1UUFA

Crystal structure of a zinc-type alcohol dehydrogenase-like protein yahk
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
346
structure length
339
Chain Sequence
IKAVGAYSAKQPLEPMDITRREPGPNDVKIEIAYCGVCHSDLHQVRSEWAGTVYPCVPGHEIVGRVVAVGDQVEKYAPGDLVGVGCIVDSCKHCEECEDGLENYCDHMTGTYNSPTPDEPGHTLGGYSQQIVVHERYVLRIRHPQEQLAAVAPLLCAGITTYSPLRHWQAGPGKKVGVVGIGGLGHMGIKLAHAMGAHVVAFTTSEAKREAAKALGADEVVNSRNADEMAAHLKSFDFILNTVAAPHNLDDFTTLLKRDGTMTLVGAPEVFNLIMKRRAIAGSMIGGIPETQEMLDFCAEHGIVADIEMIRADQINEAYERMLRGDVKYRFVIDNRTLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Yahk, a Zinc-Type Alcohol Dehydrogenase-Like Protein
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords ZINC-TYPE ALCOHOL DEHYDROGENASE-LIKE PROTEIN YAHK
total genus 110
structure length 339
sequence length 346
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2003-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1uufA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1uufA01
1ULUA 2BI7A 4D3SA 1ENYA 1PS0A 2VT2A 2JJYA 1XG5A 4EZBA 1VPDA 5THQA 4AJEA 2R6JA 3GHYA 4XR4A 2VRBA 1CIVA 1R0LA 4P4GA 2CF6A 2AG8A 4FOSA 5JW6A 1ZXBA 2J5QA 3L6DA 3FNHA 5U4QA 5KIAA 2Z1NA 5A05A 1QRRA 1T2EA 1ONPA 4CLRB 1S7CA 3GK3A 1R15A 4CM6A 3PYMA 4TRMA 2FR0A 1T2DA 2GDZA 5TC4A 3TZCA 1N7HA 2O3RA 1R0SA 2NUAA 4UUNA 4YRDA 4ZA2A 3I83A 2BFOA 5H83A 3U49A 3BIOA 4D3DA 3L77A 3VC7A 1ZO8A 4DQUA 2JD2A 1P1KA 5H82A 4U8GA 3CPSA 3R0IA 2DBQA 4FN4A 4JBHA 4GI2A 4UVGA 3MJTA 1VI2A 1YBAA 1QMGA 4BNIA 3CTMA 4FD3A 4JBGA 4BVAA 2Y68A 1UZMA 5CEJA 1X1EA 5BR7A 3IJRA 2IYOA 1XYGA 3KSUA 2VQ3A 4GMFA 3C7CB 3P7MA 4FPXA 4YJGA 2R2GA 5ILOA 2AA3A 3TWOA 4B3JA 2WTBA 3TOXA 4NK5A 4JJIA 1DIAA 4XB1A 2IEDA 4FR5A 2Y99A 1JAYA 3OHSX 2WM3A 1P0FA 2ZCVA 5B1YA 4WLVA 1FF9A 3F4BA 4WK6A 4K9DA 3OSUA 1OZAA 2BD0A 3QVOA 3ZWMA 3F46A 1Y8RA 2A4KA 2CFCA 3KZVA 5CDTA 3H7AA 5CDYA 4HADA 1NNUA 4AJPA 3AJRA 3ANNA 3VPSA 1YB4A 3UICA 3DFUA 1XWFA 2EGHA 3BTUA 4YAKA 2TMGA 2Y0EA 1C3VA 3UFXA 3AFMA 4PZDA 3SC6A 3U0BA 3WMWA 5L53A 3GFBA 4MPDA 3U09A 1FK8A 3LT2A 3NTQA 5JMPA 4KWHA 3RC7A 1PQWA 4UEOA 1KEWA 2PTGA 2GSDA 3VKVA 4BNTA 3DZFA 4DWVA 1E3LA 1A27A 1Y5RA 3FSRA 3NT2A 2YV3A 4YT5A 3TOZA 4D0SA 1JWAB 4YBZA 1GYQA 5JCXA 3UN1A 3ONDA 3QJ5A 5JC1A 1WDKA 4KUHA 3N7UA 3PLNA 4UREA 2IYPA 2QRJA 3UAGA 4KMSA 2AQHA 3LDHA 2DPHA 4BNVA 1YGYA 1JN0A 1UDCA 1AN9A 3GC6A 4TSKA 5DOVA 1YO6A 4BKRA 4M86A 1IE3A 1A4IA 3GNTA 4GKBA 4IMPA 4UEKA 1YQGA 4BO4A 1PL7A 1DIGA 4ROSA 1I2ZA 5CEEA 1E6EA 4RJTA 1YS4A 4NJMA 4ZGWA 5ER6A 3S2GA 4DUPA 4IXWA 3U62A 5HM8A 1Y1PA 4L0QA 4RLSA 3WGZA 4LGVA 4R3NA 5LC1A 4MIYA 4NNJA 3TRIA 3W4KA 4HNHA 1N8KA 3JQBA 3JQ7A 4QUKA 4QT0A 4YJFB 4BGUA 1NHGA 5BNFA 4I5GA 1HZJA 2YQ4A 2Q3EA 2E49A 5K6AC 4CQMB 1C0KA 5B4UA 1M67A 4BQRA 4P8RA 1PJ2A 1HSOA 4IDEA 2EP5A 4U0KA 1PTJA 3OETA 4FDAA 3K31A 5JCJD 1UUFA 2CSUA 4WE3A 3ZU3A 2GERA 4DMLA 4OSPA 5COQA 5KWEA 4GH5A 3S8MA 3WX0A 4RPLA 3BMNB 3FPLA 1U3TA 4HUJA 2C59A 2OZPA 4L4SA 4WKGA 1N9GB 3NJ4A 4OM8A 5G4LA 1SC6A 4E31A 1XU9A 3SC4A 5A9SA 1XKQA 5JPIA 1C0LA 3JQGA 5JAMA 1W8DA 4CLOA 3QIVA 2SCUA 4XA8A 1ISIA 5JNLA 1NQOA 3F5SA 3QWAA 3RUIA 3GGPA 3Q2KA 1T2CA 3SLKA 3NRCA 3DDNA 2AEMA 1H9BA 1R6DA 3JQFA 2BFMA 3GNSA 4OHUA 3ROKA 1V3TA 4O1MA 1UDBA 4BL5A 2P5UA 4ND5A 4BO9A 5IDWA 2Q2VA 2E4AA 3OM9A 4TVBA 3UOGA 4YAIA 3PP8A 1HDYA 2YY7A 3ANLA 1X0XA 1FDUA 4IIUA 4IXTA 2I5PO 2GN9A 1E7YA 1KOLA 3UGKA 4QECA 1NAHA 3JD3A 3DXFA 4MVJF 3SJUA 4R69A 2QW8A 4K26A 4IS2A 4BB6A 1LC0A 2R00A 4OOFA 3Q0EA 1LLCA 5JO0A 3M1LA 4Z3DA 1VKNA 2G82A 4I1IA 3U4DA 3CE6A 2EP7A 3W1VA 1P31A 1ZEMA 3L6OO 4AL4A 4CL3A 4Y6RA 3D3WB 3PXXA 1NFFA 1QV6A 1YB1A 3MTJA 5DBFA 3ZN2A 4DTIA 4BNZA 4B8ZA 1UJMA 1VM6A 4OO3A 1H0KA 4Z0HO 2YDXA 9LDBA 4LVCA 2OOSA 1U4SA 3AUAA 3G49A 3PQEA 3RVDA 3C1OA 1EVJA 2YHIB 4H7PA 3LLVA 3TFOA 2O3SA 2QYSA 2LDXA 2PZLA 4BNJA 1Z73A 3Q2IA 3ETDA 1NX6A 3HB4X 1ZW1A 4PLGA 4CV0A 1ENPA 2GD1O 4NFYA 3ZU5A 3ZWPA 4MVJM 3JD4A 5CHEA 1TT7A 1NXQA 1NFQA 4BNLA 1GY8A 2HAEA 4J91A 4KQXA 4BGVA 1TT5B 4ID9A 3BMCB 3H9GA 2HDHA 4JROA 5HRUA 3PTZA 3ULKA 2BFPA 4NBTA 1U8XX 4XD2A 1Q7BA 4EW6A 1ARZA 2F00A 3NAQA 1PJSA 2V6FA 4EJ6A 2O3JA 4TKMA 2ZCUA 3VPFA 1HF3A 3CIFA 3GMSA 3V1YA 1I24A 2X86A 2UUOA 4B4VA 2VOJA 1PS8A 3DR3A 3MCVA 1XDWA 2PZMA 1D4FA 1U1IA 3ADPA 3GA0A 4NBUA 5FWNA 3KETA 1ZUD1 2O2SA 1EUDA 4ZD6A 1W0CA 3COSA 2VZ8A 3CMCO 1SCUA 3ZDFA 1Q2XA 1GEEA 5A3VA 2EW8A 2H5LA 3KYDA 1HEUA 3BMNA 4U5QA 3PLRA 2FRDA 4DQVA 1WAMA 2C2XA 4RCVA 2RH4A 3OJLA 4CM8B 4WCFA 2V6MA 4D46A 5KJFA 4G81A 1LLDA 5FI5A 4IQ8A 1I3MA 4GSLA 4RVDA 2PLAA 5A9TA 1PL6A 4FFPA 1FJHA 3HE3A 4IS3A 1IB6A 4WGGA 4D42A 4IQGA 3PK0A 5JCJA 3L4BC 2C2YA 3W4IA 1M75A 3WGTA 1LRJA 1JKIA 2AG5A 2ZB4A 1P74A 5JY1A 1FDTA 4HKTA 3I9OA 1GQYA 3SJ7A 1E3WA 2YUTA 3HDYA 5GZ1A 1T24A 1P0CA 4YT2A 4CM1A 4YJDA 5HS4A 3E9MA 1GDHA 3R3JA 4CMJA 5BNTA 4ZN6A 3W8EA 4YQZA 1CRWG 3C1AA 2VZ9A 2PWZA 1QSGA 4KOAA 2YW9A 3WIEA 1PJBA 4HFJA 3QSGA 2OORA 2I76A 4AJIA 4YRBA 5CG2A 2QRKA 3KYCA 1GR0A 3F9IA 3GUCA 3WYBA 1NQAO 4CV3A 3O03A 4FOOA 1N2SA 1GUZA 3B6ZA 4EI2A 2WYVA 4DPMA 3JYQA 2VRCD 3MJSA 1I32A 5L9AA 4WLOA 4PLYA 2HKIA 3OIGA 2D1YA 4MOWA 3UCXA 4IIVA 1IULA 4WLUA 4JBIA 4F6CA 1ZKMA 4FW8A 4F45A 3H2SA 5GZ6A 1A7AA 