1UUPA

Crystal structure of a dimeric form of streptococcal pyrogenic exotoxin a (spea1).
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
221
structure length
221
Chain Sequence
QQDPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYLTDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDSNTSQIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EXOTOXIN TYPE A
publication title Crystal Structure of a Dimeric Form of Streptococcal Pyrogenic Exotoxin a (Spea1)
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Toxin
total genus 58
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1uupA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1uupA02
4BWGB 2IPKD 1LTSD 4Z9CB 1F77A 1BCPB 1PRTD 1T5XD 4RGTA 5FKAC 1DYQA 3BVGA 2NTTA 1TS4A 2NTSA 5FK9C 1SXTA 5D3IB 1FNVA 2WV6D 1TY0A 4RGMA 1RCVD 1D6EC 1PTOD 3BYYB 1BCPF 3GP7A 4RFBA 1RF2D 1KLGD 1EWCA 4O1NA 1LTBD 3MFGA 4RH6A 1LO5D 1PRTC 2QEJC 5I4DA 1TS5A 1HQRD 4K6LA 1LTRD 5ELBA 4DXFA 1G8ZD 1FNWA 2IJ0A 1BCPC 1S5ED 1M4VA 1MD2D 3V05A 2AQ3B 1GOZA 3DWQA 1LT4D 1PRTB 1STEA 2RDHA 1JR0D 1LT6D 3R2TA 5TSSA 2AQ2B 1BXTA 1PTOC 1AN8A 1LTID 1PZJD 5ELEA 1D5MC 2RDGA 1KTKA 1LT5D 1PTOB 1CQVA 4TSSA 3MC0B 1RD9D 1PRTF 1EEFD 1I4HA 1S5CD 1UNSA 2G9HD 1CHPD 1S5FD 2O2LD 3W2DA 3R8BA 1SE3A 1S5BD 1AW7A 1EEID 1JWSD 3BVZA 4RHSA 2CHBD 1I4PA 1PTOF 1FD7D 1CK1A 1DJRD 1ESFA 1TS3A 1RDPD 1JCKB 1SE4A 4UDUC 1SJHD 5D3DA 1LLRD 1D5XC 4C56C 1I4XA 1TS2A 1SJED 2XN9C 3DWAA 4L63B 1B1ZA 4ZYSA 3CHBD 1HA5A 1HXYD 1S5DD 1FNUA 1PTOH 3EFXD 1B44D 4RGNA 4RGOS 1V1PB 2QILA 1I4QA 1YN5A 1PZID 2XNAC 3R2IA 5ELFA 3SEBA 1LTAD 3URYA 4L6TB 3KLSX 4NZLB 3TSSA 4RCOA 1YN3A 1V1PA 1I4RA 3OWEB 3BYTB 1HTLD 1I4GA 1LTTD 2R61A 2XRQD 1ET9A 1JWUD 5ELDA 1D5ZC 4DXGA 3BZDB 1BCPD 1XXGA 1LTGD 1UUPA 1JWMD 1KLUD 1L0XB 1L0YB 2SEBD 3BVMA 4RHRA 1EU4A 1QILA 1XTCD 1CHQD 1EU3A 2J4XA 2XRSD 3O13A 1CT1D 1SEBD 1V1OA 2Z8LA 3DWPA 2ICIA 4OHJA 1PYWD 1EFID 1JQYD 2AQ1B 3EA6A 1ENFA 1TY2A 1PZKD 1YN4A 1SE2A 1ET6A 1FGBD 2TSSA 1LT3D 5ELCA 1SBBB
chains in the Genus database with same CATH superfamily
1I6HH 3VTWA 2MBHA 3V61A 1PH8A 5CV7A 1DONA 5IODA 2NVUI 1HCZA 1WTXA 2BE5C 4C3HG 3AE9B 5T1IA 1WTVA 5KNBA 3QCAA 2Y5BB 2QA4A 1N32Q 1CTMA 2C35B 2MEKA 1IBKQ 4LJZC 2JYEA 4KD4A 3LX0A 3ONAB 1UWXA 2N1VA 3KH0A 4GKKL 1SYDA 3T1YL 1WCMG 1SIFA 3APDA 4OVUA 1K8AC 3NE5B 4XGAB 3NXWA 1MI2A 2F0OA 3VYRA 1GO3E 4M8AA 1AP0A 1SR3A 5IOIA 2R3ZA 1JOKA 2WFWA 1DOMA 3W3AA 3SK4A 4JI1Q 1FXIA 4DK0A 4WJWA 5IWAL 2MBQA 4HCEA 4KDIC 3GTGB 1B9NA 1NUCA 5D94A 1LACA 3I4OA 2B2UA 2P5ZX 1WI0A 2ZJQA 3ZQ4A 4R4QA 3LWEA 1A2TA 1GKHA 2ZJDA 1M8AA 2MHJA 1WTHA 4OO1H 3ZNZB 3MC0B 4DK1A 3CAMA 2G4DB 2XWBB 4WJPA 1BDOA 2N0SB 4GLAC 3V6CB 3EJIA 4NQKE 4OVZA 2UUCL 4OONA 4UY8C 4HCPB 1A2UA 3S24A 5GAEC 4B3ML 1LM0A 2E2IB 2KENA 4HDQA 1IBKL 2A6HC 3TP8A 5KRUA 4JI2L 3DEOA 3M95A 3S15B 2L1AA 4A3MG 2PVOD 3HRDD 4EZJA 2SNSA 4BXXH 4A3GG 1O80A 1SJED 2WXMA 3T4AC 4UP9A 1VQKA 1HTPA 3HOWB 2QW7A 2EY1A 1UGMA 2OTLA 1B3QA 1F9SA 2R7FA 4KKUA 5G55A 1H9MA 5HG2A 3B0AA 4P6VF 1EM7A 3QOJA 1I4QA 1WOCA 3VUYA 1YN5A 1PZID 3EQLC 1OEYA 5E6OA 4DHJD 1VQ7A 1BBUA 2JRIB 1S72A 4G57A 4KY7A 2V3PA 1DM0B 4G7OC 4I6NB 4NY0A 2Z0DB 5E6PA 1EOVA 2KZRA 5L83A 1JC7A 3G7LA 2WXQA 2PW7A 1Y8OB 1XNQQ 1LM8B 1QQRA 2L00B 3A4SC 1AYFA 4W9CA 4XIGS 3I56A 3CCUA 5E1FA 2PEAA 3QC8B 5CHWA 3S2AA 1Q10A 3RZFA 1MVKA 4NJCA 4RM8A 2DLBA 1D5ZC 2NBFA 2AUJD 4H02A 3ZJTA 2F1MA 1NR2A 3D0FA 4IUPA 4DK3C 3A7LA 4B0EA 4GLXA 4XQNA 2KMCA 2MP2A 4K2LA 2BQQA 3WOFA 4BBRH 5AZHA 1PYWD 1X56A 2BOSA 4V0BA 2GI9A 4IPGA 1J5EL 4OEMB 3CWIA 1UE6A 3TMEA 3CKIB 4GNXB 5J2RA 3GD7A 4DN4M 4AS1A 1WD1A 3ONSA 4DR5Q 3CCEA 1HH2P 4R4OA 3ZLZA 2F0UA 4C4VA 3C8YA 3I2ZA 2CHZA 3DHQA 3M4PA 1N34L 2BW2A 1BCPB 3Q24A 2GOWA 1PRTD 4APVA 4Q5VA 2K0PA 2LUMA 2V1CC 2M1MA 4GDLB 4GU2A 3R7QA 5E6JA 4CBVA 3P4SB 1EY6A 5CTRC 2WXPA 2ZEQA 2C5LC 3TBLD 1TY0A 4YWKA 4DNRB 5CHVC 3I9V1 2ZPNA 1VMPA 4CGYB 1SSOA 3GDEA 4I65A 4X3SA 1CSPA 2L11A 5CV5A 1SNDA 2YEPF 3ZJUA 5CGKA 4TV3A 4J8QA 2N9EB 4XZ4A 2DZIA 4YSZB 3NVYA 2EXDA 3FILB 2PNRC 4C2MB 3M3YB 4K7SA 5A35A 2RSOA 1GG3A 3ECIA 3U4EG 4LMQD 2ZCBA 1F9QA 5D2MB 1CZWA 2PYKA 1STEA 1RKNA 3KUPA 4DPGA 4K0KL 5TSSA 3KVFB 3LYYA 1L0WA 2MO1A 3QHTA 1Z2MA 2MFIA 1B4OA 4II3B 2L0TA 5IP9H 3IT6B 1DOXA 3NP8A 3K59A 3HOWG 4G3XB 3WIMA 1P16A 4RKLA 2L1BA 3UQBA 2PTLA 3HZXA 3TMPB 3CCSA 3RNAC 5BR8Q 1U5KA 1YHAA 1C4CA 3N1YC 2N7JA 4HVBA 2BB5A 1R4NB 5JAVA 1WJNA 2WXLA 4K6DA 4BY1H 1STAA 1ZEQX 3OIPA 1EYGA 3UI3A 1YNXA 4B0MA 1SYEA 5F2DA 3VAWA 2EJGC 1ICFB 2K6AA 1AW7A 1YNJD 2CVRA 4GB9A 4RHSA 4PV1C 4JE3B 3V6EB 1P9DU 4IPDA 3S1NB 2Y0SE 2K28A 1TS3A 1F2YA 3BG3A 4IUMB 2LI5A 1BR9A 3KJPA 3AE7B 1TWGB 5JJLA 4OW0A 1XWEA 1NSNS 3ZDTA 3PS6A 3QG1A 3SD5A 2B2YC 4HJ9A 5KEEA 1I42A 4C3HH 1VQOA 4ZUJA 4KLKA 4KKTA 1S5DD 1T0QC 3HHMA 2N88A 3K9OB 3PHXB 4DR3L 1IL2A 1FFVA 3K8AA 1TVXA 2G5DA 4A3IB 1E7PB 1WCMH 1O7LA 1N62A 1E8YA 2M00A 1A8VA 2EYMA 2EE1A 3B9JA 4I6PA 1WJUA 1ZPSA 4YHHQ 1GD7A 2ZTCA 4J3OD 2KCCA 4A3JB 4BVUC 4E71A 3CCMA 2JSOA 2F0FA 1VQ9A 2WAQE 4P71A 4PZ6A 4B9KA 2LKVA 3KF6A 5ELDA 1AH9A 2WXOA 2WXKA 3GB1A 2VQFQ 3FRPB 4ME5A 3R66C 5C5MA 5IP7G 5DPRA 2WKCA 2SEBD 3BVMA 