1UUNA

Main porin from mycobacterium smegmatis (mspa)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
184
structure length
184
Chain Sequence
GLDNELSLVDGQDRTLTVQQWDTFLNGVFPLDRNRLTREWFHSGRAKYIVAGPGADEFEGTLELGYQIGFPWSLGVGINFSYTTPNILIDDGDITRPPFGLNSVITPNLFPGVSISADLGNGPGIQEVATFSVDVSGAEGGVAVSNAHGTVTGAAGGVLLRPFARLIASTGDSVTTYGEPWNMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MSPA
publication title The Structure of a Mycobacterial Outer-Membrane Channel
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Porin
total genus 30
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09203 MspA MspA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.300.10 Mainly Beta Ribbon Porin MspA ribbon fold Porin MspA ribbon domain 1uunA02
2.60.40.1650 Mainly Beta Sandwich Immunoglobulin-like Porin MspA (Ig-like beta-sandwich domain) 1uunA01
2V9UA 1UUNA
chains in the Genus database with same CATH superfamily
1DBJL 5I73C 1CFNB 2ZKXA 5C0AE 3ZTDC 4B9CA 1M7DA 3F84A 2UXFA 3CU7A 4K23L 5HDOA 3VXPA 5IW1A 4PEEA 1G84A 5IB2A 4AKQA 4LT7A 2A9NL 1INEH 1DQJB 3MSPA 3FO2A 5AB0A 3BH9B 3P1VA 4F1SA 2OL3H 2Q5BA 2VDQH 2ZQKA 4MDIA 3UCRA 2A73B 1LD9B 1IAKB 4IBVA 4KJPD 3RWCA 3FQTB 3V0AC 4NNYB 4MCMA 1SJEB 2ADYA 1S9YB 2FSDA 4NO0B 5EEUA 4ODUB 3NK3A 4KKBC 5IJKC 4I0PA 1HNYA 3PHOA 3KPMB 4XE0A 2A6IA 4M6AA 3FFCD 2WLNA 4A55A 3VFPA 4DT2A 5LUMA 4JMXA 1TNMA 1A7RH 1KTDB 5CZRA 4AGNA 4AEEA 3U83A 1KN2H 1EUTA 1EMTH 4XZ4A 1NCCL 3D12B 1ZLDA 4PTUA 2WLKA 3AXHA 3GSXA 3KD4A 4N2FA 4X7SL 4XT1C 4FFTA 1DVFB 4P46B 5F1IB 4X5WA 3PG2A 5E5MA 1W8NA 5CEXB 3SPJA 3VSUA 1N59B 4OIAA 4R96B 1VESA 3PYCA 4HG4K 3RGVA 3SQBB 5DVPA 3Q13A 3D39D 3RURA 5KYWA 3GHEH 1OO2A 2YOAA 1UWXK 3NZ8A 4RFNC 3BC9A 3CZFA 5I28A 5IMLA 1HTYA 1WBZB 2ZXBA 5DI8A 3TT1H 4KKPA 4H1LH 4Y2LA 3SOBL 5E6ID 3KS0J 3P77A 2X89A 4ZODA 2X0UA 2FE0A 4FQQB 1A4AA 4AUJA 4OFQA 4HKXA 5DFAA 1J0IA 3QUGA 3WELA 4YSSA 4A38A 3BVUA 1G1YA 2D03H 2NR6C 2FD6L 2YRLA 3SDXB 1GRWA 2B1HH 4FFYL 1LK3L 1OGAB 4XPFH 1G6RL 1KB5H 1YEFH 2FO8A 1L7IL 2R56H 3FCSB 3J07A 4XOCA 2DQHL 1OCOB 2J44A 1FFQA 2HKHL 4IRSA 5D7JC 3TN0B 1J1PH 4WLCA 1EDHA 3DJRA 3V9FA 3QFJB 3CLEL 3S36L 5I26A 3O9WD 1M71B 4CVZA 5DTFA 1CXHA 3H9SD 3MVSA 1FUNA 4DKDC 4N1HB 5F7NC 4LZKA 5G4OA 1U8PA 3ETBF 5H94B 4BGDA 4LLAA 2HT2D 4AH2A 2J25A 4PHXA 3O6FD 3F64A 1FPTL 4MMYA 2YUVA 3PWPE 1IBFA 1OTTC 4PY8J 3U7YH 1BAWA 4MXWL 5AAWC 4YDVB 1QTYT 5CJOH 4AQ1B 5FCUH 5GGSA 1WRFA 3HUJE 4OCYL 3HPLB 4JVPA 5E5UB 2A9ML 5FAAA 4RFEB 3T0XA 5IB1A 1OGTB 4N6RB 2V5TA 3LEXB 4BFIA 5IW6B 2EABA 3BZ4B 2YZ8A 2V9UA 1JZ7A 2DQIH 4P23C 2Q3XA 1FF5A 2OW7A 3EJZC 3FCUB 5LB1A 5I8CB 4M5TA 2J55A 4G59C 4YBLB 3RU8L 3MRDA 2FQGA 3INUH 4DO5A 5J0BA 3T0ED 5GGUA 2NZIA 1BLNA 3BXNA 5J4MA 3HR6A 2H1LM 2UWEB 1EFXD 1NBQA 3FRPA 3R1GH 4HMCA 3IWUA 4PY8I 1M05B 2WLYA 2E6JA 2Y0SA 3DX9A 2CMRH 1HAUA 1F6LL 2V2TA 1HOCA 3EJCA 4V1DB 4ZOEA 5L2JB 2XKSA 4NFBA 4BSWA 3HZMA 4PCSA 3QR1A 1WE5A 1WS7A 4M8VA 1DL7L 2IEPA 5DMJB 5C07E 3UTPD 1BZDA 1ZXKA 4MD0B 3TZVD 2CRMA 3V4VB 1R33A 4PJAE 3OLIA 3QFDB 5IHWA 4ZMAT 1M2OA 4PBVC 2H3XC 5JPMB 2CO3A 4K5NA 2VH5H 4XN1A 3SGEI 1N0LA 4P5TC 1ZWIA 1V05A 3LN5A 4KROC 4J6IA 3TJHD 1DO6A 3L4ZA 1UFUA 3MREA 2Q2LA 4JFSA 3VXMB 1J05A 3PP4L 2YGPA 4LCIL 5L88H 5JHLL 3MJ6A 2TRHA 2ETWA 3FTXA 2FNWA 5C8JA 1Q0XL 1O6VA 3C5SB 4MQ7B 3HZYA 3P3YA 4M7JL 4W6YB 1QD0A 1T5KA 5G2NA 2AXFB 2E9IA 3MJ9L 3PJLA 3RYMA 3VM5A 2IANE 1H5BB 5LGHH 3BIKB 5J89A 5HYQA 4B3VA 5I1LA 5K93A 1E67A 3VXRA 3JTBA 5ANHA 3AXLB 3UYRH 4GUPA 1UM5L 4JFHD 3AU0A 1INQB 3WOVA 3GSUB 4F24A 4I9WE 4O9HL 4F2FA 3LH8A 1A1NA 5E8NB 1N6QH 1EO7A 3TO4A 3D2UB 4ORZC 2VR6A 5TPWL 1B6DA 4OJEH 4G8FB 1KCSL 1VADA 1FLRH 1XGRA 3RVUD 1U8MB 5EBGA 3TF7C 3HG1E 4MDIB 3BX7C 3LRGA 1C8QA 4NQEB 4X9GA 4NUJA 1VCAA 1MOEA 3BP7A 3AS2A 1F5WA 1TJGL 2HN7A 2AQRA 4PRIE 5DJ0A 3SKOA 3RVWD 4OCSH 1C7SA 5BZZA 4RGNE 2AK4D 5IB5A 5FB8A 4I0PB 4CNIA 1T2QH 3VGBA 4Y4FA 4F33A 2R59A 2FO1A 5F7DA 2C4FU 1S9WB 3O2WL 3MO1B 2OKMA 4UTCA 1AZCA 3RL1A 5D7HA 2HX9A 1X3DA 2Z0UA 5HP5A 1GS8A 4UT7L 2O4EA 3AUWB 2R4RH 4G8GE 1RIVL 4I5BB 3GSQA 3RA7H 4PTUB 3ATDA 2NLJB 3GMMB 4AKPA 5E6IC 2CO7A 3GSXB 1MCOH 4X6BB 3S9DB 2NY1D 1SFHA 4X5WB 3D85D 4EOWH 3MJ7B 3B9VA 3TEWA 3IN2A 1M53A 4NKDB 4LCWD 3QZPA 2Q3ZA 3NGBC 4HDIA 3VXOB 7PAZA 4DKFH 2C7FA 2HCZX 1BQUA 1HAWA 1YMHA 3DVGA 1MPAL 2HP4A 3QUKA 2CA4A 3DX7A 5FF6B 3ZO9A 5A7EA 4MJIA 5DJ8B 5B39G 5ADOH 1HL8A 2A4ZA 3RVVD 5GS1C 3NABH 4OUUB 4GXVH 5IVXA 4WEBH 1LYQA 2K78A 2XN0A 4PJEE 1PTZA 4KJQD 5A6MA 5E9DA 2XX0A 3HKFA 2VRQA 3NPZB 2YSSA 3MUGA 2YGQA 1PEWA 2CDGA 2OYLA 3FQWA 4XMWA 3NJNA 1UUSA 3BH4A 3O9WC 1S9XB 4HJ0D 1I9JL 1P2CA 3QULA 4AZUA 2J6EH 4NQVA 1V3LA 3O4LE 3FU3A 5AOJA 3EO1B 3CSBA 2HT2C 3N5AA 3Q3GA 5DO2D 5FS5A 2YMOA 3L4YA 3TCLA 4MXQD 3O6FC 2ENSA 4LCUA 5E94A 1TSHA 3L1FA 5I1CH 4B7LA 1IBBA 2R1XB 2DQUL 4K71C 3RAJL 4NGHH 5J12C 4GG6F 2ZICA 4NC2B 3F7VA 2ZP9A 3QIWA 3NA9H 4CSPA 5CUSH 1OAKH 1U8KB 5BVJB 2FHFA 2UX7A 1U8PB 3K6IA 2DWTA 1HEHC 5D1ZI 5C0EA 4I2XA 2NQDA 1BQ5A 2N59A 3T0EC 2Y9RT 4NRYA 1EH9A 3ARXA 4K55A 1J5OH 4MMYB 3FO0H 4W9KC 2ZUYA 3MOBH 2BH0A 1KFAH 1KTLA 4FOMA 1ZLUK 3V6ZB 3T08A 1D5ZB 4MJ2A 3LIUA 1Z9OA 1MFAH 2J1XA 2OX5B 