1UU8A

Structure of human pdk1 kinase domain in complex with bim-1
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
286
structure length
277
Chain Sequence
PQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSNFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of Ly333531 and Other Bisindolyl Maleimide Inhibitors with Pdk1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
total genus 85
structure length 277
sequence length 286
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1uu8A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1uu8A02
3KGAA 2JLDA 3NAXA 3ZOSA 3C50A 3F88A 4AE6A 5CVHA 2GS7A 4CFMA 3TNPC 3QXPA 4O83A 3KVXA 3ZRLA 2I1MA 4A9RA 3FMNA 4WG4A 3CEKA 3JYAA 4TXCA 4AZVA 5AUUA 1YOLA 3MVLA 4JS8A 5CSWA 3QLGA 4IDTA 1HCKA 1TQMA 3EQIA 1LP4A 3OFMA 3SDJA 5C01A 4ALUA 4Q9SA 4G6LA 5EK7A 5BVKA 3VW6A 3V5JA 2R3RA 3OD6X 4G6NA 5F4NA 3C51A 3PWYA 4JL9A 2WEVA 4EOPA 4F1TA 3BLQA 5EG3A 4RWLA 4CCBA 3GENA 3D5UA 1ZAOA 2NRYA 3G2FA 4L52A 4F9CA 3ELJA 4DFUA 2XNNA 3P7BA 1LEWA 3G90X 4G5PA 4M68A 2PSQA 4IZ5A 4BN1A 5BVFA 3BEAA 3OTUA 2UW0A 4OTHA 3LFAA 1LUFA 1J91A 2UW4A 2G2HA 3GU5A 4JG8A 4L43A 2WOTA 2HENA 3R1NA 3IONA 3L8SA 3W2OA 5FXQA 3PA3A 5BVNA 5ETIA 2WU6A 2OZAA 4NUSA 4E20A 3JPVA 1ZRZA 4BR3A 5CANA 4RG0A 3KCKA 2ERKA 3GOKA 1CTPE 1Q24A 2XP2A 4G3GA 2CGWA 4O91A 3RPOA 4F63A 1YHVA 2WOUA 2ZYBA 4IM2A 5EDQA 4W4WA 3RK9A 3TG1A 4BDCA 5FBNC 2XYUA 1M52A 3BI6A 3ZTXA 3HUBA 4ANOA 4EK5A 2WTJA 1ZZLA 4X3FA 2G1TA 5D7AA 1OBDA 3VS6A 1YQJA 3ORZA 2OO8X 4NK9A 1J3HA 4D5KA 3S00A 2UZDA 4IVCA 4B6LA 5CU2A 1LPUA 1P14A 2UZUE 3QQHA 2QU6A 4D1ZA 3SD0A 3NNXA 4ZZNA 4KUJA 2VUWA 5LVMA 3DBQA 3RAKA 3MPMA 4IJ9A 3IGOA 1JKKA 1YXXA 2B9JA 5JH6A 3L8VA 4C02A 5BMMA 2F57A 3COKA 3SQQA 4EHEA 2ITXA 3F82A 4WSYA 5E8UA 4BYJA 3RALA 4HVGA 2FSTX 4FL3A 5HX8A 2X7GA 3ZU7A 3RWQA 1VYZA 3LFNA 2WMQA 5M56A 1ZARA 4ZTLA 4L53A 2OLCA 3MPAA 2BRNA 2BROA 2BR1A 2PY3A 4FVRA 3P79A 4FTUA 4G17A 1XQZA 2YIYA 3L8PA 4A06A 2YN8A 4AGUA 1YWNA 2A4LA 5EM7A 4ZZMA 3UOHA 4FZ6A 2R3NA 4BL1A 3G9NA 4W4XA 4EHGA 2RFSA 3ZM9A 5ANKA 4HGLA 5IU2A 4UZDA 1XJDA 3DPKA 3DTCA 2B55A 4OTDA 3I0QA 4C3FA 4CT2A 4E1ZA 1OIUA 4O7RA 2WQBA 4WUAA 4G9RA 4FKGA 2YM5A 4O7VA 4I5HA 4JVGA 4K1BA 4L6QA 3QL8A 2QC6A 3F2NA 4RIXB 4EC9A 1H26A 4KA3A 2QLQA 1Z9XA 5CVGA 3R8VA 5I0BA 2VGPA 3I5ZA 4YTHA 1PMNA 3LPBA 3BGQA 4IX4A 3A60A 2HZ4A 4ANSA 4RIYA 3ZFMA 4JAJA 4RFMA 5ACKA 3NIZA 4GK4A 2ZM4A 3ORNA 5B7VA 5BQ0A 3BYMA 3BV2A 4IB0A 1QPCA 2VTMA 3MB6A 3R7GA 4QP8A 5HTBA 5IDPA 4DFBA 4I22A 2OH0E 3ZC5A 4RC2A 3WI6A 1SMHA 2EVAA 1Z57A 3MH2A 3U6HA 2GQRA 1K3AA 3G6HA 4EL9A 1UA2A 2X2LA 3ZFXA 3UG2A 5H9BA 2OBJA 4BDGA 4IWPA 4M3QA 2J0MB 3KXGA 4D2RA 2PMNX 2ZDTA 1OGUA 3LQ5A 2Q0BA 2X7FA 3UP2A 2VX1A 3G33A 3IPHA 3E5AA 2UZBA 5M4FA 4NSTA 4X6QC 3OUNB 3W1FA 2G2IA 3QUEA 3OS3A 4D1SA 4GL9A 5AP1A 4FSZA 4YBJA 2B1PA 3V5TA 4D0WA 5AFVA 4FV3A 2QOCA 3CD3A 3A2CA 3GGFA 2FSLX 3QA0A 3UO4A 5DLSA 5KX8A 2YDJA 3OWLA 4AWIA 3G15A 2WMWA 2JAMA 2GPHA 2QD9A 3VS4A 1OKZA 4YLLA 2VTJA 4KBCA 4J99A 2HK5A 4U5JA 2ONLA 2YM3A 2CNQA 4YNEA 5DT3A 4DFLA 2C3IB 3GU4A 3FLZA 4QMSA 2PL0A 4XX9A 4FTKA 5EQPA 3CTHA 1PXKA 4J8MA 2YLFA 1W83A 4MXYA 5HG7A 4PUZA 4FV2A 4C2WA 4C34A 4NTTA 2HXLA 1OL2A 2W4OA 3H9RA 1BYGA 1FGIA 2XNBA 5EYMA 5HQ0A 5DT0A 3WARA 4FKRA 2GQGA 3C4EA 2ACXA 3FJQE 1M14A 1ZY5A 3I6UA 4X0MA 4WRSA 5ANJA 4JX3A 3ZUVA 4EK3A 5A4CA 3HECA 4WO5A 5EDRA 5IA4A 1IAHA 1AD5A 3ZDUA 4RRVA 3FBVA 1O6YA 4HNIA 4MNEA 4QMOA 4FTCA 3BWJA 5AWMA 5L8LA 2ITOA 3QKMA 4NCTC 3GXLA 3OBJA 2HZNA 4OTIA 4X2GA 5LMBA 4FIGA 2BILB 2IZTA 4CKJA 2WU7A 1P4OA 4R5YA 4TWCA 3PJCA 5AP0A 5AX3A 3LCOA 2LAVA 3LFQA 4ZK5A 5ETAA 3ZLYA 4YGAA 4U79A 1NY3A 2BZHB 3QQLA 4O81A 2GHLA 5DEWA 5ACBC 3MSSA 5A4EA 1PXMA 2W1DA 3HRFA 3ZZWA 4FE2A 4FKWA 2OK1A 2GHGA 4FIIA 4XP0A 3TV4A 2JDTA 4C58A 4EH8A 3IW4A 3ZMMA 4EI4A 5JFWA 5B0XA 1XH9A 2W4KA 3NNUA 4WG5A 3IS5A 2VWZA 4A9YA 5AM6A 4CFXA 4EH7A 5AEPA 1A48A 4OUCA 3H0ZA 3TKIA 3SXFA 3I6WA 3Q2MA 1DI8A 2IJMA 4W9WA 4XLVA 3ZO2A 1PRYA 2RFDA 3LMHA 2CCHA 3MPTA 1PMEA 2PVMA 5CU6A 5CI7A 2NPQA 3QTXA 4NEUA 3TZ7A 3ZLWA 2IZUA 1KE9A 3TIZA 3U51A 5JFXA 4FV5A 4GEOA 4MWHA 4IAIA 2CKQA 1STCE 1OIYA 3QA8A 1U54B 2YERA 5DGZA 2OZAB 4YJRA 1Q8TA 2VTSA 2V22A 3P7AA 4IAKA 4PDPA 2WAJA 4BBEA 2IN6A 1WBOA 4DGNA 4DH5A 4K18A 3GUBA 2XB7A 1HOWA 3D83A 3EWHA 1R39A 2BFYA 2YZAA 5HKMA 4EZ3A 3G0EA 3OVVA 3FXWA 3Q9XA 3IDPA 4Q2AA 4YJPA 4R3RA 1CSNA 2OWBA 4YO6A 5HI2A 5HNIX 4L3JA 2JKMA 4FZ7A 1YOMA 5J1WA 3U54A 4NW6A 4X2JA 4FT0A 4HGTA 4NT4A 4X21A 2UZTA 4K33A 3TL8A 2JKQA 4FSYA 5CEOA 4FT3A 1UV5A 2PVYA 1R3CA 4IW0A 5LMKA 3NEWA 2R3LA 4M69B 3IW7A 4IVAA 2F4JA 4U40A 5HVKA 5E9EA 4EYJA 4EOIA 1F3MC 4FKUA 4EZ7A 4ZIMA 4DLJA 3T8OA 2W1CA 4AN3A 5DOSA 2PE2A 5EHYA 4DH1A 3E92A 3ANQA 5AUTA 3P7CA 3Q60A 1PXJA 5JT2A 2ZM3A 5AR2A 4BTFA 2W1IA 4LV8A 4FEXA 4PL5A 2J0LA 4U44A 2BAKA 2XEYA 3BHHA 3O7LB 1JSUA 4EWQA 4HVHA 4ZY5A 4LQMA 2C0IA 3LFSA 4RSSA 2UVZA 3KF7A 5L6OA 1KV1A 3WZDA 1M17A 4AT5A 5BUIA 2QHNA 2CHLA 3HYHA 5CXHA 5ANEA 3V8WA 5J7HA 1QPJA 3DJ7A 2F7XE 4W9XA 5E1EA 5KHXA 4NYEA 2IG7A 1R0EA 4ZP5A 4C0TA 5JN2A 2P2HA 2YEXA 3IW6A 4YJNA 3SKCA 4C61A 2QO7A 1J7UA 4Z7HA 3TNIA 