1UVPA

Structure of the complex of porcine pancreatic elastase in complex with cadmium refined at 1.85 a resolution (crystal b)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE 1
publication title On the Influence of the Incident Photon Energy on the Radiation Damage in Crystalline Biological Samples
pubmed doi rcsb
molecule tags Hydrolase
total genus 64
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2004-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1uvpA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1uvpA01
1AIXH 1UCYH 4D9QA 3EA7A 3SNAA 5HXFA 1GHZA 2CF9H 4XSKU 2B0FA 3ZZAA 3SU4A 2VVUA 1Q31A 1UTPA 4K8YA 3I78A 1C1SA 1ORFA 1D6WA 1TPAE 2BZ6H 1WTGH 4WH8A 3UR6A 4X6PA 2FYRA 2AEIH 4NA7A 3SJ8A 2ZWLH 4CRFA 1C2KA 2UWOA 1IQGA 2FESH 3RXMA 2ZFRH 3P8OA 4JK6A 3F9EA 3KQDA 4BANB 2P59A 2BY7X 3M7UA 1J16A 4F49A 1O2MA 4FUHA 9LPRA 2VJ1A 1BZXE 1SHYA 1TMUH 1NFUA 1CGIE 2ZFTA 1LKAA 2ZTXA 3V12A 4IMZA 1C1QA 1ZRBA 1F0TA 2FPZA 3LGTA 2GDEH 1ZGVA 3AW1A 1L4DA 4WXIA 1O3MA 3QN7A 2PLXA 2AMQA 3RXTA 1QJ1B 4Z0KA 1O2PA 4Q7XA 1AE8H 1K28D 1K1NA 4IN2A 4FU9A 1SLWB 2UUKB 1O2HA 1PQAA 2SGPE 3SI3H 1Y5BT 4MPXA 1JIRA 2Z9GA 1LHGH 2ZHWH 4MNWA 4GLYA 1HYLA 3KN2A 1BTXA 1VJAU 3NKKA 1SGPE 1FUJA 2BD3A 1ABIH 1LHFH 3MH4A 3RUOA 1EAUA 1HXFH 3PWCA 4D7FA 1G37A 1S0RA 4ZKSU 3BIVH 1P9UA 3RDZA 1C2LA 4X1RU 5E0HA 1RGQA 1HJ9A 4AGJA 2AIQA 2FS8A 4I8LA 1EZUC 4YLQH 1C5RA 5PTPA 1GBFA 1P01A 2H6MA 1FPHH 1UO6A 5SGAE 5AF9H 1DE7H 3SU0A 1P2NA 1F5KU 1A61H 1P11E 1ELFA 3A82A 1D3DB 1O2YA 4FVDA 2TGAA 1IQEA 1A2CH 3V3MA 1P02A 1A5HA 2SFAA 1C5OH 3QO6A 1WV7H 1C5YB 4LXBH 1HAXB 2JKHA 4X6OA 2FX4A 1ZGIA 5C1XA 2A0QB 1HFDA 3RU4D 3P8FA 2XCNA 1DSUA 7GCHF 4R8TB 1AWFH 3GY3A 5LPRA 1O3NA 1W12U 1FLEE 3IWMA 2FOAA 3A81A 4FUGA 4RN6A 1DX5M 5L2ZH 2FLRH 1MTVA 4AG2A 1QBOA 4NIYA 1IOEA 1BTYA 1C1TA 2PGQB 2OC8A 3M3TA 4OS1A 2XRCA 4CBNA 4INKA 4B71A 4X2YA 4CRDA 1TPSA 1DFPA 1YYY1 2BTCE 1YP9A 1L0ZA 1Y3WA 3F9HA 1J15A 1CO7E 1PPFE 1F0UA 1YGCH 2PKSC 3E0PB 1TX8A 5EXMA 1MUEB 1C5XB 3FVFB 1TOCB 3F68H 2YNAA 1CU1A 3P92A 3UQOA 3BTHE 1TYNA 1P2JA 1GI8B 1HCGA 1J9CH 1TLDA 5C3NA 2H9TH 5BPEA 2ZFFH 4O03A 1QJ7B 2G00A 4DT7B 3ZV8A 5DP6A 3PO1B 1LQEA 5L2YH 1ZTJA 1O5FH 1ZSJA 4X2VA 1SPJA 4CHAC 1UTQA 2OQUA 3RXUA 5AFZH 3FZZA 2O8MA 