1UVFA

Solution structure of the structured part of the 15th domain of lekti
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
DSEMCKDYRVLPRIGYLCPKDLKPVCGDDGQTYNNPCMLCHENLIRQTNTHIRSTGKCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE PROTEINASE INHIBITOR KAZAL TYPE 5
publication title The Solution Structure of a Chimeric Lekti Domain Reveals a Chameleon Sequence
pubmed doi rcsb
source organism Homo sapiens
molecule tags Serine proteinase inhibitor
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2004-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1uvfA00
2N52A 2P6AC 1IY5A 1BUSA 1CT4I 1HPTA 2QQCA 1OMTA 2SGEI 1UVGA 2ARPF 2KMQA 2N17A 1CGJI 1DS3I 1PPFI 1IW4A 2NU4I 2SGPI 1OVOA 2OVOA 1SGRI 2QQDA 2GKTI 1CT0I 1BMOA 1LR9A 1N13A 2NU3I 2KMOA 1CGII 1SGQI 1OYVI 1YU6C 1M8CA 1Y1CA 2SGDI 1PJUA 2KMRA 2WCYA 1UVFA 2KCXA 2GKRI 2NU1I 1TBRR 1KMAA 1IY6A 1FYBA 1CSOI 2KMPA 1TUSA 2LEOA 1CE3A 1H0ZA 2B0UC 5DAEA 2NU0I 4HGUA 3SGBI 1M8BA 2NU2I 1TIHA 1R0RI 1NUBA 2ERWA 1DS2I 2V53A 1Y1BA 1CHOI 3SEKC 3SGQI 1MT1A 1HJAI 1YTPA 3QTLD 1PCEA 2JXDA 1LR7A 1SGYI 1SGNI 3TJQA 5JHWC 4OVOA 3OVOA 2BUSA 1AN1I 1LR8A 1CT2I 4SGBI 2F3CI 3HH2C 4GI3C 2N71A 2JYYA 1TBQR 2SGFI 2XRCA 1SGPI 1OMUA 3B4VC 1HDLA 2SGQI 1TGSI 2M5XA 1TURA 2GKVA 1SGDI 1UUCA 1Z7KB 1SGEI 2JZMA
chains in the Genus database with same CATH superfamily
1XA6A 1WKXA 2N52A 2P6AC 2GIVA 3FSXA 3MEKA 2OU2A 1BUSA 1CT4I 1HPTA 3KY9A 3VDUA 3UOEA 1FARA 3BJIA 1FY7A 2QQCA 1OMTA 2OZUA 2SGEI 2X52A 1UVGA 5EX3A 1K7VA 3VE5A 2L8EA 2ARPF 2KMQA 2N17A 2PQ8A 4FKDA 1CGJI 2DIPA 4WP4A 1DS3I 1PPFI 2ENNA 1IW4A 7WGAA 3TO6A 2NU4I 2LB7A 2SGPI 1W3SA 1OVOA 1PTRA 2K9HA 2OVOA 3OXFA 1SGRI 2ODDA 2QQDA 2GKTI 3UEYA 1CT0I 1BMOA 1LR9A 1N13A 1RFHA 2JW6A 2NU3I 2KMOA 2Y0MA 3OXGA 1CGII 1SGQI 1WTJA 3QWPA 1OYVI 5FUWA 3GOXA 2CWFA 1X74A 4AMLA 1YU6C 2ORVA 2J87A 2ROWA 1M8CA 1MJ9A 2LUYA 1Y1CA 2SGDI 1PJUA 2KMRA 2WCYA 3FSYA 1UVFA 1K7TA 2ORWA 5FUVA 1XX6A 2KCXA 2GKRI 2NU1I 5EX0A 2UVOA 1TOTA 2N1AB 1TBRR 2WVJA 3OL0A 4JCVE 1U5KA 3QAHA 5E3QA 1KMAA 4UXJA 4A24A 4UXHA 1IY6A 1FYBA 1CSOI 4E1PA 