4DV0Q 2LFIA 4GNXC 4OZCA 4FYDA 1NTGA 2UU7A 4JLCA 1SEBD 3DWPA 3TZUA 2CQOA 3SR1A 1G6PA 5AFWA 1MFWA 5FR3A 1EFID 3B6YA 3EA6A 4QF4A 1OO9B 4AIMA 1XYIA 2F0QA 2IGHA 3HOXG 5C4JH 2JY6A 1D2BA 2NVQH 3GTLB 4LK1C 1JJGA 3AE6B 3GTJH 4JI7L 4JPSA 2L0CA 2CH4A 3NK9A 4HJ5A 4IFDG 4ZLTF 2NCNA 1ICWA 2M17A 4A3MH 3OPOA 5LMNQ 3EUB2 4N6EB 2JA9A 1B8AA 4USAA 4A3GH 2NVTH 2JJQA 1DGJA 2B3GA 3EVQA 1N6ZA 4JWSC 1B3AA 4IPHA 4ZHOA 4LFAL 1FNVA 5I9OA 2IY5B 3HKSA 3A4RA 2E5LL 3TIXA 3CMAA 2CU1A 2PQEA 1XQQA 2HTHA 1X32A 2N9KA 4CJ2C 3K80C 3HVDA 3PZDA 2EMSA 2NVXB 3LJ3A 3NS1A 2B2WC 1VJKA 3N6RA 5GADC 3M62B 5T8IA 1N5WA 4M01A 5JZEB 2MQHA 2VXWA 1TU2B 2ZTEA 1RM6C 2KWCA 3DBHB 3RI7C 5IT9L 3S1RB 1CUKA 1K9MC 4NXMQ 2JX5A 1JR0D 3QIAA 4FF1A 1H95A 4LAAA 4NPSA 4HKZE 4N58A 2UWQA 2DJGC 4ZQ3A 1N60A 3Q0AA 1UWMA 2MJ3A 3RMHA 2DZJA 2F0JA 3CCQA 2A6HD 5KNCA 5JH5C 1RD9D 2SOBA 3CRKC 1QOBA 4RF0A 4FADA 1F0ZA 1PXUA 2KQ7A 1Q7YC 2VH1A 3K5NA 3F2DA 2YVCA 3J9CA 2MCNB 4OWTB 4EE2A 1II3A 4DNIA 1IZ6A 1BNZA 3BWUD 3H7PB 1H9RA 3E3XA 4WURA 5DPTA 3TP7A 2FAZA 1B9MA 1TQOA 4FF4A 3B08A 3AEEB 3ER0A 1VQ4A 4A3JG 1HR0Q 3MJ5A 1MKHA 1SE4A 2RMMA 1C4AA 1HHVA 4AQ7A 2E8GA 2M2LA 3PMFA 4HTHA 3SK6A 5M9OA 2KYWA 2MJEA 3I7FA 4RMAA 1I4XA 1XX8A 3KYHC 3FMCA 4KJNA 2KA7A 2XN9C 4KMUC 2Q8IB 1PH2A 3AEAB 3VVWB 3S2HH 4ANVA 2W3RA 1GUAB 4LNKA 3VYSA 3UGBB 2J0KA 3SHQA 2Z6KC 3BDCA 4RGNA 4FF3A 1KJTA 2FFKB 3A9JA 4R4CA 2JSVX 4OIKA 3CMMB 4NAWB 2NN6G 4RF1A 4AQYL 3UDIA 1N36Q 2WXGA 3QX1A 4PS3A 5HHDG 4GN1A 3FKYA 2W9NA 3NG0A 2KFKB 3RNUA 4QIWE 1UGJA 2B2YA 1YN3A 2MH7A 4ABNA 1PDXA 2E2IH 3OWEB 2KVRA 4PYUA 1EZ6A 3DEPA 3S15H 4IWPA 4KZCA 2CQAA 4TQ1A 1V9JA 4ANWA 3TZDA 4FBJB 2VUMB 1C4QA 4IFDI 4KN4C 4F8MA 3KLSA 1JWUD 2KJHB 3PF5A 1X6OA 4M02A 3QO2A 3HOWH 4XXEA 1WTQA 3RZWC 2UXDQ 1LTGD 2W54A 3RZDB 1I3QB 3M4QA 1EF1A 2VZAA 5FLXE 2BKFA 2ON8A 5EJWA 2RA4A 4HJAA 1ENAA 1TR5A 1R4NI 2A69C 3DWMA 2Z0EB 3I4LA 2OWOA 2XTIA 4JBWA 1MHXA 2V0GA 3IT4B 4KHVA 3X23A 1V6EA 3GZNI 2FCSA 2OXPA 5DPSA 1SBBB 4QY7A 2BS3B 1EOTA 5KHOA 2ZVNA 5FO9B 4BWGB 1BUIC 3VRBB 1QOHA 1F77A 4DR4Q 4N59A 5EE9A 1XF5L 3BVGA 2PI2A 4GNXA 3V3XA 1VD2A 2VRRB 3NBIA 3L13A 2IT1A 1D6EC 1S40A 1B9RA 1KAAA 2E75C 4EQNA 1NENB 3KUDB 4G50A 4P1CC 4XE0A 4XYCA 2RD0A 3ZYYX 3VRAB 4GDLA 4K14A 4OZBA 2Q8RE 2BS2B 1MHHE 3AU5A 3NENA 4K6LA 3AU4A 2IJ0A 1MIUA 3SFDB 1CA6A 4GGQA 1MD2D 5IGEA 5E7NA 2AQ3B 5HGTA 2RSNA 2X8XX 4GMVA 1TKGA 3Q23A 4II2B 4AJWA 2KWUB 3L2PA 3TUOA 2KVZA 2WXNA 1TT2A 4JCVE 4BAXA 2X6LA 1F2ZA 3FILA 2F0IA 1CQVA 1WH3A 2HHHQ 3N32A 5J3BA 2KWVB 5IP7H 3JYUA 2B2WA 2G9HD 3RMKC 1CJEA 3HUIA 3E56A 3W2DA 3JAMc 4IM2A 5HKHA 2K7VA 2BA0A 1EZ8A 1C9OA 2CHBD 2NYZD 3H09A 2BBCA 3VQIA 2NN6I 3HOXH 3FEWX 4JI3Q 3EROA 3QWNA 4C2MH 3PIO3 4IKGA 2JZ3B 2GMIC 2K4KA 4EX5A 2HE7A 3DVNV 4CQNA 1A0IA 2VUMG 4DR6L 4IFDH 1FFUA 2V4IB 2O5IC 2IO3B 3RLOA 3W1YA 1E5WA 1IXRA 2L32A 4RGOS 1PGAA 1S3OA 1OXSC 3CW2C 1YJ9A 4B3SL 2Q2IA 3MP9A 1ESRA 2UXBL 3IXSA 3R7RA 2DYOA 3AE5B 2N9XA 3U8ZA 1SB3C 2KC1A 2WDRB 5M5XH 4R8NA 1CKNB 1KAWA 1R9TB 3HGBA 2KDFB 2F0WA 3Q3FA 3S1NH 5DCNA 2HHHL 1CM9A 3DBHI 4ZAIA 1I4GA 3ERSX 2VW9A 2YU9B 2Z6KA 4YXDB 1X3EA 3NELA 1IBLL 1F9JA 3PTFC 4X65L 1BCPD 1G291 4DV5Q 1PFSA 2CR5A 4E3CA 4DUZQ 1V80A 2O4XA 4MSMB 2JA7B 1Q12A 3J80c 3GO5A 1TTNA 2V3NA 3T3OA 2EYLA 1TIID 4YSXB 2UXCL 5EKKA 5AJ3L 4CDCC 1TY2A 3D31A 2KK8A 2V3SA 1EFWA 2H88B 4KD3A 2MHVA 2MA9B 5FJ8G 1O7ZA 3F2CA 1JROA 1A3UA 1QOAA 2ZM6Q 1Z6HA 3X3MA 3EIVA 2FCMA 4A6QA 4EZKA 1EY9A 5DM73 4A3JH 2PKOA 4HJGE 2KECA 2B8FA 4WWMA 3GS2A 3D3RA 3SXHA 1XMOQ 5HURA 1HNWL 1ZXIA 3EC8A 3TEHB 4LJOB 3J81i 4FLHA 3T56B 1NBFC 4TUUA 3AE4B 2OEDA 1K28A 1QVFA 2RSUA 1EUJA 1U4RA 3IKJA 3T13A 2N49A 2E3TA 5D6JB 4A3LG 3MXPA 1LTBD 1YNND 2QEJC 5JEAJ 1VQDA 2NN6H 4G7HC 1HQRD 3KF8B 1D1KA 2YV5A 3HG9A 4GLVB 3T51B 3GTLH 1YJJA 5IGCA 4JI5L 2D5DA 2JK8A 3K81C 1I5FA 1NY4A 2W55A 3RD2A 1LUZA 1E6EB 4C3IG 5IY0A 2DWQA 1OXUA 2JPHA 2FE8A 3N9YC 5T1GA 3AEGB 2WP8J 4NQLB 5EE1A 2ZCCA 4X66L 1RL2A 3VR2A 2ES2A 5GROA 1PTOB 4RAUC 3AFQA 5LNK1 1B70B 2HJ1A 3D4RA 1KNEA 3RN5A 3RT3B 2J52A 2BCOA 2CKZB 4KZ0A 2EDGA 2KJXA 4UPAA 5IE8A 1WGKA 2NVXH 4LF7Q 3C19A 1VQAA 1SIJA 2ASQA 2RQXA 5EQ0A 2ZT9C 3F2BA 3BINA 4QUFA 4F7XA 2B76B 3BY4B 1K0SA 5FR6A 1Q8KA 3N52A 1IBMQ 1VCBA 1MJEA 1JRPA 4DQOC 5FO8B 2IX1A 1LLRD 3H7PA 2UYZB 3K0XA 2HIVA 1C3TA 4C56C 2O2VA 2CS4A 4DDGD 3UIPB 3SVMA 4MNOA 3JAML 3IAS1 4AJYB 2RVLA 4P72A 3MAQA 4LF8Q 4OX9Q 3Q8FA 1GJZA 4Q0FA 4WRDA 2VZKB 4DR2Q 3UIOB 2JA7G 1YMHE 1WJ4A 1K3BC 4L8JA 2OTJA 3BIID 1VLBA 2B29A 4WJ4A 1L6UA 5IKCM 2FMMA 2K5HA 2D3GA 5LLIA 3VUWA 2NZOA 4DWFA 1WTPA 2X69A 4NW2A 1I50B 5GQOA 3IAM1 1VCIA 3DVGX 1WGYA 2LVQA 2A69D 4CJ1B 1WWTA 5BN3A 1LTTD 3I91A 1J6QA 3T16A 4NAWA 4YSYB 5C23A 1TJEA 2FIDA 3PZ8A 2HDMA 4GOCA 4DK6C 1BKBA 4HRSA 1JB7A 1KLUD 2VQEL 1KFYB 2B3AA 5D7GA 1STYA 1D3ZA 2G1EA 5CBEE 4RWSC 3I70A 1CT1D 1V1OA 1MI0A 1ILPA 3PRZA 3TBIB 1SYBA 1X3GA 2PW5A 4WWPA 1PYBA 2I46A 1KABA 1AFPA 2CWAA 1KRSA 3CCVA 4JYAL 1S1QB 1YQBA 1PZKD 2RHQB 4DFAA 1YJNA 2CCZA 2K05A 3A1QB 2B63B 2KCMA 3U52E 1B7YB 2F4VL 1V49A 3I5JC 2IHEA 3E0JA 4A75A 4KSLC 3PQIA 1TWCB 1ZW7A 3PUZA 5EBCA 2PE6B 1MJDA 5J17A 1P8LA 2RCFA 1FJGL 2VUMH 2LXAA 5I9PA 2F0MA 1GUNA 