2VWIA 2PZPA 5E91A 5KMMA 3MVJA 2VWUA 4XHKB 4HVDA 2X8EA 1XH6A 3QTIA 3ORLA 4RJ7A 4ZSEA 4P7EA 3WYYA 1PXOA 1OB3A 2CPKE 3AT4A 3LHJA 4HCUA 4BDDA 5TOZA 3DJ5A 3QUPA 4F6WA 2XJ1A 3KA0A 2GNFA 4B8LA 3MFRA 3DBCA 1ZYDA 3MB7A 3V8SA 5JMSA 4FV8A 2UZVA 5A14A 3R7EA 1IA8A 5FM3A 3U6IA 2QOFA 4I24A 2A1AB 2XNMA 3BE9A 4RVTA 4N57A 4RIWB 4ALWA 3NW6A 4O2ZA 5D11A 5HIDA 3TZ9A 3ZS5A 4S34A 5T68A 3FC2A 3UP7A 2YDKA 3R1YA 4BDBA 4J98A 4QNAA 4DCEA 3R0TA 2QONA 3MV5A 5BVWA 2CGUA 2RSVA 4LL0A 4P5QA 2V5QA 4YZ9A 3EQPA 4G31A 5EHLA 1OUYA 1U4DA 5JKGA 4TL0A 3FE3A 4F7LA 4U81A 4TTHB 2R3HA 4BGQA 2ITZA 3F3TA 3NYOA 4W4VA 5CENA 2WTKB 3VNTA 1NW1A 4Y8DA 1M2PA 4H3PA 4QYYA 5HOAA 3VUHA 2YFXA 5LQFA 4FV9A 4O1PA 4IJPA 5IMXA 5EYDA 4CMUA 3VUMA 2C6KA 2PVJA 1ERKA 2QOQA 4NFNA 2XRUA 4K0YA 3SAYA 3PSCA 2FYSA 3QALE 2I7QA 3QD4A 5CQWA 2CKOA 3FI4A 3VW8A 3VBWA 1T46A 3VUIA 4AUAA 4C4JA 4CT1A 3CSVA 4IFGA 4IZAA 2PVHA 4CLJA 4LOQA 4PP7A 1FVVA 1LR4A 2QURA 2QR8A 2UW8A 4D5HA 3AOXA 4TYJA 3F61A 3JVSA 3FMLA 4L7FA 3UIMA 1UNLA 4IAFA 5IQIA 4IWOA 4FV4A 4WSQA 3VF9A 3LAUA 5D1JA 4D2SA 4BYIA 3W8QA 4C57A 4H36A 3RWPA 4WBOA 3F3VA 4HPUE 4D4YA 3WZKA 1PKGA 1REKA 2ETRA 3KN6A 4E7WA 5E8YA 5IQDA 4BCNA 2VWXA 3KXNA 5HE3A 1H27A 3E88A 4CFNA 2XH5A 4FI1A 4EH6A 5E4HA 1MQBA 1AGWA 2QKRA 4C36A 4E93A 1NVSA 2VTRA 1NT2A 3KK9A 1QPEA 4LUDA 3UJGA 3AC5A 1IAJA 2OSCA 1OL1A 4RC4A 4QP7A 2E9NA 5AA9A 2G2FA 3DZOA 3LCSA 4N70A 5EQEA 3O23A 4M13A 5DG5A 1ZMUA 3C4CA 3NCZA 3PY1A 1JKTA 4G3CA 3ODZX 3VUTA 1G3NA 5KKRC 2PMIA 1ZLTA 2R7IA 3B2TA 3QFVA 3O2MA 2C6DA 5LMKC 2OF4A 3LXLA 4PQNA 4PX6A 2JC6A 4E5AX 3KN5A 4I0SA 5KKRB 5M55A 1JSVA 3LIJA 4FV7A 2KTYA 5DWRA 3UG1A 2YISA 5IG1A 2YJSA 4FG8A 3NUXA 5LOHA 4KSPA 1Q5KA 3S95A 3HP2A 5DA3A 4CG8A 1Q97A 2H34A 3QTQA 4OT5A 4EJNA 4XYFA 3PVWA 4AAAA 4O1OA 2WQEA 4JRVA 3LQ8A 1ZOEA 5DRBA 2VZ6A 3HA8A 3MTLA 4FV0A 3VVHA 2C6LA 3VC4A 2QCSA 2XJ2A 4JDHA 3TT0A 3WF8A 4UWBA 4WRGA 3UPXA 2XJ0A 3ZH8A 3N4TA 2J6MA 3FXZA 3ERKA 5L6WL 3II5A 3ORTA 1Q41A 1MRYA 2WTVA 3GCQA 4ZOGA 3VBYA 3RI1A 4C59A 2C6EA 3DNDA 3QQJA 2NO3A 3NW7A 3TKUA 3TDVA 4Q5HA 5E7RA 4EOKA 4JDKA 3D5WA 4ZEGA 5HTIA 1SNXA 3F3ZA 4V04A 4OTFA 4ZTRA 2XBJA 2HCKA 3NUYA 3OMVA 3I7BA 3LJ2A 2BIKB 3E93A 3KRLA 4KBKA 2XYNA 4ZSAA 3HDMA 2PVKA 4APPA 3NCGA 4AU8A 4NKSA 1IG1A 5EW8A 5AR5A 3W2RA 3QKKA 4OAVB 3DKFA 1H07A 3IKAA 4ERWA 4AA5A 5AM7A 4U97A 1XBCA 5KMIA 4GV1A 4F6UA 5LVNA 4IADA 1CKJA 4ACMA 4AOJA 4DG3E 3FSFA 4XUFA 2FH9A 4ITJA 4CFWA 5CAPA 1UNGA 4ANQA 1GIHA 5EFQA 2Z8CA 5IPJA 4ASXA 4KIQA 2JIVA 1W84A 1ZMWA 4HYSA 3MA6A 3GU6A 5IDNA 3GT8A 4NZWB 3O50A 2BTRA 3BX5A 4FGBA 4LGHA 5H3QA 5AV1A 2WKMA 2VWBA 1V0BA 2J5FA 3COIA 1OL5A 4TWPA 3UODA 5A6OA 3LMGA 3DLSA 3EQCA 3F5XA 1KOAA 2ZB1A 3U9CA 1VEBA 3R83A 3V5QA 4PL4A 3W2SA 1H1SA 1ZMVA 5CEIA 4O0TA 4GVJA 1YDSE 4ZTMA 4N6ZA 2V62A 2CJMA 3R7OA 1BX6A 3DS6A 4FNWA 3WZEA 4A9UA 4J52A 3D2IA 5T3QA 4FKLA 3QHRA 1JNKA 5M08A 3QQGA 4W8EA 4X7QA 4XV9A 3LQ3A 2X6EA 2J5EA 4KWPA 2Z7SA 4YO4A 3ID6C 2HAKA 3ROCA 2C30A 3L9PA 3NUPA 2ZAZA 3Q4UA 2DQ7X 4Q9ZA 2CKEA 4PTCA 3O51A 3A7JA 4A9TA 5J87A 5JGAA 1FBNA 5CEPA 4WD5A 5KE0A 3SC1A 3UVQA 3KXXA 2CCIA 3HMOA 2BALA 3DFAA 4BCIA 1KUTA 5CQUA 1YVJA 2C5OA 2W1FA 1URWA 3C0IA 4QTAA 5HLNA 5GNKA 4BTKA 2VTPA 4XOYA 2BIYA 3V01A 5TKDA 5K0XA 3HAMA 4LOOA 4RBLA 3F66A 1OKVA 4YLKA 1H08A 2VX3A 3SXRA 3I79A 3BHTA 3OWPA 4IX3A 3CGOA 1GJOA 3FMMA 5B2MA 5GJFA 2R3PA 4EUUA 1MUOA 1PYEA 4QTEA 5HGIA 2YABA 3RGFA 4F9BA 3L8XA 3PXYA 4FTOA 4WOVA 4XG4A 1CKPA 1DS5A 3ZSGA 2R3MA 5C1QB 1OPKA 2WFYA 5AAFA 3FMEA 2UZWE 4CKRA 4F65A 5AP2A 3HX4A 5KMOA 4Y95A 1WFCA 5HEZA 5CXZA 4EH3A 4RT7A 3COHA 4D2VA 3KRRA 1IASA 3HRBA 1R1WA 5IA5A 3CKWA 4QMTA 4JR7A 3FPMA 3NW5A 3OROA 3R2YA 4V05A 3UZPA 4PMMA 5IA0A 4QMYA 4O0WA 2HZIA 4FNYA 3OCGA 3THBA 3RTPA 4PY1A 4PNIA 3OOMA 4YC3A 2ZMDA 5DR2A 2CLQA 5CLPA 5HIEA 4HOKA 3PVUA 4W8DA 2W96B 4FKSA 1PMUA 1H0WA 2EB3A 4L3PA 3HV6A 3C13A 2X2KA 4XG3A 4KS7A 4BVUA 1L8TA 5IQAA 3R1QA 1KWPA 1O6KA 3ENMA 5ANIA 3R2BA 3MW1A 4XS2A 3IG7A 3LLTA 2JAVA 3CGFA 4O86A 5FP6A 3WZJA 3GCPA 4FTJA 1GNGA 3AC3A 1XH5A 3BHUA 1SNUA 3HV7A 4YHJA 2XM8A 2BZIB 2QQ7A 3FQHA 3ORXA 5DBXA 3REPA 4CYJA 4A7CA 2HOGA 3FZTA 3D15A 3RBWA 4CRLA 4FTTA 4L3LA 1M7QA 1YXSA 4EUTA 5DMZA 3OOGA 2HXQA 4GFMA 4TY1A 3CS9A 4I21A 4FUYA 3O7LD 3VWAA 3EZRA 4ZMFA 3BBWA 1VR2A 2HWOA 4AA0A 3WOWA 4FSUA 2O3PA 2UZNA 3CD8A 3LFBA 4ZLZA 1Q99A 4YU2A 4CG9A 2B54A 2I40A 2X0GA 5I9WA 5IEYA 4FVPA 5A9UA 1JWHA 1H25A 4JRNA 1L3RE 3PJ3A 4DEBA 3ZCLA 4H39A 5CZIA 4L45A 3A4OX 4OTQA 4QQJA 4RQVA 2WGJA 4FTQA 3WYXA 3ZRKA 4C33A 2NNWB 4X3FC 4F9WA 4DT9A 3PIZA 4HVSA 2W1EA 4O22A 4YJSA 4IANA 3VHEA 1UKHA 2HWPA 3HAVA 3PJ2A 2ZMCA 4R1VA 5I9ZA 2IZRA 3TTIA 4IZYA 2Z7LA 3AXWA 3FV8A 1ZYJA 3HMNA 4CV9A 4FEVA 5M06A 3QLFA 3ZZEA 1JPAA 3TZMA 1PW2A 5KZ0A 1F0QA 4QRCA 5T6KA 3OG7A 1XKKA 1W8CA 1SM2A 4DEAA 2VTQA 4CTBA 2QG7A 5KBQA 4KKGA 3LJ1A 3CQUA 4XH6A 2Q83A 4RIXA 4DG2E 4ZSJA 3TXOA 4DHFA 4PF4A 5E8VA 1FINA 1TKIA 1MRVA 3VJOA 2P55A 4CXAA 1RDQE 3ZO3A 4RVLA 1YRPA 4JXFA 3D5XA 2JFLA 2GFCA 2BDWA 4FZFB 3QF9A 4UY9A 4GMYA 3W10A 4DEDA 2FGIA 4YZBA 2BRBA 4BDJA 4DT8A 3Q52A 4MK0A 4QMZA 5DNRA 4JX7A 5F1ZA 3R01A 4QMXA 4ZY4A 3POZA 2YCRA 2FVDA 2PHKA 