1UUPA

Crystal structure of a dimeric form of streptococcal pyrogenic exotoxin a (spea1).
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
221
structure length
221
Chain Sequence
QQDPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYLTDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDSNTSQIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EXOTOXIN TYPE A
publication title Crystal Structure of a Dimeric Form of Streptococcal Pyrogenic Exotoxin a (Spea1)
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Toxin
total genus 58
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1uupA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1uupA02
1SE4A 3DWPA 4RFBA 4TSSA 1D6EC 4BWGB 1I4RA 2G9HD 1LTTD 2RDHA 5ELBA 1PTOB 4C56C 3BYYB 1RDPD 3BZDB 1I4GA 1JWSD 4OHJA 4RH6A 3V05A 1PRTD 1HXYD 5I4DA 1B44D 3BVGA 1SE2A 1M4VA 3BYTB 1PRTB 2RDGA 5ELFA 1JCKB 1LTRD 4L6TB 1LT5D 2R61A 2SEBD 1ENFA 1LLRD 1UNSA 1F77A 2QEJC 1D5MC 4DXGA 1JQYD 1XTCD 1L0XB 1PTOD 4RGNA 1EU3A 1QILA 3O13A 1BCPF 1KLUD 1XXGA 4O1NA 5TSSA 1LTAD 1EEFD 1LT4D 4NZLB 3EA6A 1MD2D 5ELCA 5FK9C 1I4XA 5D3IB 3W2DA 2QILA 1PTOH 4ZYSA 1CQVA 1RD9D 1ET6A 1CT1D 2O2LD 1BCPC 1CK1A 4RCOA 1HQRD 1I4PA 1LTID 3GP7A 2AQ2B 1S5DD 1I4HA 1EU4A 1G8ZD 1CHQD 2IPKD 1L0YB 1RF2D 1BXTA 1TS4A 1PZKD 2TSSA 3R2IA 5ELDA 1LT6D 1S5FD 1PRTF 5FKAC 4DXFA 2AQ1B 1D5XC 1TS5A 2NTTA 2XN9C 3URYA 4RGTA 1T5XD 1AW7A 1STEA 1YN3A 1CHPD 1KTKA 1BCPD 1RCVD 3BVMA 1V1PA 1LTBD 1JWMD 1LTSD 3BVZA 1SXTA 1FNWA 5ELEA 3SEBA 1S5CD 1FGBD 4RHRA 1LT3D 1SEBD 1HTLD 1V1PB 1I4QA 1ESFA 1YN4A 1BCPB 1GOZA 1S5ED 2XNAC 3EFXD 3R2TA 1FD7D 1PTOF 2CHBD 2ICIA 1FNUA 3R8BA 1TY0A 2Z8LA 1SBBB 1YN5A 1TY2A 1V1OA 1EEID 1PZID 2WV6D 1LTGD 2J4XA 1ET9A 4K6LA 3OWEB 1AN8A 1JR0D 2NTSA 1LO5D 1DYQA 3DWAA 4Z9CB 1PTOC 1S5BD 2IJ0A 1SE3A 3MFGA 3TSSA 1PZJD 3MC0B 2XRSD 1D5ZC 1EFID 1SJHD 4L63B 1EWCA 3CHBD 4RGOS 1UUPA 1TS2A 1PRTC 1PYWD 2AQ3B 1DJRD 4UDUC 1FNVA 4RGMA 1KLGD 1JWUD 5D3DA 1SJED 3DWQA 4RHSA 2XRQD 1TS3A 3KLSX 1B1ZA 1HA5A
chains in the Genus database with same CATH superfamily
1XNQL 4KV2A 4DNRB 4P1BC 5C6AA 1YHQA 4UY8C 1BR9A 3V62A 4ANUA 4X62Q 1PTOB 2DY8A 4QIWB 3LWUA 1B53A 4AQYQ 3KUDB 1D2BA 2FCMA 4F7ZA 1V97A 5LMUL 3P1MA 1WFQA 3V05A 2F3IA 4RAUC 2V9HA 3HP3A 1B44D 4BBSB 3FMCA 1ESRA 2ZXOA 3NBHB 1J7CA 1E24A 1Q8KA 4LK1C 3AEFB 3J7AF 5JEAG 1K8RB 4EZLA 2VZKD 3VQIA 2MNAA 1PRTB 1G6ZA 4DR6L 2ZXRA 5EBCA 1JCKB 3EJIA 1LQBA 4LF6Q 2LZ6A 1LTRD 4L6TB 1LLRD 2BVCA 2J7QB 3TP6A 4G4KA 1SGHA 1F77A 2F0NA 4W9DA 3WAPA 1DOYA 2A6HD 2K33A 3CKIB 3QCAA 2KMAA 3S1MH 4X57B 2IHFA 3SDLC 1PH9A 1X1MA 2ASQA 1IYUA 1STGA 2E2JH 4GKKL 2UWQA 3GTQB 4XGAB 4DHZE 2SNSA 1IW7C 4LF4L 1UEAB 3NVYA 4NAMA 2INPE 4BXXG 4ZRQA 3L3OC 1VQ7A 2XIWA 3H94A 3PUYA 5CV7A 4MTNA 2CH4W 5ELCA 2WKDA 1WF9A 3ML8A 1KABA 4A3MB 2W82A 2D5DA 4DDID 1VQBA 3MJ5A 2N88A 2A6ED 4WJWA 1BCPC 1PFSA 3A5ZB 3EFUA 3AECB 1H9MA 4XWTA 3ER0A 4PV1C 3BG3A 1WX8A 2BH8A 5HI1A 2IT1A 3R7RA 1RL2A 3EIVA 4BXXH 1KAAA 4AWJA 5D65A 2F0LA 5M5YB 2L8JA 4DV2Q 2OTLA 4FA6A 1QCBD 2H1EA 2E2HH 2KFJA 3VYSA 2EYOA 2KWCA 4TQ1A 3M3YB 2ACZB 1QF6A 4BBSG 5JJIA 4IN3A 2KHWB 3P63A 4KGRA 1D3ZA 1SYFA 4AP4C 5IGDA 1W2BA 1R9TH 4BS9A 2JX5A 2L5TA 4W9KA 1NUCA 4HTHA 4JOIA 4J3OD 3SEBA 4WJOA 1IXRA 4YSYB 3AE1B 1UAPA 3RMHA 1P3QU 3OMGA 4M0WA 1OXTA 2MBQA 1EQQA 1BCPB 3DLLA 1GOZA 2KA7A 2Z59B 1GNUA 5J18A 2BE5C 1HNWL 1WXAA 2NVXB 3U50C 3EC8A 1ENCA 2KQ3A 1WJ4A 2XK5B 1WYWB 3AFQA 3NENA 1TQOA 1GD7A 1GXDC 1SDFA 1Q1BA 2B2TC 1TY2A 2HHHQ 1V1OA 3PV0A 3UDIA 2EZVA 1KD1C 1E7UA 3IG3A 1QZHA 3C1EA 1A8VA 1LTGD 1WI0A 1BBUA 2J0MA 5K5PA 2OT2A 3RZWC 4NJ7A 3WANA 4LDTD 5J1ZA 2RDFA 1A3UA 4JYAL 2WGSA 3L10B 1WX9A 4APVA 5LMUQ 4AOFA 1KRSA 2A68C 5IYDH 3DVGY 4ZRIA 2MA9B 3A33B 2XRSD 2MJ8A 4A3KG 1M8AA 1VD2A 4PG3A 2WAQB 2HIVA 4W9EA 1EFID 3GTGH 4K8JA 2FHTA 1D1KA 1K8MA 3VYRA 4IPGA 2M4NA 4P1CC 3RNFC 2B2VA 4GB9A 1N32L 1OXSC 4GLXA 2MBEA 2K9XA 3L16A 2Y5BB 1L2FA 4DWFA 3K5LA 1C0AA 2DYOA 2L0TA 4YSZB 1K8AC 2LEKA 1RFAA 4CDFC 3QO2A 5JOBA 4A3KH 2KLGA 3AE3B 3SR6A 4QIWE 4DV4L 3PLUA 1NSNS 4EE2A 3LNNA 2KEDA 3QAQA 3SDZA 2YVCA 3H0GB 4DR1L 3HOWH 2K5QA 3HM3A 2BYEA 4W9IA 1KLVA 1XPUA 5GROA 1KRTA 1STBA 4UP8A 1YJIA 3GTLB 4IQZA 2G3QB 1WVLA 1XO3A 2X6GA 2WB1B 1G6JA 2KT7A 2FE8A 1V9PA 5GXGB 1ILQA 1JC7A 2L0FA 2MGSA 1N60A 5JZEB 3TEHB 5L37A 2R7DA 3Q69A 2PI2A 2VQEL 1N63A 2JY6A 2CCZA 5M5XH 2WX0A 1SAPA 1QKZA 3K5NA 3D8GA 2JA7G 4KSLC 1V43A 1F1HA 3NQIA 4LFAL 4FN2A 2M56B 2IHEA 2HTME 1IUEA 5E6PA 2AWNA 4HN7A 3HOZB 3QJZA 1XXGA 3TBLD 4A6QA 2SNMA 1C7YA 2M0XA 2WXJA 3WA0A 2WAQG 1SNQA 4HR7B 3DWMA 2SAKA 3HIZA 4HROA 2H4OA 2KECA 4HEA1 2LFIA 4JI5Q 4YCWA 4KN4C 4KHZA 2XK5A 2K52A 1UZXB 2JA7H 2NN6I 4DQOC 3H91A 2ZJRA 4GN3B 3GTOH 4G57A 3IAS1 1VF7A 2V1YA 3S14B 1DOMA 2LJ5A 4AJWA 3JSVB 3TN2A 2KTFA 2MUYA 4M8AA 2EJFC 2LVQA 3VFKA 3NVVA 2A5UA 3BINA 3VTUA 4AJYB 2PO4A 3MP9A 4XQNA 1IBKQ 1GKHA 4BY1G 2D62A 2XN9C 5FLXc 4UP7A 3T3NA 2L7RA 4P74A 5FR6A 2MHVA 3WAOA 5I2XA 1QLBB 1KTKA 2O2VB 3DHIC 2UXDQ 2WB1G 1WH3A 1V1PA 2FMCA 5BN4A 2RR9A 3V6EB 1HHVA 1G2TA 3DHGC 1IBLQ 2DYMA 4URKA 3FDTA 1HTLD 2K05A 4CKBA 5CV5A 5I9PA 5LNK1 4C2MH 2KOXA 1FPYA 1HTQA 5FLXE 3EFXD 