2EQSA 2NVTB 4JV5L 1GPXA 3M7NA 5C4XB 2QMTA 4IG7B 2PZWA 4DV2L 3RZDH 1I3QH 4AOFA 2N1WA 1EUVB 3WAMA 3S1QH 1V8CA 4QB4A 1HEZE 4C7ZA 1VF5C 5I4DA 2MSED 4X64L 2L76A 1J9OA 3VR9B 1BVSA 4LF6Q 1V9PA 4JVZA 3UDGA 1XO3A 4YWLA 1RFKA 4BOSC 2KDIA 2KEDA 1L7YA 1SYGA 5JHBA 5HFYA 1DGSA 2R7ZB 4K8IA 4HJ7A 2IO0B 1PTOC 2KAJA 4MT5A 4PG3A 5KHQA 1TKEA 4OELB 2EYFA 2RCNA 4A3EG 1N63A 4X3TA 2K5PA 4LUZA 1BBWA 1SNMA 4EFOA 1H9SB 3KUCB 1AE3A 1I35A 2L12A 5EKLA 3JSVA 4LNQA 2K5QA 1WMHB 2PO4A 2FINB 2A68C 2WKDA 3T1HL 2MPMA 4R1JA 2JA5B 2AYOB 2Z1CA 4EQOA 1V8QA 3IFDA 3SK5A 3VR4A 4PYZA 2X6GA 1VQJA 2KQ3A 1PFBA 1HUMA 1Q82C 1QKZA 3NTKA 4MGKE 4WIPA 1WRDB 3K0YA 1PFMA 3W1GA 1AZPA 5C5LA 5EDSA 5FJ8H 1FVIA 1KNAA 2QEXA 1BBXC 1G51A 2FCNA 1HE8A 1X9NA 4UDUC 1NYRA 1SJHD 5M3FG 4BBSB 2QF7A 4LF4Q 3I55A 3KK7A 1P7EA 1CKOA 2N3SA 2KMMA 3RZOB 4A55A 2D2CC 3S2HB 1FL0A 3WAPA 3EN2A 2OJRA 3DBRB 2RR9A 1E7ZA 1VQIA 1TGZB 2K3UA 2KLGA 2PCFB 4LF9L 4CJ0B 4KDLB 1VQ6A 2QKIC 2KQSA 2F0EA 3PIPA 1PH7A 5C4ZA 3W5OA 3GTQB 4A3LH 1FCLA 2DYMA 3A55A 2HCIA 1U4AA 4IM3A 2B63G 3VFKA 4A3KG 1YZ6A 2CFMA 4K3BA 2RHSB 3B2GA 1G2SA 1N32L 1WM3A 2IGGA 2Y5CA 1GUSA 3UI2A 3TS0A 2F03A 3NRZA 4KHZA 1UEAB 2LGDA 4NB3A 4C3IH 1EYCA 3S16B 4B08A 1V81A 2ZVOA 2JYOA 5C1ZA 2K32A 1U4PA 4LNOA 1TWAB 4ICVA 2OQKA 4QCLA 1CKNA 4AWJA 3MWYW 5C4XG 1E24A 1XXGA 2JP1A 3T8MA 4JI1L 3AE8B 3IG3A 2QSDA 2K04A 3HS0C 2XVSA 2FCQA 4FA6A 1D7QA 2TMPA 4QGUA 1FEHA 2N78A 2WXIA 4OHJA 1TBEA 1JQYD 4KJOA 5C6AA 2EELA 4P1BC 4P16A 2I07B 1PDQA 1FIQA 3PVLA 2K39A 4E6IA 1PH3A 5LXIB 2PW9A 1R9TH 1ET6A 1QJOA 2OHFA 5CMDA 2LGYA 3PRPB 3PO2B 1O7IA 2R7ZG 1OQRA 2K03A 4JQWC 4QUCA 1P0RA 4DV7Q 2DAFA 2ZJPA 4FXCA 5FKAC 3D4DA 2YU9H 2ZZPB 1OTCA 3DVNU 1F9RA 1G91A 1BMLC 3L3OC 3DVGY 2NTSA 4UP8A 4A3BB 1V2YA 2LASA 4X57B 1E2ZA 3RN9C 1SXTA 1SNQA 2PMVA 4KSKC 3X3NA 2DENB 2Z6BA 4LNNA 3E5SA 3ZXRA 4H0LC 2JA5G 3BYYB 3CSTA 2LS01 2JA7H 2JT4B 1V1QA 1P98A 2O6VB 3Q14C 1NJIC 3MFGA 5K5PA 3VDZA 1BQQT 1PFDA 1BO0A 4NXNQ 4OZAA 1SYCA 3PO0A 1T3QA 1KXLA 1STBA 2K8HA 3TDQA 4M8NA 1G8ZD 3MXUA 3BZKA 4HXDA 1Q8IA 4KKIA 2IO2B 4BBSG 4ODGA 4ZKCB 2B2TC 3R2TA 2LWPA 1BXTA 5A2QL 2WWZA 3MJWA 3OMGA 4HROA 2CWPA 3VH4B 1AN8A 3AV8A 1N61A 5KYLA 2QIEB 4DHZE 3ND8A 1PYSB 2PMZE 2RDGA 2IWHA 5COYA 1LV9A 3KBXA 1DOKA 4TSSA 5IT9c 4JC0A 1WGDA 1EEFD 3NHHA 1OGWA 1XNQL 4GKJQ 2ZNVB 1QT9A 4B3TQ 1N33Q 4IUTA 5CV4A 3P4QB 4DXAB 1WX9A 1VQNA 2VNUD 3HOXB 1DZ1A 3W5VB 2L83A 3NEMA 3DOWA 5K36G 1WRIA 5BN4A 2FMCA 2H1EA 2Z9HA 5CC4A 1GUWA 3OLMD 4WAFA 2R6GA 2ALYB 1UBQA 4KGSA 5IGBA 3M85A 2KKCA 3ZKJC 1QLBB 2AL3A 3D32A 1J7CA 2EY5A 2QHOA 3VR8B 4JPBW 4RNAA 1PTOH 1JORA 3GTPB 4NPNA 4CDEC 1V1PB 3CPWA 4DR5L 3P63A 1YEZA 2CW0C 1YITA 1Z7TA 5G3LD 3GV6A 4EUTA 5G2NA 3UF8A 4KK7A 2WACA 2DAJA 4LNIA 2WB1E 3KLSX 4IOIE 2NZ1D 1MSGA 5M5XB 3GOEA 4ZKBB 4ARIA 3GZNB 2K5DA 1GAQB 4IWOA 1WZ0A 4BY7B 1C77A 4WWNA 1W3SA 3ULPA 4WJ3M 4B9WA 1YVCA 3PO2G 2CKHB 5BMGA 1HTLD 4JI0Q 1VDVA 4HSVA 2JU6X 3RD4A 2X38A 1WY8A 4CO7A 3H7SA 4A3BG 4A3EH 1ZP0B 2L55A 3BU2A 2KFJA 2D3BA 2OJWA 1BUVT 2L52A 5GAGC 3NVZA 4PT5A 1N5XA 2WINB 4P74A 3K5OA 4X6AH 3ZNGC 5BN5A 1HFGA 2I5LX 2K5NA 1IKMA 2NBVB 4ICUA 3AB5A 2L3ZA 3PSEB 2WX1A 4KX6B 3MEHA 1STHA 1VDZA 2GA4B 4MDKE 2SAKA 4W9GA 1I50H 5BR8L 4WQOB 4HDOA 3A9KB 2BH8A 4KY6A 2Q8TA 2KACA 3PHWB 5HI1A 1QWYA 1LTSD 4ME3A 2K6QA 1E1TA 1K83B 2XWJB 2YTVA 4O42A 5M3FH 2A73B 1FRDA 4MGYE 5J18A 2VB3X 1WYGA 3CF6E 3A1QA 1A15A 4J15A 3KFUA 2LXJA 4ALPA 3F2UA 3DBRI 4DF7A 1KL9A 3HKZE 3OOCA 1FGUA 3P1HA 4RGMA 1RCVD 2R2OA 3OTOQ 1PTOD 1VS0A 3S17H 3P4PB 4IDIA 3MC8A 4F87A 5C3EB 4CKCA 4LFBQ 3J81E 3U50C 4URKA 1QNUA 3C1EA 3A5ZB 1BCPC 1JWAD 2B63H 4A3KH 3P75A 2A68D 1XPOA 3C46A 3N1XC 1GOZA 1SE8A 3N30A 1WYDA 3F8TA 4FP5D 3VR6A 5JEAG 2A8VA 1TWCH 1NI2A 2BKRB 2FBWB 1FYCA 5KIXA 1YJWA 1KDAA 4O0AA 1PA6A 3RNCC 3NY5A 4AYBE 3CSFA 2HQEA 5CV6A 1QB5D 1LT5D 2JF5A 5C4XH 4V190 1PRTF 4LFCQ 5L95C 1MSHA 4YHHL 1KIXA 2LVOA 3NUCA 3ZRCA 5JVG3 4HAEA 2VZKD 1Q0WB 5CR3A 1HTQA 1S5BD 1JWSD 1X55A 4K2KA 4A4IA 4JBKA 2PE9A 3AULA 1B53A 4BY7G 3DBSA 2VQFL 1WMHA 3L0OA 1VQMA 4NDXA 3U58A 3CQZB 3A7AB 3H0GB 3L9AX 2F0NA 5I2XA 5D3DA 1DXMA 4DV0L 2KVMA 2R7ZH 4S0RA 4A3OA 4AP4C 4JIOU 1Z47A 4K81A 2PZTA 1OTRB 5E4WC 1B1ZA 4A93B 1O7YA 1YNNC 2F3VA 1QZGA 1YD8U 1QZHA 1CFMA 1HA5A 2AMCB 1WYWB 2KHJA 2WDVB 4QL5A 2N7EA 4ANXA 2F52A 2KJ6A 3Q3NC 1XCQL 2JA5H 1KDCA 4W9EA 2E2HB 5LMNL 2M0AA 3AMZA 4DHZB 3H8HA 4KI0A 1ZE3D 2K52A 2PMZB 2KDEB 3SU8X 3DQVA 2VL6A 4R4TA 5EE0A 4JG2A 1OQYA 2QCPX 2E6XA 2K6DB 1FXAA 3RUIB 1E7VA 4BBSH 1UBIA 2F0SA 2KUMA 2C5CA 1FO4A 4DXGA 3RZOH 3BZDB 1AWDA 4FN2A 3DHHC 4ZUIA 4RHRA 2WYQA 2JRHA 4WAAA 4YWGG 5DPWA 1XTCD 1CHQD 1EU3A 4NXML 4YTNB 1AEXA 3P2BA 1X65A 5E4XA 2M56B 1D4BA 4CHTB 1SAPA 1YIWA 3MHZA 5C3EG 1OXVA 4P75A 1UH6A 1K73C 4CKEA 3GTQH 2FIFA 4HPLB 5IGFA 3RNBC 4HIDA 3SE0A 2AL6A 4M0WB 4I7AA 1ZDVA 3RPFC 5IO9A 3PZ7A 4XWTA 4BKGA 5K36H 2L9HA 1SNCA 1TZ1A 4YCVA 4RA8A 1IYUA 4DV1Q 3S16H 3TREA 3TQYA 4RGTA 2REXA 2YEPB 2L8JA 4OXPA 1R7SA 2WB1B 1TWAH 2LJIA 2GVBA 4IUVA 2M19A 2B39A 4POFA 4DV6Q 3S1MH 3O65B 2ZJRA 3Q3JA 3NZ3A 1JALA 1HFNA 1RTNA 2UU9Q 1KOTA 2Y5PA 1ENCA 3PCOB 5BO4B 1HR0L 4W9DA 1A62A 3S1QB 1EQQA 2F0VA 3WA0A 4KVGB 4TQUS 