3D0EA 3LFDA 4AZSA 2ITUA 2C1BA 3S0OA 5DN3A 4GT5A 5M44A 2W5BA 3EL7A 3FMDA 3I0OA 3QYWA 4KKEA 3BPRA 3A99A 5DFPA 1ZY4A 4YUQA 5DPVA 4JBOA 3KMMA 4FTMA 3TTJA 3W2CA 4FYOA 2JKOA 1YDRE 3EJ1A 2VTLA 5HE2A 1Y6AA 3GU7A 4NFMA 4P4CA 4YZDA 2I0VA 3QRJA 4Q5EA 2RGPA 1H8FA 3A7GA 4K11A 4TT7A 2H96A 5TF9A 5KMNA 3VS7A 2W9FB 2RFEA 2BMCA 3NYXA 4FKOA 4YJUA 3RPSA 3ZO1A 4IDVA 4R6VA 1P4FA 4BIBA 4C7TA 5HHWA 3MYGA 3DAJA 4QD6A 4BDHA 2R0UA 4YTIA 2CSNA 1H1PA 2VTTA 3L1SA 3QQUA 3SRVB 4QMWA 1OMWA 4IM3A 1U46A 4D58A 4ZTHA 3UZTA 4JR3A 3GCVA 5AV3A 3RP9A 2QVSE 5H8BA 1X8BA 3WILA 4XV1A 1R78A 3FLNC 5CF5A 1WAKA 1Y91A 1BUHA 4D28A 3UVPA 4I6FA 1H1RA 2ITQA 4YP8A 2O8YA 2Y4IC 1YWVA 3AGLA 5JGBA 3I4BA 3V8TA 3CQWA 5LVLA 2WQMA 2XEZA 4MBJA 4J53A 4AN2A 2IWIA 3CXWA 5FG8A 4YR8A 3Q9WA 4ACDA 4OBQA 3E8DA 4JNWA 2JKKA 3UIUA 2PVLA 4L68A 4IC7A 3VBTA 3TNQB 1OZ1A 4RIYB 2ERZE 3MJ2A 4EHVA 3DXNA 4EEVA 4K8AA 5AV0A 2QODA 4MD7E 3QKLA 3NSZA 1E9HA 4XEYA 5HLPA 5K0KA 4BGGA 4XLIA 4D0XA 4U6RA 4MKCA 4QP6A 3OY3A 4DTKA 3I81A 3ACJA 4JDIA 4UB7A 3UDBA 5C4KA 5CEQA 2PMLX 3H4JA 3FI3A 3FPQA 3DT1A 3TV6A 3W8LA 2W7XA 4BDAA 3QU0A 3MTFA 5I3OA 1UVRA 2WELA 4APCA 3ROYA 4QP1A 2HYYA 3R8ZA 4DAWA 2XIKA 3MVMA 5HESA 5BNJA 3UYTA 3EH9A 2GU8A 4NKAA 4S30A 5FEEA 3UBDA 4V0GA 5J9YA 1UWJA 2KULA 4MXZA 3E62A 4BHZA 5AAEA 3C4ZA 3W16A 5EKNA 2E9UA 4YURA 4BCHA 3MFUA 3PPKA 5EM6A 3Q3BA 2R9SA 2BKKA 1FQ1B 3BLRA 4RZVA 4GYGA 5CSHA 5F95A 2YCSA 4QYEA 2ZV2A 4ACGA 3R7VA 3UOLA 3VRZA 2AC3A 5DRDA 4C4IA 3BQRA 3A61A 3MA3A 4NM5A 3DBDA 4IHPA 4RIOA 3LXPA 4TZRA 2XIYA 4BY9E 3PWDA 3GBZA 4FMQA 3MESA 3C5IA 3AC8A 3N4VA 2EUFB 3R28A 4MXXA 4O0VA 4PTGA 5A54A 3MIYA 4EH5A 5JSMA 4M12A 3KRWA 1TQPA 3ULZA 3PFQA 4R78A 4KRCA 4JBQA 3I60A 1XBAA 2O5KA 3QD2B 1S9IA 5C27A 1YDTE 5AUYA 4P90A 5GIPE 4I6BA 4UWCA 5FDPA 4TRLA 2BDFA 2XCKA 2Y6MA 3MS9A 2VTHA 4EKLA 2J0KA 2O63A 4QQTA 3SX9A 3QQKA 5LARA 1UU7A 3DQXA 1YI6A 2V7AA 3JY0A 1M2RA 3O8TA 3FLSA 5LWNA 3R1SA 4FODA 3BGZA 4WIHA 5B2LA 5C8NA 2UW6A 4KBAA 4XG9A 1KE6A 4C2VA 3R02A 3NUSA 3FHRA 1SVHA 3GC7A 2EB2A 2XNEA 3L9LA 2J9MA 4GFOA 3TEIA 3UQGA 1DAWA 2A2AA 3K3JA 4C4EA 2UW9A 5BVOA 2J90A 2X8DA 3NIEA 3MI9A 4XMOA 2Y4IB 4F0FA 4MD9E 3WF9A 4TWNA 2PE0A 3NPCA 1G8AA 2R2PA 4TNDA 2PVNA 3FMKA 2B53A 4GG7A 5AMNA 3DA6A 2X4ZA 4EJ7A 3LKMA 5HORA 4N0SA 3ORPA 5DHJA 4ASEA 1H1QA 4I5CA 2JDVA 4QYHA 2Q0NA 3NS9A 3F5GA 2ITYA 2UW7A 2UW5A 4M8TA 4MF0A 3KRJA 3OXTA 3R8LA 1REJA 3ZSIA 1YXVA 3BHVA 4XCUA 2QOKA 5EI8A 2I0EA 2YACA 3FSKA 3RK7A 4EONA 4DINA 4D1XA 4GG5A 4N4SA 3D5VA 5FLFA 5C8KA 1H01A 1PXLA 3NVKI 4NIFB 3GCUA 2ITVA 4CMOA 3M1SA 3QRIA 2OIQA 2PULA 3KMWA 4FIJA 3SA0A 4IAZA 4XG8A 1GY3A 3AT3A 1P2AA 1OIQA 4HYHA 4I1ZA 3TZ8A 3V6RA 2Y7JA 4CKIA 1XWSA 3VS0A 4E6CA 4IBMA 3WIGA 2ZDUA 5FXRA 4X2FA 2GNLA 3MVHA 3QX4A 1PKDA 4GKIA 4HW7A 5ANDA 2OJJA 3PTGA 1OI9A 3HP5A 5K3YA 5EI6A 3EFJA 3C9WA 4U7ZA 3HV5A 4AXAA 2XK6A 4B4LA 2JD5A 3D7TB 3FI2A 2QO2A 4TYHA 4I23A 1T45A 4HGSA 1SYKA 3CP9A 4EOMA 3BELA 4XBUA 2WTWA 4OTGA 5L3AA 1ZOHA 1XR1A 3DLZA 5CY3A 3UZRA 4CRSA 4PMTA 4CVAA 2HW6A 1KV2A 2Z7RA 4R8QA 3JVRA 2OH4A 4AOTA 2V7OA 3PSDA 4BB4A 1OUKA 4L8MA 3FC1X 3F7ZA 4H58A 3KC3A 2OGVA 4I93A 4NM0A 4MNFA 4UALA 4E6AA 5C4LA 3NZ0A 4FSTA 3ZLXA 3Q5ZA 5AIRA 3ZHPC 4B9DA 2CNUA 3C7QA 3PJ1A 4BI2A 1B38A 3B8QA 4MTAA 5A6NA 1Q4LA 3ODYX 2QLUA 3GQIA 5HNBA 3PSBA 3FAAA 2C6MA 5CT0A 2H6DA 5EOBA 3ZC6A 4U43A 5IQBA 1JVPP 2C1AA 3D4QA 4LRKA 4EOSA 3PG1A 4FK6A 3P08A 5HO6A 5GJDA 3U9NA 4RLLA 2WIPA 4ANLA 5TT7A 1ZOGA 4ZJVA 4GJ3A 4CFFA 3EN6A 1ND4A 4U41A 4I3ZA 4AP7A 4BTJA 3QBNA 4FIHA 4M67A 5ICPA 1OBGA 4GT3A 1YXTA 3PE2A 2Z2WA 4O82A 2C3KA 4L46A 2BVAA 4BCOA 4BIEA 3IW8A 3DV3A 3UIBA 3FLQA 1Y6BA 2ITWA 3QC9A 3CTJA 4DE4A 3E87A 3R71A 2ESMA 2RFNA 5F20A 3ZXTA 3SV0A 5FTGA 3Q96A 4CNHA 1J1CA 3F6XA 4GK3A 4UXQA 3FZ1A 2XA4A 5CZHA 2R5TA 2RG6A 3LXKA 1MRUA 3BYSA 3EN4A 2R3OA 3C4WA 4GIIA 4FKVA 5LVOA 2WMVA 2HW7A 3DKOA 3HMPA 4YJOA 4TYGA 2WEIA 5CNOA 5FP5A 2BKZA 3H3CA 4JT3A 3RINA 4R3PA 5M51A 3R63A 4I4EA 5EM8A 5ETFA 4CGAA 4D2WA 5FBOA 1A9UA 4R7BA 1YHWA 4PDSA 3CR0A 4TWOA 3KMUA 4AACA 1GOLA 3ZBFA 4QTBA 5DVRA 4JBPA 4J71A 2P0CA 3EOCA 2IVVA 4QPAA 3EN9A 3QD3A 4CD0A 2GNGA 4I92A 3M42A 3AGMA 2YZLA 4DGMA 2VWVA 4DH8A 3K2LA 4DBNA 4NH1A 3N4UA 3G0FA 2CMWA 3T3VA 4OBPA 2XIRA 3GC8A 5I9VA 2QR7A 3RZFA 4OAUC 5EW3A 4QYFA 2CGVA 4DFYA 4KIOA 4FTAA 4USFA 3CPBA 4O2PA 4ZTSA 4AOIA 3UOJA 3FXXA 2VRXA 3HRCA 4FZDB 5E8SA 2I6LA 3FEGA 3UE4A 4BI1A 3SHEA 4O21A 1UU3A 2QOHA 3DCVA 2Y8OA 5GIOE 4BDEA 1CM8A 3NLBA 2VD5A 3CTQA 3PIXA 3QTUA 4BRXA 5A4QA 4DTBA 4FSMA 3OXIA 5AUWA 2IZSA 3U8WA 4I94A 2WTIA 1P5EA 5HBHA 5FUTA 3HA6A 4XG2A 4LFIA 2YAKA 3PZHA 1Y57A 4IX6A 1OITA 4BCGA 2X9FA 3VJNA 5CSPA 3TN8A 2XMYA 3EHAA 2X2MA 4XG6A 4QMNA 2IPXA 1YW2A 3O96A 3VAPA 4NL0A 4XP2A 5IH4A 4H1MA 4YPSA 4IACA 3ZDIA 5CEKA 4UZHA 5JRQA 1JQHA 5BUJA 4YSJA 4G3EA 3QTSA 4IXPA 3POOA 2W9ZB 5CF6A 3PG3A 2JGZA 4MD8E 3P23A 2FA2A 2VTAA 4LRMA 5AP3A 3VULA 4RX5A 5HCXA 4JQ8A 3I1AA 4HYIA 4FZAB 3AMBA 4G3FA 4M7IA 4B8MA 4HCVA 3P4KA 4K2RA 4PP9A 4WNKA 4Y5QA 5AR8A 4BKJA 4KD1A 3EQBA 4CZUA 4GT4A 4F09A 3OW3A 2CGXA 4IVBA 3Q6WA 4YSMA 2A0CX 2JITA 4D2PA 4EQUA 3KY2A 5C8MA 1XHAA 2CN8A 1KSWA 2GQSA 4PPBA 