4ZX4A 2X0VA 4R7LA 1G7HB 1N3NA 2EXWD 2FEJA 2R8SH 3GNML 2K8QA 5IB1B 2CM5A 2E5EA 3A5VA 3FFCE 3QEGH 5F1NA 4O02A 4BFIB 5I0DA 5GJTL 3AY4A 1ZHKB 4HZ1A 1XTLA 4IM8A 4I3SH 3G6JB 4P9HC 4FG6D 2ITFA 1C7TA 5F7HA 1KJ3L 1PX8A 4WTXA 1A47A 1TLMA 1TZGH 3L54A 3MRDB 3WY3A 5I1GL 5A40E 3M1BA 2BPBA 4OCNC 1GJIA 5MI0C 3TJHC 4EBQH 5DD5L 3FRPB 2PO6D 1UZ6F 1W72H 4LHUG 4Y5VC 5FFOA 3WGVB 4QLRA 4N8VB 1OM9A 3PPSA 4GRLD 4M02A 4ANUA 3MCLH 4TRPL 2X2JA 4Y9CA 3D39E 5KYXB 2V2TB 1NJ9A 1YN6A 3NRPA 1HOCB 1RU9L 1A7NL 4DVRL 5JO5B 3LMJH 2IOOA 5FGCE 5JPNC 1IAIL 2QHRH 4PJ8A 4AQEA 1OE1A 2FEDD 3GPSA 4B0MB 3WXVH 1ZRUA 3CLWA 3GTNA 5AWNL 3QHZL 4YHZH 1EGJA 4LLQA 1RUPH 5I30H 3B9KA 2MHAB 4L4TA 5F9JA 2VQTA 5B1JA 4NOBA 5SWZA 1OT4A 1D9KD 1CICC 4HOXA 1VFAA 3V4PH 1DQDL 3GMNA 3UTQA 3HZYB 1J1OL 3PUUA 2EE9A 2PCYA 4S1RL 2AKRA 5ITFB 4Y7MA 5J1TC 3T8XB 4KAQH 1GYUA 3WMPA 4K3EL 4A7UA 4ODTL 3VXRB 1UD2A 5AOZA 2QQNH 2VLJB 1XF3B 3HBZA 1Z0MA 5H37H 2BNQB 4NM4L 1T1ZA 2ZAHA 4R7DA 3KLAA 2IAAC 3F12A 1CJYA 3PL6B 1MFDL 3CHPA 5L0QC 3NVQA 1AGFA 3TO4B 1DVTA 3WNNA 4CC0A 3WI9A 2R51A 2ZG1A 1CFVL 1SN2A 3FXIC 4X9YA 2JLLA 1MI5A 4HS8H 2IGLA 2WWOA 3E9TA 1QUPA 1F0LA 3GHPA 3ZDYB 3KPTA 4HISA 4ZUVA 3BP4B 2DYRB 3EH1A 4APQD 4ZD3H 1I85A 5FGBC 3NTCL 1OLLA 3L3OA 1T5XA 4MMZB 5GRVK 2FH6A 3BQVA 1RUMH 3EO0A 1ZK5A 4XB8A 4HETA 5LQBH 3BP7B 2NY1C 3CWGA 1IGCH 1KYOJ 1RSYA 4Y9EA 1XR9A 3SKJL 4U1IB 5AAMA 3OHXB 4N9OB 4PREA 3V95A 3FOMB 1FFOA 3WY4A 2PPAA 2ZNWA 5EORL 8PAZA 4NKOA 4CNIB 5DU7A 1VENA 3MNVB 3MRGB 2NDFA 4NJ9L 1BZQK 4ICXA 3P2DA 2KBGA 2R29L 3CMGA 3RVVC 5DQJA 5DURB 3QZNA 2DWDB 2YC1A 3UIZA 3T0EE 5MEQB 1PPIA 4MD4B 5ILTL 1IC7L 2N7BA 4GSUA 1UWXH 1F8TL 2FVNA 2YAQA 3ARDC 4KJQC 4DW2H 4JDTL 3T77A 1DQQA 2NY5H 3S7GA 2GSGA 3NJHA 2GCYA 4K7PH 4HJ0C 5ID0A 1WWWX 2VXTL 2EVIA 4ZMOA 5HGAB 1FDLH 4J3OF 4BSVA 1EJOH 3ZDXB 4NRXA 4D0BB 3SEPA 2BVEA 4IBUA 3CN0A 3P0YH 2PXYA 5DO2C 1H9VA 2GW5A 1N64L 4Y2OA 5F7EH 4MXQC 2YUWA 5IVXB 1IGIH 2Z3FA 3HPJA 4WI0B 3PQYA 4PJDF 5CU5A 4UAOB 2M83A 5KAQF 4BSJA 5C3TA 1G1OA 3FT9A 1BFOB 1JRHH 2CDGB 1OXYA 1JUFA 2NY6B 2Z31C 2BS8A 1MNNA 2VJXA 1J0HA 4AI7A 5ERWB 2GJRA 2X4OA 1T4KA 1NC2B 5L2KE 1JOIA 3DPDA 4K94C 5GIRB 3ZR6A 2OM5A 3GSNA 2CNZA 2F5BH 2NYYD 3PWVB 4KVNH 1G7JB 2BCKA 2E7DA 2CHXA 3FAXA 1HCYA 4JUSA 4NT6B 5D2NB 5IZ7A 3QUZB 1UJ3C 1XBDA 4JFHE 3RTQD 3OLEA 3SPHA 1CLYL 2ZOOA 4JS7A 4RWYL 4K9EH 5C0FA 4JFXA 4ZMTA 3QIBD 1YUHA 4H5SA 1Y18A 4I1PA 2X1QA 2EXWC 1DBBL 3F7VB 43C9B 2J21A 1V3JA 1MRDH 3BJ91 3CFTA 4PWGA 4OLEA 2BSRA 3QIWB 4H8UA 1FZKB 3OVUB 4OU3A 4QTHA 3KBPA 2V17L 4FG6C 5CLTA 5C0EB 2IVFC 5IV2A 1QNZL 3PAZA 3MRBA 2FT6A 1NGXB 1ND0B 3FYEB 2PO6C 4YZFE 4XVTH 1EHAA 2AK4E 5J6HB 4GRLC 2YK1L 4E68A 1RJYB 3IDIA 2E9GA 2CRZA 3RX7A 2JJSC 4KITB 2YUZA 2ENQA 4RFOH 5JNYA 5F1NB 4O02B 3RVXD 2IH9A 3ZKXB 1J8KA 1F42A 2FEDC 1SXZA 2HUEA 2X40A 4U3XA 3KXFD 3U6RA 2XBZA 2GVYA 1FO0B 4JY5L 4YSQA 4ONHB 5IT2L 4HJSA 4ZNEE 3UO1H 4LCWE 1IQWL 1XF5B 2FWUA 4JRFA 4LARL 4F27A 4EI6A 1KIPA 3UX9B 4WCYL 3KG5A 1D9KC 2OSXA 4LL4A 4M4RA 1LTXA 1CFQB 3AG1B 1ZA6B 1BWWA 1MXDA 1PFCA 2R39A 3SBRA 3LKPA 2C4FT 5C0CB 4AIOA 3KWTA 3U4EB 2OI9C 3B7RL 5IWLC 4LDCA 1JFQL 3O2VL 1UGNA 1GW6A 3EDDA 3TBCA 3ULUF 4ZOBA 3EYVA 4K8RL 1QI5A 4HWBA 2J5LB 3UP6A 1HESA 1TYRA 3IE4A 1SXCA 4AV4A 2VWEC 3ESPA 4D7PA 4RMQA 2E86A 1I82A 4L4TB 2X7LA 5I1KL 4PW4A 4XBEH 1TMCB 5IOPB 4ACPA 2J8UE 1PCXA 3HRZA 1XR8B 2AKRB 4P2OB 1UKSA 3E2HC 4APQC 4F20A 3B83A 3QZWA 2QELA 3QXAB 4X4XA 5D8JL 4LIQL 3KGTA 3RWHB 3VFWA 5BS0B 4HAKA 3B5GA 4OLXL 1IBGL 3NSCA 4L1SA 2Z8RA 1CYWA 5LNEA 4EJ1C 4R7DB 1A5FL 1YDPA 4U05A 4MAUL 3VWKB 2PTTA 3US0A 1GGBH 2W5PA 3AROA 1E7VA 2EDEA 1JYXA 3ULVF 2WQUA 3RG1C 2UXVA 4L4VB 4M48H 1P7BA 1J5HA 2OBGA 2RFXA 2KQNA 3BD5A 3W81A 5I1JH 4LP4A 5JQ6L 2GJ6B 4N24A 5EEZA 2DMHA 5DD0H 3GEFA 1UURA 1UB5B 3FNKA 4L9LA 4LEOA 4L37B 5BV7L 4FQIH 3UTTE 1SHMA 2HRHA 3RWIA 4UQ9A 1FFOB 1YYLH 2HRPH 1QVOA 2D31B 1YEIH 4XNYH 3VFGH 5HXMA 3CVIH 3AABA 4NKOB 2NXYB 5FUZL 4BGLA 2VO5A 1NCUA 2DQDL 2B3IA 3MLTA 4ZSOA 2BNRD 1MAMH 4QO1A 3WEXB 1TTFA 4LKXB 5BOJA 4NQDA 4RQQB 3QDMD 3OZKA 4A63A 1AOZA 3LKQA 1E9PB 4X6FB 5KVDH 3O8XA 5DRZA 1CC3A 3HI6L 1LP9A 5DJCA 4HXAL 4FC3E 2J4WH 1JN6A 4FQLL 4HUXB 1VSCA 2ADFL 3O6LL 3IF1B 4N8UA 5ID0B 2ZNHA 3OKDB 3WLWD 3QXWA 4IDLA 2PR4L 1E42A 3ARGB 4GQZA 4XX5A 3WEOA 2WXFA 4M62L 4U1MB 4NRXB 4GRWH 5JW5A 2NYYC 3B7YA 5IP4A 4WU5B 1BZ7A 3T8VA 2P5EB 5B1AB 5EDXA 1DSYA 5DSCB 1M4KA 1UM6H 1C1EH 3PDOA 3IRPX 3RTQC 3WJLA 3HPJB 4YLBA 2Q86A 3REVA 4JRYD 1INEL 1GGIH 3ALXA 4K0OA 4QOKB 2ESVB 1TF4A 2V4LA 3G08A 2VDQL 1OCZB 1JUFB 4LAQH 1AZZC 1JVOA 5GRYA 1VACA 3D2TA 5AL0A 4HIJB 4MASA 1HCZA 5DA4A 3EBAA 2JJTC 4XP9H 3I6GB 2Y1ZA 3LZLA 4MDJA 3EH3B 3L3HB 4KXZH 3CC5A 2OJ1A 2WXGA 5CP7B 1XGTB 2Q1EA 1I8LC 3OKEA 4F2ME 1RZJC 4U1NB 3O0RH 4YLCA 2OMWB 4MNGA 3PABA 3MV8A 5AEAA 1J0ZA 1H3PH 3NMEA 4YPGB 1JRHI 4ZO7A 2VWEE 3GXIA 1A7RL 2MQCA 2VLRD 3CFDA 4JFXB 4XCFH 1QO3A 1EMTL 4H5SB 4TUJB 1Y18B 1BXXA 3L3GB 4B9JA 5EOCL 3LKNB 3ATEA 1FZMB 1ZLUH 4UQCA 4OI7A 5F3HA 3NJKA 1JI1A 1SXBA 1ADQA 4Q9CA 3NSFA 4G7SB 4OF5A 4HJTA 4MMXA 4H20H 3OR7A 5AYUH 1RZ8A 4YDJB 5I8KL 4DP7X 4PGJA 5IV2B 5HI4D 3L2MA 4AYEC 4M00A 2GTWA 3GHEL 4WVRA 3AREB 3MRBB 1OPGH 