2FTMA 1ZMLA 3ITIA 1P2OA 3IG6B 1YCPM 1IHTH 3AW0A 3TVJB 1YPHC 3I77A 2H2ZA 1MTNC 4U32A 1ARCA 1RJXB 2QF0A 5EOKA 5ESBA 3SJOA 4H6TA 1MKXH 1IAUA 4WVPE 5JBBS 3K6ZA 2GZ7A 1UVUH 1LHDH 3MU4A 1ZRKA 2H9HA 3C1KA 1DY9A 1X7AC 2JETB 3TH4H 1RRKA 3O8RA 1GJCB 4UFDH 2BY9X 4BTTB 3SHCH 4NFFA 2WPIS 1C2HA 1FY5A 5A09A 1V2NT 3ATMA 2ZU5A 1ZYOA 4RKOB 2F9VA 3VEQB 5EQQA 1GMDG 1ZJDA 3RXCA 1LTOA 2QN5T 3UWIA 1LCYA 1LVBA 2F9BH 1BBRE 3KHVA 1TX7A 2OBOA 3RXDA 1QURH 2C8WB 3TK6A 2B7DH 4I33A 1TRMA 2H5DA 3BSQA 1RIWC 1FQ3A 3KQCA 1C5NH 3GY5A 1RTKA 1Z8JB 5A8XA 3BN9A 5ETXA 4DJZB 6CHAC 3NUMA 1MKWH 1HGTH 2ZCLP 3U9AH 1G30B 1V2TT 2FOEA 4CBOA 4K69A 3RMOH 3BTTE 3VB4A 3RU4E 3E1XB 3GY8A 3UIRA 1Q3XA 5FAHA 1GHWH 2OQ5A 5DP7A 2ILNA 2I6QA 4HGCA 3A8BA 3ZVBA 1ELGA 2XYAA 2FS9A 1H9LB 2M5TA 2ZFPH 1AO5A 2PWXA 4YT7H 1EAWA 1GBBA 1HXEH 2O8UA 3BG4C 4JCNA 4M7GA 2ESTE 4NFEA 3DD2H 2VIVA 1KLTA 1VJ9U 4AFZA 3GY6A 1SGFG 3MU8A 1O3GA 1L1NA 2W3KA 1OWIA 2FOGA 1OS8A 1KSNA 3Q3YA 2DUCA 2SGEE 1T4VH 4O97A 1BRUP 1C4Y2 3A7WA 5FPYA 3SJIA 1TRYA 4H6SB 2TBSA 2OLGA 1SGIB 1RFNA 1V2RT 1TFXA 3KCGH 1DANH 2GZ9A 1C1OA 3CS0A 3RMNH 3T25A 3VGCB 1Y3YA 5TCCA 4NSYA 4OGXA 3LIWA 4GCHF 4SGBE 1GJ7B 1SC8U 7KMEH 1UHBA 3LGVA 5FHTA 1CT0E 2Y82A 1NC6A 3A86A 2VINA 2P3TB 1TNGA 4OS7A 3HGPA 4NWKA 3T29A 3OY6U 1SB1H 2ZU2A 2BMGB 5GJ4B 3RP2A 1HBTH 3U8RH 3VB6A 3M7QA 2PKAA 5EPNA 5FBIA 2PHBA 1ELEE 4I8HA 4MTBA 3MU0A 2BX4A 1O5BB 1DS2E 2V3HH 1EASA 3T2NA 3TITA 2EI8A 3BTEE 2ZGJA 1EATA 4YTAA 3UUZA 3PTNA 2RCEA 2FEQH 1NY22 2ZU3A 5EQRA 3JZ1B 1WAYB 1SI5H 2BVSH 1IQHA 1W7XH 3LJOA 1UTJA 1WCZA 1N8OB 1YPHE 1DLEA 3UREA 5A0CA 1S85A 1RTLA 2OD3B 2CXVA 2OTVA 3ELAH 3GCHB 2WPHS 1GBKA 1HAPH 1O3KA 4UEHH 4Q7ZA 3KQEA 1HJ8A 2RA3A 2Z9JA 1FZZA 4GUXA 5DGJA 2KAIA 3GDUA 1XXDA 1EQ9A 5T6DA 2C8YB 3RC4A 2C93B 2GMTB 3RXHA 2GCHG 1Y8TA 2ZDVH 4K1SA 4DY7B 3LGIA 2C90B 4DCDA 1P05A 4GVUA 1UK4A 4JZIA 3ZYDA 1BMMH 2FM2A 1FY8E 3PMAB 3QGNB 1O3BA 1V2QT 2Z9KA 2P94A 1THRH 3TGJE 4NIWA 1C1MA 1AB9B 2I6SA 1GL1A 1HB0B 2GT7A 2ZDKA 4XDEA 1AHTH 1PPBH 4ISNA 2FOCA 4DVAU 4AYVB 2HPQH 1TA2A 3O8DA 1OYQA 4AN7A 4DURA 2W3IA 1UK2A 2Z3EA 5BRRE 1C5VA 4MNXA 5LPEA 3AVZA 1B0FA 1QBNA 1P2KA 1K1MA 2XC0A 4BXSA 3O8CA 2G52A 1MZAA 4OS2A 2PFEA 5DO4H 2VGCB 1QRWA 2BHGA 3SJ9A 2QY0B 2FODA 1P3EA 2NWNA 1NS3A 3PLKA 3RXRA 