4FKPA 2RL5A 4R77A 5H8GA 2CDZA 5L8JA 3H9OA 4NU1A 4OTRA 5AP5A 3PPZA 1W98A 4DCAA 4F99A 2WTKC 3GB2A 4AQCA 2PPQA 4RPVA 5HU9A 4AN9A 4IE9A 2G01A 3VUDA 4WNOA 1W0XC 3LZBA 4RX9A 1WZYA 1OL6A 2ZM1A 3OHTA 3SOAA 3BCEA 5JRSA 5AUZA 3PXKA 2XIXA 3PA4A 4RLKA 2F7EE 5GZ9A 3P1AA 4X3FB 4FTNA 5AV4A 4DLIA 4GRBA 4IB3A 4WUNA 4XG7A 4LL5A 3NUUA 4QNYA 3DB6A 5HD7A 4DEGA 3PA5A 4BCKA 4O6EA 4FT9A 1J7IA 3D7TA 2ZV8A 3ATTA 4ACHA 1URCA 4FR4A 3S1HA 2OI4X 5IZFA 3EZVA 4EH9A 4FUXA 3TCPA 5FXSA 2Y0AA 3IDCA 1WBNA 4FF8A 4LUEA 4AZWA 3LFCA 4FOCA 4M66A 4ALVA 4B0GA 4BWPA 4B7TA 3TUDA 3NAYA 5EHOA 4TNBA 3EIDA 5BX0A 5JFVA 4AZTA 4ZTNA 5H8EA 3FKOA 4LM5A 3VIDA 3QC4A 4I5PA 2WNTA 3ITZA 3DK6A 3BU6A 3KF4A 4NW5A 3NMUF 3FYJX 4HPTE 3QTRA 3R9NA 3H30A 2XUUA 5HD4A 3LMIA 5CT7A 2R4BA 2EU9A 2BUJA 4K77A 1BI7A 2WMAA 4J97A 4PWNA 3VQHA 3PXRA 4UEUA 4IWDA 5BYLA 2VU3A 4O0XA 3MWUA 2W5HA 3O8PA 4LI5A 2C6IA 3LW0A 4FL2A 4TKSA 2BHHA 3MH1A 1BMKA 2YCFA 5DE2A 3H9FA 4C37A 2WB8A 4BZDA 4QQCA 4AT3A 3F9NA 5HE1A 4DGOA 1H1WA 1AQ1A 2QU5A 5A4TA 3GEQA 5HBJA 3NR9A 1K2PA 4UN0C 1QCFA 1GAGA 2YM6A 3EKKA 5C9CA 1QL6A 1J7LA 4C62A 3SLSA 3DDPA 3F2RA 3SGCA 4DF3A 4Y46A 5GINE 3A7IA 5CSXA 3ZFYA 5EYCA 1BL7A 3DGKA 3BV3A 3DU8A 2FO0A 1FVTA 4QMQA 3EQFA 3Q32A 1WBSA 3DAKA 1W7HA 3ORIA 3L9MA 4I6HA 4F6SA 3DQWA 3A62A 3I7CA 3DBEA 5EYKA 3IGGA 4EBVA 4BDKA 4EC8A 4ANMA 3EQHA 1YWRA 4X3JA 4OR5A 3RJCA 4XRJA 4M69A 3WF5A 1U54A 4DFZE 3IO7A 4CCUA 1Q8ZA 2Y4PA 2CLXA 3C0HA 3QCQA 3ZYAA 4O0UA 1OKWA 1BLXA 3K3IA 3UMWA 3RKBA 4FG7A 4PNKA 4L44A 2W1HA 1YI4A 1QMZA 2JIIA 2W4JA 2J7TA 2XNOA 4AGCA 3PRIA 1IRKA 1H24A 3V51A 3N9XA 3LM5A 5J79A 2GNIA 5ANGA 2F2CB 2J0JA 3E8NA 4BZOA 3RHKA 2JEDA 4I41A 3R6XA 4NIFA 4AFJA 5BMSA 5J7BA 4XJ0A 4HCTA 4IB1A 1H4LA 2B4SB 2YIRA 4MCVA 3ZO4A 3FL5A 4EH4A 3NWWA 4UMRA 5LXMA 3MY5A 4C4HA 3TI1A 4A07A 3KU2A 3CE3A 2YM8A 3HDNA 3VF8A 5DYJA 3U55A 2V55A 2WHBA 4PMSA 3A7HA 3NRMA 4DEIA 3DKCA 3AD5A 4CLIA 3BU3A 2OXYA 4FV1A 4C4FA 2EXEA 4RMZA 2GDOA 3PPJA 4GU9A 3ORKA 4DFXE 4A4LA 3BBTB 4ERKA 5IMEA 3DXQA 3L9NA 4PDYA 3B2WA 3EN7A 4XRLA 4QTDA 2UZEA 5L2WA 3HV4A 4WNMA 1PXNA 4F1MA 3GNIB 3PIYA 2J50A 2YCQA 3U87A 3LCDA 2J51A 2PTKA 3EL8A 4FSQA 3W55A 4OTWA 4MH7A 4JIAA 4O7YA 4AS0A 4EOOA 4NM7A 5HE0A 3FY2A 4EYMA 3AMAA 1U5RA 4O0RA 4RJ8A 4UMTA 1CMKE 4F9YA 2GS2A 3HEGA 4PPCA 4TYEA 1Q3DA 2ZV7A 3Q5IA 2Z7QA 4MQ1A 4EH2A 5CU0A 3QRKA 5GZ8A 2XK8A 5JQ5A 1V1KA 3OC1A 4CZTA 3WF7A 3IW5A 3MDYA 2WZJA 5HX6A 4H1JA 3U6JA 3EQGA 5HG8A 4KIKB 3RVGA 4MNEB 4AW5A 4RC3A 5ANOA 4BZNA 3QTZA 5M4UA 4I0TA 4AW1A 5JGDA 4CQGA 4OLIA 3OW4A 2R3IA 4M0ZA 3VBVA 2YWVA 2WQNA 5JZNA 5JQ8A 4EHZA 1S9JA 1ZWSA 2WQOA 2XKDA 3UTOA 3ZUTA 3Q4CA 4FOBA 4UWYA 3TWJA 2YIWA 4AFEA 3R7UA 5KMKA 1OVEA 4J7BA 4XOZA 4PDOA 5IKWA 2F9GA 3KCFA 4EOJA 3PVGA 3MGYA 3UVRA 3V5PA 3SXSA 4UV0A 3TDWA 2XCHA 5M07A 5IA1A 5HG5A 4AG8A 2R3JA 3WZUA 4DYMA 5JEBA 4JI9A 3QYZA 4JBVA 1JKSA 4BKYA 4DTAA 3VN9A 2GTNA 3OWKA 4QMUA 3MY0A 1JOWB 4GVAA 1BL6A 4ORKA 4EQCA 3FDNA 2C3LA 1LEZA 2C47A 4NWMA 3CBLA 3I5NA 4KKHA 4DH7A 2QOOA 3H0YA 5CF4A 2O2UA 3RMFA 4XBRA 4IB5A 2XVDA 2UZOA 2XBAA 3B8RA 3HMIA 3AT2A 5JFSA 4FVQA 2F49A 3ZRMA 4S33A 5AR3A 1I44A 3R30A 2QOBA 2ZB0A 1YKRA 3PLSA 2F7ZE 2XIZA 4KIPA 3R9DA 2QNJA 5CAQA 3E8EA 3KQ7A 5D41A 4FT7A 5I9YA 1DAYA 3KXHA 3LOKA 2IW9A 2W5AA 5L6PA 3CJFA 1SVEA 3ALOA 4NJ3A 3FWQA 1O6LA 4AF3A 4Z16A 4GIHA 4O6LA 1MQ4A 1OL7A 2JDSA 3FKLA 3UYSA 5HIBA 2GTMA 2VWYA 3FQSA 3SG9A 3E3BX 3D9VA 1Q8UA 2B9FA 4MWIA 4V01A 5GHVA 3V6SA 3WIKA 2PU8A 4QP3A 2B9HA 1UWHA 3HMMA 3TJDA 5L4QA 2YAAA 3FY0A 3NDMA 4Y85A 3V04A 1Y8GA 2VAGA 3NNWA 3NNVA 4NCTA 3TJCA 3UGCA 4YLJA 4F9AA 3DOGA 2X8IA 3KK8A 4MF1A 5HLWA 3QXOA 2QOLA 3IOPA 3NYNA 4ASDA 4HZSA 4EWHA 3MIAA 3FLWA 3NYVA 2VTNA 1XH7A 3CKXA 3NGAA 4ASZA 5AR7A 1Q8WA 4QTCA 4DITA 5KHWA 3ZONA 4FICA 2CKPA 3QHWA 3R9HA 4IFCA 3PXZA 3TACA 1FOTA 2ZVAA 4USEA 4QQ5A 3AMYA 4EOQA 2P3GX 5AUVA 4RVKA 3QRUA 3LXNA 2OFUA 3F3UA 4E26A 3FLYA 2H9VA 3LLAA 5FTOA 5HCYA 2OXDA 3GOPA 3RPRA 3VS2A 2W99B 3BYVA 4E8AA 2J4ZA 3A8WA 4ITIA 1QPDA 2EXCX 4BC6A 3S4QA 3D14A 3Q53A 5CAVA 5HO7A 1FMKA 4LRJA 1Q8YA 5E8ZA 3S2PA 4OT6A 3UNZA 4RJ4A 4ZJJA 3ZXZA 3FI8A 2R7BA 4O7SA 3EYHA 1YI3A 4BICA 5C03A 3OCBA 4BTMA 2OG8A 4I20A 3PP1A 2W0JA 3ALNA 4TN6A 3U4UA 3JY9A 2BAQA 3CCNA 2Z02A 3EFLA 5GZAA 4GW8A 2ITTA 4JLCA 4AA4A 3BHYA 4MX9A 4WT6A 1G5SA 3BGPA 3C1XA 3FYKX 5HNGA 4AE9A 2YWPA 4FIFA 5E8WA 5ITAA 1J1BA 4XP3A 5E90A 3HNGA 5EOLA 4GCJA 1DI9A 2GMXA 5M4CA 3MH3A 3RAHA 4A4OA 3JXWA 4YC6A 3LCKA 2YHVA 5K4JA 3V5WA 5LCJA 1SZMA 1GZKA 1KE8A 2WXVA 1XH8A 2W06A 5CALA 3OT3A 3PP0A 2OF2A 3ZLSA 3TUBA 4YBKA 3C0GA 4IWQA 2WO6A 3UNJA 3BE2A 3N51A 1PYXA 3ANRA 3QZFA 3GU8A 5EI2A 4EORA 5J9LA 3DXPA 3H10A 2C4GA 3IQ7A 3TNHA 3AD6A 3M2WA 3OBGA 4FIEA 3PUPA 3UC3A 5IUIA 4QP4A 5IQHA 3RAIA 2BCJA 2X39A 2VTIA 4FBXA 2J0IA 3G51A 4YJQA 5CWZA 3CPCA 4II5A 5HCZA 5CASA 5AA8A 5HZNA 3SW7A 5AR4A 2PVFA 2PUPA 1U59A 2OICA 2X9EA 3PJ8A 2O0UA 4OGRA 4USDA 3KRXA 4BCMA 2VX0A 4Z9LA 3UQFA 3MJ1A 4BWKA 4G3DA 4DBXA 2HZ0A 5CVFA 5AP6A 4E6DA 4FEWA 2WTCA 3RCJA 3GC9A 4RQKA 2OJIA 3W18A 3Q9YA 5K9IA 5CI6A 3AQVA 5CTPA 4D4SA 2VNYA 2AUHA 3UOKA 4UMPA 4X2KA 4X2NA 3FKNA 1Z5MA 5E1SA 1JAMA 3EFKA 1KE5A 