1UUPA

Crystal structure of a dimeric form of streptococcal pyrogenic exotoxin a (spea1).
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
221
structure length
221
Chain Sequence
b'QQDPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYLTDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDSNTSQIEVYLTTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EXOTOXIN TYPE A
publication title Crystal Structure of a Dimeric Form of Streptococcal Pyrogenic Exotoxin a (Spea1)
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Toxin
total genus 58
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1uupA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1uupA02
1RF2D 3BZDB 4O1NA 1B44D 2NTTA 1I4PA 1RD9D 5I4DA 1QILA 2QILA 3R8BA 1BCPD 1LTSD 2XN9C 1TY0A 3DWPA 2AQ1B 1SEBD 1B1ZA 2IJ0A 3W2DA 3EFXD 1HTLD 3R2IA 2R61A 1YN3A 1HQRD 1D5XC 1V1PB 1PYWD 1YN4A 4TSSA 2SEBD 1T5XD 3URYA 1TY2A 1CQVA 1YN5A 4RCOA 1PTOD 1BCPC 1FNWA 4L6TB 1RDPD 5ELEA 1L0YB 4RHRA 1DYQA 1LT6D 4RH6A 1RCVD 1L0XB 2WV6D 1SJED 4C56C 1LTGD 1PTOH 1G8ZD 3GP7A 1FNUA 4RGOS 1I4GA 1PZJD 5ELCA 5FK9C 1PRTD 2NTSA 1PTOC 1SBBB 1SE4A 1UNSA 1CK1A 3BYTB 1LT5D 1JCKB 1JWSD 1I4HA 4L63B 1ET9A 4K6LA 2G9HD 1ESFA 1LTTD 1EWCA 1BCPF 1MD2D 2QEJC 1LTRD 1SJHD 1KLUD 3OWEB 4RGTA 3MFGA 3V05A 1PRTC 4BWGB 1KLGD 1LLRD 4OHJA 5FKAC 1PZID 1PZKD 1S5ED 2AQ3B 2XRSD 4RGMA 4UDUC 4RFBA 3EA6A 1LT4D 1PTOF 1FGBD 1LTID 1BCPB 1EEID 1EU3A 3BVZA 1M4VA 3BVMA 1TS4A 1FD7D 1LTBD 1EU4A 1EEFD 1TS5A 2TSSA 1JR0D 1I4RA 1S5FD 1XXGA 1KTKA 2Z8LA 3CHBD 1S5DD 1S5CD 3R2TA 5ELDA 2RDGA 2ICIA 1UUPA 1PRTF 1V1OA 4ZYSA 4NZLB 1SXTA 5D3DA 4DXGA 1I4QA 1PTOB 3TSSA 1LTAD 1LT3D 1ENFA 1JQYD 1BXTA 1SE2A 4RHSA 1I4XA 3BVGA 1D5MC 1D5ZC 2IPKD 1ET6A 3KLSX 2RDHA 5D3IB 1AW7A 3MC0B 5TSSA 4RGNA 1PRTB 1TS2A 5ELFA 1STEA 1FNVA 2AQ2B 2XNAC 1S5BD 1TS3A 1SE3A 1GOZA 1CHPD 1AN8A 1LO5D 1EFID 1JWUD 1XTCD 2J4XA 1D6EC 1V1PA 1JWMD 5ELBA 2CHBD 3DWQA 1HXYD 1DJRD 1CHQD 2XRQD 1CT1D 1F77A 3DWAA 3BYYB 4DXFA 3SEBA 2O2LD 4Z9CB 3O13A 1HA5A
chains in the Genus database with same CATH superfamily
5IGBA 4A3DH 1F9SA 1HCZA 4M0WB 5LL6S 3H7PA 3UINB 3HOWB 2RPVA 2MPMA 3SU8X 3ZJUA 3PREA 4IUQA 3WAOA 1GHJA 1T0QC 2BT6A 5KGUA 1UZXB 2NVXH 4LNOA 1UF0A 2R3ZA 2FNJB 3MEHA 2GB1A 1EYCA 4DV7Q 1IGDA 2JXXA 4M02A 2K9XA 5IT9L 1HNWQ 1V1PB 1Z9FA 3IG3A 4Q5VA 1XT9B 3NZSA 4RCNA 5BR8Q 2BKRB 4XDDA 1UE6A 1AYFA 5CYUA 3HM6X 2LHEA 1YJ1A 4HJ8A 2A74C 4DR3Q 2EQSA 1QVFA 3C1EA 4DR6Q 3PCOB 2JVCA 3V62A 3M3YB 2XK5B 1QZHA 1BF4A 1L0XB 3OMCA 4L5SA 5C4JH 1CSPA 2BS3B 4MHEA 2W9NA 1SNCA 1FNUA 4B3RQ 1E8ZA 4WJQA 3P4QB 3K5MA 3W1SC 4A3KG 4WAAA 1YJIA 2B63G 3E9IA 1XLNA 5C23A 4A55A 3UQBA 4DR5L 3TJPA 4HAEA 1I4HA 2F0EA 4JI6Q 1WWTA 1TZ1A 1IYJB 1ZOYB 1Y8RC 5A2QL 3I3CA 2EYJA 3TN2A 2B2TC 3CC4A 1DZ1A 1SJHD 3WAMA 1N63A 3OJ3A 1GPXA 2WB1G 3VDZA 2EJGC 2PKOA 2RCFA 4QB4A 5C44B 3S1RH 1W6JA 5C3XA 2MP1A 5JVH3 4JX1C 2SOBA 1PZID 2D5DA 1FJGQ 1PVOA 1WXQA 3TP5A 4G7HC 4RFBA 1M1KC 5IIFA 4DV1L 1IKMA 3EA6A 3MA2B 4JWUC 2RVLA 2G45B 1IP9A 1J19A 3UDIA 3BVZA 5C0XG 3M4OB 4LFAL 1G6ZA 3S1QB 4LJOB 4AYBE 1TS4A 5L37A 1TS5A 4MJSB 3DUZA 3A1QB 3R66C 1STNA 3Q23A 3NOBA 4LF4L 1MHWC 1FR3A 1LACA 1WTXA 1F9QA 4IUUA 4LUOA 1FXTB 2D11A 1ESRA 2JXTA 3IT6B 1EY4A 1MFWA 1LTLA 1IBXA 2K6AA 3FRPB 1WCMG 1IBKL 4A6QA 1SRUA 2B2UC 4FXGC 2D3BA 2PW9A 1BXTA 4BBNC 3BZCA 2I2YA 1CUKA 3S15B 2RSOA 3N9YC 3ERQA 3BG3A 1STBA 2PQEA 4XQNA 4KD3A 3RPFC 3UI2A 2ASQA 5C4ZA 2NVYH 2HCCA 1KOTA 2KWDA 2NMQA 5M3MH 1GB1A 2N8NA 1HH2P 2AWNA 3VHTC 4ARIA 3B08A 4IM2A 2GBMA 4ICVA 2ZCCA 5KHOA 4HKQA 2R93H 2F4IA 2LWPA 1GO3E 4W9KA 2ZJQA 1TQOA 1FRRA 1BUVT 3B2FA 3DBRI 2RPQA 1VQCA 3DWQA 2R2OA 1TWGH 1WXSA 3NHEB 1PYBA 4PZ7A 1QKZA 1CKMA 1F2ZA 2KCTA 3CF5A 1VQOA 2KCNA 1HR0L 3S17H 2KDIA 3ZJVA 1L2FA 2JK8A 2RHSB 4JG2A 3HOXH 2KCCA 3K57A 1N9WA 2O2LD 3I4MH 1IUEA 1QUQB 1U4PA 4FDBA 3RR5A 5IOCA 2MQHA 2A6HC 5HGQA 2ZM6Q 1IPGA 4O1NA 1C8CA 4OL7A 1VZ8A 4JOIA 4WAFA 1TIFA 4WWNA 1QILA 1SYDA 1IBMQ 1CKOA 2JE6I 5FLXE 2N7DA 1WTRA 2F0FA 3U7ZA 1Q81C 1TBEA 3RZDH 4RG1A 1XMOL 1R4MB 2XWBB 2JYTA 1I50H 3HOZB 2PMVA 1VD2A 4DN4M 3NQIA 3UDGA 2N1WA 1RFKA 3I4LA 4EX5A 1E8XA 4IPCA 1SDFA 2I1JA 4ITKA 1KHIA 3KBXA 1P7FA 3VA7A 3BWUD 5IA7A 4A3KB 4A3JG 2OXPA 3KJPA 2FCMA 2B63B 2GOWA 4H02A 5M5WB 3HFZB 1NBWA 5JEAJ 1YQ3B 2WDRB 4HPPA 5IE8A 2D07B 3FDTA 2KLGA 4YTNB 4EUTA 1LT5D 3PIO3 1K73C 4MEMA 4GNXC 3I2ZA 2PPBC 2A5UA 3M4YA 4QL5A 4WORA 1A2TA 3KDFA 3CMEA 2QA4A 4II3B 4OO1I 4GXBA 2MBQA 4HCPB 1SMYD 2WB1B 4BFRA 1MJCA 2PMZB 2I07B 1S3SG 2V3NA 3I72A 3K8AA 1WF9A 3DWMA 4FJVB 3A9JB 1VZ7A 1YHAA 5CV6A 4HJKA 1SYGA 4BWGB 4JI3Q 1RAXA 2ZTDA 2FFKB 1PMRA 1GUSA 3BINA 1N5WA 1RL2A 2EKEC 2JWUA 3KWVA 1WZ3A 2DYBA 4KDIC 1GUGA 2BGFA 1BR9A 3KFUA 1YNJC 1NSNS 1PTOF 1IZ6A 4KHPL 2JRIB 2BB5A 4AS1A 1EU3A 5M3MG 3VR8B 3PO2G 1VCBA 3WA0A 1ZXTA 2OQ0A 2EYLA 1WI0A 2PW5A 4LMQD 2JZPA 2EVBA 3GTKB 3CF6E 1C3TA 1N60A 2DX5B 3ZDTA 3C2PA 1OGWA 2ENBA 2XTIA 1WCMB 2LJIA 5C3JB 1UUPA 3AEVA 1FEHA 1V1OA 2N78A 3N32A 2N7JA 1Y1VH 4E6IA 4KKTA 2QDFA 3AE1B 2K52A 3DM1A 3S16H 1SF0A 2KHSA 5I6YA 3WAPA 1SSOA 1L1OC 4C4VB 4DV2L 1SGHA 4RHSA 2CWAA 2NUCA 5GADC 4LF8L 2AL6A 1HE8A 3IVFA 5JXVA 