1PH9A 1FM0D 1GC7A 3P1MA 2KJRA 4GOPB 3M4OB 5ELBA 1FNWA 4DAYB 1S5ED 1Y69U 4L5SA 2MGSA 3FVQA 3H0GG 1F9PA 5JJIA 1MPEA 3PO2H 1VZ8A 2NPTB 2O6VA 2AWOA 2V1YA 5IYDG 4DGZA 2JXMB 3E6ZX 1XNRQ 1SFOB 4A93G 1Q46A 1OFFA 1IL8A 1D5MC 2FXQA 1N36L 4A3BH 1KTKA 2GBMA 4TRDA 1FXTB 2M8SA 1EWHA 2LRWA 3IFTA 1KDBA 3MXNB 1WXAA 4W9HA 2ID0A 3IVFA 3N1ZC 1I94Q 3BVZA 1UF0A 2N4FA 1UAPA 2UUAQ 1YQ3B 3ZRFA 4XYOA 1L5PA 2KD0A 3M4YA 1U4MA 5G5HA 2QDBA 1CK1A 5AEKB 4IO9A 2J42A 2UXDL 1RDPD 2BF8B 3HKZB 2CW0D 2KLCA 1T0RC 4L2YA 5DAUA 2K25A 3ZJYC 3OAWA 4RM9A 2HDLA 3NWSA 4ZK9B 1J8IA 1XLOA 2E2JH 3J80E 4L63B 2DNCA 2GBKA 1SE9A 1RLFA 3G48A 4FDBA 2UUBQ 3Q2AC 4ZYNA 2MJDA 3K57A 3JVZX 1JICA 3A8IE 2F0GA 2WLBA 1HZAA 2A6ED 4NJ6A 3KOJA 3MXGA 2Q2UA 2C9OA 1KM7A 2LEKA 3SEBA 2J0TD 3R2IA 1T0YA 2CU3A 1LTAD 4WORA 2IZVB 2JQRB 3NQIA 2OEOA 4LF5Q 4CDDC 4DR4L 4DV4Q 4AYBB 1U4LA 1IKLA 5KYIA 4DBGA 2KHIA 1RRBA 2AX5A 3CIRB 4A90A 2H4OA 1L0VB 1V1PA 3AMUA 3AEFB 4EOYA 2KOXA 4IOCA 3STBD 1NBWA 4TVAB 4NAMA 1VR9A 4C3IB 3NJTA 5JEAH 2W82A 5GMVA 2YYZA 3K7AH 4BFRA 2WB1G 1QF6A 3FPPA 1WTWA 4IJLA 3LXFA 2NBUA 2VH2A 1IW7D 1L0YB 2NUCA 2EZVA 1K8MA 3GTPH 5C0XJ 1TIFA 3DDCB 2Z59B 4EQ5A 2ZXPA 3AE3B 5FLMG 1SMYC 3Q8BA 4JI6Q 5C3WA 2O6VD 1FMAD 4LNFA 4LUOA 3UINB 1VQ8A 1J0GA 1EL0A 2KDMA 2IDYA 4BKSD 4GN3B 4BY7H 4IQZA 4BOZB 2EJMA 1HNXQ 4C3JB 5IOCA 4ANUA 1TZOA 3MHBA 4GLSC 3FDTA 4KHPQ 2WS3B 3DLLA 4LDTB 5FK9C 1HZ6A 5JHAA 2BTEA 3NWTA 3A9KA 3ETRA 4JI3L 2EVBA 3M63B 3B1LX 3JC66 3K5MA 1PH4A 2J53A 3E9SA 3I3TB 4LUVA 1JWBD 1VZ6A 4IWQA 2LGSA 2Z4HA 3KQ4A 4K1RB 4R4IA 3RLNA 4DXFA 5ELNA 4KKJA 3VR3A 1XMQQ 1VMCA 4FF2A 2V4LA 3HKZG 2XEWA 4MM3B 1L1OB 3NHEB 4PS7A 1LT6D 1Q1OA 2ACZB 1RHPA 3A0JA 4ILWA 1K83H 2INCC 4TKNA 4DK5A 3PV0A 4N8X1 4DA2A 3H9DA 4F7ZA 4WJQA 4A8XC 1GB4A 1CA5A 1EY4A 3DPDA 1WTOA 5LMUQ 1CHPD 2PZUA 1T6BX 3CP0A 4GIVA 2IYDB 1H9JA 2BA1A 3TCAA 4M8MA 4AYBG 5C3EH 3TN2A 1PH6A 2WQYB 2K8CA 2GLSA 3WOEA 1U0LA 2C7MB 2EKIA 4A76A 1DJRD 1ESFA 1F2RI 4EQPA 4DV5L 2XIWA 1ZYRD 3VA5A 4IZ8A 1LABA 1XT9B 4IOAA 4NNJB 1QVGA 4DUZL 2OT2A 2BB6A 2MUYA 4REZA 3JW0X 4GS3A 4OO1G 3DWAA 3PPAA 3PGZA 4Y52H 2G3QB 4JL9A 2LXCA 2N8NA 2G45B 1SYFA 1C7YA 1XD3B 5E6NA 2ZM6L 3CC7A 4G0NB 4B3RQ 2D62A 5M3MB 2I38A 4G4KA 3DCGA 4HLEA 1TYGB 4W9IA 3S2DB 3D4WA 4LCDE 1XMOL 4DUYQ 4X62Q 3HFZB 4JI8Q 4XDXA 4JI4Q 1HJPA 4KV6A 4BA2I 2N9LA 2D10A 3CQZH 3H0GH 4C3JG 4B9XA 2BYTA 3VUXA 2R61A 2XRQD 3QJYA 4KY5A 2ASBA 5AUIA 1E0BA 5IYDH 4DV3Q 4A3EB 3ULLA 3NQTA 4A93H 3A8KE 2ZTDA 2RKSA 2LGIA 1RFAA 2LD9A 1H9KA 3TS2A 2KO3A 3OJ4B 1WXSA 1EU4A 1QILA 1Q90A 2N55A 2QDFA 1RIPA 1TXYA 3L7ZC 2Z8LA 4DR1Q 1WGHA 2WXRA 4PS8A 2JYTA 1E10A 2F0TA 3NUHB 1XTDA 1T0SC 2E2HH 2DY7A 2IGDA 2PJHA 1BT0A 4DNTB 2CHXA 4F1SA 3H15A 3PIP3 4A3FB 1LT3D 2HQLA 1KC8C 4MGZE 3GTKB 3NOBA 3ZXVA 4H2AA 2WHIA 3I4MB 1WM2A 3Q8EA 2FNJB 3DXJC 4OWXB 5D14A 5EGTA 4Z9CB 5M3FB 4FULA 3QWZB 4IPCA 3GTMB 3KYCD 2D0OA 2QGQA 3SR6A 5FOBB 2NTTA 4LF7L 2NMQA 2V4DA 4GN5A 3VDYA 2PNHA 2WX0A 4HEA1 4M0WA 4E74A 2DGYA 5FLXL 2KFKA 2NWGA 4GN4B 1VQBA 2Q5WD 2C9WB 4L23A 3AEVA 5GXGB 1SDFA 2L15A 3IFWB 1IBML 1BCPF 3S17B 1VQPA 1ZXTA 1GNUA 1SLJA 2KDBA 3W1SC 4GXBA 3PUVA 3S9WA 1OQQA 1L1OC 1LO5D 2LSSA 2ZXRA 2A5UA 1IP9A 2JQOA 2KMAA 3BZCA 4FO2A 3T9LA 3RUZA 3C0RB 4LF8L 4OX9L 1NVID 1LYLA 3V05A 4A3KB 1EY0A 1WFQA 1PV4A 3JAMi 4DR7Q 1JMLA 5DEHA 1YNTE 4HCSA 2EYPA 4DR2L 1LFDA 3IBEA 4M1UB 2K9XA 3H91A 4W9FA 1YJIA 4WJOA 4B6WA 2N7DA 4X3KA 2KC2A 2JEAI 3FC4A 3ZTCA 4OO1I 3K5LA 1QG7A 4DAYA 3ERQA 2JVCA 3OJ3A 4FHJA 2ZW1A 4NKLA 4PNYA 2NPTA 5M3MG 3TP6A 1HZBA 1K0RA 2QDLA 3M9BA 2NR2A 2O2LD 3LGJA 5CYUA 5BYSA 5FLMH 5LL6X 3G4SA 3KLRA 3P7JA 1WGRA 4FXKC 4W9LA 2KT7A 4DDID 4ZRJA 4IUNA 2I1KA 2HD3A 3M4OH 1ML0D 1V86A 4C1NI 1JJ2A 1EIYB 1TWHB 1V5TA 5IP4D 2BWFA 4HCNB 1JCKB 3T1YQ 4GKKQ 3MXNA 1FCCC 2BVCA 4YIJA 3TEZA 3KUZA 1CQFA 1D5XC 3GTOB 2WXHA 1IYFA 1EY8A 3UE0A 4ZYSA 1N8RC 2CH4W 1SFOH 2KOLA 5CV9A 5IWAQ 2BT6A 3PGEA 4MJSB 5LL6S 4XX5A 1VQHA 5JPNC 2PIAA 1FNUA 1B44D 3BDOA 1DOIA 4XT1B 3ZDMC 4KKSA 2XNAC 4NMZA 2DY8A 1E3PA 4YWMA 1EO6A 2I2YA 2IL8A 3QB3A 1FRRA 4MTNA 2GBRA 2BPSA 3QOLA 3EFUA 2OQ0A 4UP7A 4ZHPA 3SHLA 1UEBA 1TT5B 1EQVA 1HQMC 4A3FG 1LTLA 4I7ZC 3J80i 4YTMB 4LLGM 5IYBG 3I4MG 1A6XA 1HZ5A 1S4ZA 3CU7A 1SMYD 1PMRA 3A56A 4HEDA 4L5QA 1JJCB 2UUCQ 3HRZC 1Y56A 1ET9A 2KWDA 5AZGA 2MO0A 3ZTDA 4A3PA 1WI5A 3QR8A 1Z9FA 1VF7A 5EAYA 1V5OA 1ZGUB 4B3MQ 1DOLA 4HIMA 2ICEC 3KDFB 4K7WA 2A74C 4JI2Q 4LF6L 4A3CG 2MQJA 1L0XB 2RBMA 4PMWA 3WWVA 5EPJA 1RJTA 2BGFA 2BYVE 2LMCB 3L4PA 3X0WA 4IM0A 5DM63 2ICIA 3APFA 2ZXOA 1MGSA 1MJCA 5C2TB 2RPQA 5M5WB 4A3DB 1MHWC 3A54A 3I73A 4BBNC 1DD2A 3I90A 4R8IA 1FGBD 1UWVA 1VRAB 3K7UC 4N9F4 3FHWA 3H6NA 3I57A 4L5TA 3UE1A 1R4MB 5IT9E 4IURA 1WJJA 2K5WA 1PH1A 2KN5A 2DN8A 1AARA 5NUCA 1ISNA 3R93A 3DHIC 5C44B 4CYEA 3NPPA 1M90C 1DYQA 1GB1A 1C1YB 4PZ7A 3ZNHB 3KWLA 3S1MB 1C9FA 1ZDXA 3RNEC 3IHPC 1NNXA 5CX3A 4XQQA 3VYTA 5TR5A 4KN7C 2KX3A 3N3KB 2K22A 3MHSD 3GP7A 2NBWB 2O5JC 3AH7A 1K8GA 1JT8A 3ZUNA 1A5RA 3H3VC 3LWUA 1SN8A 4LF4L 3NTHA 5EPLA 3J7YW 3I4NB 2Z4IA 2CJNA 2D3CA 3ZVVA 2MWSB 1A70A 2KN4A 1WZ3A 1IGDA 3AFPA 3PUWA 4FJZA 3F1ZA 3CC4A 4N9TA 2MBBB 3AYHB 4O2DA 4FNFA 3U4ZA 2AQ2B 3A9JB 