3NTOA 4RORA 4YJHB 5I8ZA 4ND1A 1C1XB 1SOWA 2O50A 2NNLD 1PSDA 1NBOA 3JQ7B 4I8XA 2OBNA 4L74A 5AYVA 1GZ6A 1KVUA 4A73A 1ZK3A 4I9HA 1D1SA 5IN5A 1KEPA 2I66A 3PGJA 1A4UA 4J2OA 2NSDA 4R68A 1F12A 4RLHA 1E1MA 5JYEA 1V6AA 3H3FA 2RHRA 3U9LA 5I7FA 1T26A 1PZFA 1KIFA 1E1LA 2QQ5A 4NBVA 3ZWWA 2ZTMA 1TT5A 1C1DB 4J4HA 3W4JA 3GVCA 1DLJA 2VHWA 3H9UA 3V5NA 1GV0A 5DN9A 1ZK4A 3FTNA 4M89A 1EEHA 2PD3A 2I65A 3R1IA 3RUCA 1NFRA 1P45A 4Q3NA 5ENDA 1H2BA 1Y7TA 4BGEA 5IXSA 3P2OA 1I3NA 4M54A 4N5NA 1JWBB 2XAAA 4WECA 3WSWA 2CD9A 5LDHA 3LU1A 3ZGYA 1PJCA 3LT1A 5KVVA 3AM5A 4I5EA 1DRUA 3ON5A 4NDNE 2YDYA 5I7VA 5T5QA 2CY0A 3MOGA 4PZCA 4WOKA 3WYEA 3ZHZA 1OC4A 3HG7A 1TA4A 4J1TA 1NR1A 1K0UA 4L8VA 4CM4B 2VWQA 3OQBA 5FI3A 1C1DA 1G6KA 1YL6A 1DC4A 4BB5A 4HWKA 5TS3A 1U2GA 4UVEA 3W6ZA 2WYUA 1JQBA 5AXCA 2FOIA 5BSGA 2NU8A 4Y9DA 4RVFA 3TL2A 4YYZA 1GZ3A 3GHHA 3GN1A 1VKOA 2X5OA 2VWGA 5ADHA 3ZWVA 1UAYA 3ZNQA 1GZ4A 3KOUA 4I08A 1LLQA 1X7GA 4A27A 3FWZA 3DZJA 4YJGB 1NQTA 3FHLA 1E92A 1OMOA 5COBA 2IZ0A 3AM4A 2YYYA 4EEXA 1JKJA 1TXGA 5G0UA 3NT5A 3OICA 2VUUA 3BHMA 3VHRA 4BHTA 2P9CA 3AWDA 3FI9A 1E5QA 3ZU4A 1ADCA 5AXBA 2QX7A 2FSVA 1R0KA 1E6WA 3JQAB 5DBGA 3RD5A 2WEKA 2ZQYA 4E3ZA 3NDIA 4RL6A 2FY8A 5KCZA 1HYGA 1UZNA 3JYLA 4HFRA 3BZUA 4CM3A 4OMUA 5TF4A 2X6TA 4BO7A 2HJSA 4H15A 4BO6A 3DAGA 4XYLA 2ZTLA 3NDJA 3VH2A 2G5CA 3VTFA 2NACA 2D5AA 4C7KA 3IUSA 4A03A 1D8AA 4TMFA 4BMVA 4CMIB 1PU2A 1IYZA 1UDAA 3Q11A 1QYCA 5JLAA 5B37A 1O0SA 2B5VA 2PK3A 2Y05A 3LC7O 4NJOA 4XZ3A 3TFQA 3QP9A 4P22A 4WCFC 1EZ4A 3W8DA 4I9NA 1ULSA 3JQBC 1B8UA 4EEZA 3DAFA 1LDMA 2IODA 3K2BA 4E33A 3WQRA 4KWIA 2EKQA 2ZYGA 1GPDG 4IUYA 5K0ZA 2CVOA 2EERA 2W8ZA 3EAGA 1KY5A 1CDOA 3L4BA 4R9RA 1PGPA 5AVOA 1U8FO 2C5EA 4JK3A 5TSDA 1SO8A 3PWKA 4KTTE 1VSVA 1Y5MA 1XQ6A 3U3XA 1OFGA 2B35A 3KBOA 3OIDA 3HADA 3FNFA 1NR7A 3PQFA 1T2AA 3ROQA 5AXDA 4CMEC 3PQDA 4TZTA 3SVTA 4CMIA 3PRJA 5IJZA 2QYTA 4XDYA 3CZMA 2B83A 2C7GA 3GVHA 1B15A 3EMKA 3SEFA 1MFPA 3WSVA 1UH5A 3IC5A 5ENVA 3VKUA 3GOHA 4IBOA 1H5QA 1NVTA 2WD7A 3RUHA 3ETEA 2Q2QA 4GGOA 5JDCA 4MP6A 4CODB 4TZKA 3GQVA 5BSFA 3Q6IA 4WEQA 1BRMA 2BGMA 3GNQA 2W2KA 1XCBA 3PYLA 4LMRA 2NTVA 1DFHA 5TNXA 1GTMA 2P68A 4DC0A 7MDHA 2NVUA 1DBVO 3K9QO 5IDQA 2WSBA 3H5NA 1Y8RB 4BV8A 3TPCA 5KJCA 1XSEA 4YTEA 2CVQA 4YR9A 4II3A 1ADBA 1O94A 3ZV4A 3KYCB 4XQCA 3PZBA 3GPIA 1OAAA 4AJNA 4XYBA 3LYLA 3RC2A 4J0EA 4UUOA 3UHAA 5L40A 1P1RA 2HK9A 4DLLA 2DPGA 3E18A 3O38A 3AU8A 3GN2A 3JQGB 4WNIA 5FEUA 2GPTA 3VZSA 2HMVA 3B1KA 3P19A 3RU7A 2BHLA 4OGWA 2O4UX 1QYXA 2W2LD 4BO1A 3JQDA 1DRVA 3LF1A 4IY1A 4NH4A 1A7KA 4E5NA 2IRWA 4N18A 1JW9B 4OKIA 1GD1O 5L51A 4B4OA 4YEDA 2RHCA 3BMQB 2AE2A 2PFGA 3PHLA 4RVGA 1IUKA 2B37A 4L75A 4TKLA 2O7SA 1CJCA 3WGOA 5C7LO 2J3IA 2PZJA 4M87A 5L7TA 3F3SA 1J0XO 3A28A 1DOHA 3QWBA 5KKAA 2VYVA 3HB5X 2GNAA 1LJ8A 3ZWCA 2W2LA 1YE3A 4BNMA 4R1TA 1EDZA 2PD6A 3LLSA 3RCBA 1EK5A 1WMBA 4W7IA 1BXZA 5DT9A 3IIEA 3GGOA 2GRAA 3HZZA 5B12A 2H1SA 3WS7A 5DULA 1PZHA 1R16A 3ETGA 4RV9A 3RQSA 3IMFA 1I2CA 4NJMB 4EUFA 4F46A 3D4OA 4CLDA 1RM5A 4GX0A 1U3VA 3H5AA 3KTDA 3UF0A 1YDEA 4FJ0A 1Q1NA 4GKVA 1VC2A 3MWDB 3EDMA 2J5RA 3I9NA 3NKLA 2C82A 4BKOA 3BYZA 2X23A 2VOEA 4OQYA 1PR3A 2E82A 3G17A 5IZ4A 1MB4A 2O4CA 3AM3A 3BMOB 2X0NA 5TGDA 5A02A 4DIFA 4BO0A 2FPGA 1IL0A 1BW9B 2VUTA 4HX5A 4HXYA 4M55A 5FF9A 1NWCA 3GGGA 1C0PA 1OOEA 1T4DA 2B5WA 3A9WA 2VHYA 4XJTA 1FDSA 3INTA 3BTOA 4FFMA 3TL3A 4A26A 1PWZA 5L95A 3U5TA 1GQ2A 3RSHA 5JSFA 1R66A 2YHUA 3FNEA 3VDQA 4BNYA 4II2A 4E2XA 2D59A 1WPQA 3ITDA 1PS9A 3JTMA 3OA0A 4I5DA 5CDSA 5CDGA 3OQ1A 4B8WA 5IFLA 4N5LA 1V9LA 3OJ0A 2DTEA 4PLZA 4OH1A 2HUNA 4Z9FA 2XXJA 3DO5A 4CL8A 2J3JA 2A35A 4CQMD 2Y0CA 2O3UA 3QVSA 1A9ZA 4D44A 1TEHA 3AW9A 4MO2A 1PZGA 1MGOA 4O6VA 4JIGA 4ZVVA 3HWRA 3I9JA 3PHHA 4CR8A 3PHJA 4J3FA 1T4BA 1MA0A 4ZQHA 5A9RA 4K6FA 3OQ6A 4J7XA 4MKXA 3U4CA 4RZHA 4IPTA 1ISHA 4W99A 1HE5A 1PGNA 1NPTO 3E9QA 5HA5A 3WMXA 2X0JA 4W9NC 3D64A 1LDYA 4BO5A 3RJ5A 4FIZA 1YJ8A 1VL6A 2Y67A 3MEQA 1J6UA 3H9EO 1HRDA 2DBVO 1I2BA 4TROA 1ZH8A 3QWHA 4Y6PA 3UCFA 2DUUA 4NIMA 3EC7A 1HDZA 4NR0A 3I4FA 3P2YA 4MVJE 5K9ZA 5CEFA 3GH3A 3A1NA 4WCFB 1N7GA 3PVZA 4QX6A 3OJFA 5DCYA 3Q3CA 4CQLB 3F4LA 3PYXA 4PIVA 4IMRA 4TRRA 3PPIA 4QFCA 1PJ3A 3PGXA 5EINA 1U2DA 3I4CA 1H94A 1EE9A 2I67A 4RVHA 3O26A 1YQDA 1K89A 2B4QA 1BVRA 1ADFA 3H5RA 3QWIA 3TNLA 1RM0A 2YFHA 4GVXA 4KTVE 2EW2A 3EZLA 5EERA 4MVJA 3T4XA 3WTCA 1E7WA 3PJGA 4BIIA 4YAEA 1ZEJA 1EMDA 3RKRA 4BMSA 3ANMA 3R3SA 3BHIA 4JGBA 1OI7A 4PN3A 1DC3A 2X5JO 4BOYA 4D0RA 1YRLA 2I3GA 4M1QA 2OMEA 5T57A 2HSDA 3DZGA 3E5MA 4JNKA 2E48A 2Y1GA 3NUGA 4IDBA 5F1OA 3LT0A 3UXYA 2PGJA 4Q3BA 1JKFA 4EDFA 5JS6A 4GX5A 3JQEA 2Q1UA 2VN8A 1QLJA 2Q45A 1UXIA 6ADHA 4WUVA 4OYRA 4BS9A 1O95A 1G1AA 1TI7A 3ZNPA 1PQPA 1E7QA 4LRTB 3AOEA 4MVJD 3RU9A 4BNWA 1EFKA 3KHUA 2QZZA 4GSKA 5JYDA 3JQ6A 1I3KA 4BKPA 3BMQA 4EUHA 1HYEA 2PGLA 2Q4EA 1N5DA 3GZNB 3MOIA 1LUAA 1HE4A 1Q0LA 5A3JA 1MXHA 3AI2A 2IXAA 4JP3A 2DT5A 3ZWYA 4XB2A 1ZSVA 2EWMA 3HQ4O 4MVJP 2UVDA 3G3EA 1VE9A 1BXKA 4UVDA 4CLRA 3ROMA 3HFGA 4L4XA 5I9MA 4EJMA 2O48X 1K5HA 4OIMA 2VWHA 4Y8VA 5T67A 1JU9A 2HCTA 4UEJA 1ZXLA 2FWMX 2EV9A 3I6QA 3L07A 5DNAA 1MG5A 4FSHA 2RH8A 5F1PA 1CWUA 4DA9A 1QR6A 1X0VA 2JL1A 