3TOBA 2KMPA 1TUSA 1TBNA 2LEOA 1CE3A 2B0UC 1H0ZA 5DAEA 5FUYA 4L9MA 1HEVA 1KBEA 2NU0I 1XBTA 4HGUA 3SGBI 1Q9BA 1Y8FA 2GVIA 1VDDA 2RC4A 2E73A 1WGCA 2VRWB 1M8BA 2NU2I 2FNFX 1KBFA 1TIHA 1P9ZA 2X3TA 2L7XA 3E2IA 3TO7A 1R0RI 1NUBA 2ERWA 1DS2I 1R79A 2V53A 2QQ0A 4DNCA 3OXLA 1Y1BA 1CHOI 1W4RA 5FUXA 1P9GA 3UEJA 3SEKC 3R5CA 5CCMA 3R5DA 3FC3A 3SGQI 1MT1A 1HJAI 1YTPA 2A20A 3RU0A 3E59A 3QTLD 2ELIA 2V1CC 4E1RA 1UHAA 1PCEA 2JXDA 1S20A 1LR7A 3UGIA 1SGYI 2CWHA 1Z2IA 1K7UA 1SGNI 2J9RA 4MPIA 3TJQA 2DKVA 5JHWC 4OVOA 3UGLA 4B6DA 1X4SA 1ULKA 3OVOA 2UZ3A 5CCLA 5E3RA 5J8FA 2BUSA 1LR8A 1V1IA 1AN1I 1NXUA 1ULMA 1CT2I 2JA1A 1WGTA 2RIJA 4SGBI 1MJBA 2F3CI 3D00A 3HH2C 4GI3C 2V1CA 1TBOA 2N71A 2WGCA 2DB6A 9WGAA 2JYYA 1TBQR 2SGFI 2OD1A 2XRCA 3TOAA 2CJSC 1SGPI 2YQPA 2CWGA 2E5RA 1OMUA 3B4VC 3UFFA 3TO9A 1HDLA 2SGQI 1PTQA 3VDPA 1TGSI 3R5BA 2M5XA 5HI7A 5HQ8A 1MJAA 4UXIA 2YUUA 2W0TA 3UGDA 5J8CA 1TURA 2QPOA 2QQEA 2GKVA 3PDNA 1FAQA 2B8TA 1SGDI 1UUCA 1IY5A 1Z7KB 3R5AA 1ULNA 3CXLA 1SGEI 5E3PA 2JZMA 2ENZA 1V1HA
chains in the Genus database with same CATH topology
1XA6A 2N52A 2P6AC 3MEKA 1IY5A 1BUSA 1CT4I 1HPTA 3KY9A 3VDUA 1FARA 3BJIA 2QQCA 1OMTA 2SGEI 5EX3A 1UVGA 3VE5A 2L8EA 2ARPF 2KMQA 2N17A 4FKDA 1CGJI 2DIPA 1DS3I 1PPFI 2ENNA 1IW4A 2NU4I 2SGPI 1W3SA 1OVOA 1PTRA 2K9HA 2OVOA 3OXFA 1SGRI 2ODDA 2QQDA 2GKTI 3UEYA 1CT0I 1BMOA 1LR9A 1N13A 1RFHA 2JW6A 2NU3I 2KMOA 3OXGA 3QWPA 1CGII 1SGQI 1OYVI 5FUWA 3GOXA 1X74A 1YU6C 2ORVA 2J87A 2ROWA 1M8CA 2LUYA 1Y1CA 2SGDI 1PJUA 2KMRA 2WCYA 1UVFA 2ORWA 5FUVA 1XX6A 2KCXA 2GKRI 2NU1I 5EX0A 1TOTA 2N1AB 1TBRR 2WVJA 3OL0A 4JCVE 1U5KA 1KMAA 4UXJA 4A24A 4UXHA 1IY6A 1FYBA 1CSOI 4E1PA 2KMPA 1TUSA 1TBNA 2LEOA 1CE3A 2B0UC 1H0ZA 5DAEA 5FUYA 4L9MA 1KBEA 2NU0I 1XBTA 4HGUA 3SGBI 1Y8FA 2GVIA 1VDDA 2E73A 2VRWB 1M8BA 2NU2I 2FNFX 1KBFA 1TIHA 2L7XA 3E2IA 1R0RI 1NUBA 2ERWA 1DS2I 1R79A 2V53A 2QQ0A 3OXLA 1Y1BA 1CHOI 1W4RA 5FUXA 3UEJA 3FC3A 3SEKC 5CCMA 3SGQI 1MT1A 1HJAI 1YTPA 2A20A 3RU0A 3E59A 3QTLD 2ELIA 2V1CC 4E1RA 1PCEA 2JXDA 1LR7A 3UGIA 1SGYI 1SGNI 2J9RA 3TJQA 5JHWC 4OVOA 3UGLA 4B6DA 1X4SA 3OVOA 2UZ3A 