3GTPH 2ZXRA 2B2TA 4X65Q 1WGGA 4DF7A 1GM5A 2A1AA 3Q22A 3RLFA 1RWSA 1I94Q 2ONQA 5FR6A 3QR8A 3K0XA 2NPTA 1CHPD 3STBD 1WMHB 2BYEA 1P7EA 2A6HD 3APFA 2J4XA 2WLBA 3TEXA 3S2DH 1PFDA 1PFNA 1IL2A 2L55A 2M1MA 4OVZA 3DXJC 3UDFA 2FUHB 3PGEA 4MDKE 4XE0A 4IWOA 4LFCQ 4LF7L 4M8AA 3X3MA 4IFDJ 5IYCH 3HKZB 2NBUA 4WJPA 1RODA 2MO0A 1HNZL 1F1HA 3QQ8B 3SD5A 3QC8B 1WXVA 3IFTA 5JPMC 1U0LA 3RZOB 4CJ2C 4R8NA 3BZDB 3J7AV 1SB3C 2WXIA 1M90C 5M5YH 4MACA 5HKHA 4ZLTF 1VQ9A 3SR1A 1N36Q 2FUG1 4A3EH 5FO8B 2XN9C 1B7YB 2AQ1B 2LS01 2Q8IB 4A3CH 1FIQA 2DZJA 3VFKA 1WYGA 3P63A 1VRAB 2BS4B 2RF4A 2KXJA 2QIEB 4P73A 2NBVB 3T1YL 1HQRD 4PS7A 3R7QA 3CD6A 4N8FA 4KSLC 1TKGA 3CCUA 2KDEB 4B9XA 1WGDA 2GLSA 3DQVA 2LFIA 3ECIA 4FHJA 1Q90A 4QIWE 3AM9A 2F0GA 4A3JB 2Z1CA 4OX9Q 2KANA 1Q3LA 1L0YB 4KI0A 4GLXA 2VQFL 4A3MH 2WX1A 3RN5A 2WV6D 3PV0A 4ZQ3A 3LX0A 3RMKC 4A3BB 4A3PA 4IJLA 4C7YA 1T6BX 1ZXHA 2FHTA 4QMGA 5FK9C 4FXDA 1GG3A 2PZWA 3WOFA 3BZKA 2D0OA 3SK4A 3DHGC 2KHJA 2ZXPA 4B9WA 1EQVA 3RT3B 4BKTA 2N9PC 3VDYA 3T4AC 3GTGH 3VUXA 3HUIA 3U2SC 5JZEB 1VMPA 1N61A 1EWCA 1YNJD 3WOEA 1TZOA 1ZDXA 3W1BA 2E3TA 2OHFA 2YLMA 2QEJC 1VQGA 4YSYB 1Y1VG 3Q8CA 2VUMH 1WJUA 1LM8B 1CKNB 3OWEB 3GTOH 3RFZB 5CORA 3K0YA 4DNIA 3V05A 3OTOQ 2EY6A 2RR9A 3BU2A 2EZVA 4V190 3AH7A 5C3WA 1JT8A 2F4VQ 2NZOA 1WTWA 1YVCA 3HEJA 4MM3B 1YJNA 4GKKQ 2N3SA 1ZE3D 5CBAE 2EXDA 2ZJDA 4EEWA 4YSXB 2WU2B 1EY0A 3J81c 1J7CA 3RULA 2A5HA 4NNJB 3ZTDA 3NUCA 4NXML 1C76A 2ZXOA 3HVZA 4X66L 3L10B 3CHBD 5HY6A 3J81i 1F52A 1U4LA 1J8IA 2WXLA 4OIKA 5NUCA 3D4WA 5GAHC 3J81E 4NB3A 1IBXB 2UUBL 4IPHA 4L23A 4BKGA 2HD3A 3I57A 2FJ2A 5IYBH 2IGHA 1A6XA 4P2CB 2JA5G 3PLUA 4EFOA 2KX3A 1E10A 2K8BA 4KK7A 3D4RA 3K80C 3PMFA 4B08A 4WWOA 3DEOA 1GUTA 2UXDL 3H8HA 2RDHA 3PUYA 5AJ3Q 2GBRA 3EVQA 3S14B 1B4OA 3GV6A 3MC0B 2PPHA 3VUYA 3D8GA 4A3FH 5IKCM 1E24A 2QGQA 3I7FA 1E22A 2NVQB 2MJDA 4JI5Q 1EYAA 1CQFA 4P71A 3I63C 1Q12A 2C7MB 2CHBD 4JBMA 2E75C 3VH4B 3CCJA 1YBYA 5CV8A 4K0KL 1CHQD 2MO1A 1GUOA 3GTLH 3TEWA 2XRQD 4E71A 1CT1D 1D3ZA 2PZUA 3GTMH 2R6GA 3S2AA 3I8ZA 4HCNB 3HRZC 5LMUQ 4A90A 3O65B 3O13A 2PW7A 1WGHA 3KJOA 2W82A 2QCPX 2FCNA 2BA1A 2DHZA 2WFWA 4HCSA 2LMCA 2FAZA 2BPSA 4JIOU 2HTME 1QOFA 1H95A 1NJIC 5E6OA 2N7EA 1P1AA 4LF6Q 3HOVB 2NBWB 1VQEA 5CX3A 2LFNA 5GQOA 4NJ7A 4KY5A 4NDXA 2MP2A 3U30A 4QJFA 2Y3AA 1D5XC 1PYWD 3U9OA 1SIJA 1O7LA 2A19A 4CO7A 4DDGD 1OEYJ 1PGAA 4DK0A 2PEAA 2HQEA 3DBLI 1CQVA 1K8RB 4RCOA 4JWSC 3FP9A 2KC2A 5DLQE 2L00B 1JJGA 2F0HA 5I6WA 1ZW7A 3RNCC 5CGKA 2VXWA 3AE8B 1NUCA 3DHQA 1U4MA 3VR4A 1HRJA 4OW0A 2L3ZA 1SNDA 3TBLD 5G5HA 3DCGA 4DU9A 3E9SA 2D9UA 2D5GA 2JY6A 4GKJL 3EGRA 4ICUA 3ULPA 1PTOC 2LGXA 3SHQA 4US9A 4ANVA 1PGBA 1EZ6A 3SK5A 4GGQA 3KDFB 2F0WA 2JU6X 4C00A 4JI2L 3WIMA 2G9HD 2KYWA 1LTTD 1S1QB 2KNBA 2KN5A 4IC7B 1MD2D 3M4PA 2K8HA 3TL5A 1UELA 1J9OA 2OEOA 3PRPB 3ERSX 3H94A 5M9OA 1BUIC 3NTIA 4BKSA 4RMAA 3W9CB 2E2HB 4DAMA 1OFFA 3X23A 5KHQA 2PNHA 2G3QB 1U4AA 3TZUA 4UDUC 2PTLA 1LT4D 3NXWA 5HGTA 2F0OA 1C4AA 1FGBD 4GN3B 1VQ4A 4FVMA 1XLPA 1C48A 2DZIA 2JN4A 5J39A 1HNXQ 2MJEA 2Z0DB 5AUKA 3VVWB 4BOZB 3DHHC 5BYQA 1K3RA 2YV5A 1HUNA 4JPSA 3H6NA 1WTHA 3OIPA 3T53B 3HOWH 2WB1E 4XT3B 3K58A 2KEEA 4CKCA 2J7ZA 5CTRC 4HWIB 1H9KA 2ICIA 4RNAA 1TWHB 4MGZE 2WXKA 4PV1C 2JA5B 1IW7C 2K5PA 4LNIA 2DAJA 4DUYQ 1HTOA 1ENFA 1GD7A 1UBQA 2C9WB 3B9JA 2IY1B 3NQTA 4K5VA 2EKIA 5D7GA 3KW5B 4RMFA 4MTKA 1MJEA 2LGYA 4KIKB 1G6JA 1B9MA 4XDCA 1MIUA 4HDOA 3DBHI 3ML9A 3UQAA 2LY7A 2J42A 2R92G 3AECB 2CVRA 5J22A 2L12A 1SE9A 1SNMA 4ODGA 4PS3A 2A73B 2Z6KC 1KC8C 3C19A 1HZAA 1AWDA 2M0AA 4PQXA 5GAEC 1FXAA 3A7AB 1PGXA 2Q2IA 4FXKC 2E5LL 4RAUC 2KWUB 3FILA 2K03A 2CHZA 1G2TA 3M95A 1RYJA 1L6UA 1N5XA 1Q8IA 2IHEA 4XX5A 3G6JB 3V61A 1H4RA 2BYFA 3Q8FA 4C3JG 2JA7G 2SAKA 3AU4A 4MELA 4JV5Q 3VQIA 4A3OA 1KLVA 1DGSA 1TKYA 2KX0A 3Q6BA 4G7ZC 4HRSA 1R4QB 5C44H 2I5HA 2J7QB 2WXFA 5IAAC 2UXCQ 3W2DA 3N1ZC 3VYSA 3EFXD 3N30A 2I5LX 2M2LA 2GBNA 4HK2A 3G48A 4K2LA 4C1NK 5IGGA 1A15A 3M4OH 3WALA 2CCZA 3K5OA 1Q1BA 1MGSA 3S1QH 1HA6A 2AWTA 1TY2A 4G7OC 1B50A 1TKWB 1TWCB 1ICFB 5BN5A 4BY1G 4OWXB 1A8VA 1PTOD 1QNKA 4L6TB 1OEYA 3QAQA 5BMIA 2Z0SA 2L0CA 3S2HB 2KTFA 4NMZA 3GQBA 3T51B 1T5EA 1DONA 2BF8B 5M3FG 2KOXA 2A8VA 4DFAA 4FLHA 4P16A 3RCZA 3MP9A 3C0RB 4XQJA 2I5MX 5EPJA 4MGYE 1C9OA 2NTSA 2M0XA 3AMZA 1JOKA 1C77A 4AQYL 3T1HL 2JZ3B 2VB3X 2LGIA 4HROA 3PSIA 1GUWA 3ML8A 1NMGA 3PUXA 5D14A 3T3OA 4ZRIA 1KLUD 2B8FA 2EIFA 3NPPA 5KNCA 2LI5A 3GZNB 4MT5A 4MH0E 4OGQC 5EDSA 3AEDB 1JOQA 1WSPA 1XO3A 1CZPA 1I6HB 1STHA 4X62L 4N9F4 3AU7A 4I6PA 4RWSC 1Q86C 4GN4B 1IW7D 1PH1A 1HJPA 3CCMA 1K8AC 4FHKA 2K6DB 1DOXA 2IY5B 4LF5Q 3TP8A 1E8YA 4KY6A 3I3TB 5FOBB 2LVQA 1UWMA 4OZBA 4ZRPA 4R3DA 2HT1A 1OTRB 1S5FD 2B39A 1QE6A 3ITPA 4TQ1A 2UWQA 3PZ8A 4WH4A 3RNFC 4AH6A 2EELA 4IG7B 5DPWA 4QY7A 2YEPB 2CH4W 5J18A 1M8AA 2ICEC 3QWZB 2G4SA 1LTAD 4GNXB 3IFDA 2NS5A 3MHSD 1R4NB 1DOKA 3Q8BA 2JEBI 5EKIA 3HOZH 1VR9A 3DVNU 1SE2A 2B2YA 3AE5B 1JWBD 4JI4L 1N32L 2ZT9C 4A93G 3R3MA 2L1BA 1RLFA 1KRHA 2R92B 4YHHL 1JWAD 4IFDI 1TT5B 1YHBA 1UE5A 3NSWA 1HZ6A 4W9HA 3T16A 2KQSA 2KC1A 4ZK9B 3H1UA 4A3KH 4JI7Q 1L6VA 1XYIA 2BKFA 1V2YA 2K6QA 2K25A 2O6VA 4A20A 1PH5A 2F03A 