4LCCC 4Y4HD 5DD3H 2Q20A 2EDQA 1BM3L 1BVLA 1MJUH 8FABB 4E41D 2YBRB 1R3JA 3QC5X 3TT1L 2NUTA 5EU5A 3VM7A 3HRPA 2EDWA 5D1QA 2R4SH 5EZOL 1GC1H 5LCVL 4ZX6A 2LLNA 3GIVA 1DN2A 4FA6A 1J8RA 2EDBA 1AD0A 3T4AA 3BD4A 1T5WB 2VRAA 2JCWA 4CMHC 4IRZH 4KXDA 1IILE 4I0CC 5L8LB 1JTPA 3APNA 3M17B 1UTDA 3U6RB 4M9PA 5D70H 2B1HL 5EU7C 4XPFL 5HI3D 4OH2A 2EEAA 3RUGF 4S1DD 4H8WH 1KB5L 1YEFL 4OV5A 1K4DB 4NDMA 2YA2A 2R56L 4G8IA 4MB3A 3SPCA 1SDDB 1GS7A 3UTSD 3ZUNC 1X7TA 3VW3L 4M4RB 2I5YH 2VL5B 1MWAH 3QI9A 2QTEA 1U9KA 4G8EA 1J1PL 5CCKH 4F91B 4KKCC 3ABLB 3TVMC 3VTTA 3U7WL 3SY0B 4PYHA 3V9CA 2D7OA 4A7SA 2EYSA 1HCVA 3BISA 3CFJB 2G2RA 3DI2B 4NN6C 3S36X 5BRZE 4F8PA 3IS0X 4FHKA 4X6EA 2WZPD 2QGDA 1TEYA 3RDTA 2AW2A 5LNDA 5KTEH 2F1EA 3SBWC 3BQUD 4WTWA 1ZJBA 2ZXQA 5I5IA 3U7YL 1PX3A 2A4CA 4PR5B 1HSAB 1H3GA 3ABKB 3TTYA 5CJOL 4FTVB 1NCAH 2WVVA 2VMJA 2PYEE 4UIKH 2C9UA 3HN5A 1D7FA 2DH3A 4PGCB 2VN4A 2KYIA 4H25B 3DBSA 3KPRE 5FHAH 1BX2A 1A3RH 5ICZA 3GXPA 3I02B 4BFNA 2DQIL 1YAZA 4FL4C 4NC1C 3F05A 2V2WA 3R06A 3OV6A 2F7PA 4YHYC 1L7TH 3INUL 1IU1A 5F89A 1THCA 3L3JA 4XN2A 1UOVA 4I0KA 1JF1A 3R1GL 3FUFA 2PETA 1NUDA 2CMRL 4ZMYA 2WXQA 1NBVH 2X9XA 2YKLH 1RH8A 4AYFA 2CUMA 2DPKA 1FQ9C 2XTJB 3D50A 3FCTB 2WXKA 2P46B 5KSAB 1G0DA 3L95A 3EGXB 5HHMB 3TNNA 2J2ZA 1MRCL 3KWXA 3RJOA 2DDQH 2VH5L 4MGXA 1S2EA 3WLWC 3FU7A 5F3BB 5KW9L 1J8SA 4R4FH 5EU3B 1OW0A 1WO2A 2ATKA 3WTVA 4UDTA 4LPTA 2XKUA 1JYVA 2HJLA 5F0PB 5L88L 3S8GB 4ZSOB 1DYZA 5IW3A 3CFBB 3KXFE 2YR3A 4OTXH 4RGMB 1SMDA 2WJ7A 1RMFH 2XV0A 5D7IB 3O8XB 5LXGH 5DJZB 5LGHL 2DYSB 5DJCB 1GMEA 1C08A 5IVOA 2W38A 4NQXA 4AVJA 1JN6B 5C0AA 1KGWA 1EZSA 2NNAA 3FTVA 3UYRL 3AT8A 4H8PA 4W9FC 2NY4D 5E6SB 3W1ZA 5JDJA 1HZHH 3S5ZA 4J12A 4UT6A 3T3PB 4LOFA 5E70A 3V2AR 3MCKB 3CBJB 4NSKB 5J06A 3QCTL 1XF4B 4BHUI 2ZYRA 4R3SA 3ARPA 5HJBA 4YQXL 5EU7E 3N43B 4FQPA 4D0CB 3OR6B 2KZKA 3QXTA 3VO0A 4XPTH 5F6HI 3LN4A 4HIXL 4UTBA 4NQCB 3IJYA 2CQVA 4JM2D 1ZT1B 4Z23A 3HI1A 1Q4NX 2XV6B 3G08B 5KS9E 2MCAA 5DLML 5F7BA 4KHTH 4BZYA 5AOKA 1VACB 3FU5A 3GXUB 3ASWA 3LPPA 4MJ5A 1TETH 4PV9A 5I0YA 3M1OA 2XNAA 2DJ4A 4RZCB 3DOSA 3GSWA 4NYLA 4OCSL 4Z95H 5EOTB 3VRLF 2X2IA 1BJ1J 4S1QH 3NZUA 4EZMA 1YY8A 2IPKA 4JANB 1GCYA 5FK9B 1X5IA 3L7FA 5HI4C 5CJ5A 1S7VA 3QAZC 4UBDD 1Z0NA 1TVBB 4Y4HC 2EADA 3MV8B 1XGQB 2CRIA 4FFWC 2YAHA 4OJCA 4G5AA 4EDWH 3SDAD 1PD0A 2R2CA 3MA9H 1ORQA 1QO3B 3MV7D 1Y1UA 4Y2DD 3PGFH 3RA7L 2FNBA 1ZXQA 4CN4A 3SDCD 4HWEH 2O5XH 1MCOL 3LDBC 3AWFA 1WUNT 2I25N 3MMEB 3APFA 2OTUA 5F3HB 3MOAL 3HE6A 5CJQL 4EOWL 3NSYA 5I18H 1SRDA 3OPZH 4KXZI 2ROXA 3O41A 5IFJA 4RIRA 1WC7A 5G4NA 4ERSH 4YDZA 5F97E 4GQPH 4PWHA 2BIMA 4DKFL 1GKEA 2JELH 3RKDC 1IC5H 2MQ3A 5C86A 2O72A 1DVQA 3DVNA 4NC1E 5HI3C 5ADOL 5G55A 3NABL 4S1DC 2X4TA 3WFDH 4GXVL 5DHEA 1LHZA 3WJJA 3X1BA 4HSQA 1QMUA 1MCKA 3AMKA 3AS1A 1PDKA 3H3PH 2MTAA 4PB0L 4AMKH 4PJBF 5CWSA 1L0XA 5BQDA 5A2IH 1SY6H 2R69H 5C0BD 1HNFA 2BNRE 2OLDA 4IRJC 4MYPA 4HH9A 1XCXA 1L3WA 4POYA 1U36A 1S7RB 2CGZA 2YPVA 3SKMA 4ZMLA 1FH2A 2J6EL 3LXBA 4X9HA 3V10A 1BSIA 3C5ZC 1T7XA 2D3LA 3OJVC 1BHGA 1CQKA 3OMIB 3K91A 1L9NA 3UPRB 4EI5A 4OLZL 2FB4H 3BQUC 3JYCA 5F0LB 3D09A 4X4ME 4X6CF 5F9AC 5I1CL 3QG6A 2VXUH 4BZ1A 3L3KA 5DC4B 3QI9B 4URKA 3EOYG 1LVEA 1PG7H 1FBIL 5D2LF 5D6DC 4UNVA 4B97A 2AJZB 3Q01A 2QTVA 2VSDA 4NGHL 2O5ZH 3WNPA 1U8LB 1YUKB 1GZHA 3PWPA 3CVHB 2UZIH 3BVTA 3PJSA 5EU4B 2Z4QB 3UBXA 1QOKA 3NA9L 3U0TA 5CUSL 2A0LD 2AQPA 3NCWA 5HHQA 4E5XA 3HUJA 3IRCA 4HJ1A 4KO9A 4A2FA 4CVXB 4U1HA 3SYCA 1Q0EA 2WAHA 4HUNB 3UGEA 3GUTA 3JWOH 1LDPH 3I2CL 3VACA 3FO0L 1GOGA 2E7BA 3MOBL 1CBVL 4JZJC 1KFAL 1TJHH 2H1PH 5E1AB 3FQRA 4QXUH 1LO4L 3BUDA 1MFAL 3IETA 1F3JA 4FXKB 3BVDB 4QXGH 1LL1A 2DYPD 3P9WB 2EEBA 3F2LA 3QEGL 3HB3D 1BBDL 1KJMB 3LIZA 2ERJC 1G7MB 2VLRE 4I3SL 4WEEA 5IJKA 2V2WB 1TZGL 4LLUB 4CBZA 5FPIA 3A23A 3GC3A 4MZ2A 5F89B 4FMKA 3AS0A 5ID1A 3L3JB 3G04B 5C07A 1M57B 3QCVH 4ABWA 2VB5A 4EBQL 1MHPH 4PJ7B 4Y16D 2FR4A 4NNPH 3C8DA 4PJAA 4Y88A 4DK3A 4HALA 2APWA 3MCLL 2Z93B 4GBXD 1BBJA 1URIA 4Y8AA 3RDJA 3NIFE 4JM2F 4AYFB 2BIIA 1S7TA 3LMJL 3A4AA 5DS8A 2QHRL 2H0PA 3TNNB 1OQXA 3VCLB 4PGDA 1KC5H 4FNTA 5EBMA 1OD7A 4PJ5E 1GSKA 3WXVL 1RXLA 2LU5A 4WUUB 4FZEH 4XOAA 5SWSD 2OMXB 2IANA 4D94A 1RUPL 4UIMA 2ZYSA 5F93C 1KWKA 2XTLA 5JZ7D 3CX5K 3V4PL 5I6NA 1U3HD 4Y1TA 3HMWH 3CZLA 3IJHA 3LEVH 3CDZB 3TO2A 2F18A 1KGCE 3LPFA 3GWJA 2PYFB 2VXVH 4KAQL 4LBEA 3SCMB 1X9QA 4LPUA 1IJ9A 2UVEA 3UTSE 1D5BB 1F97A 3HUJF 4OW6A 3S5LA 2EUVA 2QQNL 2NR6A 1CCZA 5I1IH 2PUQT 4WJ5B 3GI9H 3KYMA 2XOTA 1GJWA 4FLHA 1FZOA 4QT5A 3ZE0E 3HG1A 4PP1D 1Z2KA 1L9QA 3ME0B 4ENZA 4N9GB 3QQ4B 2YFNA 1BLIA 1QFPA 3DIVA 4A6YA 4DQAA 5D7JA 1KEGH 2QEJA 3VVVA 2NY2D 4PRIA 2CGRH 4Q74A 3IJSB 2P3YA 2D8KA 4ZD3L 3SDAC 2BHUA 5DO8A 2TAAA 3LNIA 4Y2DC 3LXCA 1RUML 4G1EA 3SDCC 3W57A 1P5UC 3RE0A 4MJ5B 1H8NA 1HQ4B 5C08D 4AJWA 1IGCL 2YIHA 2H6PA 2XG5A 2D3NA 3O11A 3BAIA 1W80A 2A74A 1LXMA 1AGBA 3II1A 2X38A 1AS6A 5ESVB 3RI5F 4E9SA 4FQXA 4G8GA 4P3DB 2EXSA 4ODWA 5AAWA 4UI2A 3FFOA 3QQDB 4HUKB 4D8OA 4KVPA 4G43A 4PP2A 1IM9A 1XDTT 2BWQA 1YEGH 3FT4A 4LHJB 3B7UX 3VDBA 2PF6A 4GW5B 5DZVA 3IPBA 4HMEA 4C55A 1FAIH 5TE7H 4UT9H 3HVNA 1HHHB 2BFVH 4G1MB 2DIEA 3L9BA 