DJ7A 4FV5A 4JBQA 1Q8UA 4K6ZA 3PSBA 4MBJA 4D55A 3VUMA 3C0IA 2BRGA 2E9OA 5KCVA 3TYKA 3MVLA 4Q9ZA 4U6RA 3PG1A 5BYYA 2GMXA 2VWUA 3BWJA 3K5VA 3LMGA 4YC3A 3HLLA 2X8EA 4N6YA 3VHEA 5KMLA 3ATTA 1I09A 3SW7A 5JZJA 4U0IA 4WRSA 2B53A 3UPXA 4I24A 2Q0NA 4L67A 4RZVA 4YURA 3Q4TA 3BV3A 5HOAA 4FTNA 2XIKA 1WCCA 4QP7A 4S30A 5HICA 5K0XA 4R3PA 3V5JA 3NUSA 4ACHA 3PJ2A 4JBOA 3KK9A 4IJPA 4FV8A 2GU8A 4OBPA 4RVKA 3U9CA 3ZYAA 2O8YA 4JX7A 4TYHA 4UXQA 4KSQA 5HD7A 4ALUA 4MQ1A 5AP7A 4FTLA 4E1ZA 3R7EA 3BLAA 5DT4A 4QT1A 3D7TB 3QRTA 4XBRA 4CTBA 3HNGA 2OWBA 5B2LA 4EZ7A 4DEHA 4LUEA 5I9YA 5E8XA 1ATPE 3R2BA 2HW7A 2WMRA 3V6RA 5C1QB 1YRPA 2B9FA 3A62A 2Z7RA 3DY7A 3Q4UA 2CGUA 3Q9YA 3QAME 3R8PA 3TG1A 3TZ9A 1L3RE 2OU7A 4FTRA 4R8QA 2XKEA 2XALA 2YAKA 5IZFA 3NVKI 2O65A 2QOKA 4FKSA 1ZZ2A 1ZXEA 3ZDIA 3QCYA 2WU6A 4YNOA 4I20A 5TF9A 2Z02A 4ASXA 1PXLA 3AC2A 3MPMA 2J0JA 4XBUA 4YHFA 3MVMA 3SRVA 5K5NA 3FHIA 5HESA 5M51A 5HO8A 3ELJA 2BALA 4GUBA 4FI1A 4H1JA 2C5NA 2WD1A 4ZLOA 3R7UA 1Y8YA 2OG8A 2ZV9A 1ZRZA 2YCRA 4FTCA 4GT5A 1IG1A 2UW6A 4EHGA 3BHHA 3Q2MA 4XV9A 3QTUA 2W1ZA 4XP2A 5CQUA 3VF8A 1J1CA 1J7UA 3F61A 5IUIA 4IANA 1XH4A 2J5FA 4AA0A 3FXXA 2VGOA 3EKKA 3FQEA 2QI8A 2A4LA 2XZSA 3EZRA 3V8WA 3K5UA 4NTSA 4YP8A 3UQGA 4EL9A 2VTQA 5BUEA 3O2MA 3G90X 1H08A 3FMJA 5HI2A 1FGKA 3VUHA 3WZEA 4F0IA 2W5BA 3W2SA 1DAWA 2EXEA 4ZTSA 2B0QA 4HVIA 1PMEA 2C3IB 2J50A 4MXYA 1WBOA 2F7EE 2GHLA 3KXMA 2QOFA 4FSYA 5GZ9A 2E2BA 3ZONA 2G9XA 4EHVA 5CANA 4EI4A 2RG5A 2P4IA 4DFUA 4KA3A 4O1PA 4IZ7A 2WO6A 3LXLA 3O17A 4XP3A 1QPDA 3TNHA 3A7HA 4Y8DA 3VAPA 1BI8A 4AUAA 4EH5A 2PUUA 4W4VA 3TCPA 2Y4IB 5DGZA 3ZDUA 4CG9A 2EWAA 5C9CA 5IEVA 4EYMA 3R7IA 1W83A 5CAPA 2WAJA 4JOAA 5LCJA 4RQKA 4CYJA 4FSRA 5ACBC 2R7BA 2C4GA 2XK7A 3EKNA 3O8PA 4EOJA 1KOAA 3ORPA 3COKA 5I3RA 2I6LA 4TXCA 2XVDA 4R6VA 1OKZA 4IAZA 1PXKA 3DK7A 4S33A 1OL2A 2ZVAA 4GMYA 4JAJA 3T3UA 3U55A 2JEDA 2QURA 1H00A 5AR8A 2PZYA 1H01A 2Q0BA 3PLSA 3GU5A 4L3PA 1Z57A 3NUNA 3UBDA 1PXPA 2V7OA 5FP5A 5LMKA 2YM8A 3B2TA 5TO8A 4MWIA 2Y8OA 2J0LA 3HMOA 3POZA 2JD5A 4YJTA 4FJVA 3BHYA 2ITQA 2ETRA 2JKKA 1OIRA 4L00A 3V6SA 1J7LA 1M17A 2J7TA 2VN9A 4OTWA 3ROYA 1FVVA 1W8CA 2XNNA 5DN3A 3GOPA 4IBMA 4U81A 4W9WA 2G2IA 3P23A 3ZRLA 3CS9A 3OCBA 4XV2A 3UIXA 3UZTA 3PXQA 3MIAA 2E9PA 2HXQA 4EOIA 5BVNA 1Q8ZA 3LCKA 2OW3A 4O4EA 4YJNA 4A9YA 3E8DA 4BR3A 4DCAA 4ZK5A 