2WXGA 2B63H 4N9PA 4PYZA 5M5WH 1DGJA 1P9DU 4G50A 1Y1WG 4W9DA 5EGTA 4DV6Q 4LJPB 4W9CA 4HJ9A 4NJCA 3C8YA 2FCQA 2F0IA 4JOIC 3WWVA 4BA1I 4ZRQA 1GB4A 4X64L 1L4DB 3CPWA 2JA7B 3Q69A 3K81C 4WJ4A 4DUZQ 4IN3A 4ZDVA 4GMVA 1E2ZA 4GLSC 2EXZA 2MJ8A 2CQOA 3MEFA 3HOUG 2XVSA 1Y56A 2V4DA 1EWYC 2B2WA 2DENB 2PO4A 3M63B 3K5NA 2JJQA 4B3TQ 1FCCC 2QEXA 2EYPA 1F9JA 1L1OB 3CQZB 2KJ6A 4B3SL 2IJ0A 4EQNA 5C0XH 4N59A 3RNGC 2GBKA 1A70A 3N3KB 1LXDA 4KLKA 1PH6A 5G2NA 2FE8A 2F52A 2R61A 2ZTCA 4BY1B 3Q8DA 5HI1A 1XNRL 1MBYA 4JCVE 5EPKA 2V3PA 4AJWA 2AKWB 5IYDG 1J5EQ 3GTKH 4JBWA 4KHVA 4A75A 3H0GG 2JA6G 2KAJA 1RDPD 2J0MA 4KGTA 1PH3A 2WP9B 1WCMH 3I90A 4RHRA 2P5ZX 4DR2L 1FGUA 2JUOA 2YTVA 1EL0A 1QWYA 4GDLB 1V9PA 2AHOB 2KECA 3F8TA 3P2BA 1HUMA 2KHIA 4LW1A 3SFEB 2FIFA 1BQQT 1U5KA 1JW9D 2N9LA 1T3QA 3P42A 1SBBB 1F2RI 4R1JA 5EE0A 1MVKA 4KKUA 3PIP3 3VTWA 1N62A 2VQEQ 4J3OD 3PS6A 2L0FA 2N49A 3D6WA 2QCZA 3T9LA 5MPOA 4BAXA 1Y69U 5JJKA 1FPYA 1EO6A 3AFPA 1EIHA 4MSMB 4RGTA 1MI2A 1FFUA 3RD4A 5I9PA 1IL8A 3I4NB 2C5LC 3HOZG 2D2QA 5LHY1 1NYRA 4DQOC 3V6EB 3OIQA 1I7HA 4K8IA 3LJ3A 2WXPA 4FNFA 2QKIC 2X6LA 4MSQB 1HQMC 1W6KA 3KYDD 2WXRA 1F2LA 2PQAA 4UP8A 2KFJA 3LB8C 1C4QA 1LTID 4R4CA 3J7A5 2VH2A 1DD2A 3L3OC 2WXQA 4JI1L 1YIWA 3RZOH 4XTCS 1WE6A 1EU4A 2LZ6A 1EY9A 5BN4A 1XXGA 2Z59B 3BY4B 2MNAA 4A4IA 2PVGC 4DV5L 1MI0A 2YVCA 3OLMD 4DAVA 4G0NB 3U8ZA 3L9AX 1HZBA 2KA7A 2Z4HA 3ZNID 4TVAB 4KKSA 4CYEA 2WU5B 1VLBA 1YZ6A 1LT3D 4A93B 4JE3B 2Q5WD 2KACA 3Q3FA 3L13A 4M8NA 2K01A 5CV5A 4DV7L 3QARA 3U52E 2V1YA 1HNWL 3KF6A 1NNXA 4A3JH 1QVCA 3PGZA 4C1NI 1AZQA 1AW7A 1SMYC 2QJLA 4HEA1 2CW0C 2REXA 5EE9A 2LXAA 5BR8L 1DOLA 4IUTA 3JW0X 1Y1WB 4IPGA 4OO1G 2KD0A 3NK9A 3PF4A 4DR3L 3QOLA 1R7SA 4DR6L 3VTVA 4EZJA 2EY5A 1D6EC 2XIWA 5AUIA 4US8A 1JJ2A 1J8CA 3F2BA 2K39A 3A54A 5AZHA 3OWFA 5G55A 4B3RL 2DYOA 2ZZPB 1F77A 1AE2A 3HOUB 4BBRG 2B3AA 3TREA 1JORA 1UE1A 3A5UA 4BBSG 3IXSA 4FJYA 2KFKA 1VJKA 4GDKB 4ZUJA 4JI6L 2KHWB 2QW7A 5C5MA 3C3LA 1N6ZA 3AEFB 1LTSD 5M5XB 4Q0FA 2KUMA 3DWPA 3ONAB 2F0TA 5KEEA 3Q3JA 4FN2A 2PJHA 4GSWA 5ISRA 3PO2H 1WTOA 3NBHB 1HPCA 2ZW1A 4DV0Q 1K0RA 1NEKB 4KD4A 4RA8A 4L8JA 4ZAIA 2G5DA 1DM0B 5JOBA 4P6VF 3H9DA 1FVIA 3H0GB 1FJGL 2JA6B 4CDDC 4LFBQ 1GJXA 2RDBC 3DMUA 4YCVA 3W1GA 4QGUA 1IGCA 2IO1B 3MTSA 4YWGG 3TBIB 1SFOB 3AYHB 2DZKA 1DCZA 3AULA 2BE5C 2DNEA 2F3IA 1EM7A 1XLOA 5FLXc 4B0MA 3SE0A 3STBC 3I4OA 3PIOA 3HKZG 2LUMA 4P1CC 2PCFB 5LMNW 3RYTA 3GDEA 1R4PB 2F0VA 3J7ZC 3RLNA 4JBKA 3GO5A 1RKNA 1RJTA 3DBRB 4DAYA 5JVG3 1GJZA 1N33Q 3N6RA 1E90A 3V60A 4ZCKA 2LXCA 4L63B 2OF1A 3BK1A 4NAWB 3S14H 2M19A 2WWZA 1D4BA 1I42A 1K83B 1ZXIA 3QX1A 3D6CA 1C78A 2RSNA 4S3SA 3MFGA 2JZZA 1PA6A 1X3FA 1WD1A 2WQYB 3W5VB 4N58A 1SNPA 3TCAA 2BDOA 3QJZA 3HOYB 3JC66 1CA5A 1TIID 3HZXA 4K8JA 5E6NA 4UPAA 1X54A 2JYEA 1GC6A 3FPUB 3QG1A 2IWHA 4L5QA 4WWMA 2TMPA 2HCIA 1LTBD 2RCNA 4A3BG 5G3LF 4C3IG 4LK0M 1EF1A 4M01A 1I4RA 5IGDA 4IOCA 1SR3A 2F0SA 1WJNA 2NN6I 2H88B 4GN5A 2IX1A 4DA2A 2C7HA 2D3CA 1H9SB 2CW0D 3ULJA 2ZM6L 5CV7A 2NVUI 1PTOB 4PMWA 1I3QB 5IT9E 4KJNA 1IBML 3WCQA 3SFDB 1VQBA 3BDLA 5CV9A 2AL3A 3DVNV 4DHZB 3OYYA 1Q1OA 3RUIB 1EWIA 1I4XA 3B6YA 4QAYA 1O7YA 4NY0A 3EFCA 3APDA 4ULLA 3BS1A 1G51A 2L32A 5AZGA 5IGCA 4OWWB 4IO9A 2F0QA 3S9WA 3J81L 2IO0B 2JPHA 3FAHA 5C0XI 3U58A 2DWQA 3P4PB 2AYOB 4H0LC 3U4EG 1JWMD 4UY8C 4BBRB 3A9KA 1L4ZB 2MEKA 2DY7A 2JXMB 4AQ7A 2BQQA 1JE5A 4BBSB 3APCA 3IAS1 4HPLB 1X55A 3F2DA 3SEBA 4HJGE 4DV3Q 1VQPA 1VQ5A 3HM3A 1XNQQ 1SLJA 4IM3A 4TV3A 4WFN3 2E2HH 3A5ZB 2E2JB 4LTUA 1VQ7A 3CC2A 2KTRB 1ZKHA 2CKHB 4CDEC 1B1ZA 1EFWA 2BE5D 2K14A 3HGBA 4JI3L 1WGKA 4J6HA 2WYQA 1TU2B 1YN3A 1XMQQ 1SSNA 2AX5A 1E1OA 3CRKC 1KD1C 1JB3A 2FINB 3NWTA 4N6EB 3PZ7A 4CKEA 4LUVA 3VUWA 1ILQA 1CTMA 4UHVA 4DK6C 5FO9B 1QQRA 4N9TA 3UE1A 1TTNA 2D62A 1TWHH 5FLMG 4RH6A 1A62A 2EYHA 4HJ5A 1AZPA 2NVXB 1KJTA 2JA5H 3T56B 1K0SA 3HIZA 2PYKA 4DR1Q 3H7PB 5I9OA 1T0RC 1E7PB 1B3AA 5CHWA 3GV3A 3KK7A 5IODA 1KM7A 1OO9B 5ELCA 4R4TA 3M9BA 4JPBW 1JWSD 1D8LA 3J80c 1QVGA 2E8GA 2H5XA 2Q2UA 2D3GA 5CMDA 3KF8A 1QT9A 4HIKA 3G71A 1F2RC 3MHZA 2J0TD 2E2IB 2XSCA 1ZYRC 3HOVG 1V8CA 2W54A 4IUVA 5C4JB 1UBIA 4Y7NB 4S0RA 3MXPA 3J80i 4FF1A 1IYVA 4CQNA 4X65L 2UU9Q 3J80E 3M7GA 2HIXA 1KIXA 2JYOA 1KAAA 2L15A 2DJGC 1I94L 1IBLQ 1WJ6A 2JSVX 2RSUA 2WXMA 2V4LA 3AEBB 3H09A 1WVLA 4ACFA 5CV4A 4JQWC 4LCDE 1X3QA 1ASZA 1YJ9A 3QB3A 2DY8A 4KV6A 4MZ9A 3RNBC 4C3IB 2NB0A 1K28A 5IWAQ 2M17A 4NQLB 4LFCL 4ID6A 2K05A 4GLVB 1EEFD 2F0KA 3G4SA 5LL6X 3E5SA 5E4XA 5CHVC 5L95C 1LYLA 4W9IA 3R2TA 2VW9A 4XYCA 2HUGA 2NYZD 1C1YB 4IJHA 2IHFA 4JL9A 3IHPC 2WXNA 1ASYA 1TKEA 1N34Q 1N36L 2PIAA 2EJMA 4HR7B 2JA8G 3TP7A 4JI0Q 2F0LA 3AEGB 3VYRA 2J0JA 2F0PA 1ZKOA 3NZ3A 1B70B 3K59A 1TWCH 5C6AA 1F0ZA 1CM9A 2K28A 1K8OA 1V97A 3BDCA 4ZHOA 1SIFA 2MHJA 3S2HH 1RRBA 2E2DC 2EE1A 4OXPA 2F0MA 2E6XA 2ZNVC 2AQ2B 5IP9G 4DR4Q 3Q3OC 3VRBB 1GVPA 1S5BD 1KRSA 2K1BA 1CA6A 4HIMA 3TMEA 1VMCA 1XTCD 4OX9L 1C0AA 2KKCA 2BOSA 3H15A 1E0ZA 1NI2A 3QIJA 4B3MQ 4EQ5A 3AE6B 1YQBA 1J6QA 4XYOA 4W9GA 2IL8A 4K2KA 5EBDA 3I55A 3CC7A 3AEEB 3UI3A 3BYYB 4W9LA 3A0JA 2W55A 4USAA 3SR6A 4MIUA 5C5LA 1YMHE 4JYAQ 1WTVA 3OJ4B 4ALPA 1TGZB 3JVZX 4KKJA 1RF2D 