1UK3A 4WY3A 1W0YH 4WMFA 4B75A 2QXJA 4FUJA 3LGWA 1GGDB 3DHKH 2ZTZA 2SNWA 1GI6A 5GCHG 2XTTB 4CR5A 2ZEBA 1CBWB 2O9QA 1AVXA 2HPPH 3K65B 1F5RA 1YPGH 9ESTA 1C1UH 3M3SA 2GZ8A 4NA9H 2AMPA 2TIOA 3GCNA 1Z8RA 2B9LA 3BEUA 1AVWA 5H4IB 1TQ0B 1C2EA 1BBRK 1LHCH 3B9FH 1EOJA 2R2WU 1W8BH 2JH6D 5DP4A 3KL6A 5AVDA 1XUFA 1J8AA 3BTGE 3LGYA 4I8GA 1N6YA 3S7KB 4AFQA 2ODQA 4MPUA 5T6FA 3VPKA 1BA8B 5JBCS 4TPIZ 1O5EH 1AGJA 1QIXB 2VVCA 4Y10E 4CREA 1GJ9B 1XMNB 4FUFA 4ABHA 2AIPA 1CHOG 4XFQA 1GI7B 3L33A 2GTBA 2NU2E 1E37B 1MTUA 1FONA 1F0SA 3PWBA 3UNSA 8GCHG 3FP6E 3GCTG 1GI4A 3E0NB 1SGEE 1AN1E 5EXNA 3FANA 1OX1A 8ESTE 3UPEA 1C5QA 5TJXA 2V3OH 5L30H 3M61U 1FIWA 2G5NA 1FXYA 2XBXA 1ZPBA 4X1NU 1HAIH 2QF3A 2ZHEH 3SN8A 2ZPQA 1ESBA 2P8OB 1SOTA 1MAXA 4X0WU 4CH8B 3RXEA 1GHBG 1D3TB 1HAVA 1QR3E 2ZPSA 3D49H 3RXJA 5F03A 2FI4E 4OS6A 4ZXYH 4AFSA 3OSYA 3LGUA 3RXGA 5DK1A 4FU8A 1CT4E 1Z8IB 5GXPA 5GWZA 4QT8C 1P2IA 4XE4A 4JZFH 1H4WA 1ZPCA 2XCFA 1XKAC 1PYTD 1HRTH 1O38A 1THPB 2ANKH 4IN1A 3BTKE 3MOCA 3DA9B 1BTHH 2J4IA 1E35B 3OX7U 2Z3CA 4LZ4B 1W2KH 4ISLA 4THNH 5A2MH 3S0NA 4KTCA 3ZVGA 1E0FD 7LPRA 1T31A 2ALVA 4Y8XA 3ZZ3A 2HVXA 1TALA 1YKTA 1Z6EA 1QB1A 4TY7A 1OP8A 3ZZ8A 1XX9A 1O3DA 1ID5H 3SNDA 4WWYA 2ZQ2A 4ZKOU 3ATKA 3GICB 1DWDH 1YPMH 2GCTC 3A7YA 5EQSA 1ZTLA 4X8UH 3DUXH 1Y3VA 4GSOA 4NIVA 4WMEA 1C1PA 1Z6JH 3SW2B 5B6OA 3OU0A 2YNBA 2BD2A 2WYGA 2CHAC 2BD5A 1YBWA 3Q76A 2C4FH 2Y6TA 1W0ZU 4YOGA 3VB7A 2D2DA 2ZQ1A 1LPZB 4NZQA 2SNVA 1OXGA 4LZ1H 1Z71A 3S9CA 4Y0ZE 1WOFA 3QWCH 2VNTA 1ELCA 1ARBA 1Y5UT 1GG6B 4JYTA 1FY4A 2R0KA 1YLDA 1HAZB 3QK1A 1ZSKA 4ABEA 2PR3A 1FMGA 1Z8GA 3F1SB 3MU1A 3U1IB 4BTUB 1ESAA 4YOJA 1AZ8A 3TU7H 3P8NA 2IOTA 4FXGH 3K9XB 4TWYA 3MH6A 4Y71A 4DW2U 3SV6A 2TRMA 1GBEA 1C5UA 3MNSA 1K1IA 1KXCA 1XM1A 1SBWA 5A8ZA 1UTNA 2WYJA 1LVYA 1QNJA 5CHAB 1KY9A 4IS5A 1NFWA 3UOUA 1YLCA 3RXSA 4ZKNU 4Y7BA 1NRRH 2GV6A 1GVZA 1TBZH 3LT3A 1C5LH 1GDQA 3MFJA 1YF4A 2ZHQH 3W94A 1H9HE 1HAHH 2HRVA 2VIOA 2R3YA 1V3XA 3LC3A 4K1TA 4SGAE 1ETRH 3OY5U 4J2YB 2PKSB 1SFQB 2ZTYA 1O39A 3E6PH 1O3FA 1TONA 2VIPA 4X8TH 1QHRB 3O8BA 2QCYA 2Y80A 1CE5A 1P10A 2XC4A 1E36B 1O2UA 3MMGA 1A0JA 2V35A 1PPZA 1W11U 2F9NA 2P3FH 2RG3A 3M36A 5EGMA 4MNYA 3PTBA 1YC0A 1DWBH 1FNIA 2A5AA 2V0BA 1UTLM 5HGGA 1P04A 2G4TA 3AAUA 1TAWA 2F91A 1ZHRA 