3JS2A 4G6OA 3EN5A 4V0GB 4U9AA 2ZV9A 4F70A 3G6GA 4GSBA 4FEUA 3MH0A 4IZ7A 4O0SA 2OJFE 2QG5A 3HL7A 3KEXA 3K5VA 3QZGA 4FKJA 3C4FA 5IEXA 5IA2A 1OKYA 4ITHA 5AJQA 4RJ3A 4ENXA 1Q61A 2G9XA 4GS6A 3LFFA 4O27B 3BU5A 4WG3A 4NM3A 4J8NA 4J96A 2WPAA 5AIKA 3KULA 2R3QA 5TE0A 3HZTA 4FTRA 3R21A 4CYIA 3W32A 1Q3WA 3QTWA 4JQEA 4AT4A 3F7WA 4ZMEA 1WVYA 2W17A 4S31A 4D4RA 1VZOA 2JBOA 2UW3A 2WMTA 2XK4A 4A9SA 2VV9A 2YJRA 4QP9A 3RM7A 5BVEA 5C26A 5CU4A 4FGRA 4KSQA 2PMOX 1IA9A 3D2KA 1Q62A 3CY2A 2XF0A 3K54A 4LV5A 3ULIA 2I0HA 5DI1A 1CDKA 1WBWA 5L2QA 3R00A 2C5YA 4DN5A 5AX9A 2IVTA 2VN9A 4AX8A 4EKKA 3O17A 4FX3A 4LMUA 3VRYA 1I09A 3D7ZA 4JG7A 4C35A 1PY5A 2BDJA 2ZOQA 2FSOX 3PRFA 3T3UA 5KUPA 4Z55A 2PUIA 2HELA 5I9UA 3ATSA 4CZYB 4RFZA 5AAGA 5CNNA 5CSVA 4Y73A 4E4NA 1WVXA 3GCSA 4MXCA 4IIRA 4FTIA 4F1OA 3P86A 4D4VA 2FSMX 3VUKA 3QCXA 5FEQA 2XKEA 4A4XA 5LJJA 3WE8A 4JIKA 2WMRA 4BDIA 3OY1A 1RW8A 2Z60A 3OXZA 5FQDC 4CMTA 2VO7A 3ZEWA 3KULB 3RCDA 1TQIA 5AV2A 3FZRA 4GH2A 2YITA 3O0GA 2GHMA 2YDIA 3A4PA 4EOLA 2YA9A 4MVFA 4TPTA 2IO6A 2XKCA 4C3PA 5IQEA 2BRHA 4FA2A 1PXPA 4TW9A 5IISA 1E1VA 5CS6A 3QWKA 4U42A 5CX9A 5H2UA 2X81A 3K5UA 4KABA 3EB0A 3UPZA 5I9XA 3V5LA 3COMA 3P9JA 4YJVA 2R3GA 3BRBA 1GZ8A 1V0PA 3KXMA 4IM0A 3SRVA 5EDPA 3PXQA 2UV2A 4UYAA 5E92A 3WF6A 2PE1A 4J95A 3RPYA 2ZJWA 4R7HA 4BCFA 3UIXA 4S2ZA 4KB8A 4KRDA 4ZAUA 4AGDA 2YIQA 4CFUA 4O7ZA 4QO9A 2SRCA 5KMLA 4ID7A 2CN5A 4RA5A 4IEBA 1JBPE 3KVWA 3UQCA 3PZEA 1BI8A 4DGLC 2VNWA 2R3KA 4KIKA 2B7AA 5D10A 3TKHA 4D9UA 3BIZA 5KNJA 2P2IA 5L2SA 4Y5HA 2O64A 4ONAA 1GIJA 2PZIA 5KMJA 1SVGA 3RNYA 1ZXEA 4F7NA 4BFMA 3BYOA 4R1YA 3SG8A 3CQEA 4QMMA 3QGWA 1M7NA 4KAOA 2VWWA 2PK9A 4EQMA 2ITNA 4HNFA 4GYIA 4RWKA 3DK3A 4CV8A 1VJYA 3IK3A 3OUKA 2X6DA 5HICA 4R3CA 2PZYA 2JDOA 5AP4A 1OECA 5A4LA 1ZYSA 2PWLA 4YJTA 3C5UA 4FC0A 4AW2A 4FKQA 2E9PA 3FUPA 3KL8A 2B9IA 4FT5A 4H05A 5EQYA 1ZZ2A 2WIHA 3QGYA 2PZRA 3Q04A 4UYNA 2X7OA 4H3BA 4IVDA 1IR3A 4X6RA 4ZZOA 5FEDA 2XRWA 1FVRA 1UU8A 3F69A 5IUHA 1PJKA 4P5ZA 2EXMA 3DB8A 4O7TA 4S32A 5I3RA 2P33A 1H00A 2BHEA 3W2PA 2DS1A 4AZFA 5JZJA 4DEEA 5A3XA 4E6QA 1G8SA 2OW3A 5F94A 5FWKK 4Y72A 4F64A 4FKIA 4O7LA 3ZM4A 5LCKA 1OPLA 2UVYA 3MFSA 2P4IA 2QI8A 3PY0A 5D9HA 4F7JA 2VO3A 3VQUA 1U5QA 4QMVA 5KZIA 5IA3A 4MXOA 4FK3A 3SW4A 3R8UA 3ZUUA 4GKHA 2WTDA 1KOBA 2Y6OA 2YLEA 5KBRA 4C8BA 1VYWA 3VO3A 1GZOA 5KO1A 4RFYA 3BZ3A 2UUEA 4RX8A 4AZEA 5J1VA 1PHKA 2RG5A 3R7IA 3PY3A 3RK5A 1WBTA 3GQLA 3A8XA 2UVXA 4FYNA 2G15A 4I5MA 3UMXA 3E3PA 5DR9A 4EK6A 2WMBA 1YHSA 1RE8A 2OXXA 3GP0A 3HV3A 2YM4A 3R8MA 2VTOA 4U80A 2WMXA 4MBLA 3FMJA 3KFAA 4G9CA 4U45A 4RIWA 2XS0A 2E9OA 1FPUA 2W05A 2YM7A 3BQCA 2PUUA 3EKNA 4D55A 2RKUA 4EK8A 4F7SA 5A46A 3UNKA 4RGJA 5DEYA 3RZBA 5IH6A 3AC1A 4BI0A 3VBQA 5D12A 5HG9A 1B39A 2FUMA 4WNPA 4PL3A 3RAWA 4KINA 2JIUA 4IC8A 3VS3A 1KE7A 1JLUE 5GJGA 4G34A 3GI3A 1ZYCA 3QRTA 5FTQA 1FMOE 4MBIA 5BYZA 4CFVA 2OJGA 1F5QA 1Y8YA 3VUGA 2RIOA 3OTVA 4TYIA 4FKTA 2DUVA 4YC8A 4QMPA 3QCSA 4NJDA 2DYLA 5CYIA 5ETCA 1RJBA 4AW0A 3OEZA 3OP5A 4KS8A 5G6VA 1WVWA 3F5PA 1XO2B 3NX8A 1WCCA 4FEQA 3QQFA 2C5VA 1HCLA 4IQ6A 5DIAA 5FD2A 2IVSA 4ENYA 5BPYA 4L7SA 3R8PA 4ZS0A 3O71A 4Z7GA 4E3CA 1ZYLA 2X1NA 2GCDA 4GUEA 4XV2A 4DGGA 3RHXA 4DFNA 3T9IA 4WA9A 3IDBA 4G1WA 4WHZA 2RF9A 2FB8A 3HLLA 5J9ZA 4RVMA 2W1ZA 4M0YA 4PPAA 1UKIA 4YZMA 4ACCA 2ETMA 4CQEA 3CY3A 5EW9A 2BRGA 3WE4A 4FSRA 3W33A 4LG4A 3AC2A 4DA5A 1XH4A 2OFVA 4GJ2A 3ZEPA 4RX7A 3IECA 3QX2A 1YOJA 4YTFA 5M4IA 4KNBA 4ZTQA 1UNHA 5IUGA 1XBBA 2H8HA 3DK7A 4YHTA 4MEDA 3R9OA 2HIWA 3Q6UA 3ZBXA 4YPDA 4Z3VA 2WMUA 5L2TA 5FRIA 4YMJA 5BVDA 1WBPA 3FZPA 2BRMA 4YNOA 2GFSA 1NA7A 4E4LA 3PDTA 5CAUA 3E7OA 1YXUA 3DKGA 4PRJA 3R04A 4GU6A 4TYHB 3O8UA 4L00A 1IEPA 4LYNA 4QT1A 3F3WA 4BGHA 4JQ7A 3PVBA 5EKOA 5FM2A 4B99A 3A7FA 2C0TA 5DR6A 3TV7A 3FL4A 4C38A 2QHMA 4U3ZA 5IEVA 3G5DA 1APME 3GFWA 3Q4ZA 5AP7A 3CJGA 4R5SA 5M57A 3E7VA 5BUEA 2B52A 1OPJA 3DY7A 3E63A 1BKXA 2GSFA 4LGGA 4R7IA 4BBMA 4D2TA 3UO5A 2QKWB 2PYWA 2XK3A 2YIXA 4Y83A 2R64A 3OWJA 3G9LX 3LJ0A 4GK2A 5J5TA 3EMGA 4F4PA 3EFWA 5D7VA 3QAME 2ETKA 3VHKA 2VGOA 4XV3A 2E2BA 4O38A 3ENHA 5I4NA 1O9UA 4BF2A 3TIYA 5FDXA 2V0DA 4IMYA 5HVYA 4G5JA 4GUBA 1EH4A 1OIRA 3ACKA 3BKBA 3E64A 1WBVA 4IH8A 3TNWA 3HKOA 5LVPA 2BZJA 3U4WA 4M84A 4BDFA 4WBBB 2OIDA 4O0YA 4HZRA 4JOAA 3GC0A 3MY1A 5HTCA 2IW8A 4EK4A 3R7YA 4M15A 3TUCA 4CTCA 3DDQA 5L2IA 2GS6A 4UBAA 4P2KA 3BEGA 2QO9A 4C3RA 4DH3A 2REIA 5IF1A 2QOIA 3ORMA 4DC2A 2VO0A 2HY0A 3R22A 4E4XA 3QUDA 4G2FA 1JKLA 2WMSA 1PF8A 5E8XA 3F5UA 4HVIA 2AC5A 1A06A 5E8TA 4ZLYA 5AADA 3MBLA 4N6YA 4UXLA 4L67A 3FZOA 2Y9QA 3UC4A 3NVMB 5J5SA 4MAOA 3HGKA 3JR1A 1ATPE 3NUAA 4UMQA 2XM9A 2C0OA 3FHIA 4CSVA 3LVPA 4C4GA 3QD0A 1DM2A 3HUCA 3R73A 3RPVA 3GFEA 3SVVA 2OKRA 5LWMA 3TM0A 3PE1A 3BWFA 2C69A 3PLAE 2O65A 5FGKA 2HY81 4F0GA 2GNHA 4UX9A 1M2QA 2BFXA 2I0YA 5CU3A 2B0QA 1PXIA 2JFMA 4QYGA 5CAOA 5AUXA 4BCQA 4RWJA 4ZLOA 3DJ6A 2BZKB 3CIKA 4MQ2A 4BHNA 4E5WA 2JBPA 3M11A 3P78A 3OT8A 4FTLA 3DFCB 1OM1A 4U3YA 2DWBA 5I5ZA 4ARKA 2A27A 1GZNA 4U8ZA 3VS1A 5J95A 3FZSA 3R9RA 4LGDA 5EM5A 4CEGA 1R0PA 2PZ5A 3AG9A 1MP8A 3OF0A 3PYYA 2IW6A 4U0IA 4WKQA 4YZNA 4ZJIA 4UMUA 