3BLKA 1PZCA 1IE5A 2WLMA 4DW2L 5CP3H 3G9VA 4P23A 5CZXD 3U46A 5IROC 5JLZB 3KPOB 5HYSA 1YEKH 2QADB 3HE6B 5D4IA 1G7QB 2EEXA 2XDHA 5TH2A 3SPGA 3ESVF 2MOQA 4PJEA 1XF2A 2DN7A 3MLUL 2N1KA 4H0GA 1H6FA 3LRHA 2EDHA 4O51A 1QSFB 4RBPK 1C5CH 4XX1E 4NZDA 2O5NA 3P0YL 3DVNB 4Y0GA 4LNRA 2H0EA 5F7EL 4R8WH 1T7ZA 1IEBA 5GS0H 1CBJA 4LDLB 5TK4A 1IGIL 3CZEA 5EBLB 4Z7OE 3O4LA 1TLKA 1OB0A 4PM1A 3VDAA 3P4OB 5IB3B 1OT2A 4N8PA 2DQMA 3AAZA 1A4JB 4XP6H 1JRHL 5B1KA 2G4EA 5C0IA 4M7ZB 1MVUA 1UXWB 3WNLA 1JE6A 4NO5B 1JD7A 3QNYA 3SKMB 4P5TA 4YL9A 2A0LC 3QUXD 3NJVA 1OK0A 2A9DA 4EI5B 5MEND 1QFWM 3MNMA 3GINA 1EXGA 3LS4H 4HIIA 4JB9H 5LJYH 1XAKA 4PWJA 2MKLC 4JHUA 3QG6B 1TVDA 2AXJA 2Q2EB 3L3KB 4Z78B 2BY3A 3BVVA 4K9EL 3NCEB 5AW9B 4TOYL 3VXQB 5JOFA 4R0LA 5J1AA 5E1QA 3VFTA 5K9OA 3JWDH 3MLWH 4PSPA 3SD2A 3QNZA 4JO4H 4S2SB 3PWPB 2UXGA 1MH5A 1MRDL 5CILH 3UBXB 3KLHD 5AB2A 1TQUA 4E2OA 1GS6X 2QZ5A 3DX2A 4MCYA 4E5XB 4KV5E 1IBHA 4M5SA 4ZPTA 2VERN 1WGVA 4IGBD 4C4KO 3QO0A 1VFBA 4NXSA 5I73B 4X98B 3UROR 4L0PB 1OZTG 1J48A 4KGJA 3FFCA 3BRGC 5CCJA 2W92A 1YMME 4Y16C 4XVTL 4HVBA 3EFFA 1K6QH 4PS3A 2B7DT 2PN5A 4GBXC 2DLGA 4PJXB 2PTVA 1ZHBA 3FO9A 4F3FA 4WK0B 1JGLH 3U9WA 4CSSA 2Y3AA 1KG0B 3Q06A 2YGOA 4RFOL 3QG7H 2NNXA 1EIBA 1A3ZA 1HSBB 1JNNL 3OXSB 3MV7E 3RTLA 3D39A 4WSGA 5DEGB 2X70A 5F7MC 2N3JA 4N1EA 3S98A 2WVTA 4JRXD 2FHBA 3KYNA 4KUCF 4M56A 5C07B 2Y7MA 3NDZE 3UO1L 2JWYA 1MQ8A 4PJAB 1XIWC 5FYLH 5JZ7C 1QW8A 3QSKB 4MXVF 2CIKB 1AKJB 1ZTXE 4GSDH 1NSNL 4PVLA 2OMTA 4FYSA 4HIQA 4IIQB 3JVGC 4EE2A 2E7MA 2ICWA 3PHSA 2SEBB 1U91B 4MSWA 4NUMA 3VI4F 5CN2A 5DS8B 2B39A 2UZYA 3RPIA 1EBAA 2QGBA 4PGDB 2CH8A 4HS3A 1D5MA 2EXTA 4MJ6A 4XC3H 1CI5A 4HHAB 5C0BE 1AQDA 1JZEA 1G7LA 4EMZA 4JO8A 2O61A 5GS1A 4RFNB 5IKCB 1IGTB 2FL5B 4PP1C 2D0GA 4YNYB 4RAVB 1KMGA 2UZXA 2YMXH 4OZFB 4CGTA 1NKRA 5LGYA 4XBEL 4UQBA 4P59H 3HNVH 1QYGH 1RP9A 2WQ8A 1QFUH 5D7EA 2ZCKL 4NX0A 4HF5H 2A1WH 3O9WA 2VZ1A 1D5IL 2F2HA 3ETBJ 5HJ3B 3NCMA 7FABH 2PCXA 3BW9B 4OD1L 4HT1L 3S5LB 4MA8L 3BCFA 3A4FA 2XVKA 4LGSB 1ACYL 2CO1A 2IPUK 2WLLA 4FKEA 3TESA 4WO4A 4HV8B 4P8QA 3VRJA 2CHNA 1F13A 1GGBL 4UZGA 3ZMNA 1RK7A 1G1KA 4D0DA 3ECVA 4BE5A 3MZTA 4IKKA 5JHDB 2XVGA 2PMZA 2WLIB 4PRIB 2QVIA 2KERA 4TL5A 5I1JL 3N3EA 4FLQA 4LVEA 3IDMA 3DURA 1WBXA 1FYHB 3BO8B 5CZXC 4ZMPA 1RSFA 1GHFH 2YQ2A 1TQCC 5HHOB 4FQIL 3OTTA 4O58H 5B38A 3G5XA 3BZFA 5ITBH 3O11B 1AZVA 3KBFA 1EWHA 1YYLL 2HRPL 1IRAY 3NCYS 4NKMB 4ZUSB 5FM5M 1NMAL 4DP9X 1YEIL 3T0EA 4XNYL 3VFGL 3K6DA 3VXUB 4HBQA 2IWEA 4ODWB 4QUOA 3QHFH 3G5YA 3TH3T 4PP2B 3JWNE 3FCBA 2FHCA 1MDAA 2P7TA 1NLDH 2B59B 2RIKA 3EGDA 2WZAA 2Z7WA 1VA9A 1T80A 4JHAL 1MAML 4W4OC 1BAFH 2KS0A 3FU9A 5HVWA 3VI3F 3EBIA 3KBEA 5CM1A 2OV0A 3Q1SH 4HKBA 1CFBA 5KVDL 1T1WB 2W9LA 3CHQA 5DRXA 5H35B 1RULL 3QEUB 3U46B 5HYSB 5IF0B 5ISZE 3IDGA 3ARFA 5KOMC 2J4WL 2DWYA 2NTFB 2PW1B 1A1OA 1NGQH 1SDAB 2IWFA 3O2DA 3SE9H 4U4IA 3MUHL 1T3FB 3QUXC 4TVSa 4UUJA 1NGZB 4W9ZA 4Y5VA 5B1CA 2ZXDA 5D6CB 2VR7A 3JV6B 3T6VA 2HSIA 2RAMA 1W91A 4LNRB 4Y1SA 5C92A 1TQSA 4NHCH 4HWNA 5JW4Q 1JPFB 1UM6L 1C1EL 2G9HA 4L3ED 4TQ8A 5L2KA 2VDPB 1NAMB 3MRQB 3FTWA 4M1CD 5JPNA 3ZMRA 3VD3A 3AAZB 5LG6A 2XPGB 1E28B 1V5JA 5C0IB 5B7FA 3K6NA 4LAQL 1MVUB 4PRBA 2WP3O 5I2IB 1PF3A 5A2LH 4Z7WF 5E1GA 2RGSA 2ZXCA 1E27A 2F15A 2OXGA 4KROB 3IMUA 3KLHC 4XP9L 1HYSD 3DVFA 3TPUA 4ONGH 3ET9F 3DGGB 1B4LA 1QHQA 4IGBC 2VMDA 3IU4H 3MNZA 1SJHA 3TA3D 1Z9LA 3PAUA 4YFDB 1CICA 3T3MF 4HIIB 4HIHB 3WFHA 1TO5A 3GK8H 4FLRA 1ZT4A 3ARWA 2P43B 2ZONA 2F54D 1H3PL 2VDMB 1QPKA 1K4CB 1X5MA 3KW7A 2OS7A 3VH8A 3WMQA 1KLFB 3QDGB 2H0JA 2EDFA 1QUNA 2VM9A 2IH1A 2R2BB 1UXSB 3KYKL 1RFDH 2VW6A 4LHUD 4PJIE 2GEQA 4Q7DA 1JF6A 1MH5B 2QSTA 2ZD0A 4IBYA 3TBBA 3V0VB 1IKNC 4GMSH 1R3IH 3T0VA 5K69A 4TUOA 1N67A 3HS0B 2Z6FA 3U79A 2AK4A 2VDOH 4MCYB 2B2XH 3PS6A 4R97C 4NP9A 3IU3B 4H20L 4ZPTB 1NCWL 4ANVA 4JFYA 1CVRA 4FJ6A 3VQMA 3ZRSA 4ZMQA 4K5OA 1OPGL 5DD3L 4IHOA 4GH7B 4WKZA 1MJUL 1EDQA 1XFPA 2YAOA 2V8MA 5FGBA 4UM9B 3IVKB 5PCYA 1IBYA 4PBDA 2R4SL 4LMQI 3FSVA 1GC1L 3UTZA 2DOCA 1UACL 2AXGB 4Q2ZB 5EC2B 3D85A 5GJSH 4ZNEA 4EXPX 5D7LE 1EAOA 5HGGS 4LCWA 1C8PA 2GK2A 3DXAE 4IRZL 4XXDB 2O6EA 4KK9D 3D39B 2QGCA 1S7XA 1QZ1A 5IBLC 2QV2A 5BXFA 3SOTA 1QLEB 4J3OH 43CAB 1SXSA 3DO3A 5GS2H 1EGJH 2Z7YA 3KYNB 1GJUA 3IJ9A 4G7VH 1HNGA 1ODAA 5DJ6B 5L4JA 4H8WL 4JQVC 5F0MB 3ARDA 5IB4B 2I5YL 2AXWA 1MWAL 1GYWA 5E6IB 2VKWA 2OMTB 1QP1A 5CLYA 1YYMH 2YGVA 2ICWB 5CCKL 4YHNB 4BKTC 3G5VB 4NPYA 3R7QA 3NGBB 5CZKA 4F7PB 1JS4A 1BJ8A 3WJMA 2HTKD 4HS3B 2VIRA 2BS9A 2FT7A 3O45B 2J8UA 3DWTA 4R2GD 2IALA 2WMPA 5KTEL 2XYCA 1JV5A 5E00A 3CZSA 2Y7LA 3GJEA 2YRZA 4J3SA 3L4UA 5ICUA 3PU7A 4BDVB 1OZUA 1NCAL 4OCXH 1ZHLB 1CGWA 2VQUA 1QFWH 1TQWA 2Z31A 3QC6X 5MENE 5AVUB 1IIIA 3N85H 4R4NC 4PGZA 3TBYB 2WTOA 3P30L 4MCZA 5FHAL 4ZDHA 4PWIA 2JKWA 1A3RL 1HOEA 4X4ZA 4P46D 3H9SB 4H44C 4YL4A 5EN2A 4YHPB 1ZLWK 1H3UA 5TF0A 2OXHB 2DIBA 5KJ7E 5GRVL 1L7TL 4QCIB 3O6FB 1CT8A 1ORSB 3DPBA 1R3LA 4MJ4A 4P04A 3ZHFA 1UJ3A 1YPZF 5LBGA 4GAYB 5EPMA 1P0SE 2IG2H 3CDYA 1YEEH 1QEXA 4I1NB 3UTTA 2R0ZH 3OC5A 5JOEA 3GYRA 4HWUA 2BS71 4K71B 1KCWA 5JIIA 1JPEA 1NBVL 2VDLH 3QARA 1M7IA 2YKLL 5SWQA 3FTGA 3S96A 1NC4D 3HBGA 