2BDHA 3SU5A 3ZVCA 3S7HB 1D6RA 2DE8A 2BVXH 1YM0A 2ZG0H 1TNLA 1HV7A 1YCPK 1HLTH 1DWEH 3CS7A 1O32A 1L4ZA 2LPRA 5EODA 1MCVA 4O9VA 5DP5A 3MNBA 2BXUH 1DOJA 4B2BA 1C1VH 2GP9B 4OS5A 3RMMH 3HK3B 1A5GH 1AKSA 1GMHG 1OPHB 4LOYH 5JDUB 2BDBA 5A8YA 5C20A 3E91A 3CENA 2VIWA 4E06H 1UVOA 1GMCF 3PMJA 2TGTA 3GY4A 2RA0A 2WV4A 3HKJB 2Z94A 5EW1H 4E7NA 5FXLA 2Y5HA 1LDTT 2QXIA 2WV5A 3BTQE 5I25A 3RXPA 2NU1E 1SGYE 4FVBA 2FLBH 1F2SE 1GJAB 1OP0A 1LHEH 1RIWB 2JH5D 2STAE 3GISB 4WMDA 4A6LA 1MU8B 2GD4B 3GY2A 1A4WH 2BD9A 3RXLA 3SU3A 2BOKA 4BOHA 1EZQA 1O2TA 3NZIA 3NWUA 4Q80A 1VGCC 1SGQE 3SU6A 2AYWA 2ODPA 3UR9A 1EB1H 2AGGX 1H1BA 1BB0B 4WXVA 3SO3A 1W13U 1XUHA 4DGJA 3ZV9A 2W5EA 1KLIH 4DG4A 1IQJA 3TH2H 4UE7H 1A46H 1D3QB 1EJMA 3R3GB 4X2WA 4AFUA 1FIZA 1S5SA 1V6DA 1WQVH 3ZZ6A 1BTUA 3ZYEA 4ZHMU 1O3IA 1FV9A 2FDAA 5E2OA 2QYIA 1AMHA 1W14U 3TNSA 5E0JA 7GCHG 2ULLA 3T28A 1BOQA 1KDQA 4B1TA 4AYYB 3TJVA 2EC9H 2F9PA 1NFXA 1HDTH 1GI2A 1KXEA 4KP0A 2IN2A 2R3UA 2OC1A 1P57B 2J34A 3K6YA 1CA8B 4I8JA 4ASHA 1NU7B 2BZAA 2HALA 1AQ7A 1H8DH 3H5CB 2A7HA 3QDZB 3BG8A 5DP9A 4KGAA 4ZMAH 4X8SH 5JYIA 3GOVB 3TGKE 1N6XA 1P9SA 2QAAA 2ZU4A 1VCWA 3PB1E 3B23B 4MVNA 3SNBA 3BEFB 3SORA 1BRAA 2BY8X 3VFEA 4E7RG 2G5VA 2HOBA 1DVAH 3SU2A 4FUCA 1BHXF 2AGIX 5HMAA 1EKBB 1XKBC 5HM9A 1S82A 1AFQB 1BRBE 1O2IA 4TY6A 2H1UA 1SMFE 3SGQE 4ABGA 1L2EA 3PLBA 1C1RA 2A5IA 1V2ST 3HGNA 1HAOH 1DUEA 1UCYE 2BM2A 3SJKA 1BJUA 3LJJA 4Y8YA 1HUTH 4DOQA 1PFXC 1OSSA 1QTFA 4X1QU 1O0DH 1BQYA 1L1JA 2NU4E 2ZDAH 3UWJH 3KEEA 1UTOA 2CN0H 3ZZ4A 1QL9A 3EGKH 3L6PA 1T8OA 2F9UA 4MPVA 1O2QA 4UD9H 3PO1C 4Y76A 1TNKA 1KXDA 3G01A 4OGYA 3BF6H 3E90B 4IW4E 1XUIA 5JBTA 1LKBA 1VITH 4AOQA 4AX9H 1HIAA 1G36A 1O2OA 1ELBA 1TX6A 3LH1A 1Z1IA 1CA0B 1WYKA 3QLPH 2BDAA 1ESTA 5EXLA 1C2IA 1SL3A 2VIQA 2JETC 3RLYH 2VWOA 4YZUA 1IQKA 2H5CA 5F8TA 1GJ6A 1GCDA 3I29A 3A7TA 1DITH 4INLA 3UNQA 2FO9A 4ZKRU 1TNIA 4ISHH 1G3EA 3RXAA 2Z9IA 1O35A 1H8IH 1XVOA 3Q00A 1TGTA 2VU8E 2Y7ZA 1CVWH 4MDSA 4Y6DA 2ZGHA 1EPTC 1O2RA 1F0RA 4FU7A 4ABDA 1SHHB 1GI5A 1ZLRA 1BT7A 1ZOMA 4OS4A 5FCKA 1NN6A 2R2MB 4PROA 2LNCA 3BTME 3BTFE 2GCHF 3STIA 4YOIA 1GHAG 3KQBA 1YPJH 1QA7A 2AMDA 1M9UA 1AWHB 4AZ2B 4Y7AA 1GBMA 1A5IA 1KDQB 2VWNA 2Z3DA 2GX4A 1D3PB 2PV9B 1EAIA 1DICA 1JRSA 1QA0A 5DJ7A 3T27A 4H4FA 