5JK3A 4DG0E 4ANNA 3S3IA 3LM0A 5DT4A 3EQRA 4FV6A 2IVUA 2C5XA 3P0MA 2OU7A 4W4YA 4O7NA 5J8IA 3GVUA 3KXZA 4L9IA 3NUNA 3W2QA 3QZHA 2CNVA 4BIDA 4K6ZA 4RA4A 4I0RA 2XKFA 4YTCA 4EZ5A 3BLHA 4FSNA 4K9YA 3C4XA 4QPMA 4I6QA 4ANBA 2C6OA 2ONLC 4AGWA 2W1GA 4BBFA 4OBOA 4BCPA 3F2AA 4E4MA 4FL1A 4D9TA 2JDRA 3HVCA 2ITPA 4O96A 1H28A 3QWJA 4L01A 1K9AA 5M09A 2PVRA 4ZSGA 4RWIA 3JUHA 2XZSA 2LGCA 5K4IA 2VO6A 2WD1A 3E8CA 3UO6A 4O7WA 1NVRA 2F2UA 2UZLA 3LFEA 3LE6A 4EBWA 3Q9ZA 4L42A 1W82A 5IQFA 3OCSA 3WBLA 5IQCA 5LMAA 3EQDA 2BTSA 4IX5A 4MXAA 5HVJA 1NXKA 3OCTA 4ZSLA 3DZQA 4H3QA 3T9TA 5IQGA 3SOCA 1B6CB 4OTPA 3VS5A 5CF8A 3Q2JA 4ZY6A 1UU9A 2OZOA 3KREA 4JG6A 4YHFA 3OZ6A 3P5KA 5TR6A 5HU3A 1JSTA 4YZCA 4NTSA 3QZIA 3VBXA 2R3FA 4GFGA 4JDJA 3MFTA 5B2KA 4BKZA 5IH5A 3CC6A 1CKIA 3MN3A 4MYGA 4DEHA 4RZWA 2NP8A 3RM6A 5G1XA 5K5NA 4FSWA 4IAYA 4PMPA 5F9EA 3PXFA 4MHAA 3KKVA 2NRUA 4ZXTA 4HGEA 3V3VA 2C3JA 2C68A 3QCYA 5HBEA 4E5BA 3FQEA 4JAIA 4PTEA 1GIIA 3IOKA 4XNEA 3OEFX 4FNZA 2XNPA 4J1RA 1FGKA 3ETAA 5M53A 2R0IA 4QPSA 2XNGA 3DNEA 5HO8A 3DBFA 3EYGA 3ZSHA 4F08A 4FNXA 4HYUA 4RJ6A 4QOXA 4E73A 4O84A 1PMVA 5KCVA 4OW8A 4RJ5A 5L8KA 1NVQA 4PV0A 1WMKA 5EH0A 2A19B 2C6TA 3Q4TA 4QMLA 3BYUA 4BWXA 2OIBA 4LMNA 1E1XA 2BPMA 2PUNA 2XK9A 5CEMA 2XK7A 2BAJA 3CLYA 2E9VA 3LCTA 4F0IA 4BCJA 2J2IB 2X4FA 3AC4A 4G16A 4IAAA 4LOPA 3DAEA 1RQQA 4FG9A 4HJOA 5TO8A 3ET7A 3KB7A 2GNJA 3D94A 3DTWA 4M14A 5BYYA 3FMHA 2C5NA 2AYPA 4M97A 1TVOA 4JJRA 1V0OA 4ZS4A 3AD4A 3RNIA 2EWAA 2OJ9A 1H0VA 5DH3A 5K5XA 4QP2A 4I4FA
chains in the Genus database with same CATH superfamily
3KGAA 2JLDA 3NAXA 3ZOSA 3C50A 3F88A 4AE6A 5CVHA 2GS7A 2X0OA 3TNPC 3QXPA 4CFMA 4O83A 3KVXA 3ZRLA 2I1MA 4A9RA 3FMNA 4WG4A 3CEKA 3JYAA 4TXCA 4AZVA 5AUUA 1YOLA 3MVLA 4JS8A 5CSWA 3QLGA 4IDTA 1HCKA 1TQMA 3EQIA 1LP4A 3OFMA 3SDJA 5C01A 4ALUA 4Q9SA 4G6LA 5EK7A 5BVKA 3VW6A 3V5JA 2R3RA 3OD6X 4G6NA 5F4NA 3C51A 3PWYA 4JL9A 2WEVA 4EOPA 3W0NA 4F1TA 3BLQA 5EG3A 4RWLA 4CCBA 3GENA 3D5UA 1ZAOA 2NRYA 3G2FA 4L52A 4F9CA 3ELJA 4DFUA 2XNNA 3P7BA 1LEWA 3G90X 4G5PA 4M68A 2PSQA 4IZ5A 4BN1A 5BVFA 3BEAA 3OTUA 2UW0A 4OTHA 3LFAA 1LUFA 1J91A 2UW4A 2G2HA 3GU5A 4JG8A 4L43A 2WOTA 2HENA 3R1NA 3IONA 3L8SA 3W2OA 5FXQA 2XANA 3PA3A 5BVNA 5ETIA 2WU6A 2OZAA 4NUSA 4E20A 3JPVA 1ZRZA 4BR3A 4JMQA 5CANA 4RG0A 3KCKA 2ERKA 3GOKA 1CTPE 1Q24A 2XP2A 4G3GA 2CGWA 4O91A 3RPOA 4F63A 1YHVA 2WOUA 2ZYBA 4IM2A 5EDQA 4W4WA 3RK9A 3TG1A 4BDCA 5FBNC 2XYUA 1M52A 3BI6A 3ZTXA 3HUBA 4ANOA 4EK5A 2WTJA 1ZZLA 4X3FA 2G1TA 5D7AA 1OBDA 3VS6A 1YQJA 3ORZA 2OO8X 4NK9A 1J3HA 4D5KA 3S00A 2UZDA 4IVCA 4B6LA 5CU2A 1LPUA 1P14A 2UZUE 3QQHA 2QU6A 4D1ZA 3SD0A 3NNXA 4ZZNA 4KUJA 2VUWA 5LVMA 3DBQA 3RAKA 3MPMA 4IJ9A 3IGOA 1JKKA 1YXXA 2B9JA 5JH6A 3L8VA 4C02A 5BMMA 2F57A 3COKA 3SQQA 4EHEA 2ITXA 3F82A 4WSYA 5E8UA 4BYJA 3RALA 4HVGA 2FSTX 4FL3A 5HX8A 2X7GA 3ZU7A 3RWQA 1VYZA 3LFNA 2WMQA 5M56A 1ZARA 4ZTLA 4L53A 3W0MA 2OLCA 3MPAA 2BRNA 2BROA 2BR1A 2PY3A 4FVRA 3P79A 4FTUA 4G17A 1XQZA 2YIYA 3L8PA 4A06A 2YN8A 4AGUA 1YWNA 2A4LA 5EM7A 4ZZMA 3UOHA 4FZ6A 2R3NA 4BL1A 3G9NA 4W4XA 4EHGA 2RFSA 3ZM9A 5ANKA 4HGLA 5IU2A 4UZDA 1XJDA 3DPKA 3DTCA 2B55A 4OTDA 3I0QA 4C3FA 4CT2A 4E1ZA 4QDVA 1OIUA 4O7RA 2WQBA 4WUAA 4G9RA 4FKGA 2YM5A 4O7VA 4I5HA 2ZFYA 4JVGA 4K1BA 4L6QA 3QL8A 2QC6A 3F2NA 4RIXB 4EC9A 1H26A 4KA3A 2QLQA 1Z9XA 5CVGA 3R8VA 5I0BA 2VGPA 3I5ZA 4YTHA 1PMNA 3LPBA 3BGQA 4IX4A 3A60A 2HZ4A 4ANSA 4RIYA 3ZFMA 4JAJA 4RFMA 5ACKA 3NIZA 4GK4A 2ZM4A 3ORNA 5B7VA 5BQ0A 3BYMA 3BV2A 4IB0A 1QPCA 2VTMA 3MB6A 3R7GA 4QP8A 5HTBA 5IDPA 4DFBA 4I22A 2OH0E 3ZC5A 4RC2A 3WI6A 1SMHA 2EVAA 1Z57A 3MH2A 3U6HA 2GQRA 1K3AA 3G6HA 4EL9A 1UA2A 2X2LA 3ZFXA 3UG2A 5H9BA 2OBJA 4BDGA 4IWPA 4M3QA 2J0MB 3KXGA 4D2RA 2PMNX 2ZDTA 1OGUA 3LQ5A 2Q0BA 2X7FA 3UP2A 2VX1A 3G33A 3IPHA 3E5AA 2UZBA 5M4FA 4NSTA 4X6QC 3OUNB 3W1FA 2G2IA 3QUEA 3OS3A 4D1SA 4GL9A 5AP1A 4FSZA 4YBJA 2B1PA 3V5TA 4D0WA 5AFVA 4FV3A 2QOCA 3CD3A 3A2CA 3GGFA 2FSLX 3QA0A 3UO4A 5DLSA 5KX8A 2YDJA 3OWLA 4AWIA 3G15A 2WMWA 2JAMA 2GPHA 2QD9A 3VS4A 1OKZA 4YLLA 2VTJA 4KBCA 4J99A 2HK5A 4U5JA 2ONLA 2YM3A 2CNQA 4YNEA 5DT3A 4DFLA 2C3IB 3GU4A 3FLZA 4QMSA 2PL0A 4XX9A 4FTKA 5EQPA 3CTHA 1PXKA 4J8MA 2YLFA 1W83A 4MXYA 5HG7A 4PUZA 4FV2A 4C2WA 4C34A 4NTTA 2HXLA 1OL2A 2W4OA 3H9RA 1BYGA 1FGIA 2XNBA 5EYMA 5HQ0A 5DT0A 3WARA 4FKRA 2GQGA 3C4EA 2ACXA 3FJQE 1M14A 1ZY5A 3I6UA 4X0MA 4WRSA 5ANJA 4JX3A 3ZUVA 4EK3A 5A4CA 3HECA 4WO5A 5EDRA 5IA4A 1IAHA 1AD5A 3ZDUA 4RRVA 3FBVA 1O6YA 4HNIA 4MNEA 4QMOA 4FTCA 3BWJA 5AWMA 5L8LA 2ITOA 3QKMA 4NCTC 3GXLA 3OBJA 2HZNA 4OTIA 4X2GA 5LMBA 4FIGA 2BILB 2IZTA 4CKJA 2WU7A 1P4OA 4R5YA 4TWCA 3PJCA 5AP0A 5AX3A 3LCOA 2LAVA 3LFQA 4ZK5A 5ETAA 3ZLYA 4YGAA 4U79A 1NY3A 2BZHB 3QQLA 3AKJA 4O81A 2GHLA 5DEWA 5ACBC 3MSSA 5A4EA 1PXMA 2W1DA 3HRFA 3ZZWA 4FE2A 4FKWA 2OK1A 2GHGA 4FIIA 4XP0A 3TV4A 2JDTA 4C58A 4EH8A 3IW4A 3ZMMA 4EI4A 3W0RA 5JFWA 4BJJB 5B0XA 1XH9A 2W4KA 3NNUA 4WG5A 3IS5A 2VWZA 4A9YA 5AM6A 4CFXA 4EH7A 5AEPA 1A48A 4OUCA 3H0ZA 3TKIA 3SXFA 3I6WA 3Q2MA 1DI8A 2IJMA 4W9WA 4XLVA 3ZO2A 1PRYA 2RFDA 3LMHA 2CCHA 3MPTA 1PMEA 2PVMA 5CU6A 5CI7A 2NPQA 3QTXA 4NEUA 3TZ7A 3ZLWA 2IZUA 