3BK1A 4FHKA 3FILB 4BY1H 1VRAB 4GNXA 3HOYH 4IFDH 2WFWA 4ZHPA 2VH1A 4PMCA 2MBBB 2AKWB 2WX1A 3EFCA 3HK0A 2B2UC 3PS6A 4LF5L 3HOZG 5KNBA 3LWEA 4B3MQ 3ZUNA 1ET9A 5JVH3 3ULLA 2I38A 1GHKA 1AN8A 3Q8DA 2JQOA 5IT9c 2EDGA 2PMVA 1CSQA 2Z1CA 3U52E 1QWYA 4Q5VA 1YHAA 2WAQE 1TWFH 2I1JA 2RBMA 4L63B 1I6VC 5IT9E 1Y1WH 2Z4HA 1UGMA 5M9OA 1BBXC 4C3JB 4ME5A 2FUHB 4K0KL 2RA4A 2NVUI 3A7AB 2CJNA 2JEBI 4YTPB 1K83H 4YIJA 1YI2A 3QK0A 4R9WA 3CCLA 2JZ3B 2KKCA 4IW0A 2DWQA 3JAML 1KH0A 1C8CA 5IIFA 3G71A 2ZM6Q 1A3VA 4A3JH 4NXNL 1IKMA 3BS1A 2EKEC 2QW7A 3IFWB 1GM5A 1F0ZA 2KOLA 2G9HD 1BBWA 4NAWA 3E3XA 3ML9A 5C5LA 4CDCC 1X3GA 3QG1A 3PIO3 2A6HC 4LTUA 2C35B 1VQFA 1ZXTA 4DHJB 1H9RA 1IKLA 4KTAA 3M3JA 2GMIC 1VQEA 5EQ0A 4UP9A 3LJ3A 3MJWA 2WB1E 4PS7A 1M4VA 1EF5A 3H1UA 3FPPA 3JSVA 5ELFA 4BOSC 1P9DU 4MELA 2CWAA 2F0KA 4Q2JA 1WTVA 3A1QB 1XLPA 2NVYB 2G4DB 2VZKB 2WHIA 1D1IA 3P42A 2A6EC 4RGNA 4UAIA 2JYEA 3TCAA 1QZEA 4EUTA 4LNKA 3RT3B 4MHEA 1S40A 2RHSB 2KO3A 5IGGA 2KX3A 3MTSA 3S15H 5CHFA 1WIAA 5HG2A 3RZDB 1B3QA 5FK9C 4MH0E 3AE4B 4AS1A 4NXML 1EIHA 3ZQ4A 1ZXIA 2DNEA 1RLFA 5LMNL 2IGDA 2EVBA 2K0PA 1P16A 3EROA 1SLJA 4DAYA 1GUTA 1Y8NB 1HQRD 4Y7NH 1GVPA 2DZMA 2GVBA 3APCA 4KKTA 2EJGC 4ZRKA 1I4HA 3P20A 1CHQD 1P7FA 1HCZA 3H7PB 2MX2A 2QC8A 1EYAA 3T1YL 3BY4B 4G7ZC 3ZXVA 4A3GG 1FCCC 2MLBA 3MXUA 1VQLA 3CCUA 5T8IA 3TEWA 2HIXA 2VNUD 1MBYA 5CV9A 2PW9A 4H44C 4W9FA 1SSNA 2VQFQ 5ELEA 5EPKA 2VZAA 3KBXA 2MP2A 1A3TA 4WRDA 2F3WA 5LL6S 1ONLA 4ZUIA 3T1HL 4DGZA 3TRZA 5BYRA 4ARIA 1DZ1A 1B50A 1Z9FA 4A3GH 1N62A 4A3IH 3V2TA 4QGUA 3R8BA 1S4ZA 4JWSC 2JA6B 1K51A 5LHY1 4IDIA 4KD4A 1TKWB 2VH2A 1U5KA 3E9HA 2M00A 1PDQA 4N8FA 5EE9A 1Z2MA 1K53A 2DZJA 2Z0SA 3WAMA 4HJGE 2R92H 2IJ0A 2RHQB 2K39A 1Q81C 1E9MA 5ISRA 3MC0B 3DBLB 3CQZB 1FVIA 2MWSB 3HVZA 4PK1A 1T0RC 4IWPA 4IM2A 3IL8A 3S17H 4LDTB 4S17A 4JI3L 4G7HC 3ZJYC 1SJHD 4K5WA 1ASYA 3A1QA 1F9QA 5A35A 1MI0A 1FFUA 3J7YW 2IX0A 2L00B 3EHVA 3Q2AC 3HGBA 3PREA 3ZRCA 4I7ZC 4DV7L 4ODGA 1TKYA 2K22A 3L2PA 3I63C 2J0TD 2QCPX 5EAYA 2K8CA 4TVAB 5CGKA 1GC7A 2F0SA 3TBIB 4HMIA 4N59A 4KHPL 3P4SB 3W5VB 2PZUA 5DPTA 2FIDA 2KFKB 2DAJA 2EYPA 3L17A 1O7IA 2DENB 3Q8EA 1PFDA 2OOBB 1YBYA 4RG1A 4WH4A 1L1OC 1YJWA 3AV8A 2F0PA 2JA6G 4OZBA 3W5OA 3PCOB 3SR1A 4GLAC 1QQRA 2SEBD 2JA5B 3TP5A 3W1YA 3L0WB 1O78A 1NYRA 3ZKJC 2NBUA 5CV4A 1NTGA 1SNOA 4B3SQ 1PTOD 5IE8A 3TS0A 3OJ3A 4TUUA 4JPSA 5G55A 2H88B 2MO1A 3S2HB 2A69D 4HEDA 2ZT9C 1Y1VB 4FDBA 1ZOYB 4GOPC 1YOVB 1U4MA 2PQEA 5LXIB 3DHQA 5KIXA 2DYBA 2MH7A 4ZRJA 4TKOB 2SDFA 1KC8C 2D0PA 1KM7A 1V8QA 1YNND 1L1OB 2FCQA 4W9CA 1JOKA 1J8IA 4RA8A 5I6WA 4DV3L 1TGZB 4OVVA 2I07B 1AFPA 2RVLA 3T13A 3KYDD 1KAWA 5CTRC 4K3BA 4B9XA 2A19A 2BKRB 2BTEA 3E0JA 3GZNB 2W3RA 5FR3A 1C4PA 3ND8A 1SNMA 2K04A 1E0ZA 4HCSA 3S1NH 4G7OC 4KIKB 1O80A 4DXFA 1TWHH 1F9JA 1VCBA 2LRWA 4GOPB 2M19A 3CCRA 1T5XD 4GDKB 4MZ9A 2KHJA 3S1QB 2KWDA 3RLOA 3PZ8A 1SROA 1UELA 2LASA 4G0NB 4U673 3N3KB 4R3DA 1FNWA 1GO3E 3ZGZA 1I6HB 2PMZB 1EO6A 1IGDA 1LT3D 1EY4A 1SEBD 3HG9A 4KJOA 1RYJA 1LM8B 2WLBA 3AB5A 1ESFA 3UQBA 1U4PA 3STBD 1T0YA 4X64L 4XDCA 2CHBD 1WMHA 1FNUA 2M2LA 4S3SA 2HJ1A 5HGTA 1DGSA 2RD0A 3FKYA 1IBXB 2HTHA 2EYFA 2L55A 4WJQA 2ZXPA 1V8CA 2UU9Q 2J4XA 3DM1A 5D14A 1I3QB 4E74A 5E7NA 1EUVB 2KFKA 1J5EL 2KK8A 3MHSD 4RF1A 4NPSA 2KBNA 2Y0SG 5DCNA 3HOUB 1I5FA 3L4PA 3AQQA 3JC66 1B8AA 2DJFC 4RMFA 1WYGA 1LACA 4XYCA 3P75A 2GRIA 4CGYB 1CKNB 1EYDA 3D4WA 5NUCA 3RNGC 4DV6Q 3Q6BA 4LW1A 1VQIA 3NPPA 3G6EA 3K81C 1LXDA 2FJ2A 3U9OA 3KQ4A 1VJKA 2VRRB 4JLCA 4BBNF 3AULA 2R7ZB 1DXMA 2JXMB 4OONA 1IBMQ 1NEKB 1JOQA 2A73B 4YCUA 2RGFA 1KLGD 1L6UA 4KKJA 2GBNA 2B2WC 1YJNA 3NUCA 5CBEE 2OJRA 2KVMA 2WXIA 2MQHA 3AE7B 2WXHA 2K28A 4RFBA 1JWBD 1V6EA 4LK0M 1D6EC 1K3RA 1I4RA 2E5LL 3R3OA 1YJ1A 2AX5A 2JPHA 5M3FB 2C5LC 1MIUA 1N34L 1SE8A 2KAJA 2WXFA 1SR3A 1PUTA 1HZBA 1TWAB 2L9HA 3X3NA 2B39A 5HURA 1EFWA 1RFKA 1J0GA 1ZPSA 3OSOA 1L2NA 1DCZA 3UE1A 2QA4A 4A3EB 3RULA 3CPFA 4PNYA 1EY8A 2EXZA 1SN8A 3GTMB 1ZDVA 2MJ3A 3TZUA 1WR6E 4BKTA 4WAFA 1E3PA 4XT1B 3J7ZC 4DV1L 4A3BB 4FF3A 1B7YB 2RDGA 2XSCA 2NBVB 1OXUA 1VR9A 1ICFB 1JRPA 4OW0A 4DR7Q 4JIOU 3K7AB 2IO2B 2K1BA 4F8CB 2TMPA 4MACA 2F4VQ 3M62B 2INCC 3JYUA 1VQPA 3HOUG 1ZXHA 3BU2A 1VQOA 2K6DB 4C3HB 4HCEA 2V4LA 1BUVT 2LRUA 1PXUA 4HSVA 4BY7B 4RCNA 4F88A 1RJTA 4WWNA 3K6OA 4EOYA 4ANVA 1BVSA 3A9KB 3OHXC 5D3IB 2A5HA 2R7ZG 4KZ0A 2JWZA 3PPAA 3ZNID 4IFDJ 1OGWA 2XVSA 3KYHC 4AQ7A 2EJMA 4MSQB 1P7EA 2BS3B 3A55A 3R93A 1TZ1A 3TQYA 3MEHA 4N58A 1UE6A 2MFIA 3PO2B 5EPJA 1WCMB 2D11A 5IP4D 1C77A 1C76A 1AZPA 1PGXA 4LF7Q 1EU4A 1VMPA 1KHIA 2KQSA 2ZNVC 4LJZC 1RM6C 3R3MA 4HJAA 1ZDXA 2L05A 5M3FG 2KHIA 1WJ6A 2F4IA 3NZUA 3K9OB 2N55A 2OXPA 3RUIB 3U7ZA 3O65B 4BVUC 5J17A 3WWVA 2QDLA 2BKFA 3RNBC 2IWHA 4DR3Q 4JI2Q 3KUPA 4DK0A 2A4ZA 2INNE 2KTRA 3NVWA 3PHWB 5KYLA 4X65Q 2R2QA 2X69A 1PH3A 3FAHA 3ZDMC 3BVMA 4A3BG 1OQRA 2PMZE 1CKOA 3BVZA 3KK7A 3C8YA 3EECA 3N20C 2KDBA 2W54A 1YJ9A 4FHJA 2AEHA 1XLQA 4I6PA 3SFEB 2DBYA 4ILWA 2VUMB 2M8SA 3M7GA 3ZDTA 4X66Q 2D10A 5C4JH 3MVVA 4DU9A 3GV3A 2ZNVB 4I65A 3NTIA 3OTOQ 2K03A 4NMZA 5AJ3L 2DAFA 3I72A 3A7LA 1QOAA 2G5DA 2AWTA 1ZKOA 4HIOA 4PMWA 2FCSA 3R66C 2JRIB 1NJIC 1QT9A 