2PPCA 1MIEH 3HHSA 1NGYB 1KLGA 1TEFA 1WBXB 1R5VB 3MRMB 4LK4A 1CDBA 1JNHA 2V3FA 3QJQB 4B6ZA 1A6VH 2DV6A 3G5XB 4PJCE 4EF3A 2DDQL 3CD4A 4QXTB 2P5WB 4JO2H 1OLZA 3GHBH 4R4FL 1OL0A 5B1BB 1ZS2A 2P8MA 5GRJH 1EFXB 1C5DA 4YXHH 2PO6A 3VA6A 2IQ9H 2DM3A 2WZ6A 4GRLA 2P7TB 1MCDA 4A7GA 4RBPH 5C0ND 3Q9PA 4OGAD 2JJSA 2XV2A 3F7YB 4JRXE 1KXVA 1T7WA 1SVCP 2WVUA 3GSVA 1WLHA 1XSJA 4P99A 5JIPA 4HKBB 1RMFL 3TZVB 1QACA 2G75A 2J12B 2OSLA 3DSNA 1N4XH 3QFJD 5TQ2H 1I31A 4L05A 3VGHA 1X9LA 2VDKH 2H3KA 3CE1A 3DROB 3LJ3A 5A6IA 2CHDA 1A1OB 3GSNH 4PJ9B 1QSED 1E6JH 3DYMA 5BZDA 3ULUH 4KTYA 3SKNB 3U36B 2FJHB 2ZYIA 4UUJB 4XRCA 3KDPB 3WTXA 1RUKH 5GGVH 3TA3C 3HR5B 4QHUB 4XVSH 3QISA 4OZHE 4PW3A 2QDVA 3O6MH 1C12B 4PJHF 4QRTA 4M1GH 3AQZA 4XPTL 5KANI 1QRNE 4LEEA 4LNVA 3U4BH 4HC1A 2XUWA 1AJ7H 1G94A 1UZ8A 3EOAB 4MQXD 4KXAA 4N2OA 3O3AA 1U8IA 1JZFA 4KHTL 4PRBB 4YFLF 1CXFA 4F2MA 4DUVA 3F6LA 1A7QH 1Q9WB 12E8L 3QH3A 3WL9B 3C08H 3X11A 1RD6A 4Z95L 3TPUB 4S1QL 1A6AB 1URLA 1EBPA 3QJHA 1SJHB 5DHVB 3L5XL 3UJJH 4L1HA 3JBG7 2C3GA 3GMRA 4FCAA 1B2YA 2V5MA 4APQA 4OZGE 2K3HA 5HJGA 4ETQA 1Z3GH 3MA9L 4XCYA 4NS0A 4R4BA 4V1DD 2R9HC 3PGFL 5DJYB 3MNDA 2W07B 4HWEL 2O5XL 1LEIB 1IJNA 1BV8A 2LU3A 3QUHA 3I6LE 2BMKA 5C7XH 3NOIA 3NJMA 4Z7VF 4PGEA 3FOLB 2EKSB 4K8RD 2AK4B 4ERSL 5L0QB 5CIPA 4KK9C 1DUYA 2HFEA 4JFYB 1T0NA 4M3KB 1IC5L 4BZ2A 5F1KC 4ZT1A 1Q0YH 1RUAH 4A7GF 3TBWA 4A04A 2MNWA 3P4MA 1KJ2A 3WFDL 4RESB 2AMGA 4IU2B 3GQFA 2AEOA 4J7RA 4AQAB 5AVTB 4KKRA 4AMKL 1U4EA 4YSDA 3TIDB 2C7UB 2L7JA 1FVCB 2CALA 2NY1B 3UTZB 1SY6L 4Y5XB 2R69L 2QKIB 1A0QH 1IV8A 2IQAB 4W70A 5IMOB 4Y1AB 4LCWB 4BA0A 1OY3B 5EULV 3X1EA 3TWCH 4HWBH 1NFDE 2HTKC 2YAPA 3UGUA 3FQYA 1XT5A 4JPSA 3CHSA 4ES9A 1YRKA 4PHZA 3V7AG 4R2GC 1JXJA 2F0CA 3N42B 2W9DH 5C0RH 5IEKA 2Y5QA 5AVVB 4PVNA 1I1YA 4EUPA 3TV3H 2VXUL 4PCTA 1KIRA 3T09A 1NIEA 3UC0L 3HFFA 4DFHA 3MBED 1CGUA 1KLUB 5BRZA 2UVFA 1MZYA 4GAGH 1QLFB 2KLSA 4JKNA 4OZIF 1NCBH 2O5ZL 4PJFF 1BMZA 2NDGA 2XWEA 3L81A 4IU3A 4L3EE 5KYYB 2UZIL 4JJOA 1XH3A 1RZKL 4P46C 4Z0XA 4PBWD 1D6EB 5JIKA 4ZQTA 1I8MA 3WV0A 4GPVA 2PYEA 4M7KH 3C87A 5INCA 4WI2A 3NFSH 2WY3B 2J8UB 3LN9A 4OZFG 1ILUA 4PRNB 3SGDH 4HU8A 2BSSB 2WMPB 3RB7A 3AVEA 5TGBA 1LDPL 3KPRA 2ICEB 3UH8A 2C3XA 4TSAH 2L04A 4ELME 1TJHL 2H1PL 3CFIC 3PHAA 5AVSB 4ZUTB 1O5PA 5TDPB 1FJ1A 1KGIA 4QXUL 1FL5B 3SDDB 2G30A 2UY7B 5MEOB 4XI5D 2RMNA 4QXGL 1Z5LA 3PWJA 5CD3A 2I07A 1JGIA 2F54E 2JJTA 2JQMA 3K5SA 3ZYOA 4MCNA 2W0FA 5AKRA 1I8LA 1H6UA 3OZLA 3QBTB 3FBKA 2XQBH 4YXLH 1JWMB 4KFMA 2ZUVA 3F7KA 1BQHB 3QCVL 2YJQA 5GS3A 1QFWI 2WQWA 1MHPL 2H2SD 1KNOB 1JHTB 1A64A 3LNHA 3MYJA 4NNPL 4PJDB 4BCYA 1NMBH 1Q9OA 5C0NC 2EEFA 1N6VA 4OGAC 4LLMA 5SWQB 5GRXG 1FG2B 3WIFB 1CD9B 3HHSB 4U6YB 1J5IA 3VGGA 4LBAA 1B9ZA 3CIQA 1JNHB 3CSPA 4KK5C 1CFSB 1YG9A 1VKXB 3DTXA 1KC5L 3PPEA 3KXFA 2VRKA 3GBEA 2JKJA 3CAFA 4DGIH 2G3XA 4FZEL 2AXHA 1HE8A 3N1FC 3H4HA 1MCSA 3X11B 4GRLB 1W0WB 1SYVB 2Y2YA 3GB7A 1KB3A 4Q4EA 5KSUA 3FF8A 4JKLA 5ICYB 3LEVL 5J1SC 1WZMA 4ZW8A 2DBLH 4QHMB 5D7KE 2G75B 4J8RA 2D2CC 2PNDA 4YSAA 4NQSB 4MQXC 5FW8A 1UOKA 1SYSA 4BA8A 1SEQH 4RMWA 3ILPA 5DJDA 1HH6A 3VFSA 4B9GA 5I1IL 1G0XA 5FA4A 5F70A 4RISH 3GI9L 3OB0K 5BZDB 5AVRB 2I24N 5GZND 2JK5A 5IBTH 1HJBC 3CZKA 3I75B 1HZKA 5KS9A 4GUOA 4JY6A 1I9RH 4FFZA 1D9KB 2EINB 3A6CH 4ZXBB 1SBBA 2QPUA 3FQXA 1KEGL 1F4WH 2CGRL 3V55A 4QRTB 3TVMA 4U3HA 1ZLSH 2CJUH 3O3DA 1OSZB 4Z7IA 3R18A 1DBMH 2WIIA 3ESUF 5HPOA 5I5MA 2E6QA 3ROLB 1KJVB 2RQEA 2Z92B 1ADQH 4AYMC 3GRWA 3CXHJ 3WG7B 2JXMB 3NZSA 2J6WA 4ZYKB 4DO4A 2EVFA 4LPYA 2F61A 4K3HA 2VABA 5L4FA 4PG9B 3QJHB 2QFPA 2A9AA 4P3CH 5GGQH 2VTFA 2OCFD 4CADB 5D1ZD 2M2DA 5IQ9B 1OB1B 3CDGA 2E46A 3BPNB 4R5XA 2VXSH 4DN3H 4A67A 2VLME 2CKBB 3O3EB 4FXLA 1AI1L 5TE7L 1KWGA 1P7QD 2BFVL 5T3XH 4XCYB 1MDTA 2JIXD 4R4BB 3DECA 4CJ0A 4BH8A 1RZGA 1E2WA 3DX6A 3B5TA 2OMYA 1KDIA 4FQHA 1YEKL 1BQRA 2VN6A 3K1DA 2JF1A 3DUSB 2ZUTA 1RK1B 4PGEB 4J3TA 3U0PB 4ALAC 2I69A 3KEHA 3L8QA 4PLJD 5HDLA 4AZ8B 3DYOA 3NK4A 1YNTA 4ZFOB 4WGKA 3BZEB 1BZ8A 2HFEB 1OT1A 1PIFA 1T0NB 1SVBA 1ZV5A 1C5CL 4PCKA 4WI5A 3U1PA 4AM0B 1JYNA 4E9VA 2BIQA 3MFGB 2JJWA 5DEFB 2BNRA 1YY9C 2EDJA 3CMOH 4R8WL 3X1NA 4HOZA 3FUDA 5GS0L 1O9ZA 3RNQB 3O6KH 1UUNA 3SDXE 3MODH 3D9AH 3MBEC 1OGAE 4N2EA 2B08A 2XN9D 3V4UH 5KVEH 2HKFH 2WBJD 4JZOA 3ZKND 5JQHC 4TSCL 1PY0A 5E51A 2GHZA 3POHA 4X7CC 4XMXA 4QRRB 1O7VA 4NFCA 2OYKA 4X4MA 1E90A 4JNXA 4L23A 5I1DB 1NEZA 2VLJD 1YZZA 2H2PD 5ALCH 4W93A 2RB8A 5IFAH 3PL6D 3MRCA 3OKNA 3QFJE 1U58A 1EXUA 5F9WB 1MCQA 1T6VN 2G9KA 5D96B 1LDSA 3WTYA 2FLMA 3QDHA 3LS4L 4JB9L 4DO6A 5EA0H 3T04D 4NN5B 3CLFL 2NY3B 2I32A 3FUJA 1QFOA 3S97C 3SE8L 3N6YA 1IGJA 2IH3A 3X13B 2TSAA 5EO1B 4WWOA 1X5JA 3JWDL 3MLWL 4Z3JA 2QKSA 3B43A 2I60H 2N7AA 4ZS6D 2CU9A 4M9OA 3T65A 1JMZA 1JVKA 2ADJB 5CILL 4HEPA 1YN7A 4OGXH 3ETTA 3EFDH 1KPUA 5I6PA 2EDXA 1DR9A 4QHLA 1SDYA 2GBTA 4WWKA 1LNUA 2VSCA 2W91A 4AG4H 4NERA 1WAAE 1ZLWH 1QI3A 3CFEB 4M6OH 3RTQB 4ACTA 1KELH 2E7HA 3LRSB 2H2SC 5FYKD 5EC1B 2VLRA 3DI3B 4BFJA 2V7HB 5DURD 5EIIB 2ZKMX 3BEWB 1K6QL 3QIBB 4M7LT 3ULSA 3C2AH 1CF8H 2UWEE 3OF6D 1OARH 1JGLL 1RZIB 1SN0A 2FSEA 3FB7A 4AVKA 1IKFH 4HGWA 1NL0H 2WTRA 3SGDI 4LGPB 