1K9OE 1MD7A 1B5GH 3A7XA 1W3CA 1QB9A 2PSXA 1SQTA 2ZHFH 5FX5A 3LKWA 2HNTE 3Q77A 1TIOA 1PJPA 1BIOA 2BQ7B 3A89A 2VWMA 3H7TA 2R0LA 1WSSH 2F83A 2J9NA 1O2JA 2OC0A 1EJAA 5CE1A 3A83A 5K0HA 3MNXA 1INCA 3LU9B 3A87A 1JRTA 4NWLA 1O30A 4WH6A 1JXPA 6ESTA 5E2PA 1DWCH 2VH0A 1GJDB 3BV9B 4IMQA 1JIMA 3EQ0H 1PPHE 2STBE 4K8BA 4BAHB 1N1LA 5GCHF 2Q1JA 4GCHG 4D7GA 1VITF 3N7OA 4K5ZA 4BAMB 3JZ2B 1C1NA 4Q2KA 1G2LA 1SVPA 3QZQA 2Y5FA 3PYHA 3SUDA 2DE9A 2BXTH 2J2UA 1IQNA 1JBUH 3VGCC 1ANDA 4TYDA 3QTOH 6LPRA 2FMJA 1CHGA 3VXFH 5AFYH 1LPGB 1C2GA 2SGDE 4CR9A 6GCHF 2ANWA 2BDYA 3SQHE 3S69A 1UVSH 5TCAA 1G32B 3A7ZA 5C67A 1GHXH 2XWAA 5C2ZA 1O3LA 3AAVA 3SZNA 4ZH8A 1C5MD 4K2YA 3EA9A 1KXFA 2CGAA 4AB8A 1KTSB 2EA3A 3KF2A 3HATH 1V2PT 2A32A 3PLPA 3GCOA 3QX5H 1XVMA 1RTFB 1HJAC 1V2UT 4I32A 2ODYB 3TH3H 1GL0E 4GHTA 2ZP0H 1BRCE 1T7CA 4UFFH 5F8XA 3P95A 3GCTF 3ATWA 4A92A 1ETSH 5HYOA 1GPZA 1V2VT 3KGPA 8KME2 4LK4A 1E38B 3QZRA 3GYMA 2A4QA 2ZKSA 2A1DB 4TPYA 3A85A 1N8OC 1QL7A 4NSVA 1UJ1A 1O3HA 1UHBB 2ALPA 4YT6H 4F4OC 3GCHC 1GCTB 2O8LA 2BD8A 2WPLS 2FZZA 4JZ1A 2PKAB 2A2QH 3SUFA 5ESTE 2ZI2H 5C1UA 5FCRA 4ESTE 4A1VA 2GMTC 3TJUA 3K2UA 1GVKB 3MH5A 4A5TS 2IJOB 3C27B 3ZZDA 1UCYK 1DY8A 1A1RA 3MTYA 3E8LA 3LC5A 3M7TA 1O5AB 2A31A 4YO9A 1ZTKA 1AB9C 1NPMA 1K1LA 3QUMP 1QY6A 1VCPA 1LVMA 1BMNH 1AUJA 2THFB 1RD3B 3ATLA 2A7CA 1PYTC 1SGTA 2A4OA 1C9PA 1RXPA 1ZPZA 1GBCA 1GBHA 3Q3KA 3RXIA 3D62A 1UMAH 2KAIB 1O3EA 1UVPA 2GKVE 2VGCC 3MO3A 4NGAH 1ZR0A 3TK9A 3GYLB 5A0BA 1EOLA 2H9EH 3MO9A 2EEKA 5IDKA 2C8ZB 1GJ8B 2ANYA 2BY5X 2CJIA 1EP5A 2QA9E 1O5CB 4H42U 3KNXA 3T5FH 1C4V2 1TGNA 1K22H 1GGDC 4NA8A 4BAOB 3ENSB 4MLFB 2ZHDA 2Z6BD 1BTPA 5GDSH 1NT1A 3ZVAA 1QCPA 5JPMH 1GBJA 2Y7XA 1NFYA 5G4BA 1KYNA 1G3DA 4YESB 5JBAS 2OUAA 1HNEE 1Y5AT 1KTTB 1QFKH 5DPAA 3SBKA 1K1OA 5A0AE 1BBRH 5IYTA 1S83A 1PQ5A 4FUEA 1P03A 1MQ5A 1W10U 1SGFA 2Z7FE 1B7XB 4BXWA 4UONA 3RXFA 1FI8A 2B8OH 1QQ4A 2BB4A 2PUQH 5T6GA 1BUIA 2ZA5A 1O2SA 4XOJA 2O8WA 1TPPA 1KIGH 4A7IB 2PGBB 1O34A 1S6FA 1TBQH 1SLXB 1S81A 3STJA 1HPGA 3TLOA 2BD7A 3NPSA 3RC5A 2ANMH 5JB8S 3PROA 3QGJA 3SNEA 2YOLA 2QXGA 4B76A 1FDPA 2GDDA 1Z7KA 3R0FA 2XWBI 1CGHA 4X1SU 3RXVA 1NU9A 2WUCA 2UUYA 4K1EA 4AORA 4D76A 3F9FA 2C8XB 1LPKB 1SFIA 2XBWA 3A7VA 3MI4A 3TJOA 4B74A 2Q6DA 4Y79A 1EXFA 1UVTH 