3RLFA 3G6JB 3L17A 1J5EQ 4C3JH 1K53A 4HMIA 4JK1C 3TEXA 3W5UB 3QK0A 1DOYA 2GB1A 3SDLC 3VXWA 3DM3A 3W1SA 2D07B 4F88A 3HVZA 4EKUA 4TQ0A 3AN1A 4YTPB 4QMGA 1PH5A 1FR3A 1L1OA 3R3OA 4DKAC 1HRJA 4MM3A 1UNSA 1E8ZA 3ZO5B 1N34Q 3AEBB 4X3UA 2BS4B 3RNFC 3ZIMA 1EWYC 1WVLA 1PHJA 4A20A 1JW9D 1KF6B 3PO3B 4J1MA 1FD6A 3E9HA 1NMGA 3KWVA 2W3SA 4K5XA 1JOOA 2XSCA 1IPGA 4F8CB 4C00A 4MACA 1XPRA 4Q2JA 2EJFC 2MNAA 3PUXA 2FJ2A 3HOZB 1Q5WB 1SROA 3I63C 1TS2A 4PMBA 2E2JB 1YQ4B 3WCQA 4GZYC 1Q1EA 3A33B 1WTRA 3KF8A 1M94A 4C80A 1QCBD 3HOYB 1HXYD 4JOIC 3EECA 3RCZA 1E7UA 4K0KQ 1G2TA 3GV3A 1NMFA 4PMCA 3ML8A 2A19A 1SRUA 2A5HA 5ELFA 5JVH3 1HNZQ 4TKOB 4OGQC 3WALA 3PUYA 4DV7L 4A3DG 1ZXHA 3E0EA 3UDXA 1IYVA 4KGTA 2EYJA 3TEYA 3EFCA 2CHWA 1D8LA 4IALA 3W1BA 5JJKA 5CHFA 4MH0E 1I4RA 1J8CA 2Y3AA 3H3VI 2KEEA 1KLVA 1E8WA 1QVCA 2DUDA 3ALBA 5C44G 3OHXC 1KQSA 3J81j 3IAYA 3K7AB 1RODA 3ZGZA 2E76C 1WXMA 4NXNL 4MHEA 3Q8AA 4LW1A 3SGIA 1WE6A 2SNMA 3OW7A 1H8CA 3VR5A 3Q6BA 1X1MA 4LDTD 2B8GA 4S3SA 4ZRQA 2WDTB 1W6KA 5M3MH 2WU5B 3I4NG 3PLUA 1JQ4A 3L16A 3S2DH 5C0XG 1ASZA 2INNE 3RR5A 3ND9A 3RYTA 4W9KA 2RGFA 4CKBA 4DR3Q 2K8BA 2IPKD 2NVYH 3VHTC 4HK2A 4GKJL 2A6EC 4YY3Q 2R92B 1HNZL 2GBNA 4FHKA 4B3TL 1XLNA 1N33L 2WXFA 1EQRA 2F0KA 2KCTA 4DAMA 2RDBC 1TS4A 3TRZA 1C4PA 2DZMA 2K75A 5I6YA 1E8XA 4TMAB 3V60A 2M9VA 4HR7B 2VY3A 2KBNA 2EMTA 3L0WB 1GUTA 2I5MX 4HMJA 1YHQA 3MVVA 4WJNA 2J7ZA 2EYOA 4GSWA 4XC2A 1C48A 1EWCA 2NB0A 3STBC 4FXDA 1Y1WB 4JWUC 4KGRA 3PO3G 1GHJA 2F0LA 2G9DA 1OEYJ 2C7HA 4EGVA 3HOUB 2C7NB 2R7DA 1UE5A 2DHZA 1CZPA 3PV1A 4A3FH 3HOVB 3GTKH 2DYBA 2OOBB 3AE1B 4BZAA 1IW7C 5IYBH 3I4MH 3NTIA 2PPHA 3HOZG 2KTRB 1UE7A 1LTID 3CPFA 4U68A 1IHZA 3GTMH 3AXCA 4JBJA 5BMHA 4JI7Q 3HOYG 1HTOA 3APCA 3D8GA 3DUZA 4CDFC 1L2FA 1X3PA 2K01A 1SNOA 3RULA 1NYQA 1S5CD 4A3CH 4P7IA 4ZOHC 4JI0L 4YY3L 1WX7A 3PF4A 3M3JA 2H89B 4W9JA 5HY6A 1YX6B 1I4PA 4LFAQ 2R93B 3U9SA 4NP5A 3WANA 4M00A 2E5LQ 2FHTA 3U4VA 1RTOA 1TKWB 1I7HA 3C2PA 3H3VH 3AI5A 3PLVA 1P1AA 4ZRIA 4ASWC 1G6ZA 1RWSA 1B50A 4BS9A 4ZCKA 3VTVA 5LMNW 2AUKA 3DMUA 1VQFA 1R4MI 1C78A 3ML9A 3TEWA 2JZPA 1F52A 3NBHB 2HDEA 2ZNVC 1ONLA 1BOSA 1Y1VB 1WXVA 3CD6A 2XBBC 1A63A 5CV8A 1KRHA 2QILA 1DCZA 4HN7A 4MH8A 1JE4A 4US9A 4ZRZA 3J7ZC 1NI3A 1CSQA 2A1AA 2BE5D 4US8A 1E2WA 1NCVA 4RMFA 3TSSA 3RN2A 4NZLB 4ACFA 4L1BA 5JJZA 1IUEA 2HTME 2JXTA 4MJSA 4UHVA 3HP3A 2B2TA 1H9SA 3QAQA 3Q22A 2JXXA 5C0XI 1TWHH 2D5GA 3PREA 3OTOL 2R92G 2L5TA 4XDCA 4XT3B 4JOIA 3GTOH 1J7BA 2IX3A 1WFYA 3Q6SA 1IBXB 2FUHB 1ZKOA 4LFBL 3FKIB 1A3VA 1QE6A 1SMXA 1Y14B 4J6IA 5D65A 1WX8A 1UUPA 3S14B 1XEEA 2J0JA 3ZW3A 2XGTA 2I5HA 1VZ7A 2WP9B 2XRSD 3GE8C 1SF0A 4CHKA 1ZYRC 3LB8C 4MIUA 2J0MA 1Y1WG 3L08A 4FJVB 3U30A 2AHOB 4H7BA 3U9OA 1TWFH 5I2YA 2YTYA 4DAVA 4MSQB 3EGRA 3KDFA 5G3LF 1YN4A 3HOUG 1K52A 4HWIB 2EPBA 2RF4A 3A74A 2YLMA 2ZW0A 3G71A 1PGXA 2L4NA 1QOGA 4XDDA 3HOVG 2LMCA 1Q3LA 1HR0W 4LFCL 1HZCA 4JBMA 3G6EA 5M5YB 1IYJB 5IYCG 5DNFA 2PQAB 4AQYQ 1O78A 1T5XD 3BK1A 3ZJVA 1CKMA 2LXKA 2WNMA 1EYAA 2WIIB 2K50A 2SDFA 2H5XA 3OYYA 1WE7A 4P2CB 1UZXB 3TJPA 1EQTA 3WDNA 3VTUA 4EZLA 1KRTA 5IGGA 1QUQB 3KW5B 2XK5B 2R2QA 4A3IG 4RFBA 4RKBA 2KANA 1X54A 2O2VB 4O1NA 3DHGC 4RH6A 2PPBC 1KHIA 3ULJA 5M5WH 4A3DH 1WJ6A 2R93G 1V97A 4I6LB 2QCZA 2HUGA 3KLWA 2WDQB 3L10B 3GTGH 1NR4A 4WQMA 3J81c 3GQBA 3I8ZA 4C1NK 2JA8B 2N9PC 5IIFA 4YL8A 4XWWA 4DHJB 2JE6I 2F0HA 5IA7A 5C44H 4H44C 3CC2A 2E74C 3NZSA 1Y1VG 3IL8A 1SNPA 3JAME 3CCLA 3DBLB 2AWTA 5IN7A 1I4HA 1JMCA 1VQCA 2LUEA 2JZZA 2D0PA 3KJOA 1Q86C 1H4RA 4Y7NB 1GJXA 1F2LA 2JA6B 1T9HA 1JRUA 2M0XA 1SE3A 3T53B 5BYQA 2C60A 1Q81C 5KGUA 2L0FA 3BJUA 3I4NH 1PTOF 1VQ5A 1WF9A 3SK8A 2EIFA 5L37A 3AM9A 4HJKA 5C0XH 3B2FA 5H8YE 1JB3A 5C3JB 1K50A 1E1OA 1XPUA 1Y8NB 4N8FA 5I6WA 2EKEC 4GDKB 5H92C 3U7ZA 2EYHA 4BKSA 3FKIG 3HM3A 2ONQA 1W6JA 4KIKB 2D11A 1EWIA 2Y0SB 1XLQA 5AZFA 4IW0A 2BWES 2WXJA 4UAIA 5EE3A 3ITPA 2MX2A 1YBYA 5BYRA 1B2TA 2NS5A 4R3DA 4POGA 2RPVA 3VYUA 1ASYA 2I0QA 1L4DB 4DV1L 5EPKA 4HPPA 3CMEA 3PO3H 2KTFA 2Q2TA 4MTKA 4DV6L 4RCOA 4XYQA 1C0AA 1E0ZA 1I6HB 2OF1A 3V62A 2DNFA 1RAXA 2BYFA 4RG1A 3BYTB 2F3WA 2F3IA 2UU9L 3V2TA 3HIZA 3LDZE 2BDOA 1YIJA 2ATWA 5BMIA 1L6VA 2Q2HA 2DJFC 3A5UA 3P4RB 3HOZH 4WH4A 4PQXA 4PK1A 2AEHA 1W2BA 2IBIB 3CCRA 3HOYH 1XJVA 3OW2A 5G5GA 1G6JA 1UD7A 4BBNF 4QAYA 4DR6Q 2LGXA 4AUQC 2WAQB 1C79A 3TP5A 1GHKA 4G7ZC 1K51A 1XNRL 1Q1BA 1GC6A 4B95A 4C7YA 4B3SQ 3JSVB 3HEJA 2BH2A 2JEBI 1ZUD2 3FPUB 1QNKA 2MP1A 4OWWB 1WXQA 2UXBQ 2GVAA 3OWFA 1C76A 1WGGA 2HIXA 4ULLA 2JA8G 1AE2A 5JXVA 3FAHA 5HGQA 4HKQA 3ZNID 3W9CB 1PUTA 1EIHA 4RCNA 3NVWA 1I94L 1ACCA 4MEMA 2UUAL 2K1BA 2WV6D 4ZDVA 2LFNA 2LJ5A 3J7AF 4QJFA 5E3FA 3K9PB 1C8CA 1F2RC 1KLGD 3EBEA 1IGCA 1D1IA 2JA6G 1NE3A 3IRBA 1IBLQ 3UDFA 4X65Q 1ROEA 2ENBA 2BYEA 4YT0B 1TS5A 2IY0B 4IN3A 1LTRD 5FLXc 3M3YH 4K3CA 2M4NA 3D6CA 2UUBL 5C3XA 3PRMB 5CBAE 1GVPA 1LT4D 1PRTB 4K7UA 4ID6A 1GUGA 3MZ5A 2UXCQ 2B2VC 4DAPA 5C4HA 5AJ3Q 3HM6X 2R92H 4J6HA 1HPCA 2J7QB 1Z5SB 4K8JA 2DBYA 3P42A 2F0DA 4LF5L 1R4QB 2K14A 1YOVB 4DV4L 1NEKB 4FXGC 2Y0SG 3LNNA 3K58A 2F0PA 1RYJA 2D3AA 2KHSA 3FP9A 4H13C 5J39A 4GOPC 1K3RA 4BA1I 1SGHA 2KTRA 3J81L 3SFEB 2LY7A 4HSPA 3R8BA 