3IPFA 4ZMZA 4V1DE 3RLSA 2DD8H 4W9CC 1YEWA 3ABGA 4Z76A 1R5WB 4LF3A 3ZXAC 4WNSA 3KJ6H 3IAPA 2W88A 3MRNB 3T2PA 3F58H 1TTCA 5DD1H 3ZIYA 4DUWA 3ZJAA 3MYJB 3GMPA 1NCGA 3IFOA 1BZOA 4PJ5A 1W9XA 4TXVB 1QZNA 4B50A 3E8UH 4GSDL 3WN5B 1H9DA 3DUUA 4A7TA 1XB6A 4GRMB 4LB8A 4JDZA 5FO7B 4FNPA 3VXME 1ZIBA 1H3XA 1NWPA 5FC9A 4M3JA 2X12A 3NT0A 1P4BH 4XN4A 5AQ0A 4JFFB 2YQGA 3Q2LA 1NC2D 2R1YA 3KXFB 1KPRA 4F57H 2ZWKA 4BKLA 1ETZA 2VISB 3VNZA 3STBA 4LCCB 4FMVA 5A16A 5GZNC 5E2TL 5G5DA 4R5TA 1N26A 3LQMA 2CXKA 2BOCA 4XGZB 2WKGA 2QPFA 3UTSA 4WF7A 1S5IH 2YMXL 3K2MC 3GS7A 3QUZD 4UTBH 5KSUB 5EWIH 2Z65C 3MUY1 4P59L 3HNVL 1TMQA 1QYGL 1U42A 1WICA 2DQTH 4N68A 1IC4H 3FRUB 4IRJA 5J6SA 4HF5L 2A1WL 3MC0A 4J8RB 4AL8C 2F8XC 1BFVH 2Y5TB 4ADGA 7FABL 4HZAA 3ILPB 3C5ZA 2A83A 1CL7H 1XD1A 1XCTA 2Y25A 3RWJB 5C6TH 1JHLH 2Q7YA 2WZPA 2R7EB 1TKWA 3BQUA 1DQIA 3KAAA 1WTGT 3R4RA 4CDGC 4NQEE 4ADJA 2ZYHA 3MGOB 2WPGA 3ES6B 32C2A 4H40A 3X14A 2R2HA 1ONQB 4NI3A 2FJGA 2FIRT 15C8L 3S35H 5F0JB 3CQFA 5D1ZC 3MYZA 4FYTA 5D6DA 4NNXB 4LGRB 1T1XA 3OJ2C 1E5AA 3K6OA 4PRHB 2J7LA 4UQEA 3O3DB 2PP9A 1XGPB 1RJZA 3BPCA 2WIIB 4JCMA 1TEGA 1MCWW 1VEMA 1ZVSA 4FYQA 1WZKA 2XYBA 2XY2A 1FC2D 1KBGH 2AQNA 3LNEA 4PG2C 3IXAB 4O58L 5ITBL 4GS7B 3Q8BA 3GBNL 2NW2A 4PLJC 3S88H 1KGUA 2VABB 1ZGLA 3QAQA 3QUYD 1B0RA 3L3DB 3RUGB 5A2FA 3QWRD 4YDLC 4QYOB 1BMWA 1ED3A 2J20A 4UILH 1KTBA 1A6TA 1NLDL 3MOQA 2V8LA 4GQ9H 4P5SA 1GGYA 1BAFL 2L7QA 3UACA 4GFXA 3IXTA 2VITA 3BGMB 5AL8A 1ZT7B 2X4RB 1E4XH 3Q1SL 1G4MA 3VX0A 1RZGB 5E56A 2O5YL 2WBJC 3GJFB 2OMYB 3CFMA 2XWDA 2YPVH 3H4FA 4LLDA 3ZKNC 2ZUUA 5C0CD 4YHYB 1NCNA 4PQXA 5KN5A 1NGQL 3CUPA 3GMLA 3SE9L 4NHUB 2FGWL 4JJ5A 4AE1A 4O00A 2H2PC 5K9JH 2V5SA 3PDDA 5EF3A 3DBXB 3E0GA 4HPYH 5IEHA 3QUMB 3PL6C 2IMMA 4N5UA 5DUMH 2BNRB 4BZ1H 4KZDH 1A7PH 3QDMB 4TNWF 1ACCA 3ZHNA 5CEZE 3QPKA 5HYJD 3VTMA 3Q8CA 3ZE0F 4ABQA 3AT9A 2CDFB 4X8JA 5HD8D 4P2OD 1R5IB 6TAAA 2O30A 1I7TB 3UZQA 1EEZA 5I17B 1INDH 4ZS6C 3IAGC 3H6JA 4MMZC 5EBWB 3ILDA 3N41F 4JAMB 3FBQA 2W60B 3V9EA 2LU7A 3CCHA 5DZOA 1H8OA 3KHQA 4TULH 5D55A 1W0VB 5FXCH 1P84J 3OHXC 4ONGL 3EOBB 3PWNA 4ATWA 2GFBB 3OKNB 5IIEB 4UV7H 1U58B 3IU4L 1EXUB 5HHNA 3IDYB 2KZWA 5HGBA 2VDRB 3GK8L 5CJBA 4F7TB 3NRQA 1PZ5B 3MUUA 1J8HB 4IBTA 4JRYB 4L4VD 5FX3A 1JGEA 4XZUB 4FG4A 1IGJB 2IH3B 1KEML 2CXGA 2G0LA 3EYQD 3UAAA 2RA1A 4WTZG 4D3CH 5JA9A 1RFDL 3LPOA 1DO5A 1FC1A 1RPQA 3CFKB 4O02L 4W6XB 3RX9A 3T4YB 3LIZH 3T65B 5B3SB 1TCRA 2GJ6D 2H45A 1ZLEA 4RX4D 4JKPH 2A6DA 2ZOTA 1YMMA 1R3IL 1Q94A 4JPWL 5I0WA 2VDOL 5C2BH 4UM8B 2B2XL 1KPUB 4L2YA 1KBKA 4NAMA 5C7ZA 5DJAB 3T6XA 1JPTH 2WV3A 2WJ5A 3REWA 2K8MA 1CIDA 2NXYD 4XH2B 2B1OA 3KPQB 5HHXL 2QQLH 4TLTA 5ECJE 3G6JE 5INDA 2PWGA 3IDUA 3RVTC 3HI5H 3SDAA 5FM5O 2CM6A 3MV7A 4P0DA 1GA2A 4Y2DA 1KCRL 1DJSA 4QF1B 3WO3B 1IGYB 2ENJA 1HHGB 2NPLX 5E2VH 3SDCA 1P5UA 4B9IA 4BV1A 4J3OG 2FSEB 2V3EA 5C9KA 2FJUB 1J9SA 5GJSL 1G7IA 4GIOA 4AKOA 3P54A 4Z7OF 1BQHG 1XH2A 3NACH 5JR1H 2IFFL 3QJOA 1X5HA 3NIFB 1S7SA 4JFOA 5KAQG 1EGJL 4Y4HB 2Q8AL 3U2IA 3Q0HA 1UYWH 2P26A 1BF2A 4E41B 1TQTA 2P5ED 3ALPA 2HMID 3GMPB 4K9JA 4CGUB 3QUZC 2LTQB 1FGNH 1ZVHA 4IOFC 1OEZW 5IROA 4LU5H 4NI6A 3DUUB 3C6SA 1YYML 5C0BA 3HZKA 2K7QA 3B9DA 2KDYA 5GSRB 5CSZA 5E1IA 2H7WA 1EAPB 2JKSA 3ROOB 3ARBB 3Q2NA 4AIZA 3OZ9H 2HPOA 3KWUA 3W3BA 2XN9E 5AVQB 4GAAA 1BVOA 1TIUA 5EV7A 3W39B 4XCEA 2MIZA 5TTRA 1QQDB 4K7PY 2HVJB 4A6YH 2BVPA 1LO5A 3OB0H 1DZBA 2VLJE 4ZO6A 3UTSB 3LHPH 1FNAA 2BNQE 3CJJA 3KLLA 4KV5F 1I4FA 2IV8A 4OCXL 4EDXB 1O6SA 3FUHA 2PKDA 1E8XA 3QIUA 1BEXA 3N85L 2GHWB 2CUIA 4QLWA 3LXAA 1R3HA 3ZE2F 2WUBH 2AF2A 1CZ8H 3BAKA 3C60D 4Q6IC 4QRQB 5A43C 1XCTB 1SUJA 4QRFA 4DETA 1HQRA 4X0KB 1U8NB 1DVUA 2QVFB 1JZ2A 4U1LA 2H1XA 1O5DT 4ZW6A 3RHWF 2VMEA 4XPBH 2X6VA 1VZHA 2IG2L 2B14A 3ARED 3CQPA 3N50A 4POUB 3MLSH 5BOZG 5AUMB 3HKZA 2R0ZL 3MRFA 5I9QC 2D3JA 3BWAB 4DPAX 4PJBB 2DW5A 4J3WA 1NCCH 2O6FA 4D9LH 4XPGL 4G70B 4PRPD 2QSCH 2RH0A 1SLWA 1FCGA 2K9FB 5FYKE 1Q72L 4IEFA 4KO5A 5CMAA 4KI1A 1A3QA 5EUOE 4QRPD 5LLIC 1A6VL 5E8EA 2GTZB 4BCZA 2P80A 3FFDB 4CU8A 5MEPA 2NW2B 1XO8A 4JO2L 3BUPA 4WZ9A 3GHBL 5C0GB 1ZGLB 4JZJB 2OFQA 1CDIA 2BSED 3OJMB 3M88A 5DWPA 4YXHL 1HXYB 4A2GA 4DZBA 4WW2A 5ISZA 1U95A 1ED3B 3QORB 3NPSC 4GBXA 1IAIM 3G6DL 2IH8A 3BEVA 1DHKA 5AOMA 4O2CA 1Z9MA 1BOGB 3SOBH 2VAAB 3GZPA 3ZDXE 5FO8A 3LB6D 1OCCB 2YAEA 3WKYA 1HVXA 3OMNB 2DZEA 2MNUA 5HD8C 2BP8B 3HAEB 2KT6A 4P2OC 1U2CA 1N4XL 4LLDB 4WTQA 5TQ2L 3W9EB 5ACZA 3DC0A 3GF8A 3M7FB 3UP1A 4C4UA 5T3ZD 3GSNL 25C8H 3CUPB 3GMLB 1JDAA 4JJ5B 3ULUL 4FFYH 1I8IB 1Q38A 4TQPA 3SYPA 4AYGA 4FABH 2YAFA 5IEHB 3VWKC 1XIWA 5GGVL 1TJMA 4DEWA 1T2XA 1PYWB 1AXIB 2FQFA 4XVSL 5FR3A 5IHLB 3RWEA 1E4XI 3GSOB 3O6ML 3UMTA 3V0JA 2X0WA 3B37A 4DCQA 3JVGA 1G5GA 4RMUA 3AU1A 4M1GL 5CBAA 1NBZA 3IE9A 3N2JA 5E8PB 1TFHA 3U4BL 5BVPH 1L6XA 3D18A 1QX1A 1AJ7L 4XBGA 5IMKA 5D2NE 3NEEA 4JKWA 3KW8A 1PJ9A 1UWEH 3D25B 3CC1A 1N2RB 5JHMA 1M6OB 2Q76B 1A7QL 1YQ2A 2NY4B 3GM0A 3C08L 4AY0A 1DQTA 1V54B 3ISRA 3QRFM 5PAZA 5MP6H 1FE8H 2O6PA 1V10A 4PJIA 2WWNA 4X6DF 5J5EA 4MXWH 2NXYC 3UJJL 3B6SA 1F45A 2VZOA 4L5FE 2NW3B 1FI8C 2OZ4A 4B9FA 2ZSVB 3FHAA 4JM2B 2WNWA 1GY1A 1Z3GL 4N0RA 4ODHH 5EHFA 