2W26A 1FN6A 3RLWH 1BMAA 1XUKA 2EI7A 1DM4B 3SGBE 2P8OC 4X6MA 1SSXA 1JWTA 1AE5A 3UQVA 2Z9LA 3F6UH 3NK8A 4VGCC 1TMTH 1E34B 3M5NA 2BVRH 3ODFA 1GBDA 1T8MA 1ANBA 3EA8A 1GWAA 1NRQH 2XXLA 2AH4X 1YPLH 1O3OA 4UFEH 3MNCA 1V2JT 1C5ZB 1FN8A 3LH3A 4FUDA 3ZVFA 4YLUA 4B2CA 5EG4A 3GY7A 2HGTH 2UUJB 3BTDE 1DXPA 3A8DA 3VB5A 1GI9B 1V2WT 1B0EA 1AD8H 1QRZA 4X8VH 1XXFA 1BDAA 3TIUA 4JYVH 2W7SA 2BD4A 5F8ZA 5FX6A 1GMHF 1G3CA 1QRXA 1VCQA 2O8TA 3P8GA 3RXBA 4A1XA 2VB0A 1O2VA 1G9IE 1TNJA 1OWEA 3NCLA 3LOXA 1P0SH 1HAVB 2NU3E 1VGCB 3P70B 1AU8A 3SUEA 3WY8A 1NRNH 3D65E 4ZHAA 3QTVH 1EPTA 3Q3XA 4ZHLU 2AS9A 1DT2A 2BY6X 1IQMA 1O36A 2ZO3H 1OP2A 4K3JA 3UOPA 2A4RA 4CHAB 1T32A 3M5LA 1Y3UA 1KXAA 4AB9A 1F5LA 5I46H 4JZDH 4ABFA 2AERH 2ZF0H 1A0LA 1TRNA 1V2OT 3OTJE 1MTNB 1W7GH 1TA6A 4INHA 3TK5A 3KIDU 3U8OH 4Q7YA 1NROH 1ELAA 3RM2H 1WQSA 1LMWB 2ZZUH 1GG6C 2P93A 5EW2H 5CMXH 1MKXK 2ZDMA 5L6NH 4BAKB 1BHXB 3ZVEA 3RXOA 4HFPB 1ELVA 2VWLA 1AUTC 4GAWA 1J17T 2CF8H 1O2WA 1OWJA 1TGBA 2PTNA 4Y8ZA 3A8AA 2PSYA 2QC2A 2BLQA 1P2MA 3RXKA 1C5SA 5LGOA 1Q2WA 3ZZ9A 5CHAC 2CMYA 2V6NA 4FUBA 2G4UA 1A3EH 3DT0H 4BNRA 4HI3A 1MZDA 4NIXA 6CHAB 3P17H 7ESTE 1O3AA 3ZZ7A 1GMDF 3E16B 4U2WA 1GDUA 1OWDA 2AFQB 2FYQA 2ZDLA 4ABBA 4BAQB 1VR1H 1EP6A 2BDIA 2NU0E 1EB2A 4IC5A 4R0IA 4U01A 1MKWK 1NO9H 2G51A 1O3CA 4JK5A 2Q6FA 2G8TA 3FAOA 1O5DH 4CRGA 1EX3A 4BTIB 1Y3XA 5DP8A 5GPIB 1G3BA 3LDXH 2J94A 1Z1JA 1SOZA 3ZZ5A 1ACBE 2HNTC 4AGKA 1O31A 3BG4B 4GPGA 3M35A 2OXSA 4B2AA 1GDNA 3U1JB 2W7UA 4Y0YE 2SGQE 5JB9S 1YCPH 2BLWA 1SQOA 1O3JA 1IQFA 5E0GA 3ODDA 1V2KT 1GMCG 1XUGA 1EJNA 4A1TA 1OYTH 3SU1A 5F6MA 2HNTF 2Q6GA 2A4GA 3AASA 1SGDE 1NRSH 4NCYA 1IHSH 3RU4T 1SGRE 1FPCH 2FI5E 2ZGXH 1TPOA 1O33A 2F3CE 2P95A 1A7SA 3FP7E 3PV4A 1L1GA 2BDCA 1MAYA 3EE0B 1PQ8A 1YPEH 1K21H 4FUIA 1TE0A 1EPTB 3ZZCA 1BJVA 3UY9A 1T8LA 2R9PA 4Z6AH 3SV9A 4CRCA 1EUFA 4DIHH 1EZXC 1O5GH 1PPEE 1TMBH 1AFEH 1PPCE 2G55A 3F9GA 1GJ4H 3UFAA 5J4QA 3M3VA 2J95A 1A0HB 3T62A 4X6NA 2K1QA 1O37A 4ABAA 2OINA 5C1YA 1FAKH 5GIBA 1AKSB 1ZMNA 3NXPA 3VXEH 4ISOA 1MCTA 2UUFB 2D1JA 1GHAF 1CSOE 2BOHB 1GJ5H 5J4SA 1NM6A 3MHWU 4JYUH 5HM2A 2BX3A 1MMJN 2OP9A 5AHGH 5DKMA 2FOFA 2J92A 1ANCA 3SHAH 3SOSA 2ZCKP 3M37A 4X1PU 3U69H 1TABE 2Y81A 3MO6A 2D26C 1O2XA 1SR5C 3BIUH 4ZROA 4NZLA 1C2MA 4YM9A 