3MC9A 1A0IA 2MJDA 2NTSA 4KD3A 2FINB 5CV6A 1WSPA 1BO0A 3QHTA 2EMTA 2FUG1 3IKJA 1I42A 1SSOA 2KDFB 3KJPA 2NR2A 5LLIA 3M63B 3TMPB 1PYSB 3GTKH 3PO2G 4P16A 2JYTA 2YLMA 2YTVA 1VQNA 5C3WA 4A3CG 2BWES 3PO3G 2E2DC 1CQFA 1Q1EA 5DNFA 3S1MB 1Q82C 4JV5L 1EF1A 3CMMB 2N0SB 2CHXA 2E2JB 4M00A 5JAVA 3K0XA 2KX0A 4RGMA 2NZHA 1N8RC 1K3BC 4IWQA 1E7PB 3M4QA 3RNUA 2RKSA 4L5RC 3H8HA 1SFOH 2QIEB 1J7BA 1V86A 2P5ZX 1NNXA 4R8IA 5IN7A 3I4MG 4H0LC 5EKIA 3PF5A 4IC7B 4HCNB 1A70A 1A6XA 4KI0A 1WX7A 5BMIA 3CCMA 2UXCQ 1X54A 2VUMG 2NBWB 2NN6G 2IL8A 3NEMA 3RZOH 2ZEQA 2SOBA 1VQDA 2LUEA 1YQBA 2W55A 1Q86C 2IGHA 3EGRA 1U4LA 3Q3MC 3BZCA 4RF0A 1WGKA 1L5PA 4QAYA 5CV8A 4P75A 2L83A 4DUYQ 3T9LA 5J3BA 3QQ8B 2ZJPA 1VQAA 2E2HB 2GI9A 3I4MH 3KFUA 1YNNC 2W9NA 3JAMi 4DXAB 1PMRA 1VCIA 3SGIA 1SYCA 2Y3AA 4RKBA 3RZFA 5CYUA 1R9TB 2E3TA 4B0EA 1EWIA 2E74C 1UD7A 2X8XX 3O13A 1BUIC 3C46A 3I7FA 4IUTA 3T4AC 2NVTH 1IZ6A 1H4RA 3X23A 4DHJD 4YWKA 4K3CA 4V0BA 4B3TL 1HUNA 3FC4A 3AU7A 2EKIA 3B08A 1C48A 4LFCL 1E5WA 2BW2A 1CQVA 2L76A 5IA7A 2NB0A 4MM3A 2EYLA 1YJJA 3PUZA 4ZHOA 1PFBA 1X3EA 2CFMA 1RODA 4JI1Q 2ID0A 1C78A 1KFYB 1TIFA 1TZOA 3U2SC 4ANXA 1S5DD 1A15A 5JH5C 1V9JA 3ITPA 2IPKD 4MGKE 3STBC 3GZNI 1PZKD 2EIFA 2XGTA 1PGAA 5C23A 4DR5L 2K5WA 3U4ZA 1DGJA 3GTGB 2WINB 1WFYA 4FXDA 3QARA 1WY8A 3VA7A 2UUBL 2F1MA 4FJZA 3MXNB 3G4SA 3I91A 3CF5A 5HFYA 2KC1A 3QA8A 4HDOA 3J81L 2WP8J 2OTJA 4K1RB 1S5CD 4GIVA 2EY6A 3UI2A 2OQKA 1JE5A 1V1QA 4ABNA 4DV0Q 3DXJC 1YN4A 4HPPA 1S3SG 3FPUB 5EBDA 3CWIA 4JW0A 4A3KB 1T0SC 1E10A 3DCGA 4DPGA 2IX1A 1AWDA 1RKNA 2KHSA 1YEZA 4DR4Q 2UYZB 3AE5B 3LDZE 2MEKA 3Q6SA 5E4XA 1G6PA 2N78A 2KDEB 2NUCA 2C60A 3HOWB 4P7IA 4O42A 4WQMA 3IXSA 3KDFA 3J80c 1YITA 4DN4M 4ZKCB 1MHWC 3A8IE 1JR0D 1MJCA 4XIGS 3OW7A 4EVOA 1WZ0A 2JVCA 4IPHA 2UUAQ 3DWAA 4WJ3M 4HCPB 1VZ7A 2JSOA 3I57A 1G51A 2HCIA 2JXXA 5JXVA 1BQQT 3J81j 3VR5A 1OTCA 2IDYA 2UXBQ 3NZ3A 3P4PB 3VTWA 5TR5A 4YHHQ 4IUPA 5G3LF 3PHXB 2I1KA 2HT1A 3J80E 2JE6I 1YZ6A 2JK8A 3KBGA 2RCFA 4R4TA 1EZ6A 5M5XB 2N1WA 4ICVA 1RIPA 3IFTA 1R7SA 3H09A 4ZUJA 2B8GA 2INDC 1K52A 2MJEA 2A74C 3GTPH 4ZYNA 1N36Q 4PQXA 1II3A 4JBWA 4EX5A 5FJ8H 5IYDG 4HJ9A 2YU9H 2CVRA 1K8OA 4A3FG 3EBEA 1SIFA 2KDIA 1X3QA 1SNDA 1JW9D 4HJ8A 1XNRL 1A2TA 1TYGB 4TSSA 2DNCA 1XNQQ 2HE7A 4HK2A 2D07B 2FMMA 1UH6A 1Q46A 1MSHA 3KUZA 1G91A 3DQVA 4BBNC 2JA7B 1I94L 3NBHA 4RH6A 5C1ZA 1TWCH 1C3TA 3GTOB 1HXYD 2JA8G 4XYQA 3PF4A 2IO3B 3A4SC 1LFDA 3HOVH 4A3FH 1VQ4A 4IM0A 3W1SA 4R1JA 2M1MA 2O4XA 1CJEA 1HNZL 4OELB 5I2YA 4MN3A 4DR6Q 2KVZA 2PE6B 3NZSA 3HRDD 3Q22A 3HOWG 3WIMA 1V5OA 1UNSA 2A8VA 4XDDA 2CW0D 3AMUA 3PV1A 3R7QA 4P71A 2QEJC 5M3MG 3K58A 1AARA 3PIPA 2JA8H 1VQ8A 4GDLB 3ZNGC 2L3ZA 1F2MA 2BDNA 2JQRB 1M90C 3MEFA 2F3VA 4GKKQ 5TSSA 4JC0A 2GBJA 1HR0L 1YD8U 3NXWA 4LF4Q 4C2MB 3GOEA 5IGFA 1P1AA 3QC8B 5E4WC 3RI7C 4BY1B 3QJYA 3HOYB 3PO0A 2KNBA 3NK9A 2BA1A 2QILA 5M3MH 4DF7A 2JEAI 3L13A 1MI2A 1XMOL 1ET6A 3KF8B 5GADC 2NVQH 2RDBC 1CT1D 2CKZB 3SK8A 4RM9A 4FJVB 5D6JB 4IOIE 2KEEA 4FVMA 3CF6E 4MNOA 1H9KA 2O5IC 1C4CA 1SMXA 5ELNA 4WWMA 1FGUA 4QMGA 1X6OA 3JAME 5A2QE 1ZW7A 1BXTA 1U9RA 4W9LA 3W1BA 3D4DA 4A76A 4CDEC 3N1ZC 1TWFB 2LXCA 4NPNA 3U4EG 3A56A 3VUWA 1QUQB 1F52A 3BDCA 1P98A 1SF0A 3NWTA 2QSDA 4PMBA 2N8NA 1Y1WB 3BWUD 3D6CA 2PNRC 5BN5A 3OJ4B 2M9VA 3WOFA 2KJXA 1HZ6A 1U4AA 4ZRPA 1K83B 5C3XA 2CU3A 1W3SA 1FGBD 2C9OA 1ACCA 4NB3A 3DVNV 2F0TA 2PPHA 3KJOA 4CHTB 4GXBA 1FRDA 2E6XA 1IPGA 4A3JB 1JOOA 5IP7G 1NYQA 3RUZA 2IZVB 3MFYA 2BH2A 1HNWQ 5KHQA 4D2KA 2KXJA 1WTPA 4X3SA 5DLQE 1VF5C 3HRZC 2KJ6A 3OIQA 3I5JC 3PT2B 5CX3A 3VH3B 1EEID 4DBGA 4MT5A 4L5TA 2EPBA 2Q5WD 2ZPYA 2E76C 4LFBL 2BB5A 3E5SA 2GOWA 4E3CA 3HOYG 4JYAQ 4IFDG 5IP7H 4N9F4 2KCCA 3L0OA 2BF8B 1TT5B 5IYCH 1GUOA 3Q8FA 2FFKB 1EOVA 2KCNA 2IW3A 4KJNA 1HA6A 4RGOS 2DZKA 2F0WA 4IM3A 1S1QB 2B2TA 5F2DA 5I6YA 3LB8C 3FEWX 3V61A 4LUZA 3VR9B 1N32Q 2BGFA 4K7UA 3NS8A 1U4RA 4HIDA 3UE0A 2VW9A 1SJED 3NE5B 2REXA 3CW2C 2V4IB 3I4OA 3S15B 2EY2A 4QY7A 4K8IA 1OXXK 5JVG3 5H8YE 5IAAC 1Y1WG 4AYBB 5DPRA 4LF9L 4XC2A 3F2CA 1JT8A 4JI6L 2RDHA 4G3XB 4KZCA 2KN4A 4DV4Q 4YY3L 2G45B 3K8AA 4BKSA 2D0OA 4NW2A 3Q14C 1RTOA 3SFDB 4DR1Q 1GJZA 1FYCA 1YNJC 3KF8A 5I4DA 4Y7NB 3OOCA 2AL3A 2JT4B 5BYQA 3SK6A 4YTNB 4A3JG 5GMVA 1SE2A 1YNTE 1SB3C 3GS2A 1STHA 2F0UA 3QX1A 5COYA 5DM73 2E75C 2LGSA 3AN1A 3D31A 2K8BA 1VQ9A 1SIJA 2VQEQ 4TRDA 1C1YB 1FXAA 2DZIA 3KWVA 1K28A 3N9YC 4USAA 2C9WB 1WTXA 3AYHB 1R4PB 4DNTB 2FXQA 3TUOA 3ZYYX 1CMXB 4LFAQ 4JWUC 2F0DA 4O1NA 4KY6A 4PZ8A 4LNFA 4KKIA 4EKUA 3EA6A 4A3GB 2XWJB 3I73A 3A54A 4A3IB 1ZE3D 1EY0A 5IWAL 1E7ZA 1EUJA 4IPCA 5C0XH 1RD9D 1S3OA 3DPDA 2RPQA 4O0AA 3BK2A 5L83A 4LJOB 4I6LB 4N6EB 4HPMB 4XQJA 3ZW3A 2J52A 3GP7A 2AQ2B 4AYBG 3Q3OC 3FVQA 3D6WA 1QE6A 4K14A 3OG5A 1WI5A 1QVFA 2V3PA 1XMQL 4IUUA 3BDOA 3ONSA 1TXYA 4FXKC 3ALBA 3S17B 5IKCM 2NWGA 2L1AA 2VB2X 5T1GA 2ZJQA 2AQ1B 2JZPA 2O2VA 4KHVA 1AH9A 1STEA 2WACA 2XTIA 4KV6A 5IGEA 1YQ4B 2YEPF 4HLEA 2N7EA 1M94A 4MTKA 4R4OA 4LUOA 4QB4A 1JWMD 2CS4A 3ZTDA 2K5VA 1WWTA 4J6IA 5LMNW 2PKOA 4DK1A 1WJNA 3SU8X 5IP9H 1WTQA 1EL0A 3FILA 1B9MA 3IBEA 2LMCB 3VR6A 3Q24A 2L11A 4XT3B 1QOBA 3KF6B 5HHDG 3AI5A 1XWEA 1HZAA 4X6AH 2OJWA 2YTYA 