2MCPL 1DLHB 2KZBA 2J71A 1XGUA 1ECZA 2HA1A 3QJTB 3CPLB 1U30A 3IDJB 1V7NH 1X44A 1F90H 5C7XL 2XZQH 2X6UA 1Q94B 1I7RB 4E9RA 4B9ZA 3DX8B 4D9RD 1TTRA 1KY7A 4J39A 4WW2F 2HAZA 5EIIG 3HLAB 4NCDA 3NCFB 3QRLA 3ZGHA 1AIFB 1Q0YL 4AITA 2WWKT 1RUAL 4J1UB 3RRQA 5D7LA 3PP3H 1F3RB 3MA7A 1PLBA 3BKML 3DXAA 1AS7A 1MHEB 3SDAB 4JPVH 1TVHA 3WIIL 1BG9A 1ANUA 3MV7B 2HMIC 4BD4A 1UB6A 4KK6D 1VGKB 2ZXWB 2Y36H 5FA3B 3VU1A 1HHIB 5J13B 4ODXB 3BPOB 2CJTA 5EO9A 1LILA 3TBVB 1DDHB 3IBOA 4NENA 5LDUA 4I18B 1NKGA 5CGYC 4L1DA 3ECBA 2H26A 1KZYA 1UOWA 4KNTA 5T1LD 5HPMB 4HWBL 1X5FA 35C8L 4X8CA 1K5NA 4PD4K 5IESH 4DH2A 3FSOA 5E0FA 1SOXA 4ZZFA 1B88A 4W4OA 2BNUA 2OCCB 1E4JA 1JVLA 2W9DL 5C0CE 3U30B 4LCIH 5C0RL 3FB5B 5IQLA 4F7CA 1G9MC 4KKAD 3TV3L 4ILDA 1Q0XH 2PCPB 2VQ4A 1KBWA 2ATPA 4OFIA 5K9KA 3M46A 4RRPM 3O3BA 4DK5A 5K39A 5JORA 1NCBL 2NY5C 3BVNB 4B27A 5IVNA 4G9FD 2UX6A 3C60C 3QUXA 3NJJA 4M7KL 3APCA 3GGWA 3NFSL 1G43A 1H15A 4K3GA 3KYAA 4XNXL 5JXAH 5MENA 1CYXA 4RDQF 5BJTB 5BS0E 1JK9A 5B8CB 2P8PA 3ZTNH 3D06A 3EZ8A 3VFRB 3APDA 2BVPB 1LO5B 2PABA 3EJYD 4TSAL 1WAEA 3AREC 4LLWA 1E40A 1A4KB 3PWLA 1I4FB 1W0YT 3VXTA 5KSVB 2XQYG 3ISYA 5IM7B 2XPYA 1V8HA 3L08A 3HHMA 4X50A 2D4DA 1LEKA 1I3RA 1OAYH 1R3HB 4I48A 5AZUA 3BUBA 4QYAA 3HC0B 4L4VE 2DQGH 1I7UA 1WFNA 4BQCA 4KX9A 3RWGA 3QP3A 1RZFH 3P2BA 4IGBA 1QBBA 3FTYA 3ZTJH 5JQIB 1GCFA 3LH2L 2VR8A 5B21A 1YNKL 1PGRB 2GJ6E 4U1LB 4ES8A 2XQBL 4YXLL 5M94B 1ERNA 1CK0H 4UU9A 3KDMA 4PRAB 5ETUB 2GI0A 1NLBH 2ADGA 5DMYA 3ZSTA 3IKCA 1I3GH 4QGYA 1NMBL 1T6BX 2WO3B 3OAYK 4QD2E 4K9EC 3H0TA 4CL7A 2DYPB 3LB6C 5EZLB 1IKNA 3HB3B 2ITEA 5CNHA 5DRWA 4IEFB 2CIIA 5KVGE 4NQCD 4KQ4H 1OOWA 1WFTA 4RMBA 3HS9A 3SO5A 1DN0B 4U6XA 2V2XB 3BSGA 2C8NA 4WW1A 3RWDA 3N1QC 4JRXA 4DGIL 1TZIB 4GI9A 3FC8A 4CKQA 2AC0A 1UVQB 4XN7A 4Y16B 4IBSA 2UUDK 4QHKJ 1CE6A 3H7BA 1BEYH 1AY1H 4BIKA 2AJ3A 3BEVB 4XCCH 2W65B 2H41A 1WTLA 2C1OB 1JZIA 1F3DH 1P4LB 2DBLL 2HG5B 2P5EE 4D7BA 2Y2WA 3IRZA 1K2DB 5D5MF 1WWCA 2NOYA 5KOVC 1SEQL 1I9JH 2W59A 2XN1A 2YHGA 4LXFA 1FZJB 4CC4C 4JR9H 4OZHA 4EN3B 1SZNA 1U21A 5C3LD 1NGWB 3C8KA 4HCFA 4QOKE 5F7LB 2ESVE 1S4IA 1QRNA 2TRYA 5IBTL 5SWSB 3G5ZB 5AVZB 4PH8A 3MR9A 4HD9A 1NMCB 4JQVA 5BZWB 3HIZA 4YDMA 1HX0A 1KGYE 3D51A 2Q6WB 4A1RA 1I9RL 2QLVB 2WYIA 3EXJA 4MWFB 3ZE1B 1WYJA 1U3HB 3A6CL 3CVDA 4MA3B 4QHKI 3LH9A 5SX4H 4DCQB 1CFTB 5CBAB 2AEWA 2X4UA 1ZLSL 2CJUL 4N2BA 1T89C 3MCYA 1DBML 5IMKB 2J73A 2CPCA 2XTJC 4DP1X 1K85A 4FLOA 1UQSB 1ADQL 2FDBP 1A1MB 1XMEB 4XCNA 5KSAC 3QJZA 1LO3H 3GZOA 3MGAA 5FHBH 3OHMB 4OKVB 1RLWA 1SXAA 4OZGA 3SPVB 2AK1H 3DTDA 1EXHA 3BWUF 1XB8A 1OWWA 2F53D 2ORBH 4MNHA 4TS6A 4P3CL 5GGQL 1NDGB 1RZPA 1E65A 1KIUA 3B6SB 4PJCF 3ZL1A 2NY2B 4KK8D 2VXSL 4JY4B 1EA9C 4DN3L 5KSBE 1SBSH 4ANWA 3T2NH 3EGSB 4KPHL 3V6FB 5I71C 5B39A 5A2BA 2O6DA 5HGHB 2C1PB 3VI4B 3LS5H 1EEYB 1SOKA 2C3VB 3OD3A 1CDUA 2MEJB 2UY6A 3GS0A 4KK6C 2YSTA 4RGMC 3RBSA 1FL6B 4LRIC 5C08B 1N9PA 1NM4A 4Q0XL 4LSDA 3QEQB 1ZVYA 2ZKYA 3ZX1A 4WFFE 5DC2A 5I1GH 1I8KA 2HJKA 2E75C 1EVTC 4PRPE 1DQMH 5TK2A 1G6RB 3C5JA 2F7OA 4LSPH 4NKQB 2OMUB 3SJVD 2WO2B 3V0WH 3CSYA 3N0PB 6FABL 4CSTA 3CMOL 4JKKA 1U8JB 2EC9U 4W9GC 3VWJB 1NFDA 3L45A 5DUBB 1A7NH 1S8DA 3D9AL 2XKNB 3MODL 3RKPA 4AWJC 4DVRH 3PWUA 1TZHB 3V4UL 4P9ML 2HKFL 2JH2A 5KVEL 4GG8A 3IEAA 4HPOH 3BUQA 3SCMD 3NUKA 3D69B 2XWTA 2FO4B 5CZVH 3JTSA 4XMZA 1HWGB 5HDBF 5ALCL 5IFAL 3BDYH 3VRIB 4GP5B 4EIZC 1TZOA 2BIPA 1EUUA 2YRPA 4MNQD 4Z7UB 5FW6A 5TE6L 4L3EA 3U2SA 5T3ZE 4DGUA 4JPIA 5EA0L 3KL5A 5CINL 2DLFH 3EJYC 3KWWA 2MOVA 4JDEB 4NZRL 1KYDA 2DS4A 3O3BB 3IMSA 1AGDA 4S1RH 5LAPA 5JXED 1C16B 1A9BA 2J88H 4K94H 1E9OB 4K3EH 4IKJA 4L1TA 2I60L 1MEXH 1BZEA 4KZ0A 3K6SA 4FTVE 2DJMA 4ELMA 1Z5HA 1HDMA 4OSUH 1X5ZA 4NM4H 3S5YA 2Y7QA 1DVSA 1V27A 3GSRA 5MENB 1JIBA 5DEZA 3IMTA 2Z7UA 2FWOA 1QABA 1MHHA 3P3SA 4UB0H 1JK9B 2MTPA 2P8PB 4ZPVB 4AG4L 2NUPA 2F54A 4HJIA 1KELL 2JV6A 4ZI8A 3VI3B 1EPFA 3FKUS 3PIQA 2GSIB 4R6UA 3VXTB 2OQJA 3UBGA 3C2AL 1CF8L 4LHUA 2W0KA 4KJYA 4WFEE 4ZUWA 5I8EA 3K71B 5CAYB 4OB5H 1OARL 1BF8A 2F68X 1I3RB 4I48B 1IKFL 1P84K 1NL0L 2DAVA 2KZ1B 3KGUA 3MLYL 3M86A 1I7UB 2VMFA 3RPBA 2XN2A 4N86A 1TPXC 4JHVA 1JERA 1EFQA 3CFCL 1NUGA 4MZIA 2DD8L 4MB4A 2XTJE 5DMIH 1NGPH 3KJ6L 1QSFD 1SM3H 1FN4B 1IBDA 1R24A 5C09D 3ARSA 3QNFA 5HHME 4KKQA 3F58L 5DD1L 2ADGB 4HD5A 2IAMD 3IKCB 4HS6A 2KH2B 3GLEA 5ICXB 3BN3B 1F8TH 3E8UL 1NDMA 1DDTA 4N2CA 4AT6A 4HEME 2G5BB 1JSYA 4RLDA 2Y7OA 5DRWB 5DGQA 1LGVA 4Z7WB 1JZ3A 2BINA 4Z77A 4R97B 1P4BL 2BWDA 3SE6A 4YVNA 4UT6L 4F57L 4BELD 1DCEA 1J9QA 4ISVA 5EDSA 5MERA 4JRXB 2VT0A 4ZO8A 5D7IE 1CFMA 1MN4A 3T3MB 1T0MA 3ZQXA 3DV6A 4KUZH 1CFNA 4JFUA 1F3DJ 2CLRB 5AKSA 3HAEG 4PJGF 5IHZB 3ZDZF 4G9DA 4UTBL 3T6WA 5EWIL 1PZDA 1N68A 4V2BA 1M3JA 1EEUA 4QXVA 4HC1H 4L9DA 3RVWC 4OI9A 3T3PE 2DQTL 3BH9A 1P1ZB 1IC4L 3KE0A 3HBQA 4UDUA 1LD9A 3JQOB 2IGTA 1IAKA 4ZW3A 3FQTA 1BFVL 3SHSA 4LKCA 3VSQA 2AABH 1CIUA 5HYEA 4NNYA 1CL7L 1SJEA 4NO2B 4P2CG 5C6TL 2BIOA 4WFHD 1QTSA 1JHLL 4NQCE 4ODUA 3IWVA 1ETJA 4GJTB 1OP3K 3WO4C 1CURA 2JLPA 3ESNA 4IMLA 4L1LA 1TU2A 3KPMA 2FBJH 1L3NA 1S5HB 3S35L 4U7KA 2XU9A 4KK8C 4AGOA 1KTDA 4RWYH 5FLUA 1KGXA 4X4YA 3DHUA 4U3CA 1DJXA 2D4FA 3BOVA 