3S55A 3KEQA 4DIOA 2WWRA 1VJTA 3MWEB 4ALJA 1NVMB 1ZK0A 5F5LA 3C7AA 3ZWAA 2JHGA 3BTVA 4HFMA 2NVBA 1WWKA 4R1UA 4J7UA 4AJLA 4J9VA 3EGOA 2NU6A 1MC4A 2RAFA 2YQ5A 4MVJI 3OJEA 4PLFA 4CMKA 1E7SA 4EBFA 3ABIA 5B4TA 5AOVA 2DBZA 3AI1A 1U9JA 2BMAA 3T4EA 4BO8A 1X15A 2Y1OA 2WYWA 4XKJA 5A1TA 3JQ8A 4XX0A 2W90A 1K6IA 1MP0A 4NBRA 3DTTA 2F1KA 1E3WB 2BI8A 3DZIA 3WDSA 1IZ9A 4GWKA 3VZRA 4CUZA 2ZB3A 3LZ6A 4DPLA 1AE1A 4BNXA 4IZIA 4B3HA 2C7VA 2QHXA 4CQLA 1NWHA 1V35A 2JHFA 1R4NA 4XWYA 4ALNA 1C1XA 3ENNA 3K8ZA 1C14A 1I3LA 4GGPA 1BDMA 4ZQGA 4E0BA 4IDDA 4S1VA 4W9NA 1E7RA 5G0SA 2NQTA 1E7MA 5C5IA 3NGLA 3ROPA 3QVWA 4E6PA 1G0OA 5ITVA 2J6IA 1DHTA 4KZPA 1I36A 4RQTA 5JO9A 1HWYA 1N1GA 1DIRA 1WMAA 3DQPA 3EUWA 2ZB7A 1SMKA 2W4QA 4UVIA 4OL9A 1VSUA 2PA3A 3BHJA 5BT9A 4L4RA 2POQX 1DC5A 3LC2O 5L4SA 2YFQA 4RVSA 2HRBA 2X22A 1O9BA 2D3TA 1QYDA 2NU7A 3JQFC 4G5HA 3RUDA 1M76A 1G0NA 4CPDA 4W82A 1GL3A 4P4NA 4L73A 3GT0A 2FHSA 2UAGA 3ZWXA 2UYYA 1U3UA 3K5PA 2HJRA 3K6JA 1GUFA 1E1NA 3PEFA 3KXDA 4JJFA 4MIOA 4IDAA 3I5MA 3RI3A 4INAA 1Q0HA 4E2WA 1SPXA 1E3SA 2FSSA 4CJXA 1J49A 3EW7A 3RC1A 2EF1A 4WASA 4XDZA 3HJAA 3ICCA 2FR1A 4GLLA 3Q9NA 4IDFA 1R4MA 4NPCA 3JV7A 3RKUA 4D7AA 4JJGA 3DMYA 4ZRMA 2E37A 3HDJA 3TF5A 4KUGA 2EJWA 2NLOA 1VL0A 3H9QA 1YDWA 4UAGA 1D1TA 2NTJA 4LSMA 1VJ1A 1LDGA 1F8GA 1HSZA 3ITKA 3OA2A 1NTOA 2P4QA 3PFWO 1H9AA 3IJPA 4OXYA 4ZQFA 1WVGA 1GYPA 4LMPA 3CXRA 5K1SA 3KRTA 4Z9XA 4DLAA 5BQFA 1BVUA 4IGEA 3FCOA 2P9EA 1I01A 1I5RA 1NAIA 2ZYAA 2Q1TA 3DBRA 3EK2A 4J6FA 1U3WA 3JYPA 3DTYA 1M6HA 2Z5LA 4Q39A 3VDRA 4B7XA 3F6YA 3TZKA 4AVYA 4UUMA 4B3IA 2Z1MA 1ZJYA 4FS3A 1NVGA 3TZ6A 3RUAA 4U6SA 3V2HA 4E2YA 4RPHA 4J4TA 2C5AA 1Q7GA 4FC6A 3LF2A 3W8FA 5L7WA 4GL4A 5EIOA 2WE8A 1ENOA 5G4KA 3PWZA 1SB9A 1HLDA 3AOEC 1JVSA 3UVEA 4DYVA 2X0IA 1BGVA 2H9IA 3JYOA 3AK4A 3BTSA 4W4TA 3OEWA 2G17A 2DAPA 3GVPA 4CM7A 2HK7A 4N54A 1NPYA 1YXMA 4NFSA 1E0DA 3PFFA 3OMLA 2JCVA 3Q9UA 3GAFA 2HMUA 3GMDA 1BMDA 5KTKA 3GDGA 3PZRA 3KSZO 1DLIA 4K28A 4XYMA 1MX3A 5G0WA 5MDHA 3GZ4A 4NQZA 1GADO 3QV1A 2GCGA 3IP1A 3CSDA 4H3VA 4ZU3A 3BAZA 3NYWA 2OP0A 5FFFA 1ZMOA 2WJPA 3RFVA 4ESOA 5TT1A 1R4MB 2VHVA 4DGSA 1HYHA 1BG6A 5J23A 4FFRA 1M66A 3QQPA 3IQDB 3DAPA 5CPFA 3NGXA 1T1RA 4GX1A 3L9XA 2BF7A 1PX0A 1DSSG 4BUCA 5TLSA 1L1FA 1I10A 1KY4A 2C0CA 3NTRA 3S2EA 4FGSA 1B2LA 2ZJ0A 3WNQA 1RM4A 5KVSA 4FFLA 4RQUA 1E3IA 1HETA 1R12A 4O59O 4RF3A 4P38A 4IZHA 4AJ1A 3O4RA 4K6CA 4HNGA 2GO1A 3JQCA 1IHXA 1H6BA 1JLLA 4J1QA 1GFSA 3NT4A 4E5MA 5T64A 2O3TA 3V1TC 1UR5A 5L4NA 4YQYA 2VZ0A 4N5MA 1N1EA 2WE7A 3GG9A 2DKNA 5TX7A 3O8QB 3AU9A 4D41A 5AQ1A 1P1IA 2A92A 2Y1DA 3DHYA 3K73O 3PDUA 5CFZA 2ZB8A 2YV1A 1SEVA 3G1TA 6LDHA 3DZBA 1E5LA 4RPGA 1DAPA 1S6YA 5KJ6A 3CEAA 5U1PA 5DP1A 5JE8A 4PLCA 1CYDA 3GR6A 3DOCA 3D0OA 2Y66A 2FR8A 4MVJG 3DBHB 2WD7B 1KVTA 2Q99A 3RBXA 4RDIA 2E6UX 2DTDA 4PRLA 2OUIA 2VNAA 4WCDA 4YDRA 1ISGA 1AXEA 2X1HA 5ER9A 3WBFA 1FMCA 2Q1WA 2QRLA 3WGHA 1FDWA 1WP4A 4KDEA 1B3RA 3GRKA 2Y1EA 5A9SB 2V7PA 2IDZA 4Z0PA 2X7HA 2IE0A 4F3YA 1UP6A 4O63O 5CPBA 4QO8A 5TJHA 4YCAA 4DQXA 4OOEA 3RJ9A 1GEGA 3IAHA 3KO8A 3KYDB 4AJKA 4E4YA 2AXQA 4XRRA 1V0JA 5C3MA 3HDHA 4BMNA 2DU8A 1XQ1A 3QW2A 4DIBA 5IDXA 4R1NA 1J4AA 3GDOA 3GEDA 4DXHA 3JD0A 2O2YA 2VRCA 2EIHA 4QO7A 5IZCA 1Y9EA 2G1UA 1A9YA 1LC3A 1H6AA 3EYWA 5I9NA 4IGFA 4FCCA 1X7DA 3ZW8A 4YJFA 1D3AA 4JP2A 1UAGA 4Q9NA 1ZIDA 1EUZA 3QVTA 4NI5A 1XELA 2GASA 4JX8A 4OSOA 2VNSA 5F1KA 2D4AA 1X13A 2HRZA 4MIEA 3VVBA 4OXNA 2V6GA 2IXBA 4R9SA 4JXKA 4R01A 5I8WA 3SX2A 4E12A 3G79A 1E6UA 5A04A 1LQTA 1MV8A 1Z75A 2GZ3A 2VWPA 2W2KB 5L4LA 3F47A 1RYEA 4ALLA 2P5YA 2PD4A 4J16A 2Q1SA 4TRJA 2OL4A 1YOVB 4DMMA 4PCVA 4LN1A 3SXPA 1RM3A 2P4HX 3NEPX 4RPKA 1X1TA 1U5AA 1Z82A 2AEFA 4BO2A 2ZIZA 4W7HA 1PR9A 4J1SA 3H3JA 4CMHA 1EVYA 2V6BA 4WLEA 2WD8A 3IKVA 1A5ZA 5JBIA 2HQ1A 1YQXA 5LDGA 4L9RA 1LSUA 1GCUA 3EY4A 3G0OA 3WGQA 2EJVA 1AHHA 2I9PA 4E13A 4EYEA 2OO5A 5COAA 4AJJA 1L7EA 3OECA 3B1JA 4E2ZA 5U9CA 4WJZA 3DBVO 2J8ZA 4PRKA 4PVCA 2H6EA 1W4ZA 4AG3A 2X5KO 1P33A 5KKCA 2VT3A 1P3DA 2BLLA 2ZYDA 2TMDA 1EVIA 3ZZNA 1DB3A 1RYDA 5T8KC 2GLXA 4JQCA 4NU5A 2FZWA 3I1JA 2VHXA 3K92A 4KDFA 3UKOA 1O89A 1PJLA 2FPPA 2V65A 1X14A 1DAOA 3FTPA 1QLHA 4URFA 4LRSB 3LC1O 2X0RA 4JLWA 3ASUA 4LVUA 4NU6A 4CM5A 4ZICA 3QLJA 1B0AA 1LA2A 1QYWA 2G0TA 4GWGA 4NMHA 1CEQA 4WNCA 4XQEA 1HDXA 3KV3O 3QY9A 4BKQA 5DZSA 2AW5A 4DPKA 1LRLA 4YB8A 2J5KA 4TRNA 2I99A 3D7LA 3MZ0A 3S2FA 3ZHBA 4ZQEA 3ASVA 2J3HA 3O9ZA 1FDVA 3X2FA 2G76A 1ZBQA 4M49A 4PZEA 3AUTA 1AXGA 1LU9A 4XGKA 4AFNA 4ITUA 1KETA 1UP7A 4XQ9A 1BSVA 3E03A 5EJ2A 2JD1A 3C7DB 5GMOA 1UXKA 1EE2A 1T1SA 1GV1A 1KEUA 3L4SO 1JAXA 3PIIA 3JSAA 4O0LA 1B8PA 2IZ1A 3RASA 4BNGA 3DOJA 1N9GA 3DEYX 4E5YA 2OBYA 3L9WA 4LISA 3WFJA 1UXGA 3WFIA 3FF4A 3GG2A 4ZRNA 1CERA 3HNPA 2CZCA 1AHIA 2O7QA 4J1NA 2BELA 3C24A 5LCXA 4EGFA 3DFZA 4ZQBA 4RPJA 3GLQA 2JFFA 1B8VA 3KVOA 3ZV6A 1NYTA 5CDUA 1FXSA 4CR6A 1V3VA 2PKRA 4CMEA 2YJZA 4QFDA 4CLHA 3INGA 3MJVA 1DXYA 4CUKA 1HT0A 4J4BA 2O23A 3HFSA 3A4VA 3BXXA 2PY6A 3F1KA 3VTZA 1HDRA 4RVUA 4R3WA 3FWNA 4DBVO 4J2HA 1GYRA 1PIWA 2NADA 4ND2A 5JDCC 1EQUA 3KLPX 2GZ1A 5KOIA 5TRTA 3K96A 1YJQA 1ZCJA 3AFNA 1Y8QA 2HMTA 2FN7A 3IP3A 1KVRA 1WZEA 3UCEA 2BFAA 2Y0DA 