1KE9A 3TIZA 3U51A 5JFXA 4FV5A 4GEOA 4MWHA 4IAIA 2CKQA 1STCE 1OIYA 3QA8A 1U54B 2YERA 5DGZA 2OZAB 4YJRA 1Q8TA 2VTSA 2V22A 3P7AA 4IAKA 4PDPA 2WAJA 4BBEA 2IN6A 1WBOA 4DGNA 4DH5A 4K18A 3GUBA 2XB7A 1HOWA 3D83A 3EWHA 1R39A 2BFYA 2YZAA 5HKMA 4EZ3A 3G0EA 3OVVA 3FXWA 3Q9XA 3IDPA 4Q2AA 4YJPA 4R3RA 1CSNA 2OWBA 4YO6A 5HI2A 5HNIX 4L3JA 2JKMA 3NFGB 4FZ7A 1YOMA 2AEGA 5J1WA 3U54A 4NW6A 4X2JA 4DHJA 4FT0A 4HGTA 4NT4A 4X21A 2UZTA 4K33A 3TL8A 2JKQA 4FSYA 5CEOA 4FT3A 1UV5A 2PVYA 1R3CA 4IW0A 5LMKA 3NEWA 2R3LA 4M69B 3IW7A 4IVAA 2F4JA 4U40A 5HVKA 5E9EA 4EYJA 4EOIA 1F3MC 4FKUA 4EZ7A 4ZIMA 4DLJA 3T8OA 2W1CA 4AN3A 5DOSA 2PE2A 5EHYA 4DH1A 3E92A 3ANQA 5AUTA 3P7CA 3Q60A 1PXJA 5JT2A 2ZM3A 5AR2A 4BTFA 2W1IA 4LV8A 4FEXA 4PL5A 2J0LA 4U44A 2BAKA 2XEYA 3BHHA 3O7LB 1JSUA 4EWQA 4HVHA 4ZY5A 4LQMA 2C0IA 3LFSA 4RSSA 2UVZA 3KF7A 5L6OA 1KV1A 3WZDA 1M17A 4AT5A 5BUIA 2QHNA 2CHLA 3HYHA 5CXHA 5ANEA 3V8WA 5J7HA 1QPJA 3DJ7A 2F7XE 4W9XA 5E1EA 5KHXA 4NYEA 2IG7A 1R0EA 4ZP5A 4C0TA 4F78A 5JN2A 2P2HA 2YEXA 3IW6A 4YJNA 3SKCA 4C61A 2QO7A 1J7UA 4Z7HA 3TNIA 2VWIA 2PZPA 5E91A 5KMMA 3MVJA 2VWUA 4XHKB 3BL9A 4HVDA 2X8EA 1XH6A 3QTIA 3ORLA 4RJ7A 4ZSEA 4P7EA 3WYYA 1PXOA 1OB3A 2CPKE 3AT4A 3LHJA 4HCUA 4BDDA 5TOZA 3DJ5A 3QUPA 4F6WA 2XJ1A 3KA0A 2GNFA 4B8LA 3MFRA 3DBCA 1ZYDA 3MB7A 3V8SA 5JMSA 4FV8A 2UZVA 5A14A 3R7EA 1IA8A 5FM3A 3U6IA 2QOFA 4I24A 2A1AB 2XNMA 3BE9A 4RVTA 4N57A 4RIWB 4AXDA 4ALWA 3NW6A 4O2ZA 5D11A 5HIDA 3TZ9A 3ZS5A 4S34A 5T68A 3FC2A 3UP7A 2YDKA 3R1YA 4BDBA 4J98A 3TMOA 4QNAA 4DCEA 3R0TA 2QONA 3MV5A 5BVWA 2CGUA 2RSVA 4LL0A 4P5QA 2V5QA 4YZ9A 3EQPA 4G31A 5EHLA 1OUYA 1U4DA 5JKGA 3AKLA 4TL0A 3FE3A 4F7LA 4U81A 4AXCA 4TTHB 2R3HA 4BGQA 2ITZA 3F3TA 3NYOA 4W4VA 5CENA 2WTKB 3VNTA 1NW1A 4Y8DA 1M2PA 4H3PA 4QYYA 5HOAA 3VUHA 2YFXA 5LQFA 4FV9A 4O1PA 4IJPA 5IMXA 5EYDA 4CMUA 3VUMA 2C6KA 2PVJA 1ERKA 2QOQA 4NFNA 2XRUA 4K0YA 3SAYA 3PSCA 2FYSA 3QALE 2I7QA 3QD4A 5CQWA 2CKOA 3FI4A 3VW8A 3VBWA 1T46A 3VUIA 4AUAA 4C4JA 4CT1A 3CSVA 4IFGA 4IZAA 2PVHA 4CLJA 4LOQA 4PP7A 1FVVA 1LR4A 2QURA 2QR8A 2UW8A 4D5HA 3AOXA 4TYJA 3F61A 3JVSA 3FMLA 4L7FA 3UIMA 1UNLA 4IAFA 5IQIA 4IWOA 4FV4A 4WSQA 3VF9A 3LAUA 5D1JA 4D2SA 4BYIA 3W8QA 4C57A 4H36A 3RWPA 4WBOA 3F3VA 4HPUE 4D4YA 3WZKA 1PKGA 1REKA 2ETRA 3KN6A 4E7WA 5E8YA 5IQDA 4BCNA 2VWXA 3KXNA 5HE3A 1H27A 3E88A 4CFNA 2XH5A 4FI1A 4EH6A 5E4HA 1MQBA 1AGWA 2QKRA 4C36A 4E93A 1NVSA 2VTRA 1NT2A 3KK9A 1QPEA 4LUDA 3UJGA 3AC5A 1IAJA 2OSCA 1OL1A 4RC4A 4QP7A 2E9NA 5AA9A 2G2FA 3DZOA 3LCSA 4N70A 5EQEA 3O23A 4M13A 5DG5A 1ZMUA 3C4CA 3NCZA 3PY1A 1JKTA 4G3CA 3ODZX 3VUTA 1G3NA 5KKRC 2PMIA 1ZLTA 2R7IA 3B2TA 3QFVA 3O2MA 2C6DA 5LMKC 2OF4A 3LXLA 4PQNA 4PX6A 2JC6A 4E5AX 3KN5A 4I0SA 5KKRB 5M55A 1JSVA 3LIJA 4FV7A 2KTYA 5DWRA 3UG1A 2YISA 5IG1A 2YJSA 4FG8A 3NUXA 5LOHA 4KSPA 1Q5KA 3S95A 3HP2A 5DA3A 4CG8A 1Q97A 3O5AA 2H34A 3QTQA 4OT5A 4EJNA 4XYFA 3PVWA 4AAAA 4O1OA 2WQEA 4JRVA 3LQ8A 1ZOEA 5DRBA 2VZ6A 3HA8A 3MTLA 4FV0A 3VVHA 2C6LA 3VC4A 2QCSA 2XJ2A 4JDHA 3TT0A 3WF8A 4UWBA 4WRGA 3UPXA 2XJ0A 3ZH8A 3N4TA 2J6MA 3FXZA 3ERKA 5L6WL 3II5A 3ORTA 1Q41A 1MRYA 2WTVA 3GCQA 4ZOGA 3VBYA 3RI1A 4C59A 2C6EA 3DNDA 3QQJA 2NO3A 3NW7A 3TKUA 3TDVA 4Q5HA 5E7RA 4EOKA 4JDKA 3D5WA 4ZEGA 5HTIA 1SNXA 3F3ZA 4V04A 4OTFA 4ZTRA 2XBJA 2HCKA 3NUYA 3OMVA 3I7BA 3LJ2A 2BIKB 3E93A 3KRLA 4KBKA 2XYNA 4ZSAA 3HDMA 2PVKA 4APPA 3NCGA 4AU8A 4NKSA 1IG1A 5EW8A 5AR5A 3W2RA 3QKKA 4OAVB 3DKFA 1H07A 3IKAA 4ERWA 4AA5A 5AM7A 4U97A 1XBCA 5KMIA 4GV1A 4F6UA 5LVNA 4IADA 1CKJA 4ACMA 4AOJA 4DG3E 3FSFA 4XUFA 2FH9A 4ITJA 4CFWA 5CAPA 1UNGA 4ANQA 1GIHA 5EFQA 2Z8CA 5IPJA 4ASXA 4KIQA 2JIVA 1W84A 1ZMWA 4HYSA 3MA6A 3GU6A 5IDNA 3GT8A 4NZWB 3O50A 2BTRA 3BX5A 4FGBA 4LGHA 5H3QA 5AV1A 2WKMA 2VWBA 1V0BA 2J5FA 3COIA 1OL5A 4TWPA 3UODA 5A6OA 3LMGA 3DLSA 3EQCA 3F5XA 1KOAA 2ZB1A 3U9CA 1VEBA 3R83A 3V5QA 4PL4A 3W2SA 1H1SA 1ZMVA 5CEIA 4O0TA 4GVJA 1YDSE 4ZTMA 4N6ZA 2V62A 2CJMA 3R7OA 1BX6A 3DS6A 4FNWA 3WZEA 4A9UA 4J52A 3D2IA 5T3QA 4FKLA 3QHRA 1JNKA 5M08A 4FJVA 4LV7A 3QQGA 4W8EA 4X7QA 4XV9A 4DHZA 3LQ3A 2X6EA 2J5EA 4KWPA 2Z7SA 4YO4A 3ID6C 2HAKA 3ROCA 2C30A 3L9PA 3NUPA 2ZAZA 3Q4UA 2DQ7X 4Q9ZA 2CKEA 4PTCA 3O51A 3A7JA 4A9TA 5J87A 5JGAA 1FBNA 5CEPA 4WD5A 5KE0A 3SC1A 3UVQA 3KXXA 2CCIA 3HMOA 2BALA 3DFAA 4BCIA 1KUTA 4AXEA 5CQUA 1YVJA 2C5OA 2W1FA 1URWA 3C0IA 4QTAA 5HLNA 5GNKA 4BTKA 2VTPA 4XOYA 2BIYA 3V01A 5TKDA 5K0XA 3HAMA 4LOOA 4RBLA 3F66A 1OKVA 4YLKA 1H08A 2VX3A 3SXRA 3I79A 3BHTA 3OWPA 4IX3A 3CGOA 1GJOA 3FMMA 5B2MA 5GJFA 2R3PA 4EUUA 1MUOA 1PYEA 4QTEA 5HGIA 2YABA 3RGFA 4F9BA 3L8XA 3PXYA 4FTOA 4WOVA 4XG4A 1CKPA 1DS5A 3ZSGA 2R3MA 5C1QB 1OPKA 2WFYA 5AAFA 3FMEA 2UZWE 4CKRA 1OGYA 4F65A 5AP2A 3HX4A 5KMOA 4Y95A 1WFCA 5HEZA 5CXZA 4EH3A 4RT7A 3COHA 4D2VA 3KRRA 1IASA 3HRBA 1R1WA 5IA5A 3CKWA 4QMTA 4JR7A 3FPMA 3NW5A 3OROA 3R2YA 4V05A 3UZPA 4PMMA 5IA0A 4QMYA 4O0WA 2HZIA 4FNYA 3OCGA 3THBA 3RTPA 4PY1A 4PNIA 3OOMA 4YC3A 2ZMDA 5DR2A 2CLQA 5CLPA 5HIEA 4HOKA 3PVUA 4W8DA 2W96B 4FKSA 1PMUA 1H0WA 2EB3A 4L3PA 3HV6A 3C13A 2X2KA 4XG3A 4KS7A 4BVUA 1L8TA 5IQAA 3R1QA 1KWPA 1O6KA 3ENMA 5ANIA 3R2BA 3MW1A 4XS2A 3IG7A 3LLTA 2JAVA 4O4EA 3CGFA 