1Y1WH 1HNWQ 1EEID 5DLQE 4BKTA 1NAPA 4G11A 2VB2X 1FD7D 1P3QU 3MEFA 1YI2A 3H6MA 4WFN3 3HOUH 2K1FA 2WGSA 1ILQA 4IUQA 3QA8A 1TWGH 3HOVH 1XCTL 3QARA 4A9AA 5CORA 4KV2A 4EEWA 5IYCH 4MGIE 2EY2A 4JI6L 3CHBD 1GXDC 3ENEA 2E2DC 4JI5Q 3WAOA 1EYDA 3GE3C 5H1SE 3EFXD 3OSOA 3AQQA 3QQ8B 4K5WA 2F4IA 2WAQG 4BBRB 3EHVA 4A3IH 3P20A 1YX5B 4JGHB 1HNXL 3URYA 3OIQA 3KBGA 1CMXB 3NS8A 4X66Q 3NBHA 2EXZA 4KTAA 3NSWA 3A8JE 2QJLA 4KHPL 4L5RC 2R93H 1A3TA 5JOBA 1E22A 3K6OA 2MW5A 4YCUA 4LWCA 2Z0SA 2KX0A 1KD1C 2MP2B 4EVOA 3MFYA 5IAAC 3PT2B 1Y8RC 4MZ9A 3OMCA 3H94A 4HPMB 1VQEA 1WR1A 1I6VC 1Y1VH 4R9WA 4QIWB 2KHWB 3R3MA 2KQ4X 4ITKA 3CCJA 2HJ8A 4YCWA 1XMQL 3DBLI 5ISRA 3C3LA 4C4VB 4ARCA 2KNBA 3AE2B 3SDZA 1IBXA 2VS1A 4IFDJ 2YTXA 1UELA 2LZ6A 1OXTA 4IC7B 4LK0M 4ZRKA 1EY5A 1WR6E 3T3NA 3L54A 4U673 1QZEA 3DM1A 2INDC 1VQGA 4OVVA 1R4PB 4XTCS 2NVYB 2JWUA 2LVPA 3NVVA 3RNGC 3MTNB 5LMUL 4BXXG 5J22A 1S3SG 4HJ8A 1PVOA 2MRPA 2WU2B 2G4SA 1JOQA 1M1KC 4DU9A 5A2QE 2LHEA 3N20C 1BF4A 1MG8A 2B2UC 4D2KA 4IJHA 3FKIH 2IHFA 1MG4A 4NJ7A 5D3IB 4HIOA 1EF5A 1EIFA 1GUOA 3S14H 4BY1B 1P7FA 3C1FA 1F1HA 1Y8PB 1RF2D 2PQAA 5EBDA 3PIOA 1X3QA 1HZ9A 5JPMC 1PRTC 3HK0A 2RDFA 4LJPB 3MA2B 3Q8CA 5IGDA 4K5VA 1JE5A 1WD0A 3U7DA 3AECB 1E9MA 2K33A 4N9PA 4P73A 1EY7A 2VQEQ 2I1JA 2V9HA 2DZKA 1M4VA 1QUQA 2AWNA 1V43A 3S1RH 1X3FA 2XK5A 1STGA 3DWQA 2LHDA 4FJYA 2RDHA 3MC9A 2A4ZA 2IY1B 1J7AA 4QQBX 3KYDD 2L05A 5M5YH 2CJOA 4B3RL 3Q8DA 3TL5A 4JYAQ 2JN4A 1PZJD 5GAHC 5ELEA 4C3HB 1HA6A 4JW0A 2GBJA 2AKWB 1QOFA 5KNDA 2F4VQ 2KCNA 4DUYL 4X62L 3J7A5 1LGRA 4ZRPA 4JI8L 4JI4L 2HCCA 2INPE 2MBEA 3AU7A 4BBRG 1NDDA 3Q3OC 3D6WA 4IUUA 1E90A 1FJGQ 1WCMB 3QJZA 1S5FD 5FO7B 1LXDA 1CI3M 2DX5B 1GM5A 4JV5Q 2EOTA 1UE1A 3MTSA 1ZKHA 2JWZA 2PVGC 3H1UA 4DV3L 2B2VA 3E9IA 1PLFA 4DV2Q 3Q3MC 1KH0A 1WSPA 2MJ8A 2MLBA 1PQSA 4OIJA 1CZGA 3J7AV 4PZ8A 1OXXK 2JA8H 2ZPYA 1VQLA 4DR1L 2GRIA 5MPOA 3CF5A 4X64Q 2HT1A 2PI2E 4XQJA 1YNJC 4AH6A 1F2MA 3AB9A 5LHY1 4GOPA 1XLPA 2QC8A 1EIGA 1MBYA 2LRUA 1STNA 3ICEA 4OL7A 4FVMA 3V96A 5LXHA 1FPYA 1AZQA 1N9WA 2BDNA 1J19A 4HIKA 4L6TB 4Y7NH 2MBOA 4GDKA 2JA6H 3KF6B 5C4JB 2NVQB 1E2VA 4KIKA 3GTJB 2IO1B 3Q69A 3AEDB 4S17A 3BDLA 1SSNA 1TKYA 4MELA 1PGBA 3PSIA 3T1HQ 3I72A 1WIAA 2FUG1 3RFZB 4JX1C 2IW3A 4A3MB 2PLPA 3J80L 5IP9G 2D9UA 1L2NA 2K5VA 2GN5A 3QIJA 4A3GB 3VA7A 3CXCA 2EY6A 1ZOYB 5AUKA 3I3CA 3UQAA 5J1ZA 3M7GA 3DWGC 3CRLC 2OCEA 2IX0A 1L4ZB 1JWMD 3BS1A 2DNEA 4BY1G 1K8OA 1K8RB 3O13A 1U9RA 2J4XA 1LQBA 2JUOA 3ABVB 1YJ1A 1T5EA 4DR7L 3VH3B 3BK2A 2D2QA 2AQ1B 3NZUA 1ENFA 2KXJA 1TWFB 2L7RA 5EKIA 4WWOA 1HUNA 1SE2A 1YHBA 4LTUA 5ELOA 4LF9Q 1PFNA 5ELCA 2TSSA 2HD5B 3OG5A 3U2SC 2NZHA 4MN3A
chains in the Genus database with same CATH topology
5CV7A 1DONA 5IODA 1HCZA 1WTXA 2BE5C 4C3HG 3AE9B 5T1IA 1WTVA 5KNBA 1CTMA 2MEKA 4LJZC 2JYEA 4KD4A 3LX0A 3ONAB 1UWXA 1SYDA 3NE5B 3NXWA 1MI2A 2F0OA 3VYRA 4M8AA 1AP0A 2R3ZA 1JOKA 1DOMA 3W3AA 3SK4A 1FXIA 4DK0A 4WJWA 4HCEA 3GTGB 1B9NA 1NUCA 1LACA 2B2UA 3ZQ4A 3LWEA 1A2TA 1M8AA 4OO1H 3MC0B 4DK1A 2XWBB 1BDOA 2N0SB 3EJIA 4OVZA 1A2UA 2E2IB 2A6HC 3TP8A 5KRUA 3DEOA 3S15B 2L1AA 2PVOD 3HRDD 2SNSA 1O80A 1SJED 2WXMA 3T4AC 3HOWB 1HTPA 2EY1A 1F9SA 4KKUA 1H9MA 5HG2A 4P6VF 1EM7A 3QOJA 1I4QA 1YN5A 1PZID 3EQLC 4G57A 4KY7A 2V3PA 1DM0B 4G7OC 1JC7A 3G7LA 2WXQA 2PW7A 1Y8OB 1QQRA 1AYFA 4XIGS 5E1FA 1Q10A 1MVKA 4NJCA 2DLBA 1D5ZC 2NBFA 2AUJD 3ZJTA 2F1MA 1NR2A 4IUPA 4B0EA 3A7LA 4XQNA 4K2LA 3WOFA 1PYWD 2BOSA 4V0BA 2GI9A 3CWIA 3TMEA 3CKIB 3GD7A 4DN4M 4AS1A 1WD1A 2F0UA 3C8YA 3DHQA 2BW2A 1BCPB 3Q24A 2K0PA 1PRTD 4GDLB 4Q5VA 2LUMA 5E6JA 4CBVA 3P4SB 1EY6A 2WXPA 1TY0A 4DNRB 3I9V1 1VMPA 4CGYB 1SSOA 4I65A 4X3SA 2L11A 5CV5A 1SNDA 2YEPF 3ZJUA 5CGKA 4J8QA 4YSZB 3NVYA 3FILB 2PNRC 4C2MB 3M3YB 5A35A 2RSOA 3U4EG 4LMQD 1F9QA 1CZWA 2PYKA 1STEA 1RKNA 3KUPA 3LYYA 5LNK1 5TSSA 1B4OA 3IT6B 1DOXA 3NP8A 3K59A 4RKLA 2L1BA 2PTLA 3HZXA 1C4CA 2N7JA 2BB5A 5JAVA 2WXLA 4K6DA 1STAA 1ZEQX 3OIPA 3UI3A 4B0MA 1SYEA 5F2DA 2EJGC 2K6AA 1AW7A 1YNJD 2CVRA 4RHSA 4PV1C 4JE3B 3S1NB 2K28A 1TS3A 1F2YA 3BG3A 1BR9A 3AE7B 1TWGB 4OW0A 1XWEA 1NSNS 3QG1A 2B2YC 5KEEA 4ZUJA 4KKTA 1S5DD 2N88A 1FFVA 1TVXA 4A3IB 1E7PB 1O7LA 1N62A 2M00A 2EYMA 2EE1A 3B9JA 1ZPSA 4J3OD 2KCCA 4A3JB 2JSOA 2F0FA 2LKVA 5ELDA 2WXOA 2WXKA 3GB1A 3FRPB 4ME5A 5C5MA 2WKCA 2SEBD 3BVMA 2LFIA 4OZCA 4FYDA 1SEBD 3DWPA 3TZUA 3SR1A 5FR3A 5AFWA 1EFID 3EA6A 4QF4A 1OO9B 1XYIA 2F0QA 2IGHA 1D2BA 3GTLB 4LK1C 3AE6B 4JPSA 2L0CA 3NK9A 4IFDG 4ZLTF 1ICWA 3EUB2 3OPOA 4N6EB 4USAA 1DGJA 3EVQA 4JWSC 1B3AA 4ZHOA 1FNVA 5I9OA 2PQEA 1X32A 2N9KA 4CJ2C 3HVDA 2NVXB 3NS1A 2B2WC 1VJKA 3N6RA 5T8IA 1N5WA 2VXWA 1TU2B 1RM6C 5IT9L 3S1RB 2JX5A 1JR0D 3QIAA 4FF1A 4LAAA 4HKZE 4N58A 4ZQ3A 1N60A 3Q0AA 1UWMA 2MJ3A 3RMHA 2F0JA 2A6HD 5KNCA 1RD9D 2SOBA 3CRKC 1QOBA 4RF0A 1F0ZA 1PXUA 3J9CA 3K5NA 4EE2A 1II3A 1BNZA 3BWUD 1H9RA 4WURA 3TP7A 1B9MA 1TQOA 4FF4A 3AEEB 3MJ5A 2RMMA 1SE4A 1C4AA 1HHVA 4AQ7A 2M2LA 3PMFA 4HTHA 3SK6A 5M9OA 2MJEA 1I4XA 1XX8A 4KJNA 3FMCA 4KMUC 2KA7A 2XN9C 2Q8IB 3AEAB 2W3RA 3VYSA 3BDCA 4RGNA 4FF3A 2FFKB 2JSVX 4OIKA 4NAWB 4RF1A 2NN6G 2WXGA 5HHDG 1UGJA 2MH7A 2B2YA 1YN3A 4ABNA 1PDXA 3OWEB 1EZ6A 3DEPA 4TQ1A 