4PG5A 3M2PA 1WDLA 2PNFA 2ZQZA 2CNBA 5G4KB 1DPGA 1HDGO 1PGJA 3IOYA 4G65A 4JN6B 4R54A 4DYDA 2X4GA 4R5MA 3CINA 1W73A 3IS3A 4FQ8A 1XU7A 1NHWA 1WDMA 3K30A 4XCVA 1MUUA 1DRWA 4EITA 1DHRA 2CMDA 2BRUA 2JFGA 3IDSA 3D4PA 4D3FA 5EQFA 2GN4A 1PJTA 3KB6A 4CQMA 2VHZA 5I7EA 1JDJA 3K2EA 1OBFO 1ENZA 3ZU2A 3V8BA 1E3EA 3FD8A 4J0FA 1EBFA 3EVNA 4XR9A 1HE3A 3GZNA 3JQAD 1NP3A 2DVMA 3V2UA 4BNFA 1QG6A 3MJ4A 1PL8A 1DFGA 1Y8QB 4EJ0A 4J43A 3C1TA 3VAZA 1YL5A 1DC6A 1IPFA 4A2CA 1OC2A 3TZHA 1A72A 5DF1A 5EQDA 1LLUA 4M8SA 5A06A 1K2WA 3ZNOA 1O8CA 1XHLA 4WLFA 1R37A 2P91A 1XGKA 3ZW9A 3SBOA 3TZQA 1UP4A 3D5QA 4S3MA 1EFLA 3V2GA 3WBBA 5ICSA 1ID1A 4FJ1A 3H8VA 1PGQA 4LSWA 2X9NA 3I52A 3I9MA 2PV7A 1J5PA 3KSDO 5EMHA 2HU2A 5F3RA 1SZJG 4AJ2A 4Z6KA 5CAEA 4CUJA 2PH3A 1DIHA 3LVFO 2FZEA 1SAYA 1EDOA 1PJ4A 3WGIA 1Y81A 4QXMA 1D7OA 4L76A 4PLWA 4YWJA 4CV1A 3LQFA 3V1UA 4I9UA 3IKTA 1U7HA 1XEAA 3OBBA 3H2ZA 4KQWA 4IDGA 3UUWA 1LI4A 1Z45A 3ZV5A 4NFHA 5HTOA 1WZIA 4E30A 3INRA 1BW9A 2CDBA 3PWSA 1C0IA 1EK6A 2I6TA 4J49A 4J90A 1GQQA 1NQ5A 1SOVA 4IDCA 4YA6A 2PKQO 4CM9D 1SBYA 5A5FA 4G2NA 3E82A 4XIYA 2ZK7A 1I0ZA 5EL0A 2CF5A 3VH1A 3D3EA 2D5CA 1MXFA 3GVIA 5HWSA 3AY3A 2Z95A 1ZK1A 3GAZA 5L3ZA 3CMMA 2BH9A 1R4NB 3DHEA 4HBGA 4PVDA 4A5OA 4YRAA 4PLTA 1PQUA 1U28A 3LT4A 4E5PA 1I33A 4YVFA 4BV9A 2AQKA 5KJ1A 1QKIA 2AQIA 5A03A 4R4JA 3ONFA 8ADHA 4E5KA 1IOLA 5L45A 5A4DA 1E1KA 5FYDA 5A5EA 1NPDA 1ZSNA 3CUKA 3CH6A 1ZVMA 3WWZA 2PGDA 3N74A 2OFPA 1LDEA 3L0DA 3JD2A 2X58A 4GLOA 1XA0A 4IJVA 1ZFNA 2B4TO 2J3KA 5B4VA 3ZNNA 1QV7A 3PJFA 1GUYA 1YONA 3VPHA 4PFJA 3S1LA 2W98A 5C37A 2RBEA 2XPCA 4QEDA 4UULA 1WLYA 4YACA 2B0JA 4RF2A 2P9GA 1LSSA 3WJAA 2B4RO 1MG0A 4U7WA 1MFZA 3L6EA 1Z7BA 2DUWA 2I3AA 2EKPA 3C85A 2DFDA 1VRWA 1GPJA 5EN4A 1K6XA 2JCXA 4RF5A 1ONNA 3FBTA 4MP3A 2CVZA 3RC9A 5EPOA 3B1FA 1GAEO 1HE2A 1PGOA 1KEVA 2D0IA 5ICMA 4F6LA 4CMGA 4ILKA 4NZ9A 3T7CA 1KC3A 2OP1A 5IF3A 3WICA 3RIHA 4XEHA 5JDIC 4GBJA 2A9FA 1K6JA 1YB5A 4ALIA 3AY7A 3VH3A 2EXXA 3DMTA 3JQ8B 4IINA 1CETA 4J7CA 4J9UE 3R6DA 4BNKA 1Y6JA 1DDOA 3RBVA 5TT0A 3O8QA 3WGYA 4YPOA 4R41A 4XQGA 4ONEA 1EQ2A 2JAHA 1Z74A 1KBZA 4LW8A 3E1KA 4PG7A 1PZEA 2XF8A 2O3QA 3PJEA 4QSMA 4JCOA 3ST7A 5MGBA 1VL8A 4OQZA 3VPGA 4BNUA 3ZHXA 3WG9A 2Q50A 1LDNA 3X2EA 4WPGA 3UH1A 1CF2O 1Z6ZA 4XRGA 2UV8A 1TVEA 4IQ0A 3S2IA 2B69A 4RDHA 4KUEA 4CM8A 5C7IO 3DBLA 1VLLA 4HP8A 4U6QA 4TQGA 4DBZA 3JD1A 2DLDA 3JQ9C 4MKZA 4YAJA 1QP8A 4QTZA 3AOGA 4B4UA 5F5NA 1N92A 2PZKA 4B7CA 2NM0A 3OFSA 4IM7A 3E5RA 4Y6SA 2NQ8A 2GZ2A 4E32A 5I7SA 2DTXA 5IAAA 4A7PA 5BSHA 3QHAA 1LXCA 1V3UA 1WW8A 4IJUA 4CMAA 1O5IA 3M6IA 3WOHA 1ZJZA 4B79A 4BO3A 3TDKA 1WNTA 2AE1A 2JKVA 2HMWA 5G0TA 1ISFA 2BGKA 3RUFA 4AJHA 2VYND 2ZJ1A 4X54A 3G1UA 2OGUA 1HKUA 3PJDA 3KEOA 2AHRA 3WTBA 2EG9A 3E9NA 5KVCA 1JVBA 3WJ7A 3HHPA 3BA1A 2RCYA 4HY3A 2BGLA 4ND4A 1LSJA 3D4NA 5TJ9A 1PJQA 3ZWOA 5JY6A 5DDIP 3WQSB 4HFNA 1EBUA 1KS9A 1M2WA 3GY0A 1E77A 1O6ZA 3GRPA 5TQVA 4R1SA 1P77A 2Q46A 1H6DA 3BMOA 2NTNA 4OAQA 4CM9A 1AUPA 1JTVA 1DIBA 1ZMTA 5KVQA 4Y67A 3DBRB 2VCYA 3NJ8A 3VH4A 4D79A 5ILGA 1B14A 4MKRA 3ONEA 4D45A 4WLNA 3EHEA 2Q49A 7ADHA 3M1AA 3WR5A 4RO0A 1JA9A 1PWXA 2GYYA 3M2TA 1TLTA 4TWRA 4QQRA 3ZHYA 3D3WA 4PLVA 5T8KA 3I23A 3MJEA 3VOSA 4OJNA 3QA9A 4ALKA 1QXSA 3HN7A 4RGBA 5I9LA 3WGGA 1F14A 4CMBA 1U4OA 3DONA 2XOXA 5JXWA 1H6CA 3MTGA 1LDBA 2PR2A 2HO5A 3B70A 2EGGA 2DFVA 3H65A 4NK4A 2OXIA 4HV4A 1LX6A 3H6KA 3NDRA 1LBEA 3RWBA 3A06A 4OKNA 2C20A 1T25A 2CUKA 1SB8A 3PIDA 4UUPA 4UVHA 3MJCA 2D2IA 4XJSA 3N58A 4PLHA 3B20A 8LDHA 5JMWA 4BNHA 4DLBA 2GN6A 1HXHA 1ZZEA 4K1LA 3TSCA 2Y1FA 4I5FA 4Q3CA 1KC1A 2ILTA 1U7TA 5JAIA 1ZSYA 3F5QA 1ISMA 3I3OA 3H4VA 1UXJA 1YVEI 3DMTC 4XIJA 3VZQA 2CDAA 1UZLA 4PLPA 2Q4BA 2Y93A 2YZ7A 4Y98A 3KUXA 4NBWA 5IN4A 3NX4A 3AY6A 3U4HA 1MC5A 3E8XA 2P2SA 3HUDA 4CLOB 4FGWA 4YJHA 1YBMA 3ORFA 5HBRA 1ML3A 2VUSA 1NM5A 3GEGA 4Q3EA 3TJRA 3WLFA 4CLEA 2HLPA 4NG5A 5CG1A 5ITWA 4YT4A 4GVLA 2JFHA 3ICPA 1BHSA 2GF2A 3D5TA 3KYBA 2AQ8A 2NV6A 2DM6A 4CV2A 1I8TA 5DBIA 1LEHA 9LDTA 1MLDA 3JQ9A 4FFNA 3E6AA 3HN2A 1F8FA 4CLXA 1B3BA 1I30A 5EESA 4DREA 4GPD1 1HLPA 3EVTA 5JAZA 1YL7A 3GF4A 4OXKA 4FBGA 3QRWA 3I9KA 4B7UA 4MVJH 1KYQA 3U4IA 3PI7A 4PG8A 1E3JA 3WNVA 3TN7A 3DL2A 3LSYA 2GR9A 3DBHA 4TVOA 2DQ4A 4B4WA 3OP4A 1LQUA 3QE3A 2RIRA 4XYGA 3ADOA 3SLGA 2D8AA 4E21A 3FBGA 4FC7A 2XXBA 2EKLA 1YWGO 2C29D 4MDHA 2ZATA 1HDOA 1LSOA 3VZPA 4Z9YA 5DCWA 5HS6A 1H93A 2GGSA 1HL3A 3DZHA 3I6IA 3Q1LA 4FB5A 2Q2WA 3WXBA 2LDBA 4ZHSA 5CP8A 2IZZA 2ZTVA 2UDPA 4R16A 1YBVA 5TIIA 4Q3DA 2FMUA 2NVWA 2QIOA 4CM4A 1ZK2A 2R00C 2YV2A 3CKYA 3H9JA 2DC1A 2JAPA 1XLTA 3I9LA 1IY8A 4AJ4A 2QZ9A 1XIVA 2VYNA 3QVXA 4A10A 4Z3KA 1IZ0A 1ISJA 3PHGA 1T2FA 4RZIA 2FP4A 3EZYA 3FNGA 1P1FA 2B36A 2X9VA 4WEOA 5DCUA 3WYCA 5IXYA 5T6BA 2C07A 5IG2A 3FN4A 3FR8A 2GN8A 1P1HA 4RF4A 1Y9AA 4LK3A 4AJOA 5G0VA 3KM0A 5JAQA 3RBZA 3WQQA 3JQAA 2EEZA 2VYVD 3IL2A 1HTBA 4PGFA 1ONOA 5IDYA 1WXDA 2EHDA 2ZTUA 5KJEA 4BKUA 4D43A 3GDFA 4EUEA 1RJWA 4AICA 1BTOA 5ES3A 4DC1A 3ENKA 3WIDA 2PH5A 1U5CA 4CR7A 1H2HA 3OEYA 3DWFA 2X8LA 3CZRA 3IUPA 1YOVA 2OHXA 1Q0QA 1F0YA 3LK7A 4PG6A 3RROA 4R5HA 1F06A 1DFIA 5JC8A 3FPCA 3PDJA 3GFGA 3ZWNA 4NHEA 2DBRA 1HZZA 3ZCXA 4MJLA 4U0JA 