4O86A 5FP6A 3WZJA 3GCPA 4FTJA 1GNGA 2A98A 3AC3A 1XH5A 3BHUA 1SNUA 3HV7A 4YHJA 2XM8A 2BZIB 2QQ7A 3FQHA 3ORXA 5DBXA 3REPA 4CYJA 4A7CA 2HOGA 3FZTA 3D15A 3RBWA 4CRLA 4FTTA 4L3LA 1M7QA 1YXSA 4EUTA 5DMZA 3OOGA 2HXQA 4GFMA 4TY1A 3CS9A 4I21A 4FUYA 3O7LD 3VWAA 3EZRA 4ZMFA 3BBWA 1VR2A 2HWOA 4AA0A 3WOWA 4FSUA 2O3PA 2UZNA 3CD8A 3LFBA 4ZLZA 1Q99A 4YU2A 4CG9A 2B54A 2I40A 2X0GA 5I9WA 5IEYA 4FVPA 5A9UA 1JWHA 1H25A 4JRNA 1L3RE 3PJ3A 4DEBA 3ZCLA 4H39A 5CZIA 4L45A 3A4OX 4OTQA 4QQJA 4RQVA 2WGJA 4FTQA 3WYXA 3ZRKA 4C33A 2NNWB 4X3FC 4F9WA 4DT9A 3PIZA 4HVSA 2W1EA 4O22A 4YJSA 4IANA 3VHEA 1UKHA 2HWPA 3HAVA 3PJ2A 2ZMCA 4R1VA 5I9ZA 2IZRA 3TTIA 4IZYA 2Z7LA 3AXWA 3FV8A 1ZYJA 3HMNA 4CV9A 4FEVA 5M06A 3QLFA 3ZZEA 1JPAA 3TZMA 1PW2A 5KZ0A 1F0QA 4QRCA 5T6KA 3OG7A 1XKKA 1W8CA 1SM2A 4DEAA 2VTQA 4CTBA 2QG7A 5KBQA 4KKGA 3LJ1A 3CQUA 4XH6A 2Q83A 4RIXA 4DG2E 4ZSJA 3TXOA 4DHFA 4PF4A 5E8VA 1FINA 1TKIA 1MRVA 3VJOA 2P55A 4CXAA 1RDQE 3ZO3A 3W0SA 4RVLA 1YRPA 4JXFA 3D5XA 2JFLA 2GFCA 2BDWA 4FZFB 3QF9A 4UY9A 4GMYA 3W10A 4DEDA 4DHIB 2FGIA 4YZBA 2BRBA 4BDJA 4DT8A 3Q52A 4MK0A 4QMZA 5DNRA 4JX7A 5F1ZA 3R01A 4QMXA 4ZY4A 3POZA 2YCRA 2FVDA 2PHKA 3D0EA 3LFDA 4AZSA 2ITUA 2C1BA 3S0OA 5DN3A 3UDSA 4GT5A 5M44A 2W5BA 3EL7A 3FMDA 3I0OA 3QYWA 4KKEA 3BPRA 3KIOC 3A99A 5DFPA 1ZY4A 4YUQA 5DPVA 4JBOA 3KMMA 4FTMA 3TTJA 3W2CA 4FYOA 2JKOA 1YDRE 3EJ1A 2VTLA 5HE2A 1Y6AA 3GU7A 4NFMA 4P4CA 4YZDA 2I0VA 3QRJA 4Q5EA 2RGPA 1H8FA 3A7GA 4K11A 4TT7A 2H96A 5TF9A 5KMNA 3VS7A 2W9FB 2RFEA 2BMCA 3NYXA 4FKOA 4YJUA 3RPSA 3ZO1A 4IDVA 4R6VA 1P4FA 4BIBA 4C7TA 5HHWA 3MYGA 3DAJA 4QD6A 4BDHA 2R0UA 4YTIA 2CSNA 1H1PA 2VTTA 3L1SA 3QQUA 3SRVB 4QMWA 1OMWA 4IM3A 1U46A 4D58A 4ZTHA 3UZTA 4JR3A 3GCVA 5AV3A 3RP9A 2QVSE 5H8BA 1X8BA 3WILA 4XV1A 1R78A 3FLNC 5CF5A 1WAKA 1Y91A 1BUHA 1VLRA 4D28A 3UVPA 4I6FA 1H1RA 2ITQA 4YP8A 2O8YA 2Y4IC 1YWVA 3AGLA 5JGBA 3I4BA 3V8TA 3CQWA 5LVLA 2WQMA 2XEZA 4MBJA 4J53A 4AN2A 2IWIA 3CXWA 5FG8A 4YR8A 3Q9WA 4LDTA 4ACDA 4OBQA 3E8DA 4JNWA 2JKKA 3UIUA 2PVLA 4L68A 4IC7A 3VBTA 3TNQB 1OZ1A 4RIYB 2ERZE 3MJ2A 4EHVA 3DXNA 4EEVA 4K8AA 5AV0A 2QODA 4MD7E 3QKLA 3NSZA 1E9HA 4XEYA 5HLPA 5K0KA 4BGGA 4XLIA 4D0XA 4U6RA 4MKCA 4QP6A 3OY3A 4DTKA 3I81A 3ACJA 4JDIA 4UB7A 3UDBA 5C4KA 5CEQA 2PMLX 3H4JA 3FI3A 3FPQA 3DT1A 3TV6A 3W8LA 2W7XA 4BDAA 3QU0A 3MTFA 5I3OA 1UVRA 2WELA 4APCA 4QEBA 3ROYA 4QP1A 2HYYA 3R8ZA 4DAWA 2XIKA 3MVMA 5HESA 5BNJA 3UYTA 3P5JC 3EH9A 2GU8A 4NKAA 4S30A 5FEEA 3UBDA 4V0GA 5J9YA 1UWJA 2KULA 4MXZA 3E62A 4BHZA 5AAEA 3C4ZA 3W16A 5EKNA 2E9UA 4YURA 4BCHA 3MFUA 3PPKA 5EM6A 3Q3BA 2R9SA 2BKKA 1FQ1B 3BLRA 4RZVA 4GYGA 5CSHA 5F95A 2YCSA 4QYEA 2ZV2A 4ACGA 3R7VA 3UOLA 3VRZA 2AC3A 5DRDA 4C4IA 3BQRA 3A61A 3MA3A 4NM5A 3DBDA 4IHPA 4RIOA 3LXPA 4TZRA 2XIYA 4BY9E 3PWDA 3GBZA 4FMQA 3MESA 3C5IA 3AC8A 3N4VA 2EUFB 3R28A 4MXXA 4O0VA 4PTGA 5A54A 3MIYA 4EH5A 5JSMA 4M12A 3KRWA 1TQPA 2XARA 3ULZA 3PFQA 4R78A 4KRCA 4JBQA 3I60A 1XBAA 2O5KA 3QD2B 1S9IA 5C27A 1YDTE 5AUYA 4P90A 5GIPE 4I6BA 4UWCA 5FDPA 4TRLA 2BDFA 2XCKA 2Y6MA 3MS9A 2VTHA 4EKLA 2J0KA 2O63A 4QQTA 3SX9A 3QQKA 5LARA 1UU7A 3DQXA 1YI6A 2V7AA 3JY0A 1M2RA 3O8TA 3FLSA 5LWNA 3R1SA 4FODA 3BGZA 4WIHA 5B2LA 5C8NA 2UW6A 4KBAA 4XG9A 1KE6A 4C2VA 3R02A 3NUSA 3FHRA 1SVHA 3GC7A 2EB2A 2XNEA 3L9LA 2J9MA 4GFOA 3TEIA 3UQGA 1DAWA 2A2AA 3K3JA 4C4EA 2UW9A 5BVOA 2J90A 2X0PA 2X8DA 3NIEA 3MI9A 1W2DA 2Y4IB 4XMOA 4F0FA 4MD9E 3WF9A 4TWNA 2PE0A 3NPCA 1G8AA 2R2PA 4TNDA 2PVNA 3FMKA 2B53A 4GG7A 5AMNA 3DA6A 2X4ZA 4EJ7A 3LKMA 5HORA 4N0SA 3ORPA 5DHJA 4ASEA 1H1QA 4I5CA 2JDVA 4QYHA 2Q0NA 3NS9A 3F5GA 2ITYA 2UW7A 2UW5A 4M8TA 4MF0A 3KRJA 3OXTA 3R8LA 1REJA 3ZSIA 1YXVA 3BHVA 4XCUA 2QOKA 5EI8A 2I0EA 2YACA 3FSKA 3RK7A 4EONA 4DINA 4D1XA 4GG5A 4N4SA 3D5VA 5FLFA 5C8KA 1H01A 1PXLA 3NVKI 4NIFB 3GCUA 2ITVA 4CMOA 3M1SA 3QRIA 2OIQA 2PULA 3KMWA 4FIJA 3SA0A 4IAZA 4XG8A 1GY3A 3AT3A 1P2AA 1OIQA 4HYHA 4I1ZA 3TZ8A 3V6RA 2Y7JA 4CKIA 1XWSA 3VS0A 4E6CA 4IBMA 3WIGA 2ZDUA 5FXRA 4X2FA 2GNLA 3MVHA 3QX4A 1PKDA 4GKIA 4HW7A 5ANDA 2OJJA 3PTGA 1OI9A 3HP5A 1TZDA 5EI6A 3EFJA 3C9WA 4U7ZA 5K3YA 2IEWA 3HV5A 4AXAA 2XK6A 4B4LA 2JD5A 3D7TB 3FI2A 2QO2A 4TYHA 4I23A 1T45A 4HGSA 1SYKA 3CP9A 4EOMA 3BELA 4XBUA 2WTWA 4OTGA 5L3AA 1ZOHA 1XR1A 3DLZA 5CY3A 3UZRA 4CRSA 4PMTA 4CVAA 2HW6A 1KV2A 2Z7RA 4R8QA 3JVRA 2OH4A 4AOTA 2V7OA 3PSDA 4BB4A 1OUKA 4L8MA 3FC1X 3F7ZA 4H58A 3KC3A 2OGVA 4I6LA 4I93A 4NM0A 4MNFA 4UALA 4E6AA 5C4LA 3NZ0A 4FSTA 3ZLXA 3Q5ZA 5AIRA 3ZHPC 4B9DA 2CNUA 3C7QA 3PJ1A 4BI2A 1B38A 3B8QA 4MTAA 5A6NA 1Q4LA 3ODYX 2QLUA 3GQIA 5HNBA 3PSBA 3FAAA 2C6MA 5CT0A 2H6DA 5EOBA 3ZC6A 4U43A 5IQBA 1JVPP 2C1AA 3D4QA 4LRKA 4EOSA 3PG1A 4FK6A 3P08A 5HO6A 5GJDA 3U9NA 4RLLA 2WIPA 4QDEA 4ANLA 5TT7A 1ZOGA 4ZJVA 3UDTA 5BV3A 4GJ3A 4CFFA 3EN6A 1ND4A 4U41A 2XALA 4I3ZA 4AP7A 4BTJA 3QBNA 4FIHA 4M67A 5ICPA 1OBGA 4GT3A 1YXTA 3PE2A 2Z2WA 4O82A 2C3KA 4L46A 2BVAA 4BCOA 4BIEA 3IW8A 3DV3A 3UIBA 3FLQA 1Y6BA 2ITWA 3QC9A 3CTJA 4DE4A 3E87A 3R71A 2ESMA 2RFNA 5F20A 3ZXTA 3SV0A 5FTGA 3Q96A 4CNHA 1J1CA 3F6XA 4GK3A 4UXQA 3FZ1A 2XA4A 5CZHA 2R5TA 3AKKA 2RG6A 3LXKA 1MRUA 3BYSA 3EN4A 2R3OA 3C4WA 4GIIA 4FKVA 5LVOA 2WMVA