5EE3A 4LF5Q 4OWXB 3I4NG 2I46A 3KLSA 1LO5D 4A3IG 4B08A 2I2YA 4FNFA 3K57A 2B3GA 2YV5A 2WDRB 4W9GA 3VAWA 4QUCA 2DLBA 4EEWA 2HQEA 1M1KC 2R92G 2PW7A 1VZ6A 1N33L 3I4NH 1AE2A 1TWGH 3ERSX 5FLXL 2B2UA 1XLNA 1WGDA 1OQQA 2AQ3B 1KRHA 4K0KQ 4EZJA 4UDUC 2G9DA 3HKZG 5BR8L 3LX0A 3CC2A 3TZDA 4A3OA 1K0RA 1JWUD 5D3DA 3DWQA 3M9BA 1HQMC 1G291 2EXDA 1LUZA 3T53B 4AYBE 4DKAC 1BKBA 3CXCA 1JJCB 2OWOA 1OQYA 1FRRA 1WGGA 2JSVX 1FO4A 1T6BX 4NXNQ 1MHHE 2KMMA 5CR3A 1OEYJ 1TBEA 2CW0C 1WXSA 4XZ4A 4L5QA 2LWPA 3KUCB 2MO0A 2F0JA 3QIJA 1I50H 1AP0A 5IGBA 2NPTB 1JMCA 1UWMA 4B6WA 1EIGA 4KN7C 4C3IG 2MQJA 2N9PC 1WM3A 1YX5B 1TT2A 2KJHB 2K5DA 3S1NB 1LM0A 2R61A 4JBJA 4TQ0A 4A20A 4G11A 1TWHB 5BMHA 4CO7A 2J7ZA 3UINB 4NNJB 1D5MC 3VVWB 4WWPA 2N3SA 3VR8B 4C4VB 3BZKA 1PYBA 2JP1A 4C3IH 4JI0L 2DY7A 4A3PA 1KLUD 1R4MB 1YX6B 1NVID 1KL9A 1LTAD 1K50A 2WP9B 4TV3A 3UGBB 4C1NI 2B3AA 5AZHA 1VQHA 3W2DA 1H95A 3VDYA 4IFDI 3DOWA 4NXMQ 1KIXA 4ZYSA 5C3JB 4IOCA 3B2GA 5LMNQ 1Z6HA 2B63G 2KD0A 2QKIC 2O2LD 4A3DH 1CK1A 3AEVA 4B3RL 1HE8A 2BPSA 2D5GA 3NOBA 3ZJTA 3H7PA 1F2RC 3RMKC 2B2YC 2L0CA 4X3KA 4OVZA 1RF2D 3HKZE 4A9AA 4E6IA 5E1FA 4N8X1 4LNOA 3CMEA 1JQ4A 3T1YQ 1HFGA 1PRTF 3I4LA 2HDLA 2X6LA 5J22A 4EQPA 1FJGL 2Z4IA 1WE7A 1VQ5A 2WU5B 4OO1H 1WZ3A 3BIID 3A9JB 3NG0A 3U30A 1TS5A 3URYA 2B63H 2IO1B 4F8MA 4ZK9B 1WE6A 4JL9A 4DK6C 4GZYC 3DBRI 4XE0A 2OHFA 1H9SB 4HPLB 1XPRA 1CTMA 3EQLC 3SD5A 3UIOB 2Y0SB 5KYIA 1MFWA 4EFOA 1HNXL 1GUNA 3RN5A 3L08A 4RM8A 1PA6A 3T1HQ 1FD7D 2VXWA 2ON8A 1EOTA 1WTHA 4IUMB 4PT5A 1QG7A 4OX9L 5C3EG 4EGVA 2DGYA 1L6VA 2B76B 2PJHA 4K7SA 5LXHA 4A75A 2FNJB 2K75A 3KYCD 1PZID 4O2DA 5C4XG 3QR8A 1CSPA 4Z9CB 5C0XI 2BOSA 3V60A 3I3CA 1V80A 3J81i 4ZOHC 1QNUA 4MH8A 4FYDA 2CJOA 5C3EH 3DBSA 1D8LA 4LF8L 4JI3Q 3NQTA 1H9JA 5C4XH 2D3GA 3Q3NC 5IOIA 1Z47A 3U7DA 2L52A 4ARCA 2MCNB 3WDNA 2Y5PA 2LUMA 1DJRD 1SRUA 3IAM1 4DV7Q 3U9SA 4POGA 1B1ZA 2E2IH 1DOIA 3TL5A 5IOCA 4OGQC 1HA5A 1OO9B 3DWPA 4JI4L 2Z0DB 4RNAA 4JI8L 3E56A 1MPEA 2UUCL 4BWGB 4Y52H 2B8FA 4KHPQ 2WXLA 5KHOA 3PRPB 1I4GA 1KDBA 2DJGC 1D7QA 3W9CB 4OIJA 2Z6KC 2MPMA 1DOLA 2NBFA 4DV5L 1R4NB 1VDVA 3PQIA 1EIYB 2G4SA 4AIMA 1PH7A 3D0FA 2QCZA 3VYUA 4DR2L 3VH4B 2DHZA 1PH2A 1KF6B 4DUZL 3H6NA 1A2UA 3DWGC 5FLMH 1EM7A 3GD7A 2O6VD 4XQQA 1CM9A 4OWTB 4YT0B 2WKCA 3AEEB 4L8JA 3PUWA 3UDFA 3H7SA 1Y8OB 4BBRH 1NAPA 3D3RA 5ELOA 1EIFA 1GUGA 3CC4A 3K7UC 3B0AA 1L1OA 4EQNA 3CCVA 3VRAB 2OCEA 5C4JB 4FJYA 1H8CA 3PUVA 2LXJA 1ISNA 4JI7L 5KEEA 1GB1A 4DV3Q 2GN5A 4ANWA 3H3VH 4JCVE 3DDCB 2ALYB 3DMUA 3MA2B 5EKLA 4HJ7A 1WJUA 3KVFB 3CU7A 2NS5A 4HSPA 2LGYA 1G8ZD 1L0YB 1TKEA 2K4KA 4IZ8A 1Q1OA 4KIKA 3UDXA 2Q8IB 1S5FD 1OTRB 4GOPA 1HTPA 2Z6BA 1HJPA 2F0MA 3GTKB 1XEEA 4GDKA 4C7ZA 1E8YA 1WGRA 2MBOA 1NI2A 3I3TB 4GN4B 4KX6B 3E6ZX 2GBKA 1RCVD 2KJRA 2BS2B 2Y0SE 1CA5A 3TP8A 2L1BA 4IKGA 3HOXG 2RSUA 4RHRA 4LWCA 4ITKA 5IYBH 1WYDA 3AEAB 1SFOB 1F9RA 3D4RA 5D94A 1IBXA 4X64Q 1N9WA 4K5VA 2RPVA 1MG8A 2K14A 1TY0A 4V190 1IL8A 3PO3B 3ZRFA 4JE3B 1W6JA 4X3UA 4QQBX 3M4OH 3HOXH 4OIKA 3RZOB 2CQOA 4J8QA 3SK4A 2EELA 2K1FA 3GB1A 2Q2HA 1J5EQ 5H92C 4GN1A 1CKNA 3S2DH 2HD3A 1SYBA 1WR1A 1XLOA 3ABVB 2WXGA 1WTWA 2RMMA 3AB9A 4YL8A 2CQAA 4HKQA 2CH4A 3I4MB 1IL2A 2F0OA 1E1TA 1VQJA 5FO8B 4MEMA 4W9JA 5MPOA 2Q2TA 1OFFA 3H15A 2PEAA 3TREA 2M0AA 1PV4A 1WOCA 1EWCA 4FXCA 1E8WA 2LHDA 1TS2A 5AFWA 1Y8RC 4BZAA 3I70A 2A1AA 1E22A 4JK1C 5IY0A 2N49A 2PZTA 4OO1I 1HZ9A 4GKJL 2NVTB 2YEPB 4S0RA 1GPXA 2F0VA 4CJ0B 3CPWA 2J0JA 3EVQA 2XRQD 4CDDC 3IRBA 3CC7A 3ECIA 3KLSX 3HFZB 3DBHI 5M5WH 1BT0A 2WXNA 3FRPB 5IGCA 3RN9C 3ZJVA 2JXTA 4X62L 1NE3A 1L0VB 4KKSA 4AQYL 2E5LQ 3BYYB 2OQ0A 1EZ8A 5EKKA 1N34Q 4OHJA 2MSED 4IURA 2JA9A 5C0XJ 4H2AA 4K5XA 3VUYA 4BAXA 3FKIG 5EJWA 5BO4B 1UWXA 1TTNA 3SE0A 3NELA 1N61A 3S9WA 3S16H 1ICWA 1KQSA 3P4RB 4DV1Q 4LF6L 1FEHA 2FBWB 2F52A 1UE5A 3NJTA 2B2WA 4PYUA 2R6GA 4JG2A 4KLKA 3GTMH 2WQYB 4PZ6A 3K59A 2K5PA 4LLGM 2LGXA 1CZWA 2WXOA 2RQXA 3A8JE 3NVZA 1JQYD 5FO9B 1NENB 1XTCD 3FKIH 1MJEA 3KWLA 1SNCA 1KOTA 2L12A 2RSNA 2FCNA 1F9PA 1BDOA 1NDDA 3S1RH 3RLFA 1PHJA 3ZXRA 3NHEB 1PFMA 1R4MI 4IG7B 5DPWA 1GUSA 3OWFA 2D2QA 1VQKA 3A9KA 1IP9A 1LT4D 4DDGD 3ZNZB 4A55A 4A8XC 1KNEA 4EZKA 5FO7B 1I4XA 1VZ8A 1Z7TA 3PGZA 4C1NK 2HCCA 4CKCA 3C0RB 3IVFA 3C2PA 3L9AX 4JOIC 1X55A 2C7NB 1WJJA 2HUGA 1JJ2A 1FXTB 3CSFA 3GE8C 2CR5A 2N9LA 2XWBB 5DPSA 2R93G 2IBIB 3S2AA 3TDQA 4DV2L 3A0JA 1E8ZA 1TS4A 2W3SA 2K7VA 5ELDA 3I8ZA 4ZRZA 1YNJD 1WRDB 3PSEB 2N7JA 1B9NA 3EN2A 1UGJA 4M01A 1WTRA 2D9UA 1AW7A 3MWYW 3GTPB 3UF8A 2PQAB 1KNAA 3QIAA 2YU9B 2WYQA 1SXTA 4TQUS 4FF2A 1PH5A 3I90A 1OXVA 2R93H 2KC2A 3AE2B 3PSIA 1F9SA 3F1ZA 3W1GA 2F03A 4A3LH 3QB3A 2PW5A 1NR4A 3R2TA 1Q8IA 2L32A 2ICIA 3ENEA 1EQRA 1F2RI 1NI3A 1DM0B 2HHHL 2B2VC 5AJ3Q 3GO5A 3VDZA 2QJLA 4IJHA 1TWCB 5IODA 5C44H 4MGYE 3OPOA 1JWAD 2DNFA 4MSMB 3BJUA 3HOVB 4A3FB 4M8NA 3M95A 1C4QA 1DYQA 4GGQA 4L23A 2R7FA 3H9DA 3H3VI 3RPFC 3SHQA 4US8A 4KGSA 4WJ4A 3MC8A 3N52A 2EY1A 4GU2A 1HZ5A 2QGQA 4I7AA 1AE3A 2LXAA 2QMTA 1UUPA 4J15A 2JA8B 2KENA 4WFN3 4JBMA 4QUFA 3GTJH 2ZJDA 2K25A 4YWGG 1VQGA 4JV5Q 4LJPB 3RCZA 1L4DB 1EWHA 3ONAB 2KQ7A 3D32A 4II2B 4HWIB 3CP0A 1P8LA 2I5HA 2ASBA 1XTDA 2JN4A 3MXGA 