3STHA 2WDZA 4YXFA 4C4OA 4ALMA 2NU9A 2H63A 2NVUB 1XR3A 3ZH2A 3RUEA 2YHIA 5DOZA 3W6UA 1K3TA 4XYEA 5F21A 2CDCA 4BNNA 2X9GA 1Q7CA 1YKFA 2C54A 5H81A 5BSEA 2HMSA 3DC2A 3DOOA 4O5OA 3WB9A 2PKQP 3A14A 1ORRA 3HDQA 4WOJA 2A94A 5GZ3A 1B7GO 3P5SA 1BDBA 1RWBA 3QWFA 1L7DA 1EVZA 3OJOA 4ZJUA 1PEDA 3AUSA 1VJ0A 2VTDA 4GMGA 3NV9A 4P4LA 1AGNA 3F1LA 3DHNA 3FR7A 1DEHA 4DVJA 4DRYA 4ND3A 4GQAA 3AUUA 4YAGA 2JD0A 1IPEA 1CQJA 4C7JA 1NASA 3OH8A 4IJKA 3RFXA 1P9LA 2IEBA 4XGIA 1M6WA 4GX2A 1X7HA 3RAJA 4MINA 4LCEA 3GUYA 2FPIA 1LRKA 1KVQA 1ADGA 1DO8A 3D1LA 4LCJA 5G2OA 1RKXA 1KERA 1EUCA 5BNIA 3VVCA 1B26A 4W6ZA 3WLEA 3PHIA 3DBLB 4FJ2A 4XGNA 1A71A 1TB4A 1W6UA 2UUPA 3KLMX 5C7OO 2Y1CA 3T7EA 1P44A 3JCZA 2ZKLA 3ZI0A 1BXGA 4GAEA 3VPXA 3UW3A 3ZWBA 4H16A 1B16A 1BWSA 2ET6A 2HK8A 1CQIA 2GUGA 3AI3A 3OIFA 4MP8A 3DZKA 1V8BA 4KP7A 3E48A 3WWYA 4A0SA 4DL9A 4Q3AA 4CMCA 3GPDG 1F17A 2QG4A 3HSKA 4BQPA 2BKAA 3C3XA 5DP2A 2VTEA 5THKA 1SNYA 1UXHA 1QYVA 3C8MA 1YH3A 2AEJA 1LTHR 2JCYA 3GEMA 5JDIA 5KNLA 1SEPA 1DJNA 1ZNQO 1P1JA 1GU7A 3RFTA 4Z0TA 1RPNA 3BMCA 1QORA 2WMDA 4YT8A 3FRJA 1Z7EA 1IHYA 3TQHA 2AMFA 4R51A 5K6AA 3OF2A 1HDCA 1DJQA 5L7YA 4BGIA 5IZCC 5JFOA 5GY7A 1BXGB 1LNQA 1KVSA 4FFOA 4IJWA 3GVXA 3DB2A 3JYNA 1GCOA 4N7RA 2NWQA 3ZV3A 4PG4A 5AXAA
chains in the Genus database with same CATH superfamily
1MORA 1C8LA 1ULUA 1YB2A 4UBJA 4D3SA 1OYOA 1MJHA 1RACA 2VJMA 3G2NA 3NTXA 1CF9A 4TTSA 5AVXA 1GM5A 4L57A 3TLGA 2BCJQ 4QEZA 3WK6A 1IY9A 3JR7A 4AJEA 2R6JA 3WWDA 5LJIA 4TS9A 1R0LA 4P4GA 2CF6A 5EXDA 1F2UB 3BE6A 1M8KA 5JW6A 2I2AA 2J5QA 3ZDEA 4DA4A 4ERXA 2ZIEA 1AKQA 1C7QA 1CQIB 5GJCA 4B87A 2X9LA 5KIAA 4U63A 4GE3A 5A05A 4CLRB 3FKSD 2WF7A 1AZWA 1Q2UA 3SEZA 3IVAA 1OFHA 2COUA 2H51A 3PYMA 1NNSA 1WSAA 1IOZA 4LYFA 1U9CA 3F7TA 2O3RA 1GP2A 1CU1A 1R0SA 4Q01A 2HZBA 2CXNA 4B33A 3R7FA 3OLXA 1IHOA 1KJZA 3CR7A 1Z88A 4ZVRA 3C3PA 2PGNA 1NV9A 3L77A 3ZDBA 3ACDA 5DYYA 1ZO8A 4G9EA 2DF8A 1Y82A 1T2NA 1CBUA 2DBQA 2P27A 3HC7A 4XTCS 1CC1S 3VR6D 1U5BB 3M49A 2UXCB 2ZE5A 1Q1QA 1OXXK 1DKRA 3MJTA 5DI3B 4QM6A 1QMGA 1U7DA 3I62A 4NNOA 1YC5A 2R4QA 3PGKA 4JBGA 1J2EA 4PPFA 5BSKA 2CBZA 1WG8A 1R10A 2F64A 2CMHA 2QAGB 1PL0A 1TQ2A 3HXPA 5CEJA 1D2CA 5L3QA 2VF2A 2IYOA 3WMGA 3C7KA 2ISSD 4GMFA 4RZQA 3P7MA 4GEGA 3R3HA 2R2GA 3B36A 4HRAA 2AA3A 4HTFA 4KMMA 3TOXA 4NK5A 2AMJA 1Q91A 2IEDA 4OFBA 2Y99A 4MEJA 3OHSX 1P0FA 4WLVA 4BFYA 2C04A 1RKQA 3F4BA 2YZNA 2BV3A 4RWEA 2IV2X 3OSUA 4AU1A 4DKJA 1QVAA 5ECGC 1PDOA 3AHIA 3QVOA 2I2DA 3AT1A 3S8EA 1Y8RA 3KZVA 1YB6A 4PIPA 5CDTA 3H7AA 4CIXA 4HADA 4NSNA 2W2PA 1E2MA 4AJPA 2C94A 1OFVA 2VXYA 3ANNA 3ME5A 4ICIA 2HC9A 1M1NB 3HSYA 3UICA 1TNDA 4GUDA 3VPSA 4B9EA 1ZRMA 2TMGA 2QF7A 2Z9DA 3CEPB 4O08A 1OH8A 2BF4A 1C3VA 1J0CA 4NMMA 2C83A 3MF4A 4Q7LA 3UFXA 3U0BA 2IVFA 3WMWA 4D8WA 5DNCA 2F8SA 1E94E 4MPDA 2HA6A 1GSIA 3T5GA 4RKEA 2UYQA 2GK7A 4UEOA 1KEWA 2WSSA 1VECA 4P3YA 2IWRA 3N7AA 3KQQA 1OA0A 3FSRA 3NT2A 4YDSA 3TOZA 4YT5A 4DWVA 1F4LA 3OQOA 4J3JA 4Q9LA 1RE0A 1X8XA 2LR0A 3OAAA 1RWVA 2A5GA 3UN1A 3ZGVA 2FZLA 1TIPA 2ZYWX 5JCXA 4L51A 1BDJA 2INGX 3HB1A 1ZIPA 3QJ5A 5L3SB 4KUHA 3PLNA 4PS0A 3ZJ5A 3UAGA 4BNVA 3C3AA 5CX4A 4TLAA 3VR4A 1USUA 2XRFA 1JN0A 2H7YA 3COZA 1Q6ZA 2X7JA 1YDFA 5DOVA 2F1RA 4TSKA 1T9CA 3KEMA 4U2DA 1E2UA 4MB6A 1NF8A 2Y2UA 4M86A 3L8MA 4IG4A 5EIAA 4B74A 4UEKA 2R5NA 1LPPA 1PL7A 5I3ZA 4DSOA 4B32A 4RULA 2QPOA 5IJ9B 1E6EA 2E21A 3DKPA 1YS4A 1OYWA 1TYEB 4QDUA 2O8EA 5A0TA 5BSTA 3G7UA 2JJMA 3BRQA 2E85A 3H1GA 5C81A 3BZBA 3JPWA 2ZFUA 4QBHA 4O4JA 5SY9A 3LQKA 1Q1EA 5EE5B 4IXWA 4Y9RA 5JWRA 3QELA 4WERA 3V9AA 3KNZA 4QICA 4RLSA 5DXFA 3U60B 3G7SA 1CXZA 1EK2A 2QP9X 4H0NA 4JB8A 2ASVA 3BXEA 4FCVA 2CL6X 3TRIA 3W4KA 4HNHA 2Q8NA 5CVUA 4YMTA 5JXHA 1KJNA 1ZD2P 2EHJA 1SQ0A 5ELLA 3K0KA 4IGKA 3VI4B 2Q3BA 1RAHA 2C1XA 5A4KA 3JTEA 4US1R 4EJ2A 3HHEA 1L5LA 3OP1A 4FGLA 1P72A 5CBPB 2GM5A 4YLEA 2OCLA 4CQMB 1GAXA 3TTWA 4CKYA 5K8UA 1GN9A 2ZI5A 2YWCA 4GHWA 2AG0A 2ODNA 1U8CB 5I9IA 1HSOA 1QX3A 1QB7A 3OFND 4OFXA 4QUHA 2ZTSA 2V4MA 4RMGA 1OPXA 4U0KA 4X93A 4DHEA 2BH2A 4BQSA 2PCLA 4C9BA 2OE2A 1PDVA 4UCXA 3KELA 3AJDA 4WE3A 5TGTA 1P0IA 4MQFA 2COEA 4WZBA 3DW3X 3ZU3A 4Z7OB 4OSPA 2GM4A 4RPLA 3T7IA 4HCJA 3BMNB 3FPLA 4MCHA 4AZ0A 2WV7A 4GFDA 2WIKA 4JLVA 1CUUA 1CZHA 1F1JA 4V1CB 2FA9A 4YRZA 1QMPA 4E31A 1QPZA 1VPTA 2VAXA 3SC4A 3CX3A 5JEDA 1WO8A 5JPIA 1W94A 2L42A 3RTBA 4ETIA 2Q4OA 4KR3A 4JLJA 4NBLA 3A58B 3VU9B 4CLOA 2V7QD 2VHTA 1P2GA 3JRWA 1ZD9A 3U39A 1ISIA 3DYVA 2N0SA 4OJMX 1NQOA 1TCUA 3DMHA 3QWAA 3GGPA 3RUIA 2O8BA 1UPUA 3FW1A 1QHNA 2OXCA 2HA0A 3Q2KA 4HDNB 5D5HA 3ANSA 1CEYA 4HL6A 4UAUA 1T2CA 2VA8A 1DTWA 2QRZA 2H2FA 3BCUA 3CJTA 3NRCA 1N5MA 1Q57A 3SLKA 3QI7A 4HWRA 1HQDA 1V1MB 2AEMA 3C4QA 4UMEA 5FH9A 2ODQA 3J81A 3RAEC 3AWIA 2YYZA 4BU0A 3JQFA 2BFMA 3JARA 1M6NA 1IBRA 3NBUA 4OJKA 1Z5PA 1RXVA 2VJQA 3TPZA 1M2OB 1UDBA 3B6KA 4H35A 4DLNA 4BL5A 2P5UA 1AS3A 4E46A 2RG7A 3UMCA 2XMGA 2H7VA 2M9MA 4HWGA 2QUBA 4HPXB 1SVNA 2BUBA 1RFLA 3OZIA 4TVBA 4ZO4A 4AY4A 4XPZA 3WL3A 2XDQB 1JDPA 3G68A 3GJ6A 4M0MA 4DR4B 3MPOA 1NVUQ 2I5PO 4O4JF 3DAOA 1E7YA 1CYEA 1NAHA 1QHGA 3EJ6A 1SCKA 2ZS7A 1FYDA 3EIEA 3X1XA 3SZRA 4KIGA 5CLJA 4BY9E 3FRHA 3B7PA 3SI7A 1CY0A 3I39X 4ZVLA 1XDGA 