1B44D 5J3BA 1Z5SB 4REZA 5I4DA 1BMLC 3A8KE 1I6HH 4H2AA 3VYTA 3SDLC 2B29A 4IQZA 1FYCA 5JPNC 1TVXA 4E3CA 1NE3A 1UH6A 2C35B 4RF1A 1JRUA 3OTOL 1XQQA 3HOXB 3JSVA 1A3TA 3EC8A 3R3OA 2F4VL 3URYA 1KRTA 1PUTA 2IBIB 1EY7A 4PYUA 4KHZA 4GKKL 2LGSA 3ER0A 1JE4A 1GUNA 2E76C 4KX6B 1YNXA 3Q6SA 4B95A 4BKSD 1U9RA 4KGSA 4M1UB 3CSFA 4TQ0A 3DBSA 3WANA 3KVFB 4FA6A 1LTGD 1ZYRD 3RZDB 1EUJA 1XPRA 3Q3NC 4OZCA 3ZUNA 4IWPA 2VL6A 5J2RA 3FPPA 3A74A 4JVZA 1BT0A 3MC9A 1Q82C 5C3EG 2R7ZG 2X38A 2BDNA 1TT2A 4C80A 2R92H 1LABA 3ZQ4A 3ZKJC 5JAVA 1XPUA 5KNBA 2RDFA 4IKGA 2Y5CA 1STAA 3ZNGC 1P16A 2KCMA 2GVBA 2INDC 1Y8NB 3SK6A 4K3BA 4URKA 3PLVA 4G57A 5AEKB 5AJ3L 2Y0SB 2HHHQ 3N1YC 1ZPSA 5LMNQ 1EY8A 4ZKBB 2KMCA 1VQKA 2CHXA 2INPE 3I5JC 4HMIA 3FVQA 3MTNB 2O2VA 3Q8EA 2YTYA 1C79A 4IUNA 1E2VA 4J1MA 4BVUC 2ZTEA 4JI5L 4JC0A 4Q2JA 4C3JH 2JA7H 5KYLA 1LV9A 4XWWA 1X3PA 3M3JA 4YCWA 1YHQA 1OXTA 4LNFA 2H4OA 4WJNA 3BVMA 3DBLB 4FULA 2TSSA 1XTDA 2HE7A 3AN1A 4A3LG 3L54A 4FP5D 1PLFA 4B9KA 1TWAB 3ZDMC 2N0SB 1V5OA 3BIID 2IX3A 5LMUL 2B2YC 1FRDA 4CDFC 3CQZH 2JA8B 1PRTF 1XD3B 2KWCA 4GOPC 3I9V1 2IYDB 4ME3A 5D6JB 1OXVA 3GTQB 3CCSA 5GMVA 1B8AA 3TSSA 1FD6A 1VQHA 4BY1H 5C4XG 4KN4C 2VNUD 4DV4Q 2JRHA 4LF6L 2K8CA 1PHJA 1D5ZC 3FKIB 5I2XA 1T0SC 2BBCA 4YWKA 4M0WA 3DEPA 4V0BA 5M3FH 3MJWA 4W9JA 3MC8A 1TYGB 3QHTA 2F3WA 3EHVA 1PV4A 1TS2A 4ZHPA 4NQKE 1SYBA 1X9NA 1WR1A 3NTKA 1XJVA 3ZRFA 1TS3A 3NWSA 4WURA 2ON8A 2MSED 5IGEA 3ZTCA 1JWUD 3A8IE 2SNSA 3P1HA 4HJ7A 3ZVVA 2EY2A 2Q2TA 5GROA 1V1PA 2PMZE 4EVOA 4X3KA 4F7ZA 1FO4A 3UF8A 4L5TA 2B2WC 1S4ZA 1DJRD 2KENA 3NVVA 1PYSB 1SYFA 5BYRA 3NJTA 1L7YA 3X0WA 3FC4A 4BZAA 3AQQA 1AE3A 1QZGA 1YJWA 1YX6B 4EKUA 4Z9CB 1CJEA 1Q0WB 2XK5A 3I73A 1SE8A 5KNDA 2INNE 1C9FA 5LXIB 1LUZA 1QOAA 2CHWA 1JB7A 4JLCA 1ACCA 5LNK1 1X3GA 3I4NH 3E0EA 3W5OA 1A3UA 2V9HA 4K5XA 3M3YH 3NG0A 1SEBD 4KJOA 1HR0W 2NPTB 1KNAA 3H7SA 4AYBB 2WDVB 5J1ZA 1TR5A 4K81A 1B9NA 2HIVA 4X3UA 4LLGM 3K9OB 3PO0A 3U7DA 5IP7G 2HQLA 2GN5A 3UGBB 3HG9A 2CR5A 3SXHA 3ETRA 2N55A 2L7RA 2NZ1D 4YY3Q 2BWFA 1WYDA 2FCSA 1HNXL 3DBHB 4A9AA 5C2TB 4L2YA 5AFWA 3AE7B 3HKSA 2GVAA 4JW0A 5E3FA 4IFDG 1LFDA 5C0XJ 2L4NA 5G3LD 1B9RA 1T0YA 3UIPB 1G8ZD 5C3EB 4YTPB 3GP7A 4O42A 2R7ZB 1T9HA 5H92C 4A93H 4IW0A 4XWTA 1NENB 2IZVB 4OVVA 2OOBB 1PFMA 3M85A 5BYSA 2LXKA 3RZFA 3A1QA 4DUYL 2L8JA 3OPOA 3K5LA 3EECA 1ESFA 1I6VC 1BCPF 3K6OA 5BMGA 1Y1WH 3HKZE 2MGSA 3N52A 1VQIA 4A3GG 4KGRA 1AH9A 1ISNA 1CI3M 4XXEA 1KLGD 1MKHA 3IBEA 3FHWA 3LYYA 2AWOA 3MXNA 1MG8A 5FKAC 1KNEA 1PZKD 2IW3A 1EIGA 4KDLB 4RGMA 1WZ0A 5H1SE 3A7LA 1WTPA 3HOUH 2NBFA 4XGAB 4KSKC 3VAWA 3F2CA 1KABA 1E9MA 4AP4C 2UUAQ 4K1RB 1NTGA 4NAMA 3S15H 2O6VD 3IT4B 4DXAB 1XEEA 4ANWA 1Z47A 2CH4A 2KJXA 3E3XA 2Z9HA 5M5XH 3TP6A 2JQOA 1NR4A 2D10A 2WXHA 4ZYSA 2OTJA 4IURA 1K8GA 4JV5L 5C4XB 1HZCA 2GMIC 3TUOA 2LSSA 1V80A 5IYDH 2OTLA 1WJ4A 1DXMA 2JQRB 1E1TA 1ENAA 2BA0A 2L5TA 4LF9Q 4II2B 5JHBA 1BOSA 3H0GH 1RIPA 2JA6H 2UXCL 2L76A 1QUQA 5IP4D 1A5RA 3PRMB 5EKLA 2OT2A 4I7ZC 3I4NG 1KAWA 1SFOH 3RNEC 3KLRA 4MNOA 3JAMc 1EQRA 4XZ4A 2W3SA 5E7NA 4K5WA 2LHDA 3JAMi 4NPNA 5GAGC 1LO5D 2HJ8A 2K7VA 2BTEA 3JAME 2PZTA 2KZRA 3TDQA 5ELBA 5IGFA 1WJJA 2EYOA 1UGJA 2JP1A 4F7XA 1XLQA 3OW7A 4F1SA 4RKLA 3PTFC 1A3VA 4EE2A 2L1AA 1YQ4B 5TR5A 4I6NB 4F8MA 2VRRB 2K5QA 1CZGA 1K83H 5A35A 4M00A 2KWVB 4YCUA 1WX7A 2MLBA 1TWFB 4IOAA 2CU3A 4HLEA 4R8IA 4NXNQ 4OONA 4GOPA 1V86A 4DHJD 1YEZA 1R4NI 1IYFA 2PNRC 3ZYYX 1QOBA 4ABNA 4W9EA 3U50C 4WQOB 4X3TA 1II3A 3RN9C 4U673 2A69C 4PMBA 2M9VA 3TEHB 4FJZA 4H13C 3VR6A 1AFPA 3GTMB 4MH8A 2UXBQ 4LK1C 3VR9B 1XPOA 4TKOB 4MN3A 4I7AA 2KMMA 2LD9A 2DNFA 4KY7A 2N9KA 3A9JA 3GD7A 3R93A 4BS9A 1V81A 2J52A 1SNQA 3KQ4A 3K7UC 2YU9B 1V1QA 1DYQA 4LF5L 1Q1EA 2K33A 3TS0A 1VS0A 1PTOH 2UUCQ 1A2UA 1K53A 1Q10A 1I3QH 2LMCB 3PUVA 4WIPA 4QQBX 1QZEA 2VS1A 2K5HA 2L83A 1OQQA 2WDTB 2BH2A 2BYTA 2B2VA 4DR7Q 3S24A 1SE4A 4TUUA 3T8MA 3PUZA 4JI8Q 1JCKB 1D7QA 1ZEQX 1NR2A 2MP2B 3UE0A 1RTNA 4OO1H 1NVID 1EOTA 2ID0A 4A3GB 1VQDA 3PV1A 2KEDA 3CKIB 2N1VA 1UWXA 4CGYB 1UAPA 2WGSA 1K51A 1PRTC 2Y5BB 5K36G 3D32A 4MGIE 3QO2A 1VQNA 4C4VA 4JI7L 5FLXL 4BBRH 2HD5B 3K7AB 3CWIA 3KWLA 1YJJA 4APVA 4BBSH 4R4IA 3NE5B 2ZPYA 4DV6L 3UDXA 1YX5B 2EPBA 3NS8A 2EDGA 2C60A 1WXMA 4CJ0B 3H3VH 3DHIC 3QK0A 1S72A 1WMHA 2KVMA 4DUZL 4CJ1B 2AMCB 1WOCA 3A8JE 2E2JH 2RDGA 1F9PA 2K75A 5LLIA 1P0RA 1SXTA 3N20C 4NZLB 3NS1A 5FJ8G 1EWHA 4EGVA 3J7YW 2EY1A 4DR5Q 4B3TL 1VQ6A 3L4PA 4N8X1 1IHZA 3CSTA 1L0WA 5IOIA 2SDFA 3BVGA 2IPKD 4O2DA 1QNUA 2MBEA 3KLSX 1H9RA 4LAAA 3GE3C 4BXXG 2G1EA 3HOYG 3NTHA 5F2DA 4PK1A 1DOYA 4PZ6A 4IM0A 4HSPA 1CZWA 1J5EL 1LM0A 1G6PA 1SE3A 2KN4A 1AN8A 1XCQL 2KDMA 4DV1Q 3GB1A 3AMUA 1E6EB 1SN8A 1WX8A 1F2YA 3QJYA 4K6DA 5K5PA 2WXJA 3ZXVA 4LFAQ 1OXUA 2KDFB 1SMXA 1L5PA 1IKLA 2A69D 3PHXB 4XQQA 2VH1A 1MSHA 4LF4Q 2E2IH 1O7IA 1S3OA 3RMHA 2ES2A 4NW2A 2CKZB 1WRDB 4Y7NH 4F88A 1SYEA 2VQEL 2CU1A 2NTTA 1RD9D 1IBKQ 1A63A 4FXCA 2K4KA 4ZUIA 3E6ZX 3HHMA 1JJCB 1NBFC 2NN6G 4P1BC 3GTJB 3F2UA 1ML0D 4UAIA 2CS4A 4A3BH 4C3IH 1WX9A 4TMAB 3TEYA 3VYUA 4BY7G 2SEBD 1T5XD 1Y8PB 4A3IG 2N9XA 2CWPA 2OCEA 2MW5A 2ZNVB 3FILB 1CKNA 1GC7A 1YOVB 1X65A 1BCPC 3C1FA 3T13A 4EQPA 2RGFA 