1UUJA

N-terminal domain of lissencephaly-1 protein (lis-1)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
76
structure length
76
Chain Sequence
VLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDMNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the N-Terminal Domain of the Product of the Lissencephaly Gene Lis1 and its Functional Implications
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell division
molecule keywords PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB ALPHA SUBUNIT
total genus 23
structure length 76
sequence length 76
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08513 LisH LisH
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.30 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1uujA00
2XTCA 1UUJA 2XTEA 2XTDA
chains in the Genus database with same CATH superfamily
1TP7A 3SFGA 1OM2A 3DDKA 4ZPBA 3AWRA 4ZP8A 2IM1A 2E9RX 4ZPDA 4ZP6A 2D7SA 2IM0A 2D68A 4LQ9A 1XR5A 2ILZA 4NLSA 2E9TA 4ZPAA 1SH0A 4NZ0A 4K4YA 4IQXA 3H5YA 2XTEA 4NLUA 4WYLA 3NMAA 2EC0A 1SH2A 4NLWA 4ZP9A 3OL6A 4WYWA 4NLYA 2V1SA 5JXSA 3UPFA 3SFUA 1RDRA 4Y2AA 3UQSA 2B43A 2IM3A 4NLOA 5F8NA 4NLQA 4Y3CA 4LQ3A 1SH3A 1RAJA 3H5XA 4WZQA 5F8JA 4WFYA 4NYZA 5F8GA 4NLRA 3KLVA 3OL8A 3N6NA 3CDWA 3BSNA 5F8IA 1UUJA 1U09A 4ZPCA 3CDUA 4Y34A 3KNAA 4K4TA 3N6MA 3NAIA 4K50A 3AX5A 3OL7A 3NAHA 3NL0A 3KMQA 4WZMA 4K4ZA 3OL9A 3AX3A 2UUTA 4IKAA 3UR0A 4O4RA 3BSOA 1WNEA 4K4UA 2XZ2A 2UUWA 1TQLA 4K4XA 3N6LA 1XR6A 2V1TA 4NLTA 4NRTA 4K4VA 2XTCA 1KHWA 4NLXA 5F8MA 5F8LA 3KOAA 4X2BA 2IM2A 4NRUA 4WFXA 5F8HA 1KHVA 2XTDA 1RA6A 3KMSA 4K4SA 4K4WA 1XR7A 2CKWA 2ILYA 3QIDA 4WFZA 2IJFA 3OLBA 3AX2A 4Y2CA 4QPXA 2F8EX 4NLPA 2WK4A 3NKYA 2E9ZA 1RA7A 4R0EA 4NLVA 3OLAA 4ZP7A
chains in the Genus database with same CATH topology
1TP7A 3SFGA 3DDKA 4ZPBA 4ZP8A 2IM1A 2E9RX 4ZPDA 4ZP6A 2D7SA 2IM0A 2D68A 4LQ9A 1XR5A 2ILZA 4NLSA 2E9TA 4ZPAA 1SH0A 4NZ0A 4K4YA 4IQXA 3H5YA 2XTEA 4NLUA 4WYLA 3NMAA 2EC0A 1SH2A 4NLWA 4ZP9A 3OL6A 4WYWA 4NLYA 5JXSA 3UPFA 3SFUA 1RDRA 4Y2AA 3UQSA 2B43A 2IM3A 4NLOA 5F8NA 4NLQA 4Y3CA 4LQ3A 1SH3A 1RAJA 3H5XA 4WZQA 5F8JA 4WFYA 4NYZA 5F8GA 4NLRA 3KLVA 3OL8A 3N6NA 3CDWA 3BSNA 5F8IA 1UUJA 1U09A 4ZPCA 3CDUA 4Y34A 3KNAA 4K4TA 3N6MA 3NAIA 4K50A 3OL7A 3NAHA 3NL0A 3KMQA 4WZMA 4K4ZA 3OL9A 2UUTA 4IKAA 3UR0A 4O4RA 3BSOA 1WNEA 4K4UA 2XZ2A 2UUWA 1TQLA 4K4XA 3N6LA 1XR6A 4NRTA 4NLTA 4K4VA 2XTCA 1KHWA 4NLXA 5F8MA 5F8LA 3KOAA 4X2BA 2IM2A 4NRUA 4WFXA 5F8HA 1KHVA 2XTDA 1RA6A 3KMSA 4K4SA 4K4WA 1XR7A 2CKWA 2ILYA 3QIDA 4WFZA 2IJFA 3OLBA 4Y2CA 4QPXA 2F8EX 4NLPA 2WK4A 3NKYA 2E9ZA 1RA7A 4R0EA 4NLVA 3OLAA 4ZP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XTC A;  1UUJ A;  2XTE A;  2XTD A; 