4WWOA 5JEAH 4C56C 5M3MB 1HUMA 1QB5D 3IFDA 4FP5D 5FJ8G 1RDPD 1Q5WB 2CHZA 3K5OA 5CBAE 3C3LA 2NVQB 1TJEA 3P4QB 4PS8A 2IGGA 3JVZX 3Q0AA 1E6EB 3MHZA 1JORA 4A93G 1R4QB 1R4NI 2BBCA 2WXPA 4OVUA 1NY4A 5E6OA 2XEWA 4H13C 2C7MB 4J1MA 3OYYA 2BCOA 2F0EA 4ID6A 3PIP3 1WD0A 4IOAA 2N9EB 1GJXA 3RFZB 5J2RA 4DFAA 1IYVA 4IWOA 4QF4A 3HOVG 4DXGA 3HM6X 1HFNA 4NQKE 3NUHB 4A93H 1NMFA 1K8GA 1MJDA 2HD5B 1SNPA 2O6VB 5GAHC 3AM9A 1YQ3B 2PQAA 3ERQA 2BWFA 4XYOA 3U4VA 1ZYRC 3C19A 4DK5A 4PZ7A 3TP7A 4ZQ3A 4B3TQ 5H1SE 5DAUA 4JI5L 2Y5CA 3NY5A 5CHWA 5EE0A 2EYHA 1PTOH 4LFCQ 1DD2A 3HVDA 2WXMA 1C79A 5G3LD 3SVMA 4BBSH 5JJLA 3MXPA 2PLPA 1A5RA 1O7ZA 2K5NA 1ROEA 2HQLA 3N6RA 3MTNB 5KNCA 2V3SA 4W9HA 2J53A 4OWWB 2TSSA 3E9IA 4GNXC 1E7VA 4MIUA 1IBKL 1HEZE 2LVOA 2AUKA 3MXNA 1HR0W 5CORA 3HHMA 4A3MG 4DR5Q 1BNZA 4JX1C 3HEJA 1PVOA 2UUBQ 2UXDL 2K5HA 3ZJUA 1QVCA 1F2ZA 1CA6A 3CIRB 1IBLL 4IUVA 3P2BA 3GTQH 3AEGB 1L0WA 3JAMc 1V1PB 4ME3A 4LNQA 4RWSC 1FCLA 5KGUA 1QOFA 1EY9A 4DAMA 3APDA 2OEOA 2KCMA 3A8KE 4A3MH 5K36G 2HDMA 1SBBB 1TVXA 4XWWA 1UWVA 3IHPC 4GNXB 1T0QC 1W6KA 1WXMA 4B3ML 3NSWA 3PTFC 3G6JB 2LGIA 2D3AA 3VRBB 3GV6A 2EYMA 4FF4A 1FD6A 4BOZB 4CKEA 1T9HA 1QJOA 2HJ8A 1RWSA 1S5BD 1IGCA 1J8CA 5M5YH 3AXCA 3DBRB 4K81A 2ES2A 3TEZA 5K36H 3F8TA 1K0SA 1N5XA 3M3YH 2CHWA 2KN5A 2ZVOA 3JW0X 1PH4A 4DAVA 1E90A 3WCQA 1E8XA 1LGRA 3NBIA 1J7AA 3A4RA 4KDIC 4HKZE 3Q3FA 1D4BA 5IYCG 2VY3A 2F0QA 2C5CA 4P72A 4RHSA 2O6VA 3OAWA 5KNDA 4BA1I 2ZM6L 1XNRQ 1MGSA 2EY5A 1Y14B 2NVXH 1ENAA 3DVGX 4L1BA 4CYEA 3CCEA 3CD6A 4AH6A 2PYKA 2KACA 2PZWA 2CU1A 3DVNU 3NRZA 2BYVE 4YWMA 1NBWA 2F0HA 3T16A 1SYDA 2RSOA 3HS0C 4J6HA 4ZCKA 1I94Q 3N1XC 4CJ2C 4NAWB 3IT6B 2B29A 1HTOA 1T5EA 1SMYC 5CHVC 3DEPA 3J80L 3W5UB 1QOHA 2XBBC 2EYJA 1UBQA 1HNZQ 2WIIB 4CJ1B 2BB6A 1C9OA 1XCQL 3N1YC 1LT5D 5IO9A 2DN8A 1KJTA 2LI5A 5E3FA 4GDLA 3VHTC 4A4IA 2PI2E 2KVRA 4ZKBB 1L0XB 4M02A 2E8GA 1X56A 1EU3A 1E1OA 3H0GG 3KLRA 1MG4A 2WXRA 1NR2A 3OMCA 2G1EA 2LS01 1EQTA 4KDLB 1CZGA 1FMAD 4HXDA 3ZO5B 1HR0Q 1B70B 2QF7A 3T8MA 4C00A 2ENBA 2Q2IA 4M1UB 1WD1A 1XT9B 1Y56A 1Y8PB 2BS4B 3KOJA 1CKMA 4HJ5A 2IYDB 3EUB2 1PH1A 2F0GA 4XTCS 3VTVA 3TEYA 2LFNA 3RD2A 1WTOA 4LUVA 1TKGA 1XMOQ 3H0GH 3DM3A 4K6DA 1FL0A 3W3AA 4B9WA 4EQ5A 1LYLA 2J42A 4DAPA 2PVGC 3HKSA 1XJVA 4DAYB 4L2YA 2X38A 5CC4A 3GTLH 4R4IA 1JICA 2WXKA 3I56A 4KY7A 5C0XG 2NZ1D 1QUQA 2Z9HA 2NZOA 1V2YA 2H89B 3NS1A 5FKAC 4GS3A 2KUMA 1D5XC 3P7JA 1YN3A 1CHPD 3I4NB 1GUAB 2MW5A 1TWGB 2K50A 2ZTCA 1J9OA 2VQFL 2FAZA 1ASZA 1J6QA 1B9RA 3NP8A 3Q8CA 5G2NA 4AUQC 1N6ZA 2KANA 3Q8BA 4WURA 1F2YA 4F1SA 3G48A 3HOZH 2GBRA 4YXDB 4YSXB 3V3XA 3ZIMA 4N9TA 2MP2B 1S5ED 2ZW1A 4B9KA 2AMCB 1ZUD2 2V3NA 4IPDA 3UIPB 2Z8LA 5C4HA 2R92B 1EQVA 2ZZPB 1LABA 1HPCA 5A2QL 2WWZA 4KKUA 5IP9G 1I50B 4ALPA 3B9JA 3CMAA 3HKZB 1KDAA 3OWEB 3S14H 1RHPA 3CAMA 4GLSC 5BYSA 1GUWA 2WXQA 4LFBQ 1K73C 1X32A 4GN5A 3I9V1 4IALA 1PQSA 1YMHE 5E6JA 1IHZA 2K01A 2QEXA 1S72A 1XYIA 3T51B 2K6QA 3PGEA 4NQLB 2VL6A 3M85A 2WS3B 4REZA 3ZTCA 1WXVA 2LJIA 1AYFA 3QWNA 3TIXA 1E2ZA 4GLVB 1X9NA 5D7GA 5AUKA 3VUXA 1ML0D 3C1FA 4FULA 4DK3C 4C3IB 4K7WA 4WQOB 1PLFA 1FNVA 2NYZD 2N9XA 5AZFA 3I55A 1JROA 4K2LA 3PRZA 2ZVNA 5AUIA 1ZKHA 3IT4B 4KGTA 4LF9Q 2V1CC 2KDMA 5FOBB 4XXEA 4JI6Q 2IY5B 4A90A 5EGTA 1JWSD 2NCNA 4YY3Q 3NWSA 1QNKA 3LGJA 3K5MA 4A3DB 4RMAA 3P1HA 4C3JG 4MGIE 3BVGA 3ULPA 3OLMD 4ACFA 2GLSA 4ZDVA 3PIOA 4JVZA 1AZQA 1MSGA 3ULJA 2WNMA 3Q3JA 3DHHC 4DNIA 2EOTA 5C5MA 2BYTA 4N9PA 1PGBA 4GMVA 2LD9A 1CFMA 4TKNA 4HAEA 2IY0B 2MP1A 3UDGA 4B3SL 2B63B 4I6NB 2IO0B 3TJPA 1C9FA 3DBHB 4C3JH 4WORA 3K9PB 4JQWC 2QHOA 3RNAC 1Q90A 1JE4A 2Q2UA 3M7NA 4L5SA 2M17A 3AMZA 1WRIA 3F2UA 1EEFD 1B3AA 3PVLA 4WAAA 2F0IA 1ILPA 2MRPA 1EYGA 5GAEC 2N1VA 3B1LX 1UE1A 5IWAQ 2KZRA 1NBFC 3CSTA 2HDEA 2Q8RE 5IT9L 4B95A 1T3QA 3AE9B 1I4PA 4NP5A 4IO9A 4IUNA 1QOGA 1LTID 2JF5A 1VS0A 3SXHA 2WDVB 3K0YA 3Q23A 3IAYA 2Q8TA 3VXWA 2LSSA 3R2IA 1XMQQ 4NDXA 1FXIA 3B2FA 5C3EB 2NVYH 4A3DG 1GC6A 4CHKA 4FO2A 2GA4B 2EE1A 4G50A 4RGTA 5C4XB 2Z0EB 2DUDA 1A63A 4HRSA 2BDOA 2LMCA 2ATWA 3AEDB 5CMDA 2DX5B 2E2IB 4P6VF 4IJLA 5JPMC 1I4QA 1FIQA 1VQMA 4OO1G 1GAQB 1YHBA 3KF6A 3S24A 1PTOF 4P2CB 3FP9A 3RZDH 3AFPA 4ICUA 3VA5A 1E2VA 1J19A 5LL6X 1YIJA 2R2OA 2H5XA 4OEMB 5JEAJ 1WMHB 3TEXA 3DUZA 4DA2A 2UU9L 4FXGC 1VQ6A 2ONQA 1YVCA 4K6LA 1LV9A 5JHAA 1F2LA 1YNXA 1Z5SB 3AH7A 2RCNA 4WJPA 4XX5A 3ND9A 3MFGA 3NTHA 3E9SA 1O7LA 1XPOA 1WGHA 3H3VC 1HRJA 4FLHA 1CI3M 1ZP0B 1HH2P 2LGDA 5EPLA 2ZCBA 4DV6L 1VDZA 1CZPA 2C7HA 5I9OA 2ZW0A 3CCJA 3ICEA 1N33Q 5DM63 1PYWD 3AE6B 1IBML 1Q12A 2EQSA 4BBRB 5BR8Q 4YCVA 2KLCA 1TS3A 1PH6A 1KDCA 1WM2A 4GOCA 1SE4A 4MGZE 2KWUB 3RR5A 3GQBA 3RLNA 3VR3A 2I0QA 3A74A 1LTTD 2JA6H 1E2WA 1STYA 1FFVA 1Q0WB 3KH0A 4UHVA 3X3MA 2NPTA 1EY6A 2YTXA 4HJKA 1ZGUB 4LNNA 3CCQA 1PRTD 4IUQA 2ICEC 1MKHA 5C4ZA 3KW5B 4KVGB 3X0WA 4II3B 2N7DA 3BYTB 2ZTEA 3L54A 2K8HA 3CQZH 3ZNHB 1JJGA 2RF4A 1E0BA 1ENFA 5EE1A 4DR7L 4C4VA 1XX8A 3AE8B 4MDKE 3WOEA 4GSWA 1K9MC 1EYCA 2PNHA 3FHWA 2F4VL 2QDFA 2K6AA 1BF4A 2N9KA 1I35A 2ZTDA 2KYWA 1SYGA 2BQQA 1PDXA 3L7ZC 1JALA 1BCPF 4BA2I 4JI0Q 5DEHA 1O7YA 4F87A 2QDBA 5FLMG 3A5UA 1Q3LA 3GDEA 5HY6A 4NZLB 4FADA 1MD2D 1U0LA 