4DG3E 1FMKA 4F9AA 2QOQA 3L8PA 3RHXA 2R0IA 3BLQA 3HV4A 5DVRA 4TYEA 4FE2A 4DN5A 4EQMA 3ODZX 2NRYA 5HLWA 5EH0A 3CD8A 4O1OA 3SOAA 3BX5A 3RZBA 2WTVA 4PP7A 2JBOA 4KSPA 2JFMA 3D5UA 3QKKA 2CKEA 4ZTRA 5JQ8A 5K9IA 1MRYA 5B2MA 3OWLA 3ORZA 4DA5A 4Z16A 2XKDA 3DXQA 2JAVA 3JXWA 1UNHA 2I0HA 5HVJA 5FXQA 3VJOA 1E9HA 1R0PA 3NSZA 5AM6A 2Y6MA 3GC9A 3RZFA 4JR7A 4ZS0A 4NWMA 4NM7A 3KXHA 4UMQA 4DG0E 2H8HA 2YAAA 4NW6A 4LV7A 3D5VA 4L7SA 4NKSA 1JKKA 4YO6A 2GQRA 5HO6A 4BCOA 3W0OA 3TIZA 4ANOA 4ZAUA 3UDSA 4FT3A 1F5QA 2UZLA 4GKIA 4I4FA 3UQCA 4C4FA 3GFEA 4IVBA 3R8LA 2B52A 5AV3A 4BHNA 4C61A 3OWJA 4APPA 4BCGA 4M69A 5IA4A 3R7YA 4ACCA 3PXZA 5ANKA 4CSVA 4ZOGA 4WBBB 2C1BA 4EZ3A 4ALVA 2G2HA 4M0YA 4DBXA 1APME 2Y4PA 4IH8A 5EOLA 5ETAA 4EUUA 1GIJA 3U4WA 4CLJA 2PL0A 2GNLA 1SMHA 4AGCA 3W0MA 4E5WA 2PU8A 3A7JA 3OW4A 4MBIA 4A4XA 4IEBA 4DLIA 2IVUA 4IQ6A 3D5XA 4JX3A 2OIQA 2C3KA 1WBWA 3DQXA 3AC3A 4IB0A 2ZM4A 3OEZA 4L44A 4PV0A 3QCXA 3RAIA 3IDCA 4QYGA 4YO4A 5IG1A 3DBEA 5AAFA 5AUUA 5IA0A 4GV1A 5KMKA 3VBWA 4QQ5A 4MXAA 4RJ4A 3AXWA 3K2LA 3V8TA 4IHPA 4ZS4A 4FIFA 3VS2A 4HW7A 3NNXA 1UKIA 3FZOA 3H0ZA 4M3QA 5AUYA 5L6WL 1K9AA 2W9ZB 2XK6A 2XK4A 5E8VA 2JIIA 3VQHA 2WQMA 4ENYA 2Y9QA 4AP7A 4MWHA 3KB7A 3KVWA 2WGJA 3VS4A 3A7IA 3UO5A 4F1MA 5T6KA 3ZZEA 3COIA 3IQ7A 3SG9A 4QD6A 5IDPA 3R1NA 2BHHA 3K3IA 1SVHA 3HAVA 2ACXA 2CN5A 3DPKA 4FTIA 2C3LA 2J4ZA 2UW7A 4B8MA 4E7WA 2OZOA 3G9LX 5IA2A 4EK5A 2WOUA 1VZOA 3OY3A 3TKIA 2GNGA 3ZXTA 4F0GA 3SRVB 4EOSA 5C03A 3F7ZA 2WMQA 5HG8A 3EQHA 5GNKA 2W7XA 2C6DA 3PRFA 3JS2A 4LL5A 4D2SA 3L8SA 3TJCA 5LARA 4UWYA 4Y72A 4FNWA 2NO3A 1YDSE 2QU5A 4EJ7A 4FKQA 3VF9A 1IEPA 4QYHA 5CNOA 3Q5IA 2H96A 3IECA 4OTPA 2J2IB 4EH7A 4GT4A 5F1ZA 5ANGA 4G31A 3UIUA 4D5KA 5A9UA 4FT7A 5AIKA 4ZTLA 3KA0A 2ONLA 2RFNA 3S3IA 5LJJA 3FXWA 3LFFA 1SM2A 4G9CA 2CCHA 4ACDA 4HGLA 4IVCA 4WNMA 2GNIA 2VAGA 1Z9XA 2BZKB 1IAJA 1ST4A 4KBCA 1OGUA 2GNHA 5IEXA 2YZAA 4M67A 4RX5A 3BWFA 4DEIA 5L2TA 3GBZA 1S9JA 3Q6WA 3F82A 3PVUA 4XJ0A 5ANJA 5DT3A 4OLIA 4U3YA 4G9RA 3AMYA 3FMNA 3R01A 3CQWA 3GQLA 2XANA 3NDMA 4MXOA 2IVVA 2AC3A 4AZVA 1B38A 3PYYA 4EHEA 3OOMA 1Z5MA 3BL7A 3R0TA 4FSQA 4KKHA 3FSFA 3TNPC 4EZ5A 3LZBA 3PXRA 3DNEA 3RK5A 4J53A 2X8DA 4I5MA 3RMFA 3VO3A 4EH2A 3O7LD 1XMMA 2CNUA 2QG7A 3CLYA 3W8LA 3MTFA 1DM2A 4QDVA 4O0RA 3ZH8A 2ZYBA 4F6SA 3BKBA 1Y8GA 2EB2A 2FVDA 1WFCA 2X1NA 3Q96A