1SAPA 4DK1A 3L17A 2LGDA 4POFA 1LT6D 3ENEA 3QIAA 2C5CA 5D65A 4C3HG 4FF3A 2KOLA 4MM3A 3OHXC 1HR0Q 3PRZA 1GKHA 1MHHE 4JBJA 5EAYA 1FXIA 1PRTD 1ZDVA 2FIDA 3CMMB 1UNSA 3BYTB 3TMPB 1EIFA 2NWGA 2WX0A 1VDZA 2X69A 3CRLC 2RKSA 3PO3G 1FCLA 3RD2A 1JICA 1WXAA 2NVTB 2HTHA 1KDAA 4K3CA 4ANUA 5H8YE 2QSDA 1IXRA 5CHFA 2ZCBA 3ZW3A 4FO2A 3R7RA 3OMGA 4R9WA 1XMOQ 3LNNA 3MXNB 1LLRD 4X3SA 4Y52H 1F9RA 2RA4A 4NP5A 4A3DG 1DOMA 4A76A 3LDZE 3VH3B 3IAYA 4ARCA 2BCOA 1WIAA 2MQJA 4J6IA 5D94A 2N88A 2WS3B 3S1NB 4YSZB 2F3VA 3VTUA 5DM63 4PT5A 1JRPA 2WKCA 3EN2A 4KVGB 3CW2C 4X57B 1YITA 4L5RC 3J80L 1PH4A 1QOHA 1KTKA 2KO3A 2WP8J 1C7YA 4PNYA 4PMCA 2F1MA 4C2MB 1I4QA 4JK1C 2NVQH 5DM73 4X6AH 4L1BA 2O5IC 1R4MI 3CAMA 2HDMA 1H8CA 1QG7A 2K5NA 2V1CC 1Y8OB 5DNFA 3L16A 4FYDA 1D5MC 5FLMH 4DV0L 3AE9B 1ET6A 4ILWA 4R4QA 2QDBA 2QC8A 2CFMA 1NAPA 4DNRB 1E0BA 3KYCD 4XIGS 1JROA 4LFBL 3G7LA 4YWMA 3MXUA 2IY0B 3S1MB 2ATWA 4ZRJA 1GOZA 4B6WA 1Z7TA 1EFID 2JEAI 2UYZB 4DPGA 4KHPQ 5IT9c 1ONLA 4S17A 4KN7C 4FF2A 1JMCA 2KMAA 3DOWA 3NVZA 3PHWB 2V4IB 3HOVH 3HP3A 2K5VA 5IY0A 1R9TB 1K9MC 1N33L 2ZVOA 1OXXK 3PSEB 1YNNC 2MWSB 1H9MA 1WE7A 1QCBD 3MVVA 4GOPB 1WRIA 2K32A 2QILA 2F0UA 2MH7A 1BCPD 4KKIA 4DV2Q 4QCLA 3V3XA 1UWVA 2Q2HA 3CP0A 5KYIA 4NJ6A 3VR3A 2O6VB 4BOSC 5L83A 4BY7B 4QUCA 3R2IA 4A3IB 4LF8Q 1WM3A 3LXFA 4ZYNA 1WFQA 2WAQG 2D2CC 3KUPA 5CBEE 2IO2B 4LJZC 4P75A 2EMSA 4CHKA 2IDYA 3CXCA 3L08A 3AI5A 3ZGZA 5EE3A 1TWAH 3V96A 3KYHC 2KJRA 2K04A 2KLCA 4ASWC 3ND8A 4HKZE 1BBXC 4EZLA 3CCQA 4C3HB 2E74C 2WHIA 3L0OA 3D4DA 2JA8H 4FF4A 5A2QE 4YIJA 3Q2AC 3ULLA 3KUZA 4C56C 4LF7Q 2XGTA 3GTQH 4DK3C 3NVYA 3ZIMA 4U68A 3AV8A 2RHQB 1PZJD 1HNZQ 3HVDA 3PO3B 4HJAA 2R93G 4K7UA 3FKIH 3KLWA 3RNAC 3H3VI 4WJWA 1VCIA 1CSQA 5IP9H 3C46A 2A6EC 4K6LA 2F0JA 3CCVA 4J15A 3P75A 3IAM1 1ILPA 4LNNA 4HCEA 4M8MA 2KDBA 4HIDA 4CKBA 3W1SA 5IN7A 5E4WC 4A3DB 5HG2A 3HOXG 2DLBA 3NY5A 3P20A 4OVUA 3VRAB 3I4MG 3CCEA 1MJDA 2L0TA 1EF5A 1AARA 2BYVE 2W3RA 1EZ8A 3T1YQ 2R7DA 4OHJA 2KQ7A 1S5ED 2FMCA 2VZKD 4WJOA 1Q5WB 4KMUC 3BDOA 2DUDA 4KIKA 2V0GA 1KH0A 1V9JA 4DHJB 2R7FA 1QJOA 3CPFA 5LXHA 2L05A 3GOEA 3FMCA 2VQFQ 3MZ5A 3NVWA 1FD7D 3V6CB 2VZAA 4RF0A 1YNTE 1KL9A 2O5JC 1S40A 1KQSA 2LRWA 1OQYA 1NDDA 5ELDA 1VQMA 4NPSA 1G291 1PFBA 1S5DD 4DV3L 3E9HA 1OTCA 2HJ1A 2QHOA 4DBGA 3GS2A 4K14A 1MG4A 5CC4A 1XNQL 3DDCB 1EQTA 1ENCA 3IKJA 2L11A 5ELNA 3CMAA 2I38A 1FFVA 2DN8A 1UD7A 3E56A 1JQYD 2ZJPA 1STYA 2GBJA 2JWZA 2M4NA 3Q14C 4JGHB 1V49A 1KXLA 4E74A 1C4PA 1KDCA 4DKAC 4LDTD 2Y0SG 1B3QA 2PQAB 2ASBA 5DPSA 3VXWA 1XMQL 3CCRA 3D0FA 2LXJA 2WXOA 1BDOA 4RGNA 2MA9B 2B2UA 2XNAC 3KLSA 3TZDA 1HTQA 5T1GA 2M00A 1EYDA 2LASA 2Z4IA 5C3EH 3D31A 2R7ZH 5D2MB 4TKNA 1MSGA 1E7ZA 1YNND 3CIRB 3FEWX 4CDCC 4DWFA 5BMHA 4K7WA 3S1RB 1GHKA 4DDID 1VZ6A 1WYWB 1O7ZA 4WQMA 4DK5A 2BS2B 4DR1L 3OSOA 2I0QA 5J17A 3EROA 2Y5PA 4NXMQ 4RM9A 1EOVA 4X66Q 2MBOA 2JSOA 3MJ5A 1WGYA 4PZ8A 1SYCA 3IFWB 2EYMA 1VQ8A 3FKYA 5HFYA 2UUBQ 2RD0A 3KF6B 1C4CA 1EIYB 4G11A 2HDEA 3EFUA 1HEZE 2KQ3A 1TY0A 2FXQA 2WAQB 3FKIG 3QA8A 4KV2A 5G5GA 1D1KA 2RBMA 3AEAB 1JQ4A 4MTNA 5EQ0A 4LUZA 2UU9L 1A0IA 5HHDG 2UXDQ 1IBLL 2X6GA 4A3LH 2INCC 2LKVA 2V3SA 4GN1A 5JHAA 4CBVA 5JEAH 2XBBC 3CCLA 1YN5A 3J81j 1BO0A 3PF5A 3QOJA 4TRDA 1HFNA 2WNMA 1K8MA 2L52A 3AU5A 5IWAL 1WY8A 4KZCA 3LWEA 3NHHA 2NVYB 1WTQA 2A6ED 1GUAB 2MCNB 1OQRA 1RCVD 5C4XH 5M3MB 2BH8A 1O78A 3MAQA 3PO2B 4O0AA 1FM0D 2KFKB 2Q8RE 3Q3MC 1Q46A 4K0KQ 4IWQA 4MGKE 3TEZA 4RGOS 2R93B 4P72A 3M7NA 1NCVA 4FBJB 2DNCA 4IUPA 1XF5L 3W5UB 1UEAB 2AEHA 3N1XC 2O4XA 1TWGB 4ME5A 2C9OA 1RFAA 1X56A 5JJZA 1N34L 4YWLA 3OAWA 4JI0L 3S17B 3B1LX 3SVMA 2GRIA 3OW2A 1PFSA 5ELOA 4GZYC 3I4MB 1VQJA 4YT0B 5IYCG 4AYBG 2N9EB 1Q8KA 1VQLA 1F2MA 3K9PB 2KVRA 3OOCA 5E1FA 1SROA 3A4RA 3DVGX 1FL0A 1WD0A 2JA9A 3TRZA 3DPDA 3HK0A 4GNXA 3KH0A 5DPRA 2ACZB 3KUDB 3NENA 1QF6A 4DR4L 2AQ3B 3P4SB 4F87A 4HTHA 4HSVA 4A3EG 2YTXA 2UU7A 3U9SA 5JH5C 2GA4B 1V8QA 4POGA 4A3CG 4HN7A 3ALBA 4GIVA 2LJ5A 2EJFC 4DAYB 4B3ML 1I50B 1M4VA 1JOOA 4GLAC 4XDXA 3SK8A 1TWFH 2RMMA 3RLOA 4DGZA 4GB9A 1QLBB 3ZO5B 1RHPA 1NYQA 3L7ZC 1BNZA 4JYAL 3ZNHB 5FR3A 4GKJQ 2Z0EB 1LQBA 4IOIE 5IP7H 4HEDA 4A3MG 3AB9A 4JI2Q 5KRUA 1BBWA 4HMJA 1ZP0B 4A8XC 1XX8A 2K22A 4IFDH 3I70A 3H91A 2YU9H 5JJIA 5TSSA 2WIIB 1PRTB 1L1OA 4ZKCB 3L2PA 1TJEA 2M56B 4I6LB 3NEMA 3GE8C 5JEAG 3HS0C 2VUMG 3AFQA 1B2TA 3AE3B 4W9FA 4C7ZA 2HDLA 1E7UA 4OIJA 2J53A 1WFYA 3M62B 2AUJD 3RN2A 1PH9A 4AOFA 1EYGA 3ONSA 2BB6A 4K7SA 2D3AA 4A3GH 4EOYA 3T3NA 2VY3A 3OG5A 1HA5A 3LWUA 4KTAA 4NKLA 2ZEQA 3PQIA 2I1KA 2PLPA 3BK2A 4GS3A 3DVGY 4GDLA 5BO4B 4AWJA 1K52A 1I5FA 5DPTA 1I4PA 1GNUA 3JAML 2JT4B 2KK8A 4AIMA 3R8BA 1WM2A 2ZW0A 4IZ8A 2MJ3A 3Q0AA 1E8WA 3K7AH 3NELA 4H7BA 3AE2B 5IO9A 1Y1VB 1XWEA 3G6EA 3SHLA 2HHHL 3TS2A 1FMAD 3S16B 2IO3B 3W1YA 5LMNL 2AUKA 2J0KA 2LEKA 1K50A 2IGDA 1JMLA 4TSSA 1EY5A 2Q8TA 4HDQA 1V6EA 2CJOA 3A9KB 3JYUA 1J0GA 1Z2MA 5IYBG 1FNWA 2QDLA 3GTPB 1IYUA 4DHZE 1NY4A 2B2VC 3P7JA 1VF5C 3MWYW 3NBIA 2B76B 3KOJA 1SNOA 2DAFA 1WR6E 1YI2A 2E5LQ 3RZWC 1MPEA 4EQOA 4A3FG 3ZJTA 1I4GA 3VA5A 2DJFC 3S2DB 2ALYB 3RI7C 2JX5A 1Z6HA 1G91A 2NCNA 4D2KA 1WH3A 2MUYA 2Z6BA 2DZMA 4DV4L 3H3VC 1LTRD 3RUZA 3Q24A 