4HZHA 2A2XH 4XBCA 1GI0A 1S84A 3H7OA 2EI6A 4ZAEA 4MQAA 5DG6A 2IPHA 2SGFE 2XNIA 2FOMB 2FX6A 2Y5GA 4CRBA 1O3PB 3ZZBA 4KTSA 2ZGBH 8LPRA 1C5PA 1V2MT 1C1WH 1THSH 2UWLA 1AI8H 2XBVA 5FPTA 1AFQC 3CP7A 3SGAE 2WPKS 1K1PA 2BQWB 2BQ6B 2ZECA 1A3BH 3GDSA 3A80A 3URCA 2OC7A 1P8VC 2ZPRA 2QGRA 3SUGA 5FBEA 1TGCA 3S9AA 3RMLH 1MBQA 1NTPA 3SQEE 2FP7B 1V2LT 2AGEX 3A84A 1TQ7B 3BEIB 2P3UB 2VIDA 1MTSA 1SQAA 4ISIH 1P12E 1FJSA 2ZIQH 2ZFQH 3LONA 1D9IA 4HTCH 2TGPZ 1UTKA 5C5NA 3V0XA 1HJAB 1LO6A 4Y11E 2A5KA 3SNCA 1GJBB 1QBVH 2PUXB 2GT8A 3SV7A 1O2NA 3M5OA 3HK6B 5E8EH 3VB3A 1OWHA 1ZJKA 2QIQA 1C5WB 4CH2B 1ZHPA 1ELDE 4KTUA 4D9RA 3SV2H 1ZSLA 3GDVA 4CRAA 1TWXB 2GV7A 4JMYA 4E05H 1BTZA 1P09A 4WF8A 2A45B 3V7TA 1GVLA 1BCUH 1CA0C 1GBTA 1ANEA 4RKJB 1FY1A 3RC6A 1WBGB 5ABWA 1O2GH 3FFGA 1DDJA 1IQLA 1MTWA 2GVFA 5LH8A 3RM0H 1ELTA 1O2ZA 2WPJS 5DP3A 2ZU1A 2QV1A 3TJNA 1DSTA 3TPIZ 3MYWA 1C2JA 1FY3A 2G81E 2P16A 1BMLA 1C2DA 2RDLA 1VZQH 2QXHA 1QL8A 3ATIA 1UTMA 5C5OA 3SI4H 2FTLE 2J38A 1RS0A 1D4PB 4NG9H 1GBAA 1H9IE 4TWWA 1MU6B 1CQQA 1HAYB 3T26A 3TNTA 4KELA 2C3SA 1HIAB 1LQDB 2D8WA 1DPOA 1CHOF 1MQ6A 1C5TA 2VVVA 3HKIB 3TGIE 2GGVB 3EAJA 3HPTB 1ZZZA 1NESE 3FZDA 1ETTH 1MBMA 4B73A 4IC6A 1CGJE 1QJ6B 3FP8E 4O3TA 1C4U2 5EU8A 1AZZA 8GCHF 4WJG2 2WUBA 1FAXA 3IITA 5LPFA 4O3UA 1LVOA 1GBIA 2ASUB 1EAXA 4MG3A 3PM3A 1KXBA 4K60A 4UDWH 4ABIA 1F92A 2ZGCA 1PQ7A 4D8NA 1KLJH 1PPGE 1JOUB 4JZEH 3ZVDA 3A8CA 1OOKB 3ESTA 3U8TH 1K1JA 2FI3E 3MH7A 1VITG 1NRPH 3L3TA 1GHVH 1C2FA 1MH0A 1S6HA 2ZFSA 2OCVB 2SGAA 1GHBF 2FOBA 3DFJA 2WINI 2A7JA 1YPKH 2ZCHP 4I31A 4ZXXH 3MWIU 2ZDNA 4IBLH 2BLOA 3S9BA 1NZQH 5T3HA 4I8KA 3DFLA 1P06A 1TOMH 3M5MA 4U30A 1P2QA 1QGFA 1HAGE 1SG8B 1DUAA 1MD8A 1T8NA 1QQUA 1TGSZ 2VH6A 1U6QA 1BTWA 1C9TA 3LPRA 6GCHG 1SGCA 1WTHD 2ZNKH 5K7RA 2HWLB 2BDGA 4ABJA 2PTCE 2TPIZ 2XW9A 2UWPA 1O2LA 3EDXB 1SLVB 1ZHMA 4ZUHA 2FXRA 3P6ZB 1P3CA 2GCTB 1GHYH 2XC5A 4X2XA 4I7YH 4XBDA 1QB6A 1OWKA 3SV8A 1IQIA 2CHAB 2BLVA 1CT2E 5FPSA 2WPMS 1S0QA 2XBYA 3BTWE 2OBQA 1G2MA 1OKXA 1TNHA 1TB6H 1BITA 4MPWA 3PMBB 1AY6H 1T4UH 1DLKB 1TBRH 3B8JA 2TGDA 1EZSC 4IGDA 1GBLA 1SLUB 2JH0D 3UTUH 3OYPA 3D23A 4J1YA 2FOHA 3PMHB 4RSPA 2FWWA 1K2I1 3UNRA 1CBWC 4DIIH 3MU5A 3EYDA 4KKDA 4GHQA 4VGCB 1WU1A 3V13A 3RXQA 4MNVA 1Y59T 2F9OA 1AVGH 1O2KA 3W95A 2BYAX 5EPYA 1JMOH 2ZC9H 4XBBA 1F7ZA 3U98H 1ZMJA 2B5TB 2CV3A 1GI3A 1GCTC 3E3TA 2PW8H 3A88A 4UFGH 1XUJA 4AG1A 2HLCA 3URDA 1ABJH 1SGNE 1GI1A 1J14A 2FIRH 1DXWA 1WUNH