3CRKC 1QVGA 2CKHB 5T1IA 4H02A 3RNEC 2JA5G 2LXKA 1RRBA 3VR4A 1JB7A 1EY7A 4ASWC 4BBRG 4ULLA 2EMSA 1RAXA 1XF5L 3ZLZA 2AWOA 2V4DA 4RCOA 2NMQA 4CQNA 1TR5A 3M4OB 1B4OA 3B6YA 3U58A 3HOXB 4B3RQ 2O5JC 1MVKA 4LF7L 1JMLA 3CRLC 1IW7D 4HIMA 3S2DB 1GG3A 3N32A 2AYOB 4KK7A 2K3UA 1Y1VG 2OF1A 3A9JA 1LT6D 2J0KA 3QWZB 3N30A 1SYEA 1NCVA 2JA5H 1FJGQ 2V0GA 4DR3L 5EDSA 4JI2L 1VQCA 1UBIA 4US9A 1H9SA 1QZGA 1RTNA 4X65L 5L95C 1N5WA 5C2TB 3PUXA 1Q7YC 4MJSB 3LXFA 3QOJA 1BCPD 1LTBD 1LTSD 2KTRB 2L4NA 3S2HH 2UU7A 3PZDA 3J7AV 3AU5A 5J39A 2R3ZA 4PS3A 5GAGC 1Y1VH 2B2YA 1HNXQ 2WDQB 4X66L 5JPNC 5M5WB 1GHJA 4F7XA 2CWPA 4B0MA 3OTOL 1I7HA 3ZVVA 2LY7A 2KWVB 4NKLA 4ZLTF 4NJ6A 4OX9Q 5JJZA 1X3PA 2KCTA 4HIKA 2N4FA 3ETRA 4WIPA 3CCSA 3VR2A 1JB3A 1PFNA 1ZYRD 2WV6D 5IYBG 4FF1A 2MHJA 1STNA 1TU2B 5BN3A 1VLBA 1EWYC 4JPBW 1HZCA 4C7YA 2I5LX 3S16B 3LYYA 1V5TA 1XD3B 1SE3A 3TSSA 3J7A5 2OEDA 5G5GA 1GB4A 1PZJD 2ZCCA 1X65A 2BE5D 2JU6X 4NJCA 3UI3A 1D5ZC 3H6MA 1LTLA 4TMAB 2LKVA 4H7BA 4LF8Q 2LVPA 5E6NA 4BKGA 2AUJD 1WXQA 1IYFA 1TIID 3FKIB 3APFA 3S1QH 3M4PA 4BFRA 2IX3A 1AEXA 3S1RB 5JHBA 1I6HH 2AL6A 4U68A 3GE3C 4LCDE 5G5HA 2A68D 1MHXA 1Y69U 4OXPA 4JI4Q 2D3CA 3F2DA 4JI8Q 2UUCQ 5ELBA 4BKSD 4HVBA 3BZDB 2UXCL 3V96A 3U8ZA 4JGHB 1PH8A 2IY1B 2PPBC 4LNIA 4OZCA 1P0RA 4OZAA 1I3QH 4DV5Q 1XCTL 1KXLA 4YTMB 3PRMB 3KLWA 3T3OA 1L4ZB 3T56B 3AU4A 2K32A 3HOUH 4DUYL 4DR2Q 5AEKB 1CUKA 4R4CA 4FBJB 4DUZQ 1L7YA 4P73A 2PVOD 5HGQA 4Q0FA 2AHOB 1UE7A 3K80C 2GBMA 4PYZA 1UF0A 3RN2A 2I5MX 1EY5A 4KMUC 4YWLA 3J81c 4QJFA 1QILA 2R7ZH 4MJSA 2PIAA 3PZ7A 5GQOA 4A3EG 2R93B 2Z6KA 2KMCA 5AZGA 4DHZB 4K2KA 4KSKC 2JZZA 1XQQA 4LAAA 3J80i 2BA0A 4QL5A 3SK5A 2MBHA 2PE9A 1X3FA 5JJKA 1B2TA 3WALA 3Q8AA 3J81E 3MZ5A 4HDQA 5M3FH 4JI7Q 1FM0D 3NTKA 3MAQA 3SHLA 1TWAH 5C44B 4POFA 2JYOA 3MHBA 4JI1L 2L15A 2PCFB 3TMEA 5D2MB 4A3EH 4MM3B 4C3HG 2PTLA 1V81A 3PLVA 5BMGA 1FR3A 3RNCC 4A3BH 3G7LA 4BY7G 3TS2A 2VS1A 3E0EA 3HZXA 1SMYD 3HUIA 3K7AH 2GVAA 2NTTA 4R4QA 1JRUA 1G2SA 2JRHA 3DBLI 2JJQA 3GTJB 1NMGA 4C3HH 4OL7A 2JWUA 2WDTB 3V6CB 2F0FA 3QOLA 1WCMG 4R8NA 4DV0L 1IYJB 2D3BA 4UPAA 4BY7H 1VMCA 3RD4A 5KRUA 4EQOA 2XNAC 2D2CC 4RKLA 4DR4L 4E71A 2VB3X 3M4YA 4QCLA 4NY0A 4WJNA 4XDXA 1YN5A 3DEOA 1V49A 2BT6A 1BOSA 2GB1A 3OW2A 4C80A 1A62A 4A3LG 3NHHA 2YYZA 3PO2H 2LHEA 4M8MA 3RYTA 4LMQD 1WCMH 2UUAL 4A3CH 1DOKA 3KDFB 4CBVA 3PO3H 3AEBB 5HKHA 1PTOC 3I2ZA 2UXBL 4YHHL 4HMJA 1C4AA 3F2BA 4ZAIA 2A69C 5C44G 3J9CA 1DONA 2FIFA 3VYTA 1WGYA 4JBKA 3OIPA 1STAA 4X3TA 3UQAA 2WU2B 3CHBD 1DOXA 1N36L 2KQ4X 1PRTC 3BDLA 2BYFA 3W1SC 1UEBA 4A93B 1SE9A 4M0WB 1BMLC 2JUOA 1Q10A 3PMFA 1OEYA 1YIWA 4GKJQ 2ZPNA 2VUMH 4KY5A 1ZEQX 2NN6H
chains in the Genus database with same CATH topology
4DNRB 5C6AA 1BR9A 1PTOB 2DY8A 4QIWB 3LWUA 1B53A 1D2BA 1V97A 3P1MA 3V05A 4RAUC 3HP3A 1B44D 4BBSB 3FMCA 1ESRA 2ZXOA 1J7CA 3AEFB 4LK1C 3J7AF 5JEAG 2VZKD 3VQIA 1G6ZA 1PRTB 2ZXRA 5EBCA 1JCKB 3EJIA 1LTRD 4L6TB 1LLRD 3TP6A 4G4KA 1F77A 2F0NA 1DOYA 2A6HD 2K33A 3CKIB 1IYUA 1STGA 3GTQB 2SNSA 1IW7C 1UEAB 3NVYA 4NAMA 2INPE 4ZRQA 3L3OC 2XIWA 3H94A 3PUYA 5CV7A 5ELCA 2WKDA 1KABA 4A3MB 2W82A 2D5DA 3MJ5A 2N88A 2A6ED 4WJWA 1BCPC 3AECB 1H9MA 4XWTA 5HI1A 4PV1C 3BG3A 2IT1A 1KAAA 5D65A 2F0LA 5M5YB 1QCBD 2H1EA 3VYSA 2EYOA 4TQ1A 3M3YB 2ACZB 1QF6A 3P63A 4IN3A 4KGRA 1SYFA 5IGDA 4BS9A 2JX5A 2L5TA 1NUCA 4HTHA 4J3OD 3SEBA 4YSYB 3AE1B 1UAPA 3RMHA 4M0WA 3OMGA 1OXTA 1BCPB 1GOZA 2KA7A 2BE5C 2NVXB 1ENCA 2KQ3A 1TQOA 1GXDC 1SDFA 1Q1BA 2B2TC 1TY2A 1V1OA 3PV0A 2EZVA 3C1EA 1LTGD 5K5PA 2OT2A 5J1ZA 2RDFA 1A3UA 2A68C 2XRSD 2MJ8A 1M8AA 2WAQB 1EFID 4K8JA 2FHTA 1D1KA 1K8MA 3VYRA 2B2VA 1OXSC 2K9XA 3K5LA 2DYOA 4YSZB 2LEKA 3QO2A 5JOBA 3AE3B 3SR6A 1NSNS 4EE2A 3LNNA 2KEDA 3SDZA 3H0GB 2K5QA 1STBA 1YJIA 3GTLB 4IQZA 1WVLA 1XO3A 2X6GA 2WB1B 2FE8A 5GXGB 1ILQA 1JC7A 2MGSA 1N60A 3Q69A 1N63A 1SAPA 1QKZA 3K5NA 3D8GA 1V43A 3NQIA 2M56B 2HTME 1IUEA 2AWNA 4HN7A 3HOZB 4A6QA 1XXGA 2SNMA 2WXJA 1SNQA 4HR7B 3DWMA 2SAKA 4HROA 2H4OA 2KECA 4HEA1 2LFIA 4KN4C 4KHZA 2NN6I 4DQOC 3H91A 4G57A 3IAS1 1VF7A 3S14B 1DOMA 3TN2A 2MUYA 4M8AA 2EJFC 3NVVA 2PO4A 3MP9A 4XQNA 2D62A 2XN9C 3T3NA 2MHVA 5I2XA 1QLBB 1KTKA 1V1PA 2FMCA 5BN4A 1HHVA 1G2TA 2DYMA 3FDTA 1HTLD 2K05A 4CKBA 5CV5A 5I9PA 5LNK1 5FLXE 3EFXD 3BK1A 3FILB 1VRAB 4IFDH 4ZHPA 4PMCA 2B2UC 5KNBA 3LWEA 1ET9A 5JVH3 2I38A 1GHKA 1AN8A 2EDGA 2PMVA 2Z1CA 3U52E 1QWYA 4Q5VA 2RBMA 4L63B 1I6VC 5IT9E 2Z4HA 5M9OA 1BBXC 4C3JB 4ME5A 2RA4A 3A7AB 2CJNA 2JEBI 4YTPB 4YIJA 4R9WA 2DWQA 3JAML 1KH0A 1C8CA 5IIFA 1IKMA 1A3VA 3BS1A 1F0ZA 2KOLA 2G9HD 5C5LA 3QG1A 3PIO3 2A6HC 4LTUA 1ZXTA 1H9RA 1IKLA 4KTAA 5EQ0A 1M4VA 3FPPA 5ELFA 2F0KA 4Q2JA 1WTVA 1XLPA 2NVYB 2VZKB 1D1IA 3P42A 2A6EC 4RGNA 4UAIA 2JYEA 4MHEA 5IGGA 3MTSA 5HG2A 3RZDB 5FK9C 3AE4B 4AS1A 1EIHA 3ZQ4A 1ZXIA 2DNEA 2IGDA 2EVBA 2K0PA 3EROA 4DAYA 1GUTA 1Y8NB 1HQRD 4KKTA 2EJGC 1I4HA 3P20A 1CHQD 1P7FA 1HCZA 1EYAA 4G7ZC 1FCCC 3MXUA 3TEWA 5T8IA 2VNUD 1MBYA 5CV9A 2PW9A 4H44C 1SSNA 5ELEA 5EPKA 3KBXA 1A3TA 4WRDA 2F3WA 5LL6S 1ONLA 4ZUIA 4DGZA 5BYRA 4ARIA 1DZ1A 1B50A 1N62A 3V2TA 3R8BA 1S4ZA 4JWSC 2JA6B 1K51A 5LHY1 4IDIA 4KD4A 1TKWB 2M00A 1PDQA 5EE9A 1K53A 4HJGE 2IJ0A 