2CQAA 3TZDA 2VUMB 1C4QA 4IFDI 4KN4C 4F8MA 3KLSA 1JWUD 3QO2A 4XXEA 1WTQA 1LTGD 2W54A 3RZDB 1I3QB 5FLXE 2ON8A 5EJWA 2RA4A 1ENAA 1TR5A 3DWMA 2A69C 3I4LA 4JBWA 1MHXA 2V0GA 3IT4B 2OXPA 1SBBB 2BS3B 1EOTA 5FO9B 4BWGB 1BUIC 3VRBB 1QOHA 1F77A 4N59A 5EE9A 1XF5L 3BVGA 3V3XA 3NBIA 2IT1A 1D6EC 1B9RA 1KAAA 2E75C 4EQNA 1NENB 4XE0A 3VRAB 3ZYYX 4K14A 4OZBA 2Q8RE 2BS2B 1MHHE 4K6LA 2IJ0A 3SFDB 1CA6A 1MD2D 5IGEA 2AQ3B 5HGTA 2RSNA 1TKGA 3Q23A 3TUOA 2WXNA 1TT2A 2X6LA 1F2ZA 3FILA 2F0IA 1CQVA 2B2WA 2G9HD 1CJEA 3HUIA 3E56A 3W2DA 2K7VA 2BA0A 1EZ8A 2BBCA 2CHBD 2NYZD 3H09A 3VQIA 2NN6I 3FEWX 3EROA 3QWNA 3PIO3 4IKGA 4CQNA 4IFDH 1FFUA 2V4IB 2O5IC 2L32A 4RGOS 1PGAA 1OXSC 3MP9A 1ESRA 3IXSA 2DYOA 3AE5B 1SB3C 2WDRB 4R8NA 1R9TB 3HGBA 2F0WA 1CM9A 4ZAIA 1I4GA 2YU9B 4YXDB 1BCPD 1G291 2O4XA 2JA7B 1Q12A 3GO5A 3T3OA 2V3NA 2EYLA 1TIID 4YSXB 5EKKA 1TY2A 3D31A 2H88B 4KD3A 2MHVA 1O7ZA 1JROA 1A3UA 1QOAA 1Z6HA 3X3MA 4A6QA 1EY9A 5DM73 2PKOA 4HJGE 2KECA 2B8FA 4WWMA 3GS2A 3D3RA 3SXHA 5HURA 1ZXIA 3T56B 3AE4B 2OEDA 1U4RA 3IKJA 3T13A 2E3TA 3MXPA 1LTBD 1YNND 2QEJC 5JEAJ 2NN6H 4G7HC 1HQRD 1D1KA 3HG9A 3T51B 1YJJA 5IGCA 2D5DA 2W55A 1E6EB 4C3IG 2DWQA 1OXUA 2FE8A 3N9YC 5T1GA 3AEGB 2WP8J 5EE1A 3VR2A 1PTOB 4RAUC 3D4RA 1KNEA 2J52A 2BCOA 2EDGA 2KJXA 1WGKA 1SIJA 2RQXA 5EQ0A 2ZT9C 4QUFA 4F7XA 2B76B 3N52A 1JRPA 4DQOC 5FO8B 2IX1A 1LLRD 4C56C 3SVMA 3JAML 3IAS1 2RVLA 3MAQA 3Q8FA 4Q0FA 4WRDA 2VZKB 1YMHE 3BIID 4L8JA 1VLBA 1L6UA 2FMMA 1WTPA 2X69A 4NW2A 1I50B 3IAM1 1VCIA 2A69D 4CJ1B 1WWTA 5BN3A 1LTTD 3I91A 3T16A 4YSYB 1TJEA 3PZ8A 2HDMA 4HRSA 1KLUD 1KFYB 5D7GA 1STYA 2G1EA 5CBEE 4RWSC 3I70A 1CT1D 1V1OA 1MI0A 1ILPA 3TBIB 1SYBA 2PW5A 2I46A 1KABA 1AFPA 1PZKD 4DFAA 2K05A 2B63B 3U52E 3E0JA 1TWCB 3PUZA 5EBCA 5I9PA 2F0MA 1GUNA 2NVTB 1GPXA 3M7NA 5C4XB 2QMTA 2PZWA 1V8CA 4QB4A 1HEZE 4C7ZA 1VF5C 5I4DA 1J9OA 3VR9B 1XO3A 1RFKA 2KEDA 1SYGA 5HFYA 2R7ZB 4K8IA 4MT5A 1PTOC 2KAJA 1TKEA 2EYFA 1N63A 4X3TA 2K5PA 1SNMA 1H9SB 2L12A 5EKLA 2K5QA 2PO4A 2FINB 2A68C 2WKDA 2MPMA 2JA5B 2Z1CA 4EQOA 1V8QA 3IFDA 3SK5A 3VR4A 2X6GA 2KQ3A 1PFBA 1HUMA 1QKZA 3NTKA 4WIPA 3K0YA 1PFMA 1AZPA 5C5LA 1KNAA 1BBXC 4UDUC 1NYRA 1SJHD 4BBSB 2QF7A 3KK7A 1P7EA 2KMMA 3RZOB 4A55A 2D2CC 3S2HB 2K3UA 2PCFB 4CJ0B 2QKIC 2F0EA 5C4ZA 3GTQB 1FCLA 2DYMA 3A55A 2HCIA 3B2GA 1G2SA 2IGGA 2Y5CA 1GUSA 3UI2A 2F03A 3NRZA 4KHZA 1UEAB 3S16B 1EYCA 4B08A 2JYOA 2K32A 1U4PA 1TWAB 4QCLA 3MWYW 2JP1A 1XXGA 3AE8B 2QSDA 2K04A 3HS0C 2XVSA 2TMPA 1FEHA 2WXIA 4OHJA 1JQYD 5C6AA 4KJOA 2EELA 4P16A 2I07B 1PDQA 1FIQA 4E6IA 2PW9A 1ET6A 1QJOA 2OHFA 5CMDA 3PO2B 1OQRA 2K03A 4QUCA 4FXCA 5FKAC 3D4DA 1F9RA 1G91A 1BMLC 3L3OC 2NTSA 4A3BB 1E2ZA 1SXTA 1SNQA 2PMVA 3X3NA 3E5SA 4H0LC 3BYYB 2LS01 3MFGA 5K5PA 1BQQT 1PFDA 1BO0A 4OZAA 1SYCA 3PO0A 1T3QA 1STBA 3TDQA 1G8ZD 3MXUA 1Q8IA 4KKIA 4ODGA 4ZKCB 2B2TC 3R2TA 4HROA 1BXTA 5A2QL 3OMGA 1AN8A 3AV8A 1N61A 5KYLA 2QIEB 3ND8A 2RDGA 2IWHA 5COYA 1LV9A 3KBXA 1DOKA 4TSSA 1EEFD 3NHHA 1QT9A 4IUTA 5CV4A 3P4QB 2VNUD 3HOXB 1DZ1A 3W5VB 2L83A 5K36G 1WRIA 5BN4A 2FMCA 2H1EA 5CC4A 1GUWA 4WAFA 2R6GA 4KGSA 5IGBA 3M85A 1QLBB 1J7CA 2EY5A 3VR8B 4RNAA 1PTOH 1JORA 3GTPB 1V1PB 3P63A 2CW0C 1Z7TA 5G3LD 3GV6A 4KK7A 2WACA 3KLSX 4IOIE 2NZ1D 1MSGA 5M5XB 4ZKBB 4ARIA 2K5DA 1GAQB 4BY7B 1C77A 5BMGA 4B9WA 1HTLD 1VDVA 4HSVA 2JU6X 3RD4A 2X38A 1ZP0B 2L55A 1BUVT 2L52A 3NVZA 4PT5A 1N5XA 2WINB 3K5OA 5BN5A 1HFGA 1IKMA 3AB5A 4KX6B 3MEHA 1STHA 1VDZA 2GA4B 2SAKA 4KY6A 2Q8TA 5HI1A 2KACA 1QWYA 1LTSD 1FRDA 1K83B 2XWJB 4O42A 2A73B 2VB3X 1WYGA 1A15A 3F2UA 4DF7A 3OOCA 3P1HA 4RGMA 1RCVD 1PTOD 3P4PB 4IDIA 4F87A 5C3EB 4CKCA 3J81E 1QNUA 3C1EA 1BCPC 1JWAD 3C46A 2A68D 3P75A 1GOZA 4FP5D 3VR6A 5JEAG 2FBWB 1FYCA 5KIXA 1KDAA 2HQEA 5CV6A 1QB5D 1LT5D 4V190 1PRTF 1MSHA 3NUCA 5JVG3 4HAEA 2VZKD 5CR3A 1S5BD 1JWSD 4K2KA 1B53A 4NDXA 3CQZB 3A7AB 3H0GB 3L9AX 2F0NA 5I2XA 5D3DA 1DXMA 2KVMA 1Z47A 2PZTA 5E4WC 1B1ZA 4A93B 1O7YA 1YNNC 2F3VA 1CFMA 1HA5A 2WDVB 1XCQL 1KDCA 2E2HB 2M0AA 3AMZA 3H8HA 4KI0A 1ZE3D 2PMZB 5EE0A 2QCPX 2E6XA 1FXAA 2F0SA 2KUMA 2C5CA 1FO4A 4DXGA 3BZDB 1AWDA 4ZUIA 4RHRA 4YWGG 1XTCD 1CHQD 1EU3A 4YTNB 1AEXA 5E4XA 2M56B 1D4BA 4CHTB 1SAPA 3MHZA 1OXVA 4CKEA 5IGFA 3SE0A 1ZDVA 3RPFC 3PZ7A 4XWTA 5K36H 2L9HA 1SNCA 4RA8A 1IYUA 4RGTA 2YEPB 1R7SA 2WB1B 2LJIA 4IUVA 2M19A 2B39A 3NZ3A 1JALA 1HFNA 1RTNA 2Y5PA 1ENCA 3S1QB 2F0VA 4TQUS 1FM0D 3P1MA 3M4OB 5ELBA 1FNWA 1S5ED 1Y69U 2MGSA 3FVQA 1MPEA 1F9PA 1VZ8A 2AWOA 4DGZA 2JXMB 3E6ZX 1OFFA 1SFOB 1IL8A 1D5MC 1KTKA 4TRDA 1EWHA 3IFTA 1KDBA 2ID0A 3BVZA 1UAPA 1YQ3B 4XYOA 1L5PA 3M4YA 1U4MA 5G5HA 2QDBA 1CK1A 2J42A 1RDPD 3HKZB 2CW0D 4L2YA 5DAUA 2HDLA 3NWSA 4ZK9B 1J8IA 1XLOA 3J80E 4L63B 2DNCA 2MJDA 3K57A 1JICA 3A8IE 2F0GA 2WLBA 2A6ED 3MXGA 2C9OA 2LEKA 3SEBA 2J0TD 3R2IA 2CU3A 1LTAD 4WORA 2JQRB 3NQIA 2OEOA 4AYBB 1U4LA 1IKLA 5KYIA 2AX5A 3CIRB 4A90A 2H4OA 1L0VB 1V1PA 3AMUA 3AEFB 4NAMA 1VR9A 4C3IB 5JEAH 2W82A 2YYZA 1QF6A 3FPPA 1WTWA 3LXFA 1IW7D 1L0YB 2NUCA 2EZVA 1K8MA 5C0XJ 3AE3B 2ZXPA 1SMYC 3Q8BA 5C3WA 1FMAD 1EL0A 2KDMA 2IDYA 4IQZA 2EJMA 4C3JB 5IOCA 1TZOA 3MHBA 4GLSC 3FDTA 2WS3B 5FK9C 1HZ6A 2BTEA 3NWTA 3ETRA 2EVBA 2J53A 3K5MA 3E9SA 