5CCLA 2BUSA 1V1IA 1AN1I 1LR8A 1CT2I 2JA1A 4SGBI 2F3CI 3D00A 3HH2C 4GI3C 2V1CA 1TBOA 2N71A 2DB6A 2JYYA 1TBQR 2SGFI 2OD1A 2XRCA 2CJSC 1SGPI 2YQPA 3UFFA 2E5RA 1OMUA 3B4VC 1HDLA 2SGQI 1PTQA 3VDPA 1TGSI 2M5XA 5HI7A 5HQ8A 4UXIA 2YUUA 2W0TA 3UGDA 1TURA 2QPOA 2QQEA 2GKVA 3PDNA 1FAQA 2B8TA 1SGDI 1UUCA 1Z7KB 3CXLA 1SGEI 2JZMA 2ENZA 1V1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N52 A;  2P6A C;  1IY5 A;  1BUS A;  1CT4 I;  1HPT A;  2QQC A;  1OMT A;  2SGE I;  1UVG A;  2ARP F;  2KMQ A;  2N17 A;  1CGJ I;  1DS3 I;  1PPF I;  1IW4 A;  2NU4 I;  2SGP I;  1OVO A;  2OVO A;  1SGR I;  2QQD A;  2GKT I;  1CT0 I;  1BMO A;  1LR9 A;  1N13 A;  2NU3 I;  2KMO A;  1CGI I;  1SGQ I;  1OYV I;  1YU6 C;  1M8C A;  1Y1C A;  2SGD I;  1PJU A;  2KMR A;  2WCY A;  1UVF A;  2KCX A;  2GKR I;  2NU1 I;  1TBR R;  1KMA A;  1IY6 A;  1FYB A;  1CSO I;  2KMP A;  1TUS A;  2LEO A;  1CE3 A;  1H0Z A;  2B0U C;  5DAE A;  2NU0 I;  4HGU A;  3SGB I;  1M8B A;  2NU2 I;  1TIH A;  1R0R I;  1NUB A;  2ERW A;  1DS2 I;  2V53 A;  1Y1B A;  1CHO I;  3SEK C;  3SGQ I;  1MT1 A;  1HJA I;  1YTP A;  3QTL D;  1PCE A;  2JXD A;  1LR7 A;  1SGY I;  1SGN I;  3TJQ A;  5JHW C;  4OVO A;  3OVO A;  2BUS A;  1AN1 I;  1LR8 A;  1CT2 I;  4SGB I;  2F3C I;  3HH2 C;  4GI3 C;  2N71 A;  2JYY A;  1TBQ R;  2SGF I;  2XRC A;  1SGP I;  1OMU A;  3B4V C;  1HDL A;  2SGQ I;  1TGS I;  2M5X A;  1TUR A;  2GKV A;  1SGD I;  1UUC A;  1Z7K B;  1SGE I;  2JZM A; 
#chains in the Genus database with same CATH topology
 1XA6 A;  1WKX A;  2N52 A;  2P6A C;  2GIV A;  3FSX A;  3MEK A;  2OU2 A;  1BUS A;  1CT4 I;  1HPT A;  3KY9 A;  3VDU A;  3UOE A;  1FAR A;  3BJI A;  1FY7 A;  2QQC A;  1OMT A;  2OZU A;  2SGE I;  2X52 A;  1UVG A;  5EX3 A;  1K7V A;  3VE5 A;  2L8E A;  2ARP F;  2KMQ A;  2N17 A;  2PQ8 A;  4FKD A;  1CGJ I;  2DIP A;  4WP4 A;  1DS3 I;  1PPF I;  2ENN A;  1IW4 A;  7WGA A;  3TO6 A;  2NU4 I;  2LB7 A;  2SGP I;  1W3S A;  1OVO A;  1PTR A;  2K9H A;  2OVO A;  3OXF A;  1SGR I;  2ODD A;  2QQD A;  2GKT I;  3UEY A;  1CT0 I;  1BMO A;  1LR9 A;  1N13 A;  1RFH A;  2JW6 A;  2NU3 I;  2KMO