2K5WA 4J8QA 2IT1A 3U4ZA 1N8RC 1WGRA 1ROEA 1PXUA 5M5YB 2D0PA 2IX0A 1ZUD2 5KIXA 3E0JA 3J9CA 4A3EB 1PH7A 4YL8A 1Y14B 2WACA 1X1MA 1GXDC 3SGIA 2OEDA 2OJRA 2F0NA 1AP0A 3RNUA 1AEXA 1UE7A 5GXGB 4FADA 1BCPB 2SNMA 3MHBA 4ZRZA 3PPAA 5EE1A 2WINB 2EYFA 1X32A 1H9JA 3ZNZB 4GU2A 1YIJA 4MJSA 4OZAA 4KZ0A 3KF8B 2Z8LA 5JJLA 2DBYA 4HVBA 2PI2E 2DYMA 4OWTB 2YYZA 4YTMB 4A3MB 1BBUA 3J7AF 1NI3A 1YD8U 3WDNA 1OXSC 4AQYQ 5D3DA 1KDBA 4DXGA 2B3GA 3M4QA 3T1HQ 3UIOB 4UP9A 3GTJH 1K3BC 2ZPNA 4ZRKA 4IPDA 4PS8A 3F1ZA 3I56A 3QWNA 1LGRA 5EBCA 5EJWA 1EUVB 3ND9A 2KT7A 4GOCA 4HIOA 4GDKA 2A68C 5D3IB 2B8GA 5C4HA 1E5WA 3GTGB 2G4DB 1ICWA 1ZGUB 1FNVA 1E3PA 1VDVA 2A4ZA 2VUMB 4YY3L 1P8LA 4X62Q 3NBHA 1PH8A 2DGYA 2QF7A 2I46A 3GTOB 1D2BA 2CQAA 2K3UA 4BA2I 3ABVB 1KF6B 3TQYA 1UGMA 2MX2A 4XC2A 3ZLZA 4LNQA 4YXDB 1HXYD 4BBNF 3P4RB 3PVLA 3D3RA 3DWAA 4ANXA 3ZJYC 2C7NB 3DWGC 2NVTH 2K5DA 2BW2A 5K36H 1VF7A 4XYQA 2VZKB 4CHTB 4RM8A 3GZNI 4WJ3M 1KFYB 4B0EA 2PE6B 2KBNA 2WKDA 1EY6A 3IL8A 2RQXA 3A4SC 3B0AA 4UP7A 4HPMB 4ZOHC 1D1IA 1VQAA 3HOWG 4JI4Q 1N32Q 2H1EA 1HTLD 3W3AA 1DOIA 1QB5D 3TIXA 4F8CB 1X3EA 3H6MA 4YHHQ 3S1NH 1PDXA 2QMTA 1J7AA 3MFYA 4G3XB 4NAWA 1YN4A 1G2SA 5T1IA 4P74A 5EPLA 4WRDA 1J7BA 3NZUA 2LVPA 5CR3A 4IUMB 1PDQA 2L9HA 3P1MA 3VR5A 2PE9A 5COYA 4LWCA 5FJ8H 5ELEA 2GI9A 2MBHA 1I35A 2X8XX 1BVSA 1W3SA 4I65A 2UUAL 5FO7B 4A3FB 4R4OA 2CJNA 1SJED 2PVOD 4LDTB 4C2MH 3EJIA 2MHVA 3SDZA 2EMTA 1V43A 3AE4B 4LNKA 3DM3A 1E2WA 3V2TA 3PZDA 1O80A 5BN3A 4X64Q 2WAQE 1RTOA 2JF5A 1HFGA 1WI5A 1EQQA 1HZ5A 2NR2A 4BXXH 1STGA 3Q8AA 4AUQC 4EZKA 1CK1A 3KBGA 3HOYH 2MFIA 5EKKA 1V5TA 3A56A 1L0VB 1JALA 3GTLB 2FMMA 1ET9A 4LF9L 3JSVB 3HRDD 1UEBA 4XT1B 4H44C 4WWPA 4OELB 1VQFA 3NRZA 3ZXRA 2WDQB 4QUFA 1CMXB 3DLLA 3S1MH 2KQ4X 1H9SA 4B3SQ 3MXGA 2N4FA 2MRPA 5T8IA 4IDIA 2R2QA 1JC7A 3L0WB 1L2NA 2G9DA 3I91A 5HURA 1P98A 1XNRQ 2FBWB 3IRBA 2XRSD 2OQKA 2YEPF 3NUHB 3EQLC 3A55A 5C44G 4QF4A 2H89B 3PIPA 2K50A 1R9TH 3B2GA 4TQUS 1EEID 4DR2Q 2BVCA 1W2BA 2LUEA 2OWOA 2KVZA 4P7IA 4DAPA 1JR0D 1QOGA 1P3QU 2NN6H 2LRUA 1S5CD 2M8SA 2A68D 3VR2A 1XCTL 2OJWA 2NZHA 3EBEA 4HXDA 4BY7H 4C3JB 4NXNL 4A3IH 4G4KA 2ZVNA 4IALA 2MBBB 2F0DA 2XWJB 3X3NA 1M94A 1MHXA 5I2YA 1BKBA 2O2VB 3AB5A 3EUB2 3KUCB 1Q7YC 4DNTB 3AXCA 1CFMA 4RKBA 1RM6C 5DCNA 2UXBL 1X6OA 2EOTA 4C3HH 1HTPA 3ICEA 2IGGA 2XEWA 3ZRCA 5ELFA 1PH2A 1E7VA 2BWES 3A33B 1STEA 3EIVA 2KTRA 3CU7A 1HZ9A 1NMFA 2K0PA 3U4VA 3PT2B 2ZJRA 5C1ZA 1HHVA 2K1FA 5DAUA 3PO3H 4PG3A 1GAQB 3NP8A 4JI1Q 3BJUA 2PI2A 4AJYB 2UUCL 2Y0SE 5AZFA 3PUWA 1TXYA 4OEMB 5M3FB 1PQSA 1B53A 3QCAA 5E6JA 4DXFA 5E6PA 3LGJA 1U4RA 2Z6KA 2LVOA 4DV5Q 4QIWB 2VB2X 5DEHA 4DR7L 2KJHB 4JI8L
chains in the Genus database with same CATH topology
5IGBA 1F9SA 1HCZA 5LL6S 3HOWB 2RPVA 2MPMA 3ZJUA 4IUQA 1GHJA 2BT6A 5KGUA 2R3ZA 3MEHA 2GB1A 1EYCA 1IGDA 2K9XA 5IT9L 1V1PB 4Q5VA 4RCNA 4XDDA 1AYFA 5CYUA 2LHEA 2A74C 3C1EA 3M3YB 1BF4A 1L0XB 3OMCA 2BS3B 4MHEA 1SNCA 1FNUA 3P4QB 3K5MA 1YJIA 1XLNA 4A55A 4HAEA 1I4HA 2F0EA 1WWTA 1ZOYB 5A2QL 3I3CA 2EYJA 3TN2A 2B2TC 1DZ1A 1SJHD 1N63A 1GPXA 2EJGC 2PKOA 4QB4A 5C44B 1W6JA 5C3XA 2MP1A 5JVH3 4JX1C 2SOBA 1PZID 2D5DA 1WXQA 3TP5A 4G7HC 4RFBA 1IKMA 5IIFA 4JWUC 3EA6A 3MA2B 2RVLA 3M4OB 3BVZA 5C0XG 1G6ZA 3S1QB 1TS4A 1TS5A 3DUZA 1STNA 3Q23A 1FR3A 1LACA 1WTXA 1F9QA 4IUUA 2JXTA 1ESRA 3IT6B 1EY4A 1IBXA 2K6AA 3FRPB 4A6QA 2B2UC 4FXGC 2PW9A 1BXTA 2I2YA 3S15B 2RSOA 3N9YC 3ERQA 3BG3A 1STBA 2PQEA 4XQNA 4KD3A 3RPFC 3UI2A 5C4ZA 2HCCA 2KWDA 2NMQA 1GB1A 2AWNA 4ARIA 4HKQA 2F4IA 1TQOA 1FRRA 1BUVT 3B2FA 3DWQA 1QKZA 1F2ZA 3ZJVA 2KCNA 1IUEA 2KCCA 3K57A 2O2LD 1U4PA 5IOCA 2A6HC 1VZ8A 4O1NA 1C8CA 4OL7A 4WAFA 1QILA 1SYDA 2JE6I 5FLXE 1WTRA 2F0FA 3U7ZA 2XWBB 2JYTA 3HOZB 2PMVA 4DN4M 3NQIA 1RFKA 3I4LA 4ITKA 1SDFA 3KBXA 1P7FA 3VA7A 3BWUD 4A3KB 2OXPA 2B63B 5M5WB 5JEAJ 1YQ3B 2WDRB 3FDTA 4YTNB 1LT5D 3PIO3 2PPBC 3M4YA 4WORA 1A2TA 4OO1I 1SMYD 2WB1B 2PMZB 2I07B 3DWMA 2V3NA 3I72A 1VZ7A 5CV6A 1SYGA 4BWGB 2FFKB 1PMRA 1GUSA 1N5WA 2JWUA 3KWVA 1GUGA 1BR9A 1YNJC 1NSNS 1PTOF 2BB5A 4AS1A 1EU3A 3VR8B 1ZXTA 2EYLA 2PW5A 4LMQD 2JZPA 2EVBA 3GTKB 1N60A 3C2PA 2ENBA 1WCMB 2LJIA 5C3JB 1UUPA 1FEHA 1V1OA 2N7JA 4E6IA 4KKTA 3AE1B 3DM1A 1SF0A 2KHSA 5I6YA 1SSOA 4RHSA 2NUCA 5JXVA 2ZXRA 2B2TA 4DF7A 3Q22A 3RLFA 1RWSA 2ONQA 1CHPD 1P7EA 2A6HD 2J4XA 2WLBA 3TEXA 1PFDA 4OVZA 1PFNA 4XE0A 2L55A 3DXJC 4M8AA 3X3MA 4IFDJ 3HKZB 1RODA 3IFTA 5JPMC 3RZOB 4CJ2C 4R8NA 3BZDB 3J7AV 1SB3C 2WXIA 4MACA 4ZLTF 3SR1A 2FUG1 5FO8B 2XN9C 2AQ1B 2LS01 2Q8IB 1FIQA 1WYGA 3P63A 1VRAB 2BS4B 2QIEB 1HQRD 1TKGA 4B9XA 2LFIA 1Q90A 3AM9A 2F0GA 4A3JB 2Z1CA 1Q3LA 1L0YB 4KI0A 2WV6D 3PV0A 4ZQ3A 3LX0A 4A3BB 4C7YA 1T6BX 1ZXHA 2FHTA 4QMGA 5FK9C 4FXDA 2PZWA 3WOFA 3SK4A 2ZXPA 4B9WA 1EQVA 3T4AC 3HUIA 3U2SC 1VMPA 1N61A 1EWCA 1YNJD 3WOEA 1TZOA 1ZDXA 2E3TA 2OHFA 4YSYB 2QEJC 3Q8CA 3OWEB 3RFZB 5CORA 3K0YA 3V05A 2EY6A 2EZVA 4V190 3AH7A 5C3WA 1WTWA 3HEJA 4MM3B 1ZE3D 5CBAE 4YSXB 2WU2B 1EY0A 1J7CA 2A5HA 3NUCA 1C76A 2ZXOA 3HVZA 3CHBD 2WXLA 1U4LA 1J8IA 4OIKA 5NUCA 3D4WA 3J81E 1IBXB 4L23A 3I57A 2FJ2A 2IGHA 1A6XA 4P2CB 1E10A 4KK7A 3D4RA 3PMFA 4B08A 3DEOA 1GUTA 3H8HA 2RDHA 3PUYA 3EVQA 3S14B 1B4OA 