1JWBD 1VZ6A 2Z4HA 3KQ4A 4DXFA 4KKJA 3VR3A 4FF2A 1VMCA 4MM3B 1LT6D 2ACZB 1RHPA 4ILWA 3PV0A 4DA2A 4A8XC 1GB4A 1CA5A 1EY4A 1WTOA 1CHPD 2PZUA 1T6BX 1H9JA 2BA1A 3TN2A 2WQYB 3WOEA 2EKIA 1DJRD 1ESFA 1F2RI 4EQPA 2XIWA 1ZYRD 3VA5A 4IZ8A 1LABA 2OT2A 2BB6A 2MUYA 4REZA 4OO1G 3DWAA 1SYFA 2D62A 5M3MB 2I38A 4G4KA 1TYGB 3S2DB 3D4WA 4XDXA 4BA2I 4KV6A 2N9LA 2BYTA 4C3JG 4B9XA 2R61A 2XRQD 3QJYA 4KY5A 5AUIA 1E0BA 4A3EB 3NQTA 3A8KE 2RKSA 2LGIA 1H9KA 1EU4A 1QILA 1Q90A 2N55A 3L7ZC 2WXRA 2Z8LA 2JYTA 1E10A 2F0TA 3NUHB 2IGDA 2DY7A 4DNTB 3PIP3 4A3FB 1LT3D 3GTKB 4H2AA 3I4MB 3Q8EA 3DXJC 5D14A 5EGTA 4Z9CB 5M3FB 3GTMB 3SR6A 5FOBB 2NTTA 2NMQA 4HEA1 2V4DA 4M0WA 5FLXL 2NWGA 2Q5WD 5GXGB 4L23A 1SDFA 1BCPF 3S17B 1ZXTA 3PUVA 3S9WA 1OQQA 1LO5D 2ZXRA 4FO2A 3RUZA 1NVID 3V05A 4A3KB 1EY0A 1JMLA 1YNTE 5DEHA 4HCSA 2EYPA 4M1UB 2K9XA 3H91A 1YJIA 4X3KA 2JEAI 3FC4A 4OO1I 3K5LA 4DAYA 1QG7A 3ERQA 2ZW1A 4NKLA 4PNYA 3TP6A 2O2LD 5CYUA 5BYSA 5LL6X 3KLRA 3P7JA 4FXKC 4IUNA 1ML0D 4C1NI 1TWHB 1JCKB 3MXNA 1FCCC 4YIJA 3TEZA 1CQFA 1D5XC 3GTOB 2WXHA 1EY8A 4ZYSA 2KOLA 5CV9A 2BT6A 5LL6S 5JPNC 2PIAA 1FNUA 1B44D 3BDOA 1DOIA 4XT1B 4KKSA 2XNAC 4NMZA 2DY8A 2I2YA 2IL8A 3QB3A 1FRRA 3QOLA 4ZHPA 3SHLA 1EQVA 1HQMC 4I7ZC 4YTMB 4LLGM 1A6XA 1HZ5A 1S4ZA 3CU7A 1SMYD 1PMRA 3A56A 4HEDA 3HRZC 1Y56A 1ET9A 2KWDA 1VF7A 1DOLA 2ICEC 2A74C 1L0XB 2RBMA 4PMWA 5EPJA 1RJTA 2LMCB 3L4PA 5DM63 2ICIA 2ZXOA 1MGSA 5C2TB 5M5WB 4A3DB 3A54A 3I73A 1DD2A 3I90A 4R8IA 1FGBD 1VRAB 3I57A 5IT9E 4IURA 2K5WA 2DN8A 5NUCA 3R93A 5C44B 3NPPA 1DYQA 1GB1A 3KWLA 3S1MB 1C9FA 1ZDXA 4XQQA 3VYTA 4KN7C 2K22A 3GP7A 3AH7A 2O5JC 3H3VC 3LWUA 3NTHA 5EPLA 3J7YW 3I4NB 2Z4IA 2CJNA 1A70A 2KN4A 1IGDA 3PUWA 4N9TA 4FNFA 2AQ2B 3RLFA 3G6JB 1K53A 4HMIA 4JK1C 3TEXA 3W5UB 1DOYA 2GB1A 3W1SA 3HVZA 4F88A 4TQ0A 3AN1A 4YTPB 4QMGA 1HRJA 1FR3A 3R3OA 1UNSA 3AEBB 4X3UA 2BS4B 1EWYC 1WVLA 1JW9D 1KF6B 3PO3B 4J1MA 1FD6A 3KWVA 2W3SA 4K5XA 1JOOA 2XSCA 4MACA 4Q2JA 2EJFC 3PUXA 2FJ2A 3HOZB 1TS2A 4PMBA 2E2JB 1YQ4B 3WCQA 4GZYC 1Q1EA 1WTRA 3KF8A 4C80A 1QCBD 3HOYB 1HXYD 1G2TA 3GV3A 4PMCA 2A5HA 5ELFA 5JVH3 4TKOB 4OGQC 3PUYA 4KGTA 1ZXHA 1IYVA 2EYJA 3TEYA 4IALA 1I4RA 2Y3AA 2KEEA 3OHXC 3IAYA 3K7AB 1RODA 3ZGZA 2E76C 4MHEA 3Q8AA 2SNMA 3OW7A 3VR5A 2B8GA 4S3SA 4ZRQA 1W6KA 2WU5B 1JQ4A 5C0XG 2INNE 3ND9A 4CKBA 2IPKD 2A6EC 2R92B 1XLNA 2WXFA 2F0KA 1TS4A 1C4PA 5I6YA 4TMAB 2M9VA 4HR7B 1GUTA 4HMJA 3MVVA 2J7ZA 2EYOA 1C48A 1EWCA 2NB0A 4FXDA 1Y1WB 4JWUC 4KGRA 1GHJA 2F0LA 2G9DA 4EGVA 3HOUB 1CZPA 3HOVB 3AE1B 1IW7C 3NTIA 1LTID 4U68A 1IHZA 5BMHA 3D8GA 3DUZA 1X3PA 2K01A 1SNOA 1NYQA 1S5CD 4ZOHC 2H89B 1I4PA 2R93B 3U9SA 4NP5A 2FHTA 1RTOA 1TKWB 1I7HA 3C2PA 1G6ZA 1RWSA 1B50A 4BS9A 2AUKA 3DMUA 1C78A 3TEWA 2JZPA 2HDEA 1ONLA 1BOSA 1Y1VB 5CV8A 1KRHA 2QILA 1DCZA 4HN7A 4MH8A 1JE4A 4US9A 4ZRZA 1NI3A 2BE5D 4US8A 1E2WA 1NCVA 4NZLB 3TSSA 4L1BA 5JJZA 1IUEA 2HTME 2JXTA 3HP3A 2B2TA 1H9SA 3Q22A 5C0XI 2D5GA 2L5TA 4XDCA 4XT3B 1J7BA 2IX3A 1IBXB 3Q6SA 1ZKOA 3FKIB 1A3VA 1QE6A 5D65A 1UUPA 3S14B 1XEEA 1VZ7A 2WP9B 2XRSD 1SF0A 1ZYRC 3LB8C 4MIUA 4H7BA 3U9OA 5I2YA 4DAVA 3EGRA 5G3LF 1YN4A 1K52A 2EPBA 2ZW0A 1PGXA 2L4NA 1QOGA 4XDDA 2LMCA 1Q3LA 5M5YB 5DNFA 3ZJVA 1O78A 1T5XD 3BK1A 2WNMA 1EYAA 2WIIB 2SDFA 4P2CB 1EQTA 3WDNA 5IGGA 4RFBA 4RKBA 4O1NA 4RH6A 2PPBC 1V97A 2HUGA 2WDQB 1NR4A 4WQMA 3GQBA 3I8ZA 4C1NK 2JA8B 5IIFA 4XWWA 2JE6I 2F0HA 4H44C 2E74C 3IL8A 1SNPA 3JAME 1I4HA 4Y7NB 1GJXA 1F2LA 2JA6B 1SE3A 3T53B 5BYQA 5KGUA 1PTOF 3AM9A 3SK8A 5C0XH 3B2FA 5H8YE 1JB3A 5C3JB 1K50A 1Y8NB 5I6WA 4GDKB 5H92C 3U7ZA 2EYHA 2ONQA 1W6JA 2Y0SB 1XLQA 2WXJA 4UAIA 5EE3A 3ITPA 5BYRA 1B2TA 4R3DA 2RPVA 3VYUA 1L4DB 5EPKA 4RCOA 4XYQA 1E0ZA 1I6HB 2OF1A 3BYTB 2F3WA 3V2TA 2BDOA 5BMIA 1L6VA 3P4RB 4WH4A 4PQXA 5G5GA 2WAQB 1C79A 3TP5A 1GHKA 4G7ZC 1K51A 1Q1BA 4C7YA 3HEJA 2JEBI 1ZUD2 3FPUB 1QNKA 2MP1A 1WXQA 3OWFA 1C76A 4ULLA 5JXVA 3FAHA 4HKQA 3W9CB 1PUTA 1EIHA 4RCNA 3NVWA 1ACCA 2K1BA 2WV6D 2LFNA 3J7AF 5E3FA 1C8CA 1F2RC 1KLGD 1IGCA 1D1IA 1ROEA 4YT0B 2ENBA 1TS5A 4IN3A 1LTRD 3D6CA 5C3XA 5CBAE 1LT4D 1PRTB 4ID6A 1GUGA 3MZ5A 2B2VC 4DAPA 5C4HA 4J6HA 1HPCA 4K8JA 2DBYA 3P42A 2F0DA 1R4QB 1NEKB 4FXGC 3LNNA 3K58A 2F0PA 1RYJA 2KHSA 4H13C 5J39A 4BA1I 3J81L 3SFEB 2LY7A 4HSPA 3R8BA 1EEID 1NAPA 2VB2X 1FD7D 3H6MA 4WFN3 1ILQA 4IUQA 1XCTL 4A9AA 5CORA 2EY2A 3CHBD 1GXDC 2E2DC 1EYDA 3EFXD 3OSOA 4K5WA 2F4IA 4BBRB 3P20A 3URYA 3OIQA 3KBGA 3NBHA 2EXZA 4KTAA 3NSWA 3A8JE 2QJLA 1A3TA 5JOBA 3K6OA 4EVOA 3MFYA 3OMCA 3H94A 1I6VC 4R9WA 4QIWB 2KQ4X 4ITKA 5ISRA 3C3LA 4ARCA 3AE2B 3SDZA 1IBXA 4IFDJ 1OXTA 4LK0M 1EY5A 3T3NA 4U673 3DM1A 1R4PB 4XTCS 2NVYB 2JWUA 3NVVA 5J22A 2WU2B 1JOQA 4DU9A 5A2QE 2LHEA 1BF4A 2B2UC 4D2KA 5D3IB 1GUOA 4BY1B 1P7FA 3C1FA 1Y8PB 1RF2D 5EBDA 1X3QA 5JPMC 1PRTC 2RDFA 3MA2B 3Q8CA 5IGDA 4K5VA 1WD0A 3AECB 1E9MA 2K33A 4N9PA 1EY7A 1M4VA 2AWNA 1V43A 1STGA 3DWQA 2LHDA 2RDHA 1J7AA 2CJOA 1PZJD 5ELEA 4C3HB 1HA6A 1QOFA 5KNDA 2KCNA 4ZRPA 2HCCA 2INPE 3AU7A 3D6WA 4IUUA 1WCMB 1S5FD 5FO7B 1CI3M 2EOTA 3MTSA 2PVGC 2B2VA 1PLFA 1KH0A 1WSPA 2MJ8A 4OIJA 1CZGA 3J7AV 5MPOA 1OXXK 2GRIA 4XQJA 1YNJC 1F2MA 3AB9A 5LHY1 1XLPA 1EIGA 1MBYA 1STNA 4OL7A 4FVMA 3V96A