A;  2Y0M A;  3OXG A;  1CGI I;  1SGQ I;  1WTJ A;  3QWP A;  1OYV I;  5FUW A;  3GOX A;  2CWF A;  1X74 A;  4AML A;  1YU6 C;  2ORV A;  2J87 A;  2ROW A;  1M8C A;  1MJ9 A;  2LUY A;  1Y1C A;  2SGD I;  1PJU A;  2KMR A;  2WCY A;  3FSY A;  1UVF A;  1K7T A;  2ORW A;  5FUV A;  1XX6 A;  2KCX A;  2GKR I;  2NU1 I;  5EX0 A;  2UVO A;  1TOT A;  2N1A B;  1TBR R;  2WVJ A;  3OL0 A;  4JCV E;  1U5K A;  3QAH A;  5E3Q A;  1KMA A;  4UXJ A;  4A24 A;  4UXH A;  1IY6 A;  1FYB A;  1CSO I;  4E1P A;  3TOB A;  2KMP A;  1TUS A;  1TBN A;  2LEO A;  1CE3 A;  2B0U C;  1H0Z A;  5DAE A;  5FUY A;  4L9M A;  1HEV A;  1KBE A;  2NU0 I;  1XBT A;  4HGU A;  3SGB I;  1Q9B A;  1Y8F A;  2GVI A;  1VDD A;  2RC4 A;  2E73 A;  1WGC A;  2VRW B;  1M8B A;  2NU2 I;  2FNF X;  1KBF A;  1TIH A;  1P9Z A;  2X3T A;  2L7X A;  3E2I A;  3TO7 A;  1R0R I;  1NUB A;  2ERW A;  1DS2 I;  1R79 A;  2V53 A;  2QQ0 A;  4DNC A;  3OXL A;  1Y1B A;  1CHO I;  1W4R A;  5FUX A;  1P9G A;  3UEJ A;  3SEK C;  3R5C A;  5CCM A;  3R5D A;  3FC3 A;  3SGQ I;  1MT1 A;  1HJA I;  1YTP A;  2A20 A;  3RU0 A;  3E59 A;  3QTL D;  2ELI A;  2V1C C;  4E1R A;  1UHA A;  1PCE A;  2JXD A;  1S20 A;  1LR7 A;  3UGI A;  1SGY I;  2CWH A;  1Z2I A;  1K7U A;  1SGN I;  2J9R A;  4MPI A;  3TJQ A;  2DKV A;  5JHW C;  4OVO A;  3UGL A;  4B6D A;  1X4S A;  1ULK A;  3OVO A;  2UZ3 A;  5CCL A;  5E3R A;  5J8F A;  2BUS A;  1LR8 A;  1V1I A;  1AN1 I;  1NXU A;  1ULM A;  1CT2 I;  2JA1 A;  1WGT A;  2RIJ A;  4SGB I;  1MJB A;  2F3C I;  3D00 A;  3HH2 C;  4GI3 C;  2V1C A;  1TBO A;  2N71 A;  2WGC A;  2DB6 A;  9WGA A;  2JYY A;  1TBQ R;  2SGF I;  2OD1 A;  2XRC A;  3TOA A;  2CJS C;  1SGP I;  2YQP A;  2CWG A;  2E5R A;  1OMU A;  3B4V C;  3UFF A;  3TO9 A;  1HDL A;  2SGQ I;  1PTQ A;  3VDP A;  1TGS I;  3R5B A;  2M5X A;  5HI7 A;  5HQ8 A;  1MJA A;  4UXI A;  2YUU A;  2W0T A;  3UGD A;  5J8C A;  1TUR A;  2QPO A;  2QQE A;  2GKV A;  3PDN A;  1FAQ A;  2B8T A;  1SGD I;  1UUC A;  1IY5 A;  1Z7K B;  3R5A A;  1ULN A;  3CXL A;  1SGE I;  5E3P A;  2JZM A;  2ENZ A;  1V1H A; 
#chains in the Genus database with same CATH homology