2GZHA 1XZEA 4KNWA 4IS2A 3P8ZA 4BB6A 3WHKA 1MW9X 4QVGA 4UBNA 2XQIA 4C1NA 1VFPA 3F98A 5JO0A 2QB5A 3M1LA 3ND5A 2BFFB 2EJCA 2F48A 3Q7QA 3U4DA 4IDPA 3UWDA 3BEOA 3H11B 1ZEMA 3L6OO 1FFSA 4KYTA 4ZHQF 5CMLA 1XVTA 1Z8FA 4X61A 4Y6RA 1NFFA 3LXXA 1NI5A 2XDAA 3R7WA 2I2FA 4Z4EA 4BNZA 1BJKA 4LJ8A 2WIDA 2WHQA 2PV0A 5L6LB 3JATB 2YWBA 4ZGGA 3OT5A 1VM6A 5ECYA 4QEKA 3GX1A 3F6BX 3R5HA 4E7PA 2YDXA 1FFAA 1HDIA 1MVOA 1K8XB 4OQXA 3UA3A 4DC9A 1MENA 1U4SA 5GJBA 2IYQA 2JRLA 4QYMA 2OAQ1 1FMTA 1JDBC 2GILA 2R6GA 3C1OA 1MAHA 4WACA 4EW1A 4WZBE 3L0IB 4ABTA 3TFOA 2O3SA 2LDXA 2AN1A 1EXNA 3FDZA 2ZIVB 4RTMA 3IEIA 3KOXA 1E9BA 3ETDA 1Y1TA 3FKQA 1NX6A 3WYDA 1Q0TA 3DCNA 4CV0A 1BE1A 4IH9A 2GD1O 3ZWPA 3DCYA 1LV8A 4ZQIA 3TXAA 2JJ8A 4MR7A 4FT4A 3NEJA 2QUKA 1LBSA 3I09A 4LDQA 5CHEA 3ICVA 1NXQA 2WG1A 1QUFA 4JLUA 4EI9A 4F7WA 4R0MA 4J91A 2DKFA 3U9SA 2DFLA 4L5IA 1R6UA 4UE3S 1GUBA 3VPAA 4BGVA 3BMCB 2JFUA 4JQOA 3H9GA 5AT1A 4X3CA 1YNOA 3PTZA 1D9ZA 4XD2A 1Q7BA 221PA 5TF0A 4TS4A 3RNLA 1UK8A 1YZFA 2BMDA 4FS8A 1GWNA 4DABA 1ARZA 5CM8B 1T6YA 4EW6A 1Z0SA 4GXRA 4P4SA 4TKMA 4XEUA 3RYTC 1Q74A 1SWWA 1Z15A 2DMRA 4CFZA 4K88A 4CDMA 3RK4A 4WFIA 2KHZA 4UASA 4LNAA 1NC1A 2A0WA 3TLXA 4F9EA 3C6BA 4RZ3A 1PS8A 3B53X 1M74A 1A5AB 1RWQA 1XDWA 2FOLA 2PZMA 3HEBA 3KPUA 3FYCA 3DWIA 4UNNA 1D4FA 3FG9A 4GS5A 2O6LA 4QASA 2R751 4RXTA 5FWNA 1EUDA 1W0CA 5HJ7A 2EFJA 2PSDA 2HIMA 1SCUA 4MVYA 4DBLE 4QUIA 4ZJPA 5LNK6 4DLSA 2ZRQA 4HB3A 3RLIA 4KXWA 4ER0A 1GZ5A 2EW8A 2H5LA 3I0ZA 1HEUA 1PTJC 1G5PA 3EN0A 3W5UA 1DZ3A 4AUNA 4G0MA 3F6PA 4NDZA 1VIMA 4IDOA 2VI5A 2E4VA 1WAMA 2C2XA 5D7BA 2W6MA 3OJLA 1KJJA 3N2ZB 5LQRA 4GECA 3IUJA 4B81A 1T2VA 1ETHA 4UD6A 3AM1A 3MOSA 3HA3A 3V4SA 4ZAXA 3ZTTA 5KJFA 1X94A 3E4DA 2IS1A 3DDHA 2GXQA 2IIPA 4IQ8A 3HLKA 3G8AA 2JZNA 3PG5A 4RVDA 5G1NA 4CNBA 3P9RA 1IQRA 2AD5A 3A6JA 4FFPA 1C0EA 3QJGA 4RELA 4B85A 1FJHA 1K8QA 5AJUA 3HWX1 2LNDA 1Z34A 3NG1A 4LF9B 1Y1KE 1CTQA 3L4BC 2C2YA 1M75A 2JEOA 1ZNYA 5CU7A 1LRJA 4C2AA 1JKIA 4CRWB 2QXUA 5FBWB 5JY1A 1FDTA 4HKTA 4B3SB 3I9OA 4TV8B 3AVOA 2QD3A 4CIWA 1GQYA 3N2GB 4Z2AA 2NV2B 4L28A 1K6EA 1Y4SA 5AHXA 1H0HA 2ZREA 1SBNE 1P0CA 3DOUA 1DKOA 2BSXA 2ZRIA 4YT2A 5ABPA 1V39A 3JRXA 3AKEA 4YQZA 3FETA 2PWZA 4GYJA 1PJBA 1LPMA 3QSGA 2I76A 1PYOA 4AJIA 1J24A 1D09A 2E4WA 3BCSA 1SC9A 2OG2A 2QGNA 3W9SA 3NYIA 2ANCA 1C3XA 3O03A 3IJEB 4FOOA 1JYSA 1LI7A 2WQ7A 2AFIB 3BN3A 1UOOA 1NBAA 2WYVA 5JAPA 3JYQA 5AOAA 2I0FA 3MJSA 3RRZA 1CUIA 4UM8B 1I32A 2I3DA 2JFVA 3RS3A 3X3HA 2PKXA 4QJBA 2R3SA 5EJ9A 3BC1A 5LQUA 3OIGA 2D1YA 1HQCA 4MOWA 2QX6A 1SIWA 2P90A 4M9RA 1CY2A 3BS4A 4JBIA 5TPWA 1RXCA 3K3PA 2VC2B 1TAUA 1KS2A 5EKTA 3AR2A 4L3VA 1A7AA 1Y8AA 2M1ZA 4YJHB 2IT1A 1RLIA 2I29A 2J1LA 2VIIA 1KPGA 3A7EA 4MWOA 3JQ7B 1PSDA 2FVYA 1NBOA 2NNLD 1FVFA 2Y0BA 2OBNA 1RQGA 2I3BA 2OM2A 4I8XA 4A73A 1DGQA 2R1TA 1ZK3A 1YFKA 1D1SA 1VL5A 3VJKA 3WWEA 3UUGA 1JMVA 1YR8A 5C1PA 1ACMA 2BEUB 3DNFA 1JEQA 1K7CA 3ACBA 1QVZA 2O8FA 4DRXB 1T9DA 3ECAA 3RYFB 2IK8A 1JSLA 5HZMA 2ZPTX 3ZBTA 5A5GA 4YONB 5FTMA 1E1LA 3QMVA 1BX3A 1LLFA 1HEYA 2VJKA 2W6PA 4D4LA 4BTLA 2W4MA 2YWRA 4Q9HA 2CL0X 2ZYHA 1DLJA 2BGJA 2B4AA 1PTKA 1DX4A 2PD3A 2XB6A 3GAAA 4NJEA 4RPCA 3RUCA 1WEHA 4ERNA 4TUYB 4Q3NA 4H6VA 5ENDA 1RWKA 1F2TB 2E2WA 1PJZA 1V5WA 2MYTA 4XOUA 1I3NA 3MLAA 4S1OA 2HBQA 3N2YA 3W05A 2YJ3A 3WO1A 4OQQA 1U0JA 1BZYA 1ZDMA 3MD0A 3W9UA 2EFEB 3CUTA 4H1WA 1IUPA 3U7QB 4KE7A 1PJCA 1XAIA 3LT1A 2IQIA 3THSA 5JNSA 4MICA 4FGUA 4CQNA 2XWJI 4N4AA 3MOGA 5CUQA 3ZHZA 4Q3OA 3WYEA 1D7AA 4C2UA 1MO6A 3HG7A 1HRKA 3F9RA 3HBAA 1XEWY 1TA4A 4J1TA 3NGMA 1FPMA 4DSZA 2C2MA 3HCAA 4CG0A 1K0UA 1K7SN 3T15A 5K03A 3X1KA 3CVWA 2UUBB 1E2BA 3UYLA 3OQBA 3I1FA 2V5VA 1IWBB 4HWKA 1ZH6A 4JC0A 4QQFA 5DSXA 4UVEA 3W6ZA 2HH9A 3I9FA 2WYUA 4ZZIA 7ABPA 2H7CA 5JZMA 4JXXA 2XMBA 1COZA 1GRQA 1DTEA 1OVGA 4YS6A 3RF7A 4D26A 4Y9DA 4RVFA 4DRXA 2XNCA 3GHHA 2MTBA 2X5OA 1TFUA 3ROGA 5CT6A 4MMYB 5GGYA 2F43B 5FCDA 1GZ4A 3ENVA 3KOUA 4RD2A 1LLQA 1X7GA 1NULA 4E09A 1KAQA 4EUKA 3FWZA 2PNJA 4DCNA 5CDHA 4AT1A 2C2GA 5AWFC 4KAFA 1H2WA 1BS1A 3M9LA 3RFUA 2PUGA 3FOAA 5FLXA 4MULA 1SKAA 1OMOA 4EEXA 1SM4A 2C1ZA 3PI6A 2B2XA 4K87A 3TSYA 3BHMA 3VHRA 1UPAA 1JFRA 3LCCA 4RSHA 3ZJYA 3EUAA 2P9CA 4UDXX 3WLSA 1L7QA 1BO6A 3AWDA 1E5QA 3L7CA 3ZU4A 3QYAA 2BGRA 4DR6B 5TY0A 1Z26A 4HDMB 2M1XA 3PD0A 5C52B 2VJNA 2BMJA 3NDIA 4E3ZA 5JJ5A 1AHPA 3ZCUA 5BVHA 4Q6BA 1HYGA 2HZ7A 4HFRA 1H4QA 4Q6WA 4AROA 4D4MA 1YS1X 1PJAA 2LE0A 2Z98A 3EA0A 3WRXC 1YJAA 5TF4A 2ZCJA 3G85A 1L5HA 3DAGA 3WB2A 2NACA 2D5AA 3IUSA 4HS9A 1NDUA 1W0KA 1D8AA 3HPRA 1SXJE 4LXGA 3VC1A 4DT1B 5LP6A 3I4LA 5DM1A 2C4NA 3KZMA 4V3CA 3ZGXA 3AUFA 1VJCA 4WSOA 5FULA 3I2KA 5D3QA 4BRSA 4W5JA 2Y05A 3GLHB 3IVRA 5A5DA 1Y33E 4XZ3A 5K8TA 4F97A 2VPZA 4WCFC 3VMFA 2QQGA 3Q10A 3AFIA 3JQBC 3PR2B 2C03A 4F2GA 4RTSA 1C7ZA 1LDMA 1XZCA 2ZJZA 5EJ6A 2FMTA 5B1HA 3K2BA 4EY5A 4E1BA 3OY7A 1GPDG 1CUZA 2C4HA 2W8ZA 3EFOB 4HAOA 4R9RA 3RVKA 4BFUA 1NF9A 4OU4A 3ORSA 2XE4A 1P2FA 3F7MA 2WPDD 4D82A 3EPLA 3QEBZ 1PN3A 4Y2GA 1UC4B 1SO8A 5TSDA 1FU4A 1W25A 1IZYA 2VJYA 3P71T 2R25B 4KTTE 5EMKA 1VSVA 2B34A 1O87A 1QO7A 3CN7A 3VPDA 4A8PA 2W6IA 4AD8A 5J4KA 2B35A 3LUBA 2AUTA 4YJ2F 2JEYA 5AW5A 4EP1A 3QG5A 5BVHB 4RJKA 