1E9MA 5ISRA 3MC0B 3CQZB 3HVZA 3IL8A 4G7HC 1SJHD 4K5WA 1F9QA 5A35A 1MI0A 1FFUA 3J7YW 2IX0A 3HGBA 4I7ZC 4ODGA 1TKYA 2K22A 2J0TD 2QCPX 5CGKA 2F0SA 3TBIB 4HMIA 4N59A 3P4SB 3W5VB 2PZUA 2EYPA 3Q8EA 1PFDA 4WH4A 3AV8A 2F0PA 4OZBA 3SR1A 1QQRA 2SEBD 2JA5B 3TP5A 1O78A 1NYRA 5CV4A 1SNOA 1PTOD 4JPSA 2H88B 3S2HB 2A69D 4HEDA 2ZT9C 1Y1VB 1ZOYB 1U4MA 2PQEA 3DHQA 5KIXA 2MH7A 4TKOB 2SDFA 3WCQA 1V8QA 1YNND 1JOKA 1J8IA 4RA8A 5I6WA 2I07B 1AFPA 2RVLA 3T13A 4B9XA 2BTEA 3E0JA 1E0ZA 2W3RA 5FR3A 1C4PA 3ND8A 1SNMA 2K04A 4HCSA 4G7OC 1O80A 4DXFA 2M19A 1T5XD 4GDKB 3S1QB 2KWDA 3PZ8A 4U673 4R3DA 1FNWA 3ZGZA 1I6HB 2PMZB 1IGDA 1LT3D 1EY4A 1SEBD 3HG9A 4KJOA 1RYJA 2WLBA 3AB5A 1ESFA 1U4PA 4XDCA 2CHBD 1FNUA 2M2LA 4S3SA 5HGTA 1IBXB 2EYFA 2L55A 2ZXPA 1V8CA 2J4XA 3DM1A 5D14A 1I3QB 4RF1A 3HOUB 3L4PA 1WYGA 1LACA 3P75A 2GRIA 4CGYB 1EYDA 3D4WA 5NUCA 3NPPA 2FJ2A 3U9OA 3KQ4A 1VJKA 2R7ZB 1DXMA 2JXMB 1NEKB 1JOQA 2A73B 1KLGD 1L6UA 4KKJA 2B2WC 2WXIA 5CBEE 3NUCA 2KVMA 3AE7B 2WXHA 2K28A 4RFBA 1JWBD 4LK0M 1D6EC 1I4RA 3R3OA 2AX5A 2WXFA 5M3FB 2KAJA 1PUTA 5HURA 1TWAB 2L9HA 3X3NA 2B39A 1RFKA 1ZPSA 3OSOA 1DCZA 4A3EB 4PNYA 1EY8A 2EXZA 3GTMB 1ZDVA 2MJ3A 3TZUA 4WAFA 4XT1B 4A3BB 4FF3A 2RDGA 2XSCA 1OXUA 1VR9A 1JRPA 4OW0A 3K7AB 2K1BA 2TMPA 4MACA 1ZXHA 4C3HB 4HCEA 1BUVT 1PXUA 4HSVA 4BY7B 4RCNA 4F88A 1RJTA 3K6OA 3OHXC 5D3IB 2A5HA 4IFDJ 2XVSA 4AQ7A 2EJMA 1P7EA 2BS3B 3A55A 3R93A 3MEHA 4N58A 3PO2B 5EPJA 1WCMB 1C77A 1C76A 1AZPA 1PGXA 1EU4A 1VMPA 4LJZC 1RM6C 1ZDXA 2F4IA 3U7ZA 2N55A 2OXPA 2IWHA 3KUPA 4DK0A 2INNE 3NVWA 5KYLA 2X69A 3FAHA 3BVMA 1OQRA 3KK7A 3BVZA 3C8YA 2W54A 1XLQA 3SFEB 2DBYA 4ILWA 2VUMB 3M7GA 3MVVA 4DU9A 3GV3A 4I65A 3NTIA 2K03A 4NMZA 3I72A 3A7LA 1QOAA 1ZKOA 4PMWA 1QT9A 2MJDA 2NTSA 4KD3A 2FINB 5CV6A 1WSPA 1BO0A 2FUG1 3IKJA 1SSOA 4P16A 2JYTA 5C3WA 2E2DC 1CQFA 1Q1EA 5DNFA 3S1MB 2N0SB 2E2JB 5JAVA 4RGMA 1E7PB 2RKSA 3H8HA 2QIEB 1J7BA 4R8IA 4H0LC 5EKIA 1A70A 1A6XA 4KI0A 5BMIA 2NN6G 2IL8A 2SOBA 3EGRA 2W55A 2IGHA 4RF0A 1U4LA 1WGKA 1L5PA 5CV8A 2L83A 2E2HB 2GI9A 1YNNC 1PMRA 1VCIA 1SYCA 2Y3AA 4RKBA 5CYUA 1R9TB 2E3TA 4B0EA 2E74C 3O13A 1BUIC 3C46A 4IUTA 3T4AC 4V0BA 1HUNA 3FC4A 3AU7A 2EKIA 1C48A 2BW2A 1CQVA 2NB0A 2EYLA 1YJJA 3PUZA 4ZHOA 1PFBA 1KFYB 1TZOA 1RODA 2ID0A 1C78A 3U2SC 1S5DD 1A15A 3ITPA 2IPKD 1PZKD 1PGAA 1DGJA 2K5WA 3GTGB 2WINB 4FXDA 3VA7A 2F1MA 3I91A 5HFYA 3J81L 2WP8J 1S5CD 2EY6A 3UI2A 4ABNA 3DXJC 1YN4A 3FPUB 5EBDA 3CWIA 4A3KB 1E10A 2IX1A 1AWDA 1RKNA 2KHSA 3AE5B 2MEKA 3Q6SA 5E4XA 2NUCA 3HOWB 4O42A 4WQMA 3IXSA 4DN4M 4ZKCB 3A8IE 1JR0D 4XIGS 4EVOA 3OW7A 3DWAA 1VZ7A 2JSOA 3I57A 2HCIA 5JXVA 1BQQT 3VR5A 2IDYA 3NZ3A 3P4PB 4IUPA 5G3LF 3J80E 2JE6I 3KBGA 1EZ6A 5M5XB 3IFTA 1R7SA 3H09A 4ZUJA 2B8GA 1K52A 2MJEA 2A74C 4PQXA 1II3A 4JBWA 2CVRA 1K8OA 1X3QA 1SNDA 1JW9D 1A2TA 1TYGB 4TSSA 2DNCA 2FMMA 1MSHA 1G91A 2JA7B 3NBHA 4RH6A 3GTOB 1HXYD 4XYQA 3W1SA 2O4XA 1CJEA 5I2YA 4MN3A 3HRDD 3Q22A 1UNSA 4XDDA 2CW0D 3AMUA 2QEJC 3K58A 4GDLB 1F2MA 2BDNA 2JQRB 2F3VA 5TSSA 3NXWA 4C2MB 5IGFA 5E4WC 4BY1B 3QJYA 3HOYB 3PO0A 3NK9A 2BA1A 2QILA 2JEAI 4DF7A 1MI2A 1ET6A 1CT1D 3SK8A 4IOIE 2KEEA 4FVMA 1H9KA 2O5IC 1C4CA 4WWMA 4QMGA 3JAME 5A2QE 1BXTA 1U9RA 3D4DA 1TWFB 3U4EG 3A56A 3BDCA 1SF0A 3NWTA 2QSDA 4PMBA 1Y1WB 3BWUD 3D6CA 2PNRC 5BN5A 2M9VA 3WOFA 2KJXA 1HZ6A 4ZRPA 1K83B 5C3XA 2CU3A 1FGBD 2C9OA 1ACCA 2F0TA 4CHTB 1FRDA 2E6XA 1NYQA 4A3JB 1JOOA 3RUZA 3MFYA 4D2KA 1WTPA 4X3SA 1VF5C 3HRZC 3OIQA 1EEID 4MT5A 2Q5WD 2EPBA 2E76C 2BB5A 3E5SA 4IFDG 2KCCA 1GUOA 3Q8FA 2FFKB 2KCNA 2IW3A 4KJNA 1HA6A 4RGOS 2F0WA 3VR9B 3LB8C 2B2TA 5F2DA 5I6YA 3FEWX 1U4RA 2V4IB 1SJED 3NE5B 3S15B 2EY2A 4K8IA 1OXXK 5JVG3 5H8YE 4AYBB 2RDHA 2KN4A 4NW2A 1RTOA 3SFDB 1FYCA 1YNJC 3KF8A 5I4DA 4Y7NB 3OOCA 5BYQA 3SK6A 4YTNB 1SE2A 1YNTE 1SB3C 3GS2A 1STHA 2F0UA 5COYA 5DM73 2E75C 3AN1A 3D31A 1SIJA 4TRDA 1FXAA 3KWVA 3N9YC 4USAA 1WTXA 1R4PB 4DNTB 3TUOA 3ZYYX 4JWUC 2F0DA 4O1NA 4KY6A 4KKIA 3EA6A 4A3GB 2XWJB 3I73A 3A54A 4A3IB 1ZE3D 1EY0A 5C0XH 1RD9D 3BK2A 4N6EB 4XQJA 2J52A 3GP7A 2AQ2B 3FVQA 3D6WA 1QE6A 4K14A 2V3PA 4IUUA 3BDOA 4FXKC 3S17B 2NWGA 2L1AA 2VB2X 5T1GA 2JZPA 2AQ1B 4KHVA 1STEA 2WACA 4KV6A 5IGEA 1YQ4B 2YEPF 4QB4A 1JWMD 1WWTA 2PKOA 4DK1A 1WTQA 1EL0A 3FILA 1B9MA 2LMCB 3VR6A 3Q24A 2L11A 4XT3B 1QOBA 5HHDG 1XWEA 5EE3A 2I46A 3KLSA 1LO5D 4B08A 2I2YA 4FNFA 3K57A 2WDRB 4QUCA 2DLBA 2HQEA 2PW7A 1VZ6A 5FLXL 2B2UA 1XLNA 1OQQA 2AQ3B 1KRHA 4UDUC 2G9DA 3LX0A 3TZDA 1JWUD 5D3DA 3DWQA 1HQMC 1G291 3T53B 2JSVX 1FRRA 1FO4A 1T6BX 1MHHE 2KMMA 5CR3A 2CW0C 2F0JA 1AP0A 5IGBA 1UWMA 1EIGA 4KN7C 4C3IG 1TT2A 2K5DA 3S1NB 2R61A 4TQ0A 5BMHA 1TWHB 2J7ZA 1D5MC 3VR8B 2JP1A 2DY7A 1KLUD 1NVID 1LTAD 1K50A 2WP9B 4C1NI 3W2DA 4IFDI 4ZYSA 5C3JB 3B2GA 1Z6HA 2QKIC 2O2LD 3ZJTA 1CK1A 2D5GA 1F2RC 2B2YC 2L0CA 4X3KA 4OVZA 1RF2D 4A9AA 4E6IA 5E1FA 1JQ4A 1HFGA 1PRTF 3I4LA 2HDLA 2X6LA 5J22A 4EQPA 2Z4IA 2WU5B 4OO1H 3BIID 1TS5A 3URYA 4F8MA 4ZK9B 4XE0A 4GZYC 2OHFA 1H9SB 1CTMA 3EQLC 2Y0SB 5KYIA 1GUNA 1FD7D 2VXWA 2ON8A 1EOTA 4PT5A 1QG7A 1L6VA 4EGVA 2B76B 1PZID 4Z9CB 5C0XI 2BOSA 3I3CA 4ZOHC 1QNUA 4MH8A 4FYDA 2CJOA 3NQTA 1H9JA 1Z47A 2L52A 4ARCA 3WDNA 2Y5PA 2LUMA 1DJRD 