3GV6A 3MC0B 3D8GA 2NVQB 2MJDA 1EYAA 1CQFA 1Q12A 2CHBD 2E75C 5CV8A 1CHQD 3TEWA 1GUOA 2XRQD 1CT1D 2PZUA 2R6GA 3I8ZA 3HRZC 4A90A 3O13A 2PW7A 2W82A 2QCPX 2BA1A 4HCSA 2LMCA 2HTME 1QOFA 3HOVB 2LFNA 4KY5A 4NDXA 2Y3AA 1D5XC 1PYWD 3U9OA 1SIJA 1O7LA 1PGAA 4DK0A 2HQEA 1CQVA 4RCOA 4JWSC 5I6WA 2F0HA 5CGKA 2VXWA 3AE8B 1NUCA 3DHQA 1U4MA 3VR4A 1HRJA 4OW0A 1SNDA 5G5HA 4DU9A 3E9SA 2D9UA 2D5GA 3EGRA 1PTOC 4US9A 1PGBA 1EZ6A 3SK5A 2F0WA 2JU6X 2G9HD 1LTTD 1MD2D 1J9OA 2OEOA 3H94A 5M9OA 1BUIC 3NTIA 3W9CB 2E2HB 1OFFA 3TZUA 4UDUC 2PTLA 1LT4D 3NXWA 5HGTA 2F0OA 1C4AA 1FGBD 1XLPA 4FVMA 1C48A 5J39A 2MJEA 5AUKA 5BYQA 1HUNA 4JPSA 3OIPA 3T53B 4XT3B 3K58A 2KEEA 4CKCA 2J7ZA 1H9KA 2ICIA 4RNAA 1TWHB 2WXKA 4PV1C 2JA5B 1IW7C 2K5PA 1ENFA 3B9JA 3NQTA 4K5VA 2EKIA 5D7GA 1B9MA 4XDCA 2LY7A 2J42A 3AECB 2CVRA 5J22A 2L12A 1SNMA 4ODGA 2A73B 1AWDA 2M0AA 4PQXA 1FXAA 1PGXA 3A7AB 4FXKC 4RAUC 3FILA 2K03A 1G2TA 1RYJA 1L6UA 1N5XA 1Q8IA 3G6JB 3Q8FA 4C3JG 2SAKA 3VQIA 1TKYA 4G7ZC 4HRSA 1R4QB 2WXFA 3W2DA 3VYSA 3EFXD 2M2LA 4K2LA 4C1NK 5IGGA 1A15A 3K5OA 1Q1BA 1MGSA 1HA6A 1TY2A 4G7OC 1B50A 1TKWB 1TWCB 5BN5A 5BMIA 1PTOD 1QNKA 4L6TB 2L0CA 3S2HB 4NMZA 3GQBA 3T51B 1T5EA 1DONA 4DFAA 4P16A 3MP9A 4XQJA 5EPJA 2NTSA 3AMZA 1JOKA 1C77A 2VB3X 2LGIA 4HROA 1GUWA 3PUXA 5D14A 3T3OA 1KLUD 2B8FA 5KNCA 3NPPA 4MT5A 4OGQC 3AEDB 1JOQA 1WSPA 1XO3A 1CZPA 1I6HB 1STHA 3AU7A 4RWSC 1IW7D 1DOXA 3TP8A 4KY6A 5FOBB 1UWMA 4OZBA 4ZRPA 4R3DA 1S5FD 2B39A 1QE6A 3ITPA 4TQ1A 3PZ8A 4WH4A 2EELA 2YEPB 1M8AA 2ICEC 1LTAD 3IFDA 1DOKA 3Q8BA 2JEBI 5EKIA 1VR9A 1SE2A 2B2YA 3AE5B 1JWBD 2ZT9C 2L1BA 1KRHA 2R92B 1JWAD 4IFDI 3NSWA 1HZ6A 3T16A 4ZK9B 1L6VA 1XYIA 2F03A 2WXGA 4N9PA 1DGJA 5EGTA 4NJCA 3C8YA 2F0IA 4BA1I 4ZRQA 1GB4A 1L4DB 2JA7B 3Q69A 4IN3A 1E2ZA 4GLSC 2EXZA 2MJ8A 2XVSA 1Y56A 2V4DA 1EWYC 2B2WA 2PO4A 3K5NA 1FCCC 2EYPA 3CQZB 2IJ0A 4EQNA 5C0XH 4N59A 1A70A 2FE8A 2R61A 4BY1B 5HI1A 1MBYA 5EPKA 2V3PA 4JBWA 4KHVA 2KAJA 1RDPD 4KGTA 2WP9B 3I90A 4RHRA 4GDLB 1EL0A 1QWYA 2KECA 1HUMA 3SFEB 2N9LA 1BQQT 1JW9D 1T3QA 3P42A 1SBBB 1F2RI 5EE0A 1MVKA 4KKUA 3PIP3 1N62A 4J3OD 3D6WA 5MPOA 1Y69U 1EIHA 4RGTA 1MI2A 1FFUA 3RD4A 5I9PA 1IL8A 3I4NB 5LHY1 1NYRA 4DQOC 3OIQA 1I7HA 4K8IA 2WXPA 4FNFA 2QKIC 2X6LA 1HQMC 1W6KA 2WXRA 1F2LA 3LB8C 1C4QA 1LTID 1DD2A 3L3OC 2WXQA 4XTCS 1EU4A 1EY9A 5BN4A 1XXGA 2PVGC 1MI0A 4DAVA 3L9AX 2KA7A 2Z4HA 4KKSA 2WU5B 1VLBA 1LT3D 4A93B 4JE3B 2Q5WD 2KACA 2K01A 5CV5A 3U52E 1AZQA 2QJLA 4HEA1 4C1NI 5EE9A 1AW7A 1SMYC 2CW0C 1DOLA 4IUTA 1Y1WB 4OO1G 3NK9A 3QOLA 1R7SA 2EY5A 1D6EC 2XIWA 5AUIA 4US8A 3A54A 3OWFA 2DYOA 1F77A 3HOUB 1JORA 3IXSA 1VJKA 4GDKB 4ZUJA 3C3LA 5C5MA 3AEFB 1LTSD 5M5XB 4Q0FA 2KUMA 3DWPA 3ONAB 5KEEA 2F0TA 5ISRA 1WTOA 1HPCA 2ZW1A 1NEKB 4KD4A 4RA8A 4L8JA 4ZAIA 5JOBA 1DM0B 4P6VF 3H0GB 2JA6B 1GJXA 3DMUA 1IGCA 3MTSA 4YWGG 3TBIB 1SFOB 1DCZA 2BE5C 2DNEA 1XLOA 1EM7A 4B0MA 3SE0A 2LUMA 2PCFB 1R4PB 2F0VA 3GO5A 1RKNA 1RJTA 4DAYA 5JVG3 3N6RA 4L63B 2OF1A 3BK1A 4NAWB 2M19A 1D4BA 1K83B 1ZXIA 3D6CA 1C78A 2RSNA 4S3SA 3MFGA 2WQYB 1WD1A 3W5VB 4N58A 1SNPA 2BDOA 3HOYB 1CA5A 1TIID 3HZXA 4K8JA 2JYEA 3FPUB 3QG1A 2IWHA 4WWMA 2TMPA 2HCIA 1LTBD 4LK0M 5G3LF 4C3IG 1I4RA 5IGDA 2F0SA 2NN6I 2H88B 2IX1A 2W55A 4DA2A 1H9SB 2CW0D 5CV7A 1PTOB 4PMWA 1I3QB 5IT9E 4KJNA 3WCQA 3SFDB 3BDLA 5CV9A 1I4XA 1O7YA 4ULLA 3BS1A 2L32A 5IGCA 2F0QA 3S9WA 3J81L 3FAHA 5C0XI 2DWQA 3P4PB 4H0LC 3U4EG 1JWMD 4BBRB 1L4ZB 2MEKA 2DY7A 2JXMB 4AQ7A 4BBSB 3IAS1 3SEBA 4HJGE 4WFN3 4LTUA 2E2JB 1B1ZA 2BE5D 3HGBA 1WGKA 4J6HA 1TU2B 1YN3A 1SSNA 2AX5A 3CRKC 1JB3A 2FINB 3NWTA 4N6EB 3PZ7A 4CKEA 1ILQA 1CTMA 5FO9B 1QQRA 4N9TA 2W3SA 2D62A 1AZPA 2NVXB 4RH6A 2EYHA 3T56B 2PYKA 5I9OA 1E7PB 1B3AA 3GV3A 3KK7A 5IODA 1OO9B 5ELCA 1JWSD 5CMDA 3KF8A 1QT9A 3MHZA 1F2RC 2J0TD 2E2IB 2XSCA 1ZYRC 1V8CA 2W54A 4IUVA 5C4JB 4Y7NB 3MXPA 4FF1A 1IYVA 4CQNA 3J80E 3M7GA 2JYOA 1KAAA 2JSVX 2WXMA 3AEBB 3H09A 1WVLA 5CV4A 1X3QA 3QB3A 2DY8A 4KV6A 4C3IB 2NB0A 4ID6A 2K05A 1EEFD 2F0KA 5LL6X 3E5SA 5E4XA 3R2TA 2HUGA 2NYZD 2WXNA 1TKEA 2PIAA 2EJMA 4HR7B 3TP7A 2F0LA 3AEGB 3VYRA 2F0PA 1ZKOA 3NZ3A 3K59A 5C6AA 1F0ZA 1CM9A 2K28A 1K8OA 1V97A 3BDCA 4ZHOA 2E2DC 2EE1A 2F0MA 2E6XA 2AQ2B 3VRBB 1S5BD 2K1BA 1CA6A 3TMEA 1VMCA 1XTCD 2BOSA 1E0ZA 3AE6B 4XYOA 2IL8A 4K2KA 5EBDA 3UI3A 3AEEB 3BYYB 4USAA 3SR6A 4MIUA 5C5LA 1YMHE 1WTVA 4KKJA 1RF2D 1B44D 4REZA 5I4DA 1BMLC 3A8KE 4H2AA 3VYTA 4IQZA 1FYCA 5JPNC 1TVXA 4RF1A 3HOXB 1A3TA 3R3OA 3URYA 1PUTA 1EY7A 4KHZA 1JE4A 1GUNA 2E76C 4KX6B 3Q6SA 1U9RA 4KGSA 4M1UB 4TQ0A 1LTGD 1ZYRD 3RZDB 4OZCA 3FPPA 2X38A 2BDNA 1TT2A 4C80A 1LABA 3ZQ4A 5JAVA 5KNBA 2RDFA 4IKGA 2Y5CA 1STAA 1Y8NB 3SK6A 4G57A 2Y0SB 1ZPSA 1EY8A 4ZKBB 2INPE 4HMIA 3FVQA 3Q8EA 1C79A 4IUNA 1E2VA 4J1MA 4Q2JA 5KYLA 1LV9A 4XWWA 1X3PA 1OXTA 2H4OA 3BVMA 2TSSA 3AN1A 1FD6A 4FP5D 1PLFA 1TWAB 2N0SB 3BIID 2IX3A 2B2YC 1FRDA 2JA8B 1PRTF 3I9V1 1OXVA 3GTQB 3TSSA 4KN4C 2VNUD 1D5ZC 3FKIB 5I2XA 2BBCA 4M0WA 3DEPA 4V0BA 1TYGB 2F3WA 1TS2A 4ZHPA 1SYBA 3NTKA 1TS3A 3NWSA 4WURA 2ON8A 5IGEA 1JWUD 3A8IE 2SNSA 3P1HA 2EY2A 1V1PA 4EVOA 4X3KA 1FO4A 2B2WC 1S4ZA 1DJRD 3NVVA 5BYRA 1SYFA 3FC4A 4Z9CB 1CJEA 3I73A 5KNDA 2INNE 1C9FA 1QOAA 