3L7KA 2Y1LA 4YECA 3HRHA 3DPSA 3VNVA 1VMDA 3ROQA 2G04A 3H0CA 1O57A 1P4JA 4LXHA 1Y3HA 3R0JA 2GLTA 1TJ3A 4L5YA 1F0NA 5IJZA 2V7VA 1TOAA 4BE7B 1L8AA 3EE6A 2LCQA 2ZP1A 2W71A 4GBMA 2B83A 4A82A 2WILA 5FPHA 2BMEA 2XT6A 3E84A 3R3WA 3V33A 2PBLA 1MDBA 3WSVA 2CXHA 1YUNA 4NE9A 1QBGA 2NUPA 3GOHA 4V02A 2Z4RA 1LWOA 3MINB 4JHXA 3ETEA 2FU5C 3DH0A 3G13A 4CU2A 4RNDB 4MP6A 2LPMA 4TZKA 3GQVA 4YMWA 4CODB 3AP2A 4WEQA 3KX2A 1BRTA 2I2BA 3UJPA 4BBZA 2W2KA 2A86A 1XCBA 3G0DA 5KNBD 1UMKA 2Z0MA 1FRNA 2NTVA 3CLVA 1DFHA 1PHPA 2FJPA 4DIDA 4ZZ0A 1QVWA 1VCNA 3PKJA 4DC0A 3PEUA 2RGCA 1TO2E 4WN9B 2PRKA 3FAZA 3ZLJA 3GI1A 3H5NA 4G8DA 2AZMA 3D8SA 1WMSA 3O3MB 4FNOA 4GC9A 5KJCA 1CNEA 3VPCA 5CYGA 3OOJA 2ZR9A 3UHJA 4IOJA 4YR9A 1Z29A 1F0PA 4FMPA 2Y9PB 1QP0A 3GPIA 2H0QA 4XYBA 4D6XA 2O8BB 3AHCA 1UBLS 1UBNA 2PEZA 2MSLA 3PQ8A 2ONKA 4BFTA 4DXDA 1G5HA 3OZBA 3UAWA 3UG6A 1AU9A 2DPGA 1TMKA 2VK4A 3E18A 3O38A 1G5TA 3JQGB 3HBMA 3OZFA 4H0CA 2GPTA 4K9QA 4L08A 3SIRA 3WL6A 1WSDA 4UE2A 4GI5A 1LQ2A 3ZI7A 4F3KA 1P3JA 1PBNA 4BO1A 1RYNA 3M8KA 4LHYA 5EWJB 4ATNA 3L1VA 4O4LF 4E5NA 1U2GC 4MS3A 1QOZA 1BKSB 3JU3A 4WK0B 5CB4B 4OKIA 2IOYA 3RHSA 4NZPA 3W79A 3O75A 2AE2A 2EFHB 5CLIA 2NV0A 3ZLBA 2B37A 3U61B 1CJCA 4P3OA 2GD2A 5EXSA 2WTNA 5U4XA 4G56A 1KYTA 2CCGA 4TYQA 3M3DA 4L0DA 2B8EA 1HYQA 3R7WB 3RYHB 5K0EA 2AYYA 4S12A 5CCBA 1ZM2A 3QWBA 2HD4A 1V8ZA 4GO1A 1JDVA 1XXHE 4EB6A 4Y30A 1R8YA 1LJ8A 1X1AA 2A5YB 3M5PA 2QORA 1QNLA 2W2LA 3TE6A 1Z7WA 5T4EA 3MLEA 3H1AA 4N0MA 3A1WA 1NVWQ 5K45A 1MX9A 4YPVA 4OFZA 3RCBA 5FFNA 2Q3LA 3SHTA 4F1KA 4LMBA 3Q3EA 3OQHA 1G18A 2FV8A 4GDFA 3GGOA 3NANA 4EBBA 3QELB 3INNA 1PT9A 2H1SA 3CNNA 1GKKA 1Z39A 2XD9A 1PZHA 3ETGA 1GTJ1 2XT0A 1QQ5A 4F93B 4W1QA 3FWKA 1XNGA 1YDGA 3IMFA 1YDHA 1MCZA 2WJVA 4KQGA 1FDRA 3U7IA 4BTVA 3GLVA 3SQLA 4GLJA 1XQ9A 4CLDA 5EXEA 1DWOA 1RM5A 4FFBB 2IYAA 3TZBA 3H5AA 1VG9B 3FZGA 3UF0A 4WZAB 2G70A 2FW9A 3PDIA 1DC8A 1C7FA 3ZBUA 3D8HA 2EJTA 1VC2A 3MWDB 5HJ5A 3FTFA 2J5RA 3NKLA 3BYZA 1V8PA 3D3KA 3OLYA 3V8NA 2VOEA 4F8YA 3F8WA 3FCXA 1PR3A 2E82A 3G17A 1I5OA 3QENA 3P96A 2ZTHA 3EBPA 4K8OA 5IZ4A 2O5EA 1EFRD 1MB4A 1S2DA 1Z06A 2GEUA 4BDTA 2KPOA 1S96A 4D81A 1ZHHA 4F2DA 3UTCA 4BO0A 2VPXA 3QFSA 4OTZA 3PXCX 2XKKA 1WX1A 1J22A 1DRJA 3CS3A 3EDQA 2C4TA 2P4UA 2QTTA 2ZITA 3I37X 2B5WA 1WZ2A 4XJTA 2DFPA 3G9ZA 4ZAZA 4CG3A 4BP8A 3ERCA 4HZUB 3EZ6A 4RGQA 5KSPA 1ES9A 1CUCA 2KQUA 2QTHA 3QBVA 1PWZA 4HEJA 4RTLA 1BHO1 3ZX4A 3BQ9A 4Y2VA 3AR7A 4WDQA 3FNEA 5I8PA 1QS0A 1W1UA 2CV1A 4C5CA 4G4SO 5GWXA 1IY0A 3G8YA 3ITDA 3RUPA 3RADC 3OA0A 4I5DA 2AN3A 5CA0F 3BREA 3VR5D 521PA 3I0MA 3LQ2A 5HF8A 2DFTA 4N5LA 5IFLA 3VFDA 1VTKA 4HAZA 1PSZA 4K9MA 5EFZA 5IC5A 1UZUA 2YHBA 2YZMA 5M29A 1P80A 3K09C 5A7FA 6PFKA 2WZCA 4CL8A 2OM6A 3QLVC 4KX5A 1YQUA 2A35A 2G9RA 5AJWA 1JP7A 2FMHA 4RFVA 3R3XA 5ADWA 4F4UA 3WIOA 1NJ6A 1Q7RA 1MGOA 4O6VA 5JQGA 3KR9A 3V8VA 4F38A 1NG9A 4AF8A 1A8PA 2ZJ6A 5FL3A 2QSJA 4J3FA 3OPYA 2X19A 1KKMA 2Y27A 4ZQHA 3HEMA 1M6YA 3TTXA 4LE1A 9ATCA 2Z2XA 4MKXA 3QNWA 1TECE 3U3RA 2QR2A 4BGDA 3BL5A 1DEOA 3D3NA 1ISHA 2DHDA 4K2AA 4YDHB 2N3ZA 3AGQA 1ZI8A 4TS1A 4NABA 4RJ2A 1T3SA 2GZDA 5CX1A 4OA5A 3P5BA 3U3JA 3QKTA 4MQ5A 4GOMD 1NA5A 3D64A 1XWWA 4W9NC 2FYTA 3RLFA 5KKNB 1L7RA 1OIVA 4FIZA 1NXTA 4Z3OA 4JWKA 1PG5A 2OCAA 4WJLA 1HRDA 5CK4A 2BKEA 1CV2A 3KJGA 3MM4A 4NIMA 3VQTA 1J70A 3NHUA 1T1EA 3H84A 3WBKA 3GJ4A 7YASA 5K9ZA 2QLNA 5CEFA 3D6HA 3GH3A 4DRZA 2G77B 2BBWA 1F8XA 3UO8B 4GVPA 2FEAA 3M6LA 3GWZA 4I1UA 1M1YE 3CY6A 5BWLA 3QPAA 3Q3CA 4MDYA 3F4LA 3PYXA 4IMRA 3CV3A 3O93A 4IIGA 1W4BA 2FPWA 5AFSA 2Q5QA 1XEXA 5TGZA 1NUPA 1U2DA 4EGQA 3F73A 4HQLA 2FN8A 3KWJA 2I67A 4EYKA 1V5FA 1K63A 4O2AA 3HJNA 1P5RA 1GUAA 3SK0A 3U4QB 4MI9A 4FGKA 3SU8A 4YMSA 3VOAA 4CE6A 1JPNA 1G6Q1 4G84A 1Q15A 5B5SA 3CF6R 3Q3HA 1RM0A 2YFHA 4PO8A 5EERA 1A8SA 2EW2A 2FB9A 2GK4A 2P6OA 3EZLA 3PWTA 2IX9A 1ZEJA 5EJIA 4ZXPA 3RKRA 1ZD4A 1FJ2A 5EKUA 2DJIA 3BHIA 3R3SA 1OI7A 4NEHB 2X5JO 1U1FA 3HCBA 4RJJA 1TVCA 2Q7DA 3RS9A 4HRXA 4C5AA 3ADCA 3QHPA 1T4CA 2A1UB 4DQDA 4YRGA 3F5DA 3ELWA 2OQVA 5C51B 1IB0A 1UBHS 4DWOA 2E48A 3HKCA 1OLUA 3C6MA 1ZVKA 3C3DA 4Q3BA 4NESA 1JKFA 4LBYA 3DLHA 1G20A 1QLJA 2Q45A 3AUYA 4Q4JB 1N8NA 3P4YA 4FYPA 6ADHA 2FEPA 1TI7A 2MYUA 2NO6A 5DRYA 3RB8A 1VHDA 1BEEA 4REQB 4PINA 1TIBA 1K3UB 5DN6D 5KQLA 2RHTA 4MVJD 3RU9A 1QVRA 4FX2A 2QLBA 5DW0A 3A0RB 2ZSJA 4GSKA 2QLFA 2YRWA 3MFQA 1ZUNB 5JYDA 3QVUA 1Z56C 2RGXA 3Q0TA 4HG2A 4HXGA 3A0UA 4PSCA 5ESXA 2X8JA 3KKOA 2HXSA 5JFTA 1X7WB 2XCQA 4EUHA 4YGXB 2I6SA 2Q4EA 1MABB 1UFKA 4PSKA 4IVRA 1ECGA 2YICA 3U3KA 3U4AA 3DTVA 2P6RA 4GPTA 5A3JA 4DCMA 5C8ZA 3BAFA 3AI2A 2I6UA 5IBQA 1Q3KA 3E3MA 4YCBA 4MUYA 3X1YA 5B55A 4QHSA 1N0VC 4DR1B 4AAYA 4LHSA 3Q87B 2R8XA 2B61A 4MH0R 4XB2A 5K2OA 1SG9A 5ULLA 2DPXA 1KAMA 5LD2B 1CLUA 4UVDA 1QU2A 3ZE0B 3VHQA 4CLRA 1Z2PX 5FTLA 3TE7A 3ROMA 3KFLA 5AJYA 2WZBA 1JNYA 3P9PA 2O48X 2V74B 4KWEA 4EJMA 3JAMA 3F3MA 3FZQA 3KV1A 2JIDA 2ZT8A 1PE0A 5KTMA 4RABA 1P8JA 1ZXLA 2FWMX 1JB9A 2WA2A 4R1MA 4WD3A 3I6QA 3REOA 5KYWB 3QM1A 3TYXA 5AW4A 3KVNA 3CKLA 3AZOA 4P0PB 3S55A 4LPSA 1JF8A 4JR1A 4ALJA 3WLRA 1ZK0A 3KDAA 3LQRA 3EXHC 4JSTA 3ZCVA 4LWQA 1XEFA 2JHGA 5JSKA 2OECA 2W2VA 4IKEA 2HWWA 1S5PA 2E7ZA 4J7UA 