3IAM1 3U9SA 1B1ZA 1DOIA 5IOCA 4OGQC 1HA5A 1OO9B 3DWPA 4RNAA 3E56A 1MPEA 4BWGB 2B8FA 2WXLA 1I4GA 1KDBA 3W9CB 4OIJA 2MPMA 1DOLA 2NBFA 1VDVA 3VYUA 1KF6B 1A2UA 3DWGC 1EM7A 3GD7A 4XQQA 1CM9A 4YT0B 2WKCA 3AEEB 4L8JA 3PUWA 1Y8OB 1NAPA 3D3RA 1GUGA 4EQNA 3VRAB 5C4JB 3PUVA 5KEEA 1GB1A 3DMUA 3MA2B 5EKLA 3CU7A 4HSPA 1G8ZD 1L0YB 1TKEA 4IZ8A 2Q8IB 1S5FD 1HTPA 2F0MA 3GTKB 1XEEA 4C7ZA 4KX6B 3E6ZX 1RCVD 2BS2B 1CA5A 3TP8A 2L1BA 4IKGA 4RHRA 4ITKA 3AEAB 1SFOB 1F9RA 3D4RA 1IBXA 2RPVA 4K5VA 1TY0A 4V190 1IL8A 3PO3B 4JE3B 1W6JA 4X3UA 3RZOB 4OIKA 4J8QA 3SK4A 2EELA 3GB1A 5H92C 1XLOA 1SYBA 3ABVB 2WXGA 1WTWA 2RMMA 3AB9A 2CQAA 4HKQA 3I4MB 2F0OA 5FO8B 5MPOA 1OFFA 2M0AA 4FXCA 1EWCA 2LHDA 1TS2A 5AFWA 3I70A 4JK1C 2YEPB 2PZTA 4OO1I 2NVTB 1GPXA 2F0VA 4CJ0B 3EVQA 2XRQD 3KLSX 2WXNA 3FRPB 5IGCA 3ZJVA 2JXTA 1L0VB 4KKSA 3BYYB 1EZ8A 5EKKA 4H2AA 4OHJA 4IURA 5C0XJ 4K5XA 5EJWA 1UWXA 3SE0A 1N61A 3S9WA 1ICWA 3P4RB 1FEHA 2FBWB 2B2WA 2R6GA 2WQYB 3K59A 2K5PA 4LLGM 1CZWA 2WXOA 2RQXA 3A8JE 3NVZA 1JQYD 5FO9B 1NENB 1XTCD 3KWLA 1SNCA 2L12A 2RSNA 1F9PA 1BDOA 3RLFA 1PFMA 1GUSA 3OWFA 1LT4D 4A55A 4A8XC 1KNEA 5FO7B 1I4XA 1VZ8A 1Z7TA 4C1NK 2HCCA 4CKCA 3C2PA 3L9AX 2HUGA 2N9LA 2XWBB 3TDQA 1TS4A 2W3SA 2K7VA 5ELDA 3I8ZA 4ZRZA 1YNJD 2N7JA 1B9NA 1UGJA 1WTRA 2D9UA 1AW7A 3MWYW 3GTPB 1KNAA 3QIAA 2YU9B 1SXTA 4TQUS 4FF2A 3I90A 1OXVA 3AE2B 1F9SA 2F03A 3QB3A 2PW5A 1NR4A 3R2TA 1Q8IA 2L32A 2ICIA 1F2RI 1NI3A 1DM0B 2B2VC 3GO5A 2QJLA 1TWCB 5IODA 3OPOA 1JWAD 3HOVB 4A3FB 1C4QA 1DYQA 4L23A 3RPFC 4US8A 4KGSA 3N52A 2EY1A 1HZ5A 2QMTA 1UUPA 2JA8B 4WFN3 4QUFA 4YWGG 1L4DB 1EWHA 3ONAB 3MXGA 5JEAH 4C56C 5M3MB 1HUMA 1QB5D 3IFDA 4FP5D 1RDPD 3K5OA 5CBAE 3C3LA 2NVQB 1TJEA 3P4QB 2IGGA 3Q0AA 1E6EB 3MHZA 1JORA 1R4QB 2WXPA 2BBCA 4H13C 4J1MA 4ID6A 2BCOA 2F0EA 3PIP3 1WD0A 3RFZB 1GJXA 4DFAA 1IYVA 4QF4A 4DXGA 1HFNA 3NUHB 1SNPA 3AM9A 1YQ3B 3ERQA 4XYOA 1ZYRC 3TP7A 4ZQ3A 5DAUA 2Y5CA 5EE0A 2EYHA 1PTOH 1DD2A 3HVDA 2WXMA 1C79A 5G3LD 3SVMA 3MXPA 2PLPA 1O7ZA 1ROEA 3N6RA 5KNCA 2J53A 2TSSA 1HEZE 4MIUA 2AUKA 3MXNA 5CORA 1BNZA 4JX1C 3HEJA 3ZJUA 1F2ZA 1CA6A 3CIRB 4IUVA 3AEGB 1V1PB 1FCLA 4RWSC 5KGUA 1QOFA 1EY9A 2OEOA 3A8KE 5K36G 2HDMA 1SBBB 1TVXA 4XWWA 1W6KA 3NSWA 3G6JB 2LGIA 3VRBB 3GV6A 2EYMA 4FF4A 1FD6A 4CKEA 1QJOA 1RWSA 1S5BD 1IGCA 3TEZA 5K36H 1N5XA 4DAVA 3NBIA 1J7AA 4HKZE 1D4BA 2F0QA 2C5CA 4RHSA 5KNDA 4BA1I 1MGSA 2EY5A 4L1BA 1ENAA 2PYKA 2KACA 2PZWA 3NRZA 3T16A 2F0HA 1SYDA 2RSOA 3HS0C 4J6HA 4NAWB 4CJ2C 3IT6B 1T5EA 1SMYC 3DEPA 3J80L 3W5UB 1QOHA 2EYJA 2WIIB 4CJ1B 2BB6A 1XCQL 1LT5D 2DN8A 5E3FA 4ZKBB 1L0XB 3KLRA 1EU3A 2WXRA 1NR2A 3OMCA 2G1EA 2LS01 1EQTA 1CZGA 1FMAD 2QF7A 2ENBA 1WD1A 4M1UB 1Y56A 2BS4B 1Y8PB 3EUB2 2F0GA 4XTCS 3TEYA 2LFNA 1WTOA 1TKGA 4K6DA 4B9WA 3W3AA 2J42A 4DAPA 2PVGC 4L2YA 2X38A 5CC4A 1JICA 2WXKA 4KY7A 5C0XG 2NZ1D 2H89B 3NS1A 5FKAC 2KUMA 1D5XC 3P7JA 1YN3A 1CHPD 3I4NB 1TWGB 1J9OA 1B9RA 3NP8A 3Q8CA 3Q8BA 4WURA 1F2YA 4YXDB 4YSXB 3V3XA 4N9TA 1S5ED 2ZW1A 1ZUD2 2V3NA 2Z8LA 5C4HA 2R92B 1EQVA 1LABA 1HPCA 5A2QL 4KKUA 1I50B 3B9JA 3HKZB 1KDAA 3OWEB 4GLSC 1RHPA 5BYSA 1GUWA 2WXQA 1X32A 3I9V1 4IALA 1YMHE 5E6JA 1IHZA 2K01A 1XYIA 3T51B 3M85A 4REZA 2WS3B 2LJIA 1AYFA 3QWNA 1E2ZA 5D7GA 5AUKA 1ML0D 3C1FA 4C3IB 1PLFA 1FNVA 2NYZD 1JROA 4K2LA 5AUIA 3IT4B 4KGTA 2KDMA 5FOBB 4XXEA 4A90A 5EGTA 1JWSD 3NWSA 1QNKA 3K5MA 4A3DB 3P1HA 4C3JG 3BVGA 1AZQA 1MSGA 2WNMA 2EOTA 5C5MA 2BYTA 4N9PA 1PGBA 1CFMA 4HAEA 2MP1A 2B63B 1C9FA 4WORA 1Q90A 1JE4A 3M7NA 3AMZA 1WRIA 3F2UA 1EEFD 1B3AA 2F0IA 1ILPA 2HDEA 2Q8RE 5IT9L 1T3QA 3AE9B 1I4PA 4NP5A 4IUNA 1QOGA 1LTID 3SXHA 2WDVB 3K0YA 3Q23A 3IAYA 2Q8TA 3R2IA 4NDXA 1FXIA 3B2FA 5C3EB 4FO2A 2GA4B 2EE1A 4RGTA 5C4XB 4HRSA 2BDOA 2LMCA 3AEDB 5CMDA 2E2IB 4P6VF 5JPMC 1FIQA 1I4QA 4OO1G 1GAQB 1PTOF 4P2CB 3VA5A 1E2VA 5LL6X 5JEAJ 3TEXA 3DUZA 4DA2A 4FXGC 2ONQA 4K6LA 1LV9A 1F2LA 3AH7A 3ND9A 3MFGA 3NTHA 3E9SA 1O7LA 3H3VC 1HRJA 1CI3M 1ZP0B 5EPLA 1CZPA 1VDZA 5I9OA 2ZW0A 5DM63 1PYWD 3AE6B 1Q12A 4BBRB 1TS3A 1KDCA 1SE4A 3GQBA 3VR3A 1FFVA 1LTTD 1E2WA 1STYA 3X3MA 1EY6A 1PRTD 4IUQA 2ICEC 5C4ZA 3BYTB 1E0BA 1ENFA 5EE1A 1XX8A 3AE8B 3WOEA 1EYCA 2K6AA 1BF4A 2N9KA 1SYGA 1PDXA 3L7ZC 1JALA 1BCPF 4BA2I 5DEHA 1O7YA 4F87A 2QDBA 1Q3LA 4NZLB 1MD2D 3CRKC 5T1IA 3VR4A 1EY7A 4ULLA 1XF5L 4CQNA 2AWOA 2V4DA 4RCOA 2NMQA 1TR5A 3M4OB 1B4OA 3HOXB 2O5JC 1MVKA 1JMLA 3CRLC 1IW7D 3S2DB 4KK7A 2K3UA 2OF1A 1LT6D 1SYEA 1NCVA 2V0GA 4US9A 1H9SA 1RTNA 1N5WA 5C2TB 3PUXA 3LXFA 3QOJA 1BCPD 1LTBD 1LTSD 2L4NA 3J7AV 5J39A 2R3ZA 2B2YA 2WDQB 5JPNC 5M5WB 1GHJA 4F7XA 4B0MA 1I7HA 2LY7A 4NKLA 4ZLTF 5JJZA 1X3PA 3ETRA 4WIPA 3VR2A 1JB3A 1PFNA 1ZYRD 2WV6D 4FF1A 1STNA 1TU2B 5BN3A 1VLBA 1EWYC 4C7YA 3S16B 3LYYA 2OEDA 5G5GA 1SE3A 3TSSA 1GB4A 1PZJD 2BE5D 2JU6X 4NJCA 3UI3A 1D5ZC 3H6MA 4TMAB 2LKVA 4H7BA 2AUJD 1WXQA 1TIID 3FKIB 2IX3A 1AEXA 3S1RB 4U68A 5G5HA 2A68D 1MHXA 1Y69U 5ELBA 3BZDB 3V96A 2PPBC 4OZAA 4OZCA 1XCTL 4YTMB 3T3OA 1L4ZB 3T56B 2K32A 2PVOD 4Q0FA 1EY5A 4KMUC 1QILA 2PIAA 3PZ7A 2R93B 4K2KA 4LAAA 2BA0A 3SK5A 1B2TA 3Q8AA 3J81E 3MZ5A 1FM0D 3NTKA 3MAQA 3SHLA 5C44B 2JYOA 3MHBA 3TMEA 2PCFB 4MM3B 4C3HG 2PTLA 5BMGA 1FR3A 3G7LA 3HZXA 1SMYD