 1XA6 A;  2N52 A;  2P6A C;  3MEK A;  1IY5 A;  1BUS A;  1CT4 I;  1HPT A;  3KY9 A;  3VDU A;  1FAR A;  3BJI A;  2QQC A;  1OMT A;  2SGE I;  5EX3 A;  1UVG A;  3VE5 A;  2L8E A;  2ARP F;  2KMQ A;  2N17 A;  4FKD A;  1CGJ I;  2DIP A;  1DS3 I;  1PPF I;  2ENN A;  1IW4 A;  2NU4 I;  2SGP I;  1W3S A;  1OVO A;  1PTR A;  2K9H A;  2OVO A;  3OXF A;  1SGR I;  2ODD A;  2QQD A;  2GKT I;  3UEY A;  1CT0 I;  1BMO A;  1LR9 A;  1N13 A;  1RFH A;  2JW6 A;  2NU3 I;  2KMO A;  3OXG A;  3QWP A;  1CGI I;  1SGQ I;  1OYV I;  5FUW A;  3GOX A;  1X74 A;  1YU6 C;  2ORV A;  2J87 A;  2ROW A;  1M8C A;  2LUY A;  1Y1C A;  2SGD I;  1PJU A;  2KMR A;  2WCY A;  1UVF A;  2ORW A;  5FUV A;  1XX6 A;  2KCX A;  2GKR I;  2NU1 I;  5EX0 A;  1TOT A;  2N1A B;  1TBR R;  2WVJ A;  3OL0 A;  4JCV E;  1U5K A;  1KMA A;  4UXJ A;  4A24 A;  4UXH A;  1IY6 A;  1FYB A;  1CSO I;  4E1P A;  2KMP A;  1TUS A;  1TBN A;  2LEO A;  1CE3 A;  2B0U C;  1H0Z A;  5DAE A;  5FUY A;  4L9M A;  1KBE A;  2NU0 I;  1XBT A;  4HGU A;  3SGB I;  1Y8F A;  2GVI A;  1VDD A;  2E73 A;  2VRW B;  1M8B A;  2NU2 I;  2FNF X;  1KBF A;  1TIH A;  2L7X A;  3E2I A;  1R0R I;  1NUB A;  2ERW A;  1DS2 I;  1R79 A;  2V53 A;  2QQ0 A;  3OXL A;  1Y1B A;  1CHO I;  1W4R A;  5FUX A;  3UEJ A;  3FC3 A;  3SEK C;  5CCM A;  3SGQ I;  1MT1 A;  1HJA I;  1YTP A;  2A20 A;  3RU0 A;  3E59 A;  3QTL D;  2ELI A;  2V1C C;  4E1R A;  1PCE A;  2JXD A;  1LR7 A;  3UGI A;  1SGY I;  1SGN I;  2J9R A;  3TJQ A;  5JHW C;  4OVO A;  3UGL A;  4B6D A;  1X4S A;  3OVO A;  2UZ3 A;  5CCL A;  2BUS A;  1V1I A;  1AN1 I;  1LR8 A;  1CT2 I;  2JA1 A;  4SGB I;  2F3C I;  3D00 A;  3HH2 C;  4GI3 C;  2V1C A;  1TBO A;  2N71 A;  2DB6 A;  2JYY A;  1TBQ R;  2SGF I;  2OD1 A;  2XRC A;  2CJS C;  1SGP I;  2YQP A;  3UFF A;  2E5R A;  1OMU A;  3B4V C;  1HDL A;  2SGQ I;  1PTQ A;  3VDP A;  1TGS I;  2M5X A;  5HI7 A;  5HQ8 A;  4UXI A;  2YUU A;  2W0T A;  3UGD A;  1TUR A;  2QPO A;  2QQE A;  2GKV A;  3PDN A;  1FAQ A;  2B8T A;  1SGD I;  1UUC A;  1Z7K B;  3CXL A;  1SGE I;  2JZM A;  2ENZ A;  1V1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...