3RO7A 1GNVA 1SA0A 3OJEA 3WSTA 1W9HA 3DAHA 4INOA 2O8CB 3B3QA 1KMHB 3IKJA 1LF5A 2PR7A 1G5RA 1B8OA 4ACBA 3U1BA 4MK4A 5B4TA 1I0IA 2L2QA 4JJ8A 3TLKA 4C4XA 2LD4A 1ZI9A 3EPHA 1CUEA 2W37A 5FL7A 3ZY4A 4DJEC 3FCUB 2NZYA 1CW2B 3ILXA 3NW9A 3CX8A 2HA3A 1XJ5A 2FKNA 3R77A 1CG6A 4FFVA 5WRFA 4YAFA 4E70A 5LPNA 2LP4Y 4PU0A 3EARA 3O2NA 1CEXA 3CJRA 3SYLA 4DCVA 1KH3A 3VZRA 4P4TA 4CUZA 3QK7A 1RSZA 1OH6A 1AE1A 3EIWA 4L5AA 4GNKA 4B3HA 2C7VA 3ZHSA 1R9MA 3FLAA 4BLTA 2EDCA 3TQSA 3KB8A 1RADA 5LQKA 1VCOA 4KIUA 1K8RA 3RSQA 1BDMA 3P9QA 3Q15C 4ZO8A 2JIZD 3D6UA 1UBRS 2CHEA 1SHKA 1KZ4A 1E7RA 3IV6A 2FWPA 4R6WA 5CVVA 5FWDA 4AWBA 4D3XA 1T9HA 1Q5PA 2I4MA 3KJHA 3ROPA 3QVWA 4JU8A 1LB1B 16PKA 4CI9A 2J6IA 5IWAB 3R0XA 3HA7A 3HNRA 2ENUA 4HQ0A 5BMOA 1I36A 3NVKI 3RU3A 3EUWA 3BWXA 3TH5A 4UEQA 1D04A 1JEOA 1II0A 2QA5A 3D3QA 3D8RA 2J07A 4BRUA 4XH9B 2YBDA 3MUEA 2PA3A 3BHJA 1QKJA 4L4RA 2IUFA 2YL2A 1J8FA 5LLSA 4AG6A 1OT5A 1T35A 1JLLB 2X22A 3JVIA 2YJGA 2CE7A 3H5VA 4ML3A 3BFKA 4LZWA 1QYDA 1BJTA 2NU7A 1VGVA 3HH8A 3DXZA 5LYJF 3OLVA 1OY1A 4QULA 2O2IA 3BHNA 2WW8A 5DM4A 5HMMA 3VRHA 4CT0A 4JYZA 1B1AA 4ZAVA 3WISA 5DM60 3MT9A 3K5PA 1U3UA 4IIYA 3V7WA 2HJRA 2HA7A 4BDSA 2DHQA 2EP8A 3D2LA 4IDAA 3I5MA 4GXTA 4JJFA 3P9ZA 2PRSA 4CL2A 4B44A 1B0ZA 3ND8A 3EW7A 1U7PA 3RC1A 3ZIDA 4XVUA 4W6QA 2XODA 2EF1A 3NUQA 3OZGA 3RT9A 4EABA 2FR1A 3EVBA 4ZHQB 4GLLA 3Q9NA 1GARA 1R4MA 2P5TB 2AT1A 2YY5A 4N6OA 4MYRA 3K53A 5C8DA 4M83A 2QZSA 5JNUA 3DMYA 2EC5A 2DYKA 1IZZA 1U1GA 2E37A 3HDJA 4KUGA 1KI9A 2EJWA 2NLOA 2UZ1A 1G9SA 3VX4A 4YIKA 1X39A 1YDWA 2AMYA 1CE8B 2NTJA 1MB0A 4M9ZA 3N6RA 3ZGLA 2XRYA 5DWQA 5CIYA 4GGMX 4KPGA 3AC0A 2VEOA 3ITKA 4LXQA 3T7AA 4TV9A 1L7NA 1NTOA 2P4QA 1D6MA 1O94C 2E0IA 2RB4A 3BJZA 3LD9A 2XA1A 3NP7A 2ZUSA 3ZVNA 3CXRA 3BG5A 1TCVA 3QZUA 1XYVA 4BV2A 5K1SA 1B2RA 6GPBA 2KE5A 2HO4A 1CULC 3SYTA 4C4PA 5AK3A 2P9EA 4M22A 3NXSA 3RS7A 5BVGA 4HDRB 1J06A 1I5RA 1NAIA 2PUJA 3EK2A 3DBRA 3RS0A 1P0PA 3PKIA 1B73A 3SG0A 1U3WA 1CQXA 3ZE1B 1GOTA 2Y6VA 3JYPA 1D2AA 3ABRB 3VDRA 3OZWA 3OZ7A 4QC2A 4AVYA 2HIGA 4OK6A 4ENTA 4ZVUA 1IUOA 1E61A 4GICA 4QYIB 4E2YA 1DKPA 3N7TA 3W3AA 2C5AA 1Q7GA 2HUPA 1ZWLA 3E9EA 4FFBA 4F11A 1OBCA 3JQQA 3FVRA 4JC8A 4DJDC 5EIOA 5AMXA 4BMXA 4YJ2A 3SC2B 2WE8A 4DDUA 5KS2A 2X4DA 1KJWA 3IVMA 3PWZA 3FNRA 1I7NA 2FRVA 1HLDA 4DYVA 1AKYA 5KYGA 2A9QA 1ZQ9A 4XASA 4KW7A 2OO5C 1BGVA 1VKRA 3JYOA 1BHJA 3A9SA 4GEKA 4LQ4A 2G17A 4XVCA 4BLQA 2ACWA 2ZYSA 4GP6A 4CM7A 8OHMA 4N54A 2WPNA 4NFSA 1E0DA 4FU0A 4K9PA 1UOEA 3AB7A 4WFJA 4TYYA 3ZHOA 3VR4D 3MS7A 4LC0A 1BMDA 3X1MA 2IP4A 3PZRA 3BCRA 5EOVA 2HWYA 4DA7A 4K28A 4OGGA 1T9GS 1MX3A 3OWOA 5MDHA 2FQYA 1I7SB 1II9A 2J0UB 1GADO 1OHHA 3QV1A 2GCGA 3IP1A 1J5XA 1JPUA 3CSDA 5LDDC 2J0QA 5J5CA 4AKHA 1THMA 1ZMOA 1QGUA 4MPTA 4Q4AA 1ZAYA 3KQKA 1HYHA 2BGIA 3B6JA 3BSSA 2IXEA 4HNRA 5J23A 5C80A 4RD1A 3DAPA 1H85A 1SU4A 3L9XA 4HDNA 4JI5B 2OG1A 3HJRA 1G1MA 3M5DA 5DH9A 4D4JA 2YVQA 2BM9A 4BFZA 1J8VA 2VQSA 3RDPA 4H4EA 3MJFA 3A04A 5KVSA 4EM6A 4FFLA 4NKRA 4RQUA 1R12A 4O59O 3TAUA 5HRCA 1EXDA 4V03A 2A7XA 4LSZA 4HNGA 3UB2A 1WSWA 4F71A 1IHXA 2QRVB 4YWHA 2HNBA 5C5EA 1XDBA 1YRHA 2QN1A 3K7EA 3W5IA 3TLYA 1W93A 4Q3KA 1K1EA 4BX3A 4IMIB 3S2YA 5K0TA 5L4NA 2RC5A 3P0JA 2VZ0A 3BIFA 4OHBA 5KYXB 1RIFA 2V8OA 3GRFA 4QUDA 4ASUA 5TX7A 3AU9A 3CRQA 1XN4A 5DBEX 5AQ1A 1P1IA 1UMCA 2A92A 5A62A 2F3TA 2RJNA 3PDUA 5SY6A 4ZZ1A 5JSQA 2FSHA 3NBXX 1NBEA 5I01A 2OCIA 1E3DA 3DV9A 3FPGA 1HBJA 5DP1A 3QTBA 5DYNA 3K9FC 1CYDA 4HLQB 3T0IA 1NJFA 5F33A 4U5XA 1TKAA 3AB8A 3H19A 2BGNA 2GCOB 3CM0A 1QLWA 1KVTA 1V43A 2WD7B 1UL1X 1N2OA 2A6PA 2P35A 5FNVF 3ND7A 3C8ZA 3ECSA 4IIJA 5HF9A 1XMOB 1XJ0A 4PRLA 2OUIA 4A8JB 4JODA 1GRCA 4WCDA 4RYDA 3N2NA 1IBLB 1FMCA 1YI8A 5KMGB 1SCBA 2WV9A 3GPLA 1DVRA 1V48A 3DP7A 2V45A 2E55A 1FDWA 2XKBA 1PR1A 2G6TA 2EZUA 2ICAA 3SDZA 3TMYA 2XADA 1DAGA 3OCCA 5I7RA 5BW8A 2HEGA 4F21A 2V7PA 3CO0S 1Z5WA 3L84A 1FXUA 5CGQB 4Z0PA 5KYUA 2LGJA 2G7ZA 2HL6A 4O63O 3SEQA 2DKOA 3HYSA 2DCMA 1U7UA 3ICEA 4DQXA 2IDKA 2J48A 4DKXA 3COPA 2KBFA 2JJ1A 3G5MA 3IAHA 3KYDB 2H31A 4R71A 5BR1A 4EJSC 5C3MA 3HDHA 4F3TA 1XKXA 3T1VA 3TTUA 3U26A 1G6HA 4JP1A 5K0JA 3U37A 1FRZA 2MR5A 1SH7A 1GTZA 1ZCBA 3GEDA 3GCXA 1Z2DA 3JD0A 4MR9B 4DXHA 1RCUA 1W1WA 4HAIA 2WMOB 2QI9F 3PXUA 5DHUA 2V8BA 2FMXA 1LC3A 1ZUIA 1U2PA 3EF3A 2Q6LA 3DR5A 3Q8WA 4QXQA 5I9NA 4IGFA 4DUGA 4PYIA 1X7DA 3FKSA 1J1UA 1DNPA 3PFHA 4YJFA 3VDXA 4BZQA 5KU7A 4WA7A 4F5DA 4JP2A 4XJXA 2ZUEA 1ZIDA 3C16C 1GKYA 1D4ZA 1WA5A 2OGZA 4PY2A 2OD9A 1CCWA 1GPYA 2MCFA 1KYVA 2VNSA 3AFHA 2IF0A 2D4AA 1HMPA 2H3EA 4HWPA 2LBPA 1X13A 2HRZA 2B30A 4MIEA 4MAFA 2HCJB 4OY3A 5CT5A 2BAGA 2V6GA 3PNMA 3VVBA 3LC0A 3F67A 4PPGA 2ZDHA 3HVJA 1IN7A 3SX2A 3G02A 5FI1B 1KYXA 3PENA 1E5VA 5A04A 3LIIA 2H5EA 4Z1MD 4F85A 3F47A 4LQDA 1RYEA 3A36A 5BV8A 4ALLA 1M72A 1QJ4A 2PD4A 3DE3X 3TLBA 1X1QA 3TRJA 1E2DA 4TRJA 5ALWA 5LD2C 3FPBA 5F2OA 1PG2A 2R8ZA 4DMMA 4BMPB 2OHGA 3SXPA 1U7WA 1RM3A 1IRIA 4WZ6A 3I05A 5AVWA 1Y4AE 3K9BA 3HBJA 4RVCA 4G5OA 4TL7A 1L1RA 5K0CA 4TQ9A 4NOLA 1RYBA 3NEPX 3LUAA 2CK3D 4J6EA 4S1TA 3ROXA 2FP4B 1MIOB 4UTZA 3F9CA 4KH1A 5AVVA 1PR9A 4DG5A 1C4WA 2A0XA 2V6BA 2LWIA 3DSRA 1OVMA 1O95C 3M6XA 3MRVA 2YVKA 3K9WA 3RRXA