2NCMA 2C3WA 4FHJA 1DVFA 4P46A 5F1IA 2A5UA 5CEXA 1CGVA 1BG1A 4O2FB 1KBGL 4XCNB 1N59A 5CIPH 1S3KH 2M1KA 4J6RH 4R96A 1QBMH 3SQBA 4P5MB 3RFZB 1D5XB 3AG2B 4BZ2H 3GZKA 4AQ8C 4F9LC 2EXYD 3S88L 3EYFB 2M8XA 5E8OB 5EH1A 1KJ2H 5GGTA 3U7AA 4OQ1A 1WBZA 4GQ9L 2OP4H 4Y89A 4OFDA 2IO5A 5BUPA 4NCC1 4OF7A 1DP0A 5BOPA 5B39B 1AKJD 1KTCA 3K3QA 3U4AA 1E4XL 3OWRA 1IT9H 4B9KC 4FI8A 4WWID 2BHFA 2YPVL 2EJ1A 3I74A 5F96L 3SCMC 1N8ZB 4JM4H 2EDOA 2H3NA 3HCVB 5ADPH 3SDXA 1DVZA 1T6WA 1SXNA 3ARVA 4JY5H 5K9JL 1OGAA 5H8DA 4HPYL 2F5AH 2H32H 1I9IH 3NIDF 5DUML 3CU1A 1T21B 4EUPH 3CH8A 4BZ1L 4F8OA 3NJXA 5AW4B 3Q6FB 4KZDL 3FCSA 1A7PL 2B0SH 2ZUXA 3RX8A 3TN0A 3PWUB 3QFJA 4LCYB 4OZ4B 1M71A 1INDL 5CU9A 4Y4KD 2CK2A 2HVKB 3VD1A 1JFQH 1VFUA 4X5LA 3ULAB 3V8OA 4U49A 4DP5X 3VQ1C 1PL3A 4LSTH 5H94A 3BSHA 4ZS7H 1Q1JL 3LNDA 1O6TA 1YPZB 4UV7L 3WKNA 2AGJH 4DKEH 1NBYA 3U2SB 4YDVA 5I1KH 3LKSB 2HLEB 3D4GA 4KOCA 4AQ1A 5JHDD 3HPLA 1IAII 3HE7D 3AG3B 3NQKA 4OD3L 4XMKH 1IM3B 3PGDA 1PKQE 4HSCX 1ZCRA 1AGDB 4JVWA 4RFEA 4D3CL 3OKMB 4OCMC 1OGTA 4LIQH 3LEXA 3BZ4A 1JF5A 3LIZL 1WAAA 3FSAA 3BIBX 2GC4C 4JKPL 5HHOD 4LRNH 4DQOH 5I8CA 3SBQA 3F6IA 3W5NA 4F1ZA 2IXQB 1F4XH 2OW6A 3C6LD 2NYKA 3HZVA 3K7UA 1A5FH 1CG9B 1DEDA 2J43A 2L7UA 3AFLA 3TA3B 1A4CA 2UWEA 1HL9A 3PE9A 2VR9A 5F8QC 4K3DL 1DTUA 2QQLL 1M05A 1WZLA 2NUPB 2ZJSL 2K9UA 5DVKA 1MUJB 3BAXA 1NZRA 3Q1EA 3BZ5A 4I3RH 4PV1C 4PY7B 4V1DA 1Z9SB 4YFLI 4TVPE 2ED6A 1YHPA 5E2VL 5I8EB 3NFPA 2CBTA 4MD0A 3V4VA 4PJ7E 2A9BA 4W4NA 4W68A 3QFDA 1EHXA 4M7ZC 5LWYL 3NACL 5JR1L 4LAJH 4NUGH 1URZA 3LVEA 3B7TA 2WTPA 2D73A 1UYWL 3DV4B 3VXMA 4JPKH 1IEAB 4HP5A 4LQ1A 1HHJA 4PJHB 5DUPH 3MV9B 4MQ7A 2X88A 4WUUE 4PLKD 5FO9B 3HVDA 3HG4A 1NDMB 2AXFA 4LU5L 1X9UA 5DZNA 4N22A 1Z9PA 3HI6H 4HXBH 2YPKB 3EDEA 1L9PA 2FJSA 4CILA 2QPSA 4G83A 3RGVD 3AXLA 4N0UB 3DMMD 4OJDH 1JZ4A 1HT6A 3OZ9L 1RPUA 1X6NA 1INQA 3ZT6A 3BGFC 3GSUA 4AW4A 5EIQA 4L3CA 4L8DB 2VN7A 2ADIB 4H0IA 3ZO0A 4FQCH 5E8NA 1HL5A 1NIAA 4FFZH 3WS6C 3DV6B 3D2UA 1UT1A 2C9AA 4LQFH 4MJHA 5E6RB 4RMRA 4A6YL 4N90E 3BN9D 3LHPL 4G9DB 1G9NC 1XGZA 1KCUH 3QQ3A 4G8FA 4UINH 4WHDA 5DYOA 1E6OH 5ECGA 1U8MA 1F41A 3QDGD 2LW3A 3F5WB 4WI4A 1OHZA 5E7FA 2X89D 4NQEA 4UDUB 5I6XB 2CR0A 3GRWH 3BIAX 2EC9T 4LKCB 3RGHA 1AH1A 2WUBL 2XXGA 4EQ2A 1CZ8L 3SGKC 4R9HA 4C59B 2OJEB 4R2GB 4YGAB 1GGCH 4XMPL 3LZPA 5EEXA 3NH7H 1IZKA 1ZPUA 1G7PB 2BDNL 2EXYC 4BM7A 5KVMC 4IMLB 4XPBL 1S9WA 1TU2B 1HH9B 3MO1A 4NQTA 3EIFA 5GS0D 3MLSL 3A6OA 5IUSA 3ZKSD 3B1TA 4IRSD 5AKTA 3MLXH 4AX3A 4UM9D 4X4YB 5DHMC 4I5BA 4LVOB 4D9LL 5A2AA 3GMMA 1EERB 2NLJA 1Y7VA 5EOCH 4X6BA 5EO0B 4W6WB 2QSCL 4KKLD 3GKZA 1MY7A 4IIQC 4WRLA 1YJDC 3FT2B 3MJ7A 2B8OT 4IHBA 1XEUA 4NKDA 3P3UA 1KXHA 2JQAA 3GBMH 4C4BA 3VXOA 4LHQB 1OAQH 5I8KH 4ZFGH 1BPLB 4ONOA 3WDJA 2KQMA 1VCBC 1HL4A 3LZQA 3EYOA 5FF6A 1PY9A 3QDAA 1MCFA 3DETC 3JWOC 1TNNA 2LGNA 2Z7ZA 5DJ8A 2QMKA 5F88B 2B77A 5IQOA 1FSKB 1MCHA 1BM3H 3WNOA 4OUUA 4YEFA 1ETA1 2FBRA 3GXTA 4I4WA 5E2UH 3S2AA 3QWOA 1VGEH 1H8LA 3K74B 2OL3A 1NC4B 4PGBA 3ZGIA 1QSFE 5EZOH 5LCVH 5C09E 1UHVA 4PJFB 5LN4A 4CMMB 5J11C 1RIHH 3X2QB 4U1KB 2AV7B 3DRQB 3P4LA 1S9XA 2EDTA 4P2QD 3WKQA 1G6VK 3ZSSA 2E4FA 2GBAA 3VMPA 2H3NB 5ALBH 4NFDA 2WXPA 25C8L 2VJ8A 4WGWB 3EO1A 2FIKB 1FVEB 2IBZX 2RQ8A 2AI0H 3BLBA 3VUAA 4FABL 3VB9A 3J27A 2VDML 3A4DA 1CDCA 1NAKH 3VW3H 2GUYA 2R1XA 1WFMA 4RA0C 5IJVB 1CTMA 3HE7C 4AXWA 2X3AA 4YBQD 5F9DC 2WXHA 5BVPL 4DERA 4G72B 3U7WH 1R4XA 1EAJA 1UWEL 1S9VB 3UADA 1QSEB 1U8KA 4LLYB 5BVJA 4QRAA 2CBOA 3LKOB 1DUZB 4UTAA 5GZNA 3T1FB 4IW4C 5MP6L 3C6LC 1FE8L 5LG1A 5BZXA 1KV7A 4QWWC 5ACMA 1VEPA 4UCFA 1NBYB 1WCQA 3NJIA 1KXQE 2ZX8A 5FYLD 3L4WA 4WFHE 2F7IA 3DNKA 3V6ZA 3FUNA 1D5ZA 4OQTA 2X44D 1T7VA 3PGDB 2OX5A 3DA0A 3F3HA 3FPXA 5KBMA 3S8FB 3LKRB 1G7HA 4ODHL 4JQIA 4NUQA 4N85A 1NM9A 1D6VH 3B8YA 1ZHKA 4I87A 1V7NL 1F90L 3IGLA 3G6JA 2XZQL 2F9BT 1AFVL 3N44F 4LVNB 1E7UA 5HVGB 1QLEL 2GPZA 3ARZA 4PJXE 5LHDA 3T0DA 3HZVB 2GJJA 4UV4H 4UYPA 2P5WD 1TSRA 1T20B 1FLTX 3P11H 5D1ZA 4JZNB 4OLYL 1EEQA 3SE4C 1GL4B 4N8VA 1PZ2A 4UOZA 4L18A 5E9AA 4XOEA 1JPST 2ITCA 5KYXA 4XNAA 1P7QA 4HH8A 5JIDA 4JPVL 3ILEA 1EJ8A 2WXNA 4AC4A 2LQRA 4PLKC 5JO5A 3L3IB 2YO3A 2Y36L 4LSUH 2RACA 3NFPB 4KHXH 4PG2A 2VC2H 5B3NA 4P05A 3LY6A 3PFQA 4W9EC 1B9KA 3RZCB 1MRCH 1ZAGA 3V7AE 1U41A 1O75A 3DMMC 4EN2A 1L5GB 5KW9H 4PJ9D 5IESL 1QSVA 2MHAA 4HCIA 1TZ8A 1A9EB 1QR1B 3R0NA 3NESA 1HHJB 1ROCA 3BN9C 3C9NB 5IR1B 4G6FB 2GJZB 4HUWB 2XN9A 2HFTA 3PV6A 5ITFA 5GISH 4XO8A 3EO9L 3T8XA 3NBNA 5J6GB 4OM0H 2WBKA 1T0OA 4KJPC 2DWXA 2GT9B 1FFNB 1FIEA 1YEDB 2DJSA 2VLJA 4HK0B 1XF3A 2OPCA 2BNQA 3LCYA 4J2XA 1BQLH 4QKTA 3PL6A 4BFOA 4L3CB 3HS0C 3HN8A 5I0VA 5JXAL 2JCCB 1IZJA 1OE3A 4C8XA 1CI3M 1HU8A 4P57A 1AC0A 2EQDA 2X5PA 3GO1L 3CBRA 3QCTH 3ZTNL 5B38G 4YQXH 3KVDD 1VHPA 7CGTA 5LGJA 3QQ3B 3MBEB 1OP3H 3QRGL 4JRLA 5DYOB 5JHAA 4IRSC 1AHWB 3PXHA 2JNZA 3BP4A 1HC1A 4HIXH 4DP4X 3ZTJG 1TYEB 4ODBD 3VFUB 2CJSA 3VYNA 3F7LA 5DLMH 2BFGA 4MMZA 3UAEA 3ELQA 4DGWC 5BV7B 4FADA 3KLQA 1MCPH 1OAYL 4KKLC 5JHDE 2DBJA 3WAJA 3CTTA 1IAOA 4U1IA 4YSPA 2DQGL 3OHXA 1A2YB 3FOMA 4U1SB 1RZFL 3LPWA 1MWOA 2X2HA 3SKUD 4I13B 3HG3A 5BW7C 3QXDB 3MNVA 3MRGA 1MCLA 4X2UA 2BVYA 1