1ACCA 5LNK1 1A3UA 4K5XA 1SEBD 4KJOA 1KNAA 4AYBB 2WDVB 5J1ZA 1TR5A 1B9NA 4X3UA 4LLGM 3PO0A 3HG9A 3SXHA 3ETRA 2N55A 2NZ1D 4A9AA 5C2TB 4L2YA 5AFWA 3AE7B 1B9RA 5E3FA 4IFDG 5C0XJ 2L4NA 5G3LD 1G8ZD 5C3EB 4YTPB 3GP7A 4O42A 2R7ZB 5H92C 4XWTA 1NENB 1PFMA 3M85A 5BYSA 3OPOA 3K5LA 1ESFA 1I6VC 1BCPF 3K6OA 5BMGA 2MGSA 3N52A 4KGRA 1CI3M 4XXEA 1KLGD 3LYYA 2AWOA 3MXNA 5FKAC 1KNEA 1PZKD 2IW3A 1EIGA 4RGMA 3A7LA 1WTPA 2NBFA 1KABA 1E9MA 4NAMA 1XEEA 1Z47A 2KJXA 3TP6A 1NR4A 2WXHA 4ZYSA 4IURA 5C4XB 3TUOA 2JQRB 1DXMA 1ENAA 2BA0A 2L5TA 1BOSA 5EKLA 2OT2A 4I7ZC 3KLRA 4K5WA 2LHDA 1LO5D 2BTEA 2K7VA 3JAME 2PZTA 3TDQA 5ELBA 5IGFA 2EYOA 1UGJA 2JP1A 4F7XA 1XLQA 3OW7A 4RKLA 1A3VA 4EE2A 2L1AA 1YQ4B 4F8MA 2K5QA 1CZGA 5A35A 1TWFB 2CU3A 4R8IA 2PNRC 3ZYYX 1QOBA 4ABNA 4X3TA 1II3A 4U673 2A69C 4PMBA 2M9VA 4H13C 3VR6A 1AFPA 3GTMB 4MH8A 4LK1C 3VR9B 4TKOB 4MN3A 2KMMA 4KY7A 2N9KA 3GD7A 3R93A 4BS9A 2J52A 1SNQA 3KQ4A 2YU9B 1DYQA 1Q1EA 2K33A 1PTOH 1K53A 1A2UA 1Q10A 4WIPA 2LMCB 3PUVA 2L83A 1OQQA 2B2VA 1SE4A 3PUZA 1JCKB 1ZEQX 1NR2A 1RTNA 4OO1H 1NVID 1EOTA 2ID0A 4A3GB 2KEDA 3CKIB 1UWXA 4CGYB 1UAPA 1K51A 1PRTC 5K36G 3QO2A 5FLXL 3CWIA 3K7AB 3KWLA 1YJJA 3NE5B 2EPBA 2EDGA 4CJ0B 2KVMA 4CJ1B 3A8JE 2RDGA 1F9PA 4NZLB 1SXTA 3NS1A 1EWHA 4EGVA 3J7YW 2EY1A 3L4PA 1IHZA 2SDFA 3BVGA 2IPKD 1QNUA 3KLSX 1H9RA 4LAAA 2G1EA 1DOYA 3NTHA 5F2DA 4HSPA 1CZWA 1SE3A 2KN4A 1AN8A 1XCQL 2KDMA 3GB1A 3AMUA 1E6EB 1F2YA 3QJYA 4K6DA 5K5PA 2WXJA 1OXUA 1L5PA 1IKLA 2A69D 4XQQA 1MSHA 3RMHA 4NW2A 4F88A 1SYEA 2NTTA 1RD9D 4FXCA 4ZUIA 3E6ZX 2NN6G 3GTJB 3F2UA 1ML0D 4UAIA 4TMAB 3TEYA 3VYUA 2SEBD 1T5XD 1Y8PB 3FILB 1BCPC 3C1FA 3T13A 4EQPA 1SAPA 4DK1A 1LT6D 3QIAA 2C5CA 5D65A 4C3HG 4FF3A 2KOLA 3OHXC 1MHHE 1FXIA 1PRTD 1ZDVA 1UNSA 3BYTB 2NWGA 1VDZA 2X69A 3CRLC 2RKSA 1FCLA 1JICA 2NVTB 1KDAA 5H8YE 2QSDA 4FO2A 3OMGA 4R9WA 3LNNA 1LLRD 4X3SA 1F9RA 2RA4A 4NP5A 1DOMA 3IAYA 4ARCA 2BCOA 2N88A 2WS3B 3S1NB 4YSZB 2F3VA 5DM63 4PT5A 1JRPA 2WKCA 3J80L 1QOHA 1KTKA 2WP8J 4PNYA 4PMCA 2F1MA 4C2MB 1I4QA 4JK1C 5DM73 4L1BA 2O5IC 2HDMA 1QG7A 1Y8OB 5DNFA 4FYDA 1D5MC 3AE9B 1ET6A 4ILWA 2QDBA 1NAPA 4DNRB 1E0BA 4XIGS 1JROA 3G7LA 3MXUA 3S1MB 1GOZA 1Z7TA 1EFID 2JEAI 1ONLA 4KN7C 4FF2A 3NVZA 2V4IB 3HP3A 1R9TB 1OXXK 1YNNC 1H9MA 1QCBD 3MVVA 1WRIA 2K32A 2QILA 2F0UA 2MH7A 1BCPD 4KKIA 4QCLA 3V3XA 5KYIA 3VR3A 4BY7B 4QUCA 3R2IA 4A3IB 3LXFA 3KUPA 2D2CC 5CBEE 4LJZC 2IDYA 3ZGZA 3V96A 2K04A 3ND8A 4HKZE 1BBXC 4C3HB 2E74C 3D4DA 4FF4A 5A2QE 4YIJA 4C56C 3NVYA 4U68A 3AV8A 1PZJD 3HVDA 3PO3B 4WJWA 1VCIA 3C46A 2A6EC 4K6LA 2F0JA 3IAM1 2BYTA 3P75A 1ILPA 4HCEA 3W1SA 4CKBA 5E4WC 4A3DB 5HG2A 2DLBA 3P20A 3VRAB 2W3RA 1EZ8A 4OHJA 1S5ED 2FMCA 2VZKD 4KMUC 3BDOA 2V0GA 1KH0A 1QJOA 3FMCA 3MZ5A 3NVWA 1FD7D 4RF0A 1YNTE 2O5JC 5ELDA 1G291 1PFBA 1S5DD 3GS2A 4K14A 5CC4A 1EQTA 1ENCA 3IKJA 2L11A 2I38A 1FFVA 2DN8A 3E56A 1JQYD 1STYA 1C4PA 1KDCA 2WXOA 1BDOA 4RGNA 2B2UA 2XNAC 3KLSA 3TZDA 5T1GA 2M00A 1EYDA 2Z4IA 3D31A 1MSGA 1YNND 3CIRB 3FEWX 5BMHA 3S1RB 1GHKA 1VZ6A 1O7ZA 4WQMA 2BS2B 3OSOA 3EROA 2Y5PA 2JSOA 3MJ5A 5HFYA 1SYCA 2EYMA 1C4CA 2HDEA 1HEZE 2KQ3A 1TY0A 5G5GA 2WAQB 1D1KA 2RBMA 3AEAB 1JQ4A 5HHDG 5EQ0A 2X6GA 2LKVA 4CBVA 5JEAH 1YN5A 1BO0A 3QOJA 4TRDA 1HFNA 2WNMA 1K8MA 2L52A 3LWEA 3NHHA 2NVYB 1WTQA 2A6ED 1OQRA 1RCVD 3MAQA 5M3MB 1FM0D 1O78A 3PO2B 3IT4B 3TEZA 2Q8RE 4RGOS 2R93B 3M7NA 1NCVA 2DNCA 4IUPA 1XF5L 3W5UB 1UEAB 2O4XA 1TWGB 4ME5A 2C9OA 5JJZA 3S17B 3SVMA 2GRIA 4GZYC 3I4MB 4YT0B 1F2MA 3OOCA 5E1FA 1WD0A 2ACZB 1QF6A 2AQ3B 3P4SB 4F87A 4HTHA 4HSVA 3U9SA 2GA4B 1V8QA 4HN7A 2EJFC 1I50B 1M4VA 1JOOA 4XDXA 3SK8A 2RMMA 4DGZA 1QLBB 1RHPA 1NYQA 3L7ZC 1BNZA 5FR3A 4IOIE 4HEDA 3AB9A 5KRUA 4HMJA 1ZP0B 4A8XC 1XX8A 2K22A 4IFDH 3I70A 3H91A 5TSSA 2WIIB 1PRTB 4ZKCB 1TJEA 2M56B 5JEAG 3HS0C 1B2TA 3AE3B 4C7ZA 2HDLA 4OIJA 2J53A 2AUJD 2BB6A 3T3NA 1HA5A 3LWUA 4KTAA 4NKLA 3BK2A 2PLPA 1K52A 1I4PA 3JAML 3R8BA 2ZW0A 4IZ8A 2MJ3A 3Q0AA 3AE2B 4H7BA 1Y1VB 1XWEA 3SHLA 1FMAD 3S16B 2AUKA 2LEKA 1K50A 2IGDA 1JMLA 4TSSA 1EY5A 2Q8TA 2CJOA 1FNWA 3GTPB 1IYUA 2B2VC 1VF5C 3P7JA 3MWYW 3NBIA 2B76B 1SNOA 1MPEA 4EQOA 3ZJTA 1I4GA 3VA5A 3S2DB 2JX5A 1Z6HA 1G91A 4D2KA 2MUYA 3H3VC 1LTRD 3RUZA 3Q24A 2K5WA 4J8QA 2IT1A 1ROEA 1PXUA 5M5YB 2IX0A 1ZUD2 5KIXA 3E0JA 3J9CA 4A3EB 2WACA 1GXDC 2OEDA 2F0NA 1AP0A 1AEXA 5GXGB 1BCPB 2SNMA 3MHBA 4ZRZA 5EE1A 2WINB 2EYFA 1X32A 1H9JA 4OZAA 2Z8LA 2DBYA 2DYMA 2YYZA 4YTMB 4A3MB 3J7AF 1NI3A 3WDNA 1OXSC 5D3DA 1KDBA 4DXGA 3QWNA 5EBCA 5EJWA 3ND9A 2A68C 5D3IB 2B8GA 5C4HA 3GTGB 1ICWA 1FNVA 1VDVA 2VUMB 3GTOB 3NBHA 1D2BA 2QF7A 2I46A 2CQAA 2K3UA 4BA2I 3ABVB 1KF6B 4YXDB 1HXYD 3P4RB 3D3RA 3DWAA 3DWGC 2K5DA 2BW2A 5K36H 1VF7A 4XYQA 2VZKB 4CHTB 1KFYB 4B0EA 5EE3A 2WKDA 1EY6A 3IL8A 2RQXA 4ZOHC 1D1IA 2H1EA 1HTLD 3W3AA 1DOIA 1QB5D 3H6MA 2QMTA 1PDXA 1J7AA 3MFYA 1YN4A 5T1IA 1G2SA 5EPLA 4WRDA 1J7BA 5CR3A 1PDQA 2L9HA 3P1MA 3VR5A 5COYA 2GI9A 5ELEA 4I65A 5FO7B 4A3FB 2PVOD 2CJNA 1SJED 3EJIA 2MHVA 3SDZA 3AE4B 1V43A 1E2WA 3V2TA 1O80A 5BN3A 1RTOA 1HFGA 1HZ5A 3Q8AA 1STGA 1CK1A 3KBGA 5EKKA 3A56A 1L0VB 1JALA 3GTLB 2FMMA 1ET9A 3HRDD 4XT1B 4H44C 3NRZA 2WDQB 4QUFA 2KQ4X 1H9SA 3MXGA 5T8IA 4IDIA