#chains in the Genus database with same CATH topology
 1TP7 A;  3SFG A;  1OM2 A;  3DDK A;  4ZPB A;  3AWR A;  4ZP8 A;  2IM1 A;  2E9R X;  4ZPD A;  4ZP6 A;  2D7S A;  2IM0 A;  2D68 A;  4LQ9 A;  1XR5 A;  2ILZ A;  4NLS A;  2E9T A;  4ZPA A;  1SH0 A;  4NZ0 A;  4K4Y A;  4IQX A;  3H5Y A;  2XTE A;  4NLU A;  4WYL A;  3NMA A;  2EC0 A;  1SH2 A;  4NLW A;  4ZP9 A;  3OL6 A;  4WYW A;  4NLY A;  2V1S A;  5JXS A;  3UPF A;  3SFU A;  1RDR A;  4Y2A A;  3UQS A;  2B43 A;  2IM3 A;  4NLO A;  5F8N A;  4NLQ A;  4Y3C A;  4LQ3 A;  1SH3 A;  1RAJ A;  3H5X A;  4WZQ A;  5F8J A;  4WFY A;  4NYZ A;  5F8G A;  4NLR A;  3KLV A;  3OL8 A;  3N6N A;  3CDW A;  3BSN A;  5F8I A;  1UUJ A;  1U09 A;  4ZPC A;  3CDU A;  4Y34 A;  3KNA A;  4K4T A;  3N6M A;  3NAI A;  4K50 A;  3AX5 A;  3OL7 A;  3NAH A;  3NL0 A;  3KMQ A;  4WZM A;  4K4Z A;  3OL9 A;  3AX3 A;  2UUT A;  4IKA A;  3UR0 A;  4O4R A;  3BSO A;  1WNE A;  4K4U A;  2XZ2 A;  2UUW A;  1TQL A;  4K4X A;  3N6L A;  1XR6 A;  2V1T A;  4NLT A;  4NRT A;  4K4V A;  2XTC A;  1KHW A;  4NLX A;  5F8M A;  5F8L A;  3KOA A;  4X2B A;  2IM2 A;  4NRU A;  4WFX A;  5F8H A;  1KHV A;  2XTD A;  1RA6 A;  3KMS A;  4K4S A;  4K4W A;  1XR7 A;  2CKW A;  2ILY A;  3QID A;  4WFZ A;  2IJF A;  3OLB A;  3AX2 A;  4Y2C A;  4QPX A;  2F8E X;  4NLP A;  2WK4 A;  3NKY A;  2E9Z A;  1RA7 A;  4R0E A;  4NLV A;  3OLA A;  4ZP7 A; 
#chains in the Genus database with same CATH homology
 1TP7 A;  3SFG A;  3DDK A;  4ZPB A;  4ZP8 A;  2IM1 A;  2E9R X;  4ZPD A;  4ZP6 A;  2D7S A;  2IM0 A;  2D68 A;  4LQ9 A;  1XR5 A;  2ILZ A;  4NLS A;  2E9T A;  4ZPA A;  1SH0 A;  4NZ0 A;  4K4Y A;  4IQX A;  3H5Y A;  2XTE A;  4NLU A;  4WYL A;  3NMA A;  2EC0 A;  1SH2 A;  4NLW A;  4ZP9 A;  3OL6 A;  4WYW A;  4NLY A;  5JXS A;  3UPF A;  3SFU A;  1RDR A;  4Y2A A;  3UQS A;  2B43 A;  2IM3 A;  4NLO A;  5F8N A;  4NLQ A;  4Y3C A;  4LQ3 A;  1SH3 A;  1RAJ A;  3H5X A;  4WZQ A;  5F8J A;  4WFY A;  4NYZ A;  5F8G A;  4NLR A;  3KLV A;  3OL8 A;  3N6N A;  3CDW A;  3BSN A;  5F8I A;  1UUJ A;  1U09 A;  4ZPC A;  3CDU A;  4Y34 A;  3KNA A;  4K4T A;  3N6M A;  3NAI A;  4K50 A;  3OL7 A;  3NAH A;  3NL0 A;  3KMQ A;  4WZM A;  4K4Z A;  3OL9 A;  2UUT A;  4IKA A;  3UR0 A;  4O4R A;  3BSO A;  1WNE A;  4K4U A;  2XZ2 A;  2UUW A;  1TQL A;  4K4X A;  3N6L A;  1XR6 A;  4NRT A;  4NLT A;  4K4V A;  2XTC A;  1KHW A;  4NLX A;  5F8M A;  5F8L A;  3KOA A;  4X2B A;  2IM2 A;  4NRU A;  4WFX A;  5F8H A;  1KHV A;  2XTD A;  1RA6 A;  3KMS A;  4K4S A;  4K4W A;  1XR7 A;  2CKW A;  2ILY A;  3QID A;  4WFZ A;  2IJF A;  3OLB A;  4Y2C A;  4QPX A;  2F8E X;  4NLP A;  2WK4 A;  3NKY A;  2E9Z A;  1RA7 A;  4R0E A;  4NLV A;  3OLA A;  4ZP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...