chains in the Genus database with same CATH superfamily
1AIXH 1UCYH 4D9QA 3EA7A 3SNAA 5HXFA 1GHZA 2CF9H 4XSKU 2KX4A 2B0FA 3ZZAA 2W6JD 3SU4A 2VVUA 1Q31A 1UTPA 4K8YA 3I78A 1C1SA 1ORFA 1D6WA 1TPAE 2BZ6H 2J5UA 1WTGH 3U28C 4WH8A 4Q63A 3UR6A 4X6PA 2FYRA 2AEIH 4NA7A 3SJ8A 2ZWLH 4CRFA 1C2KA 2UWOA 1IQGA 2FESH 3RXMA 2ZFRH 3P8OA 4JK6A 3F9EA 3KQDA 4BANB 2P59A 2BY7X 3M7UA 1J16A 4F49A 1O2MA 4FUHA 9LPRA 2VJ1A 1BZXE 1SHYA 1TMUH 1NFUA 1CGIE 2ZFTA 1LKAA 2ZTXA 3V12A 4IMZA 1C1QA 1ZRBA 1F0TA 2FPZA 3LGTA 2GDEH 1ZGVA 2J97A 3AW1A 1L4DA 4WXIA 1O3MA 3QN7A 2V7QD 2PLXA 2AMQA 3RXTA 1QJ1B 4Z0KA 4RI0A 1O2PA 4Q7XA 1AE8H 1K28D 1K1NA 4IN2A 4FU9A 2QF4A 1SLWB 2UUKB 1O2HA 1PQAA 2SGPE 3SI3H 1Y5BT 4MPXA 1JIRA 2Z9GA 1LHGH 2ZHWH 4MNWA 4GLYA 1HYLA 3KN2A 2JJ2D 1BTXA 1VJAU 3NKKA 1SGPE 1FUJA 2BD3A 1ABIH 1LHFH 3MH4A 3RUOA 1EAUA 1HXFH 3PWCA 4D7FA 1G37A 1S0RA 4ZKSU 3BIVH 1P9UA 3RDZA 1C2LA 4X1RU 5E0HA 1RGQA 1HJ9A 4AGJA 2AIQA 2FS8A 4I8LA 1EZUC 4YLQH 1C5RA 5PTPA 1GBFA 1P01A 2H6MA 1FPHH 1UO6A 5SGAE 5AF9H 1DE7H 3SU0A 1P2NA 1F5KU 1A61H 1P11E 1ELFA 3A82A 1D3DB 1O2YA 4FVDA 2TGAA 1IQEA 1A2CH 3V3MA 1P02A 1A5HA 2SFAA 1H8ED 1C5OH 3F0PA 3QO6A 1YY3A 1WV7H 1C5YB 4LXBH 1HAXB 2JKHA 4X6OA 2FX4A 1ZGIA 2WZQA 5C1XA 2A0QB 1HFDA 3RU4D 3P8FA 2XCNA 1DSUA 3F2HA 7GCHF 4R8TB 1AWFH 3GY3A 5LPRA 1O3NA 1W12U 1FLEE 3IWMA 2FOAA 3A81A 4FUGA 4RN6A 1DX5M 1S6LA 5L2ZH 2FLRH 1MTVA 4AG2A 1QBOA 4NIYA 1IOEA 1BTYA 1C1TA 2PGQB 2OC8A 3M3TA 4OS1A 2XRCA 4CBNA 4INKA 4B71A 4X2YA 4CRDA 1TPSA 1DFPA 1YYY1 2BTCE 1YP9A 1L0ZA 1Y3WA 3F9HA 1J15A 1CO7E 1PPFE 1F0UA 1YGCH 2PKSC 3E0PB 1TX8A 5EXMA 1MUEB 1C5XB 3FVFB 1TOCB 3F68H 2YNAA 2KCYA 1CU1A 3P92A 3UQOA 3BTHE 2YMSC 1TYNA 1P2JA 1GI8B 1HCGA 1J9CH 1TLDA 5C3NA 2H9TH 5BPEA 2ZFFH 4O03A 1QJ7B 2G00A 4DT7B 3ZV8A 5DP6A 3PO1B 1LQEA 5L2YH 1ZTJA 1O5FH 1ZSJA 4X2VA 1SPJA 4CHAC 1UTQA 2OQUA 3RXUA 5AFZH 3FZZA 2O8MA 2FTMA 1ZMLA 3ITIA 1P2OA 3IG6B 1YCPM 1IHTH 3AW0A 3TVJB 1YPHC 3I77A 4Q4LA 2H2ZA 5CDFE 1MTNC 4U32A 1ARCA 1RJXB 4XRNA 2QF0A 5EOKA 5ESBA 3SJOA 4H6TA 1MKXH 1IAUA 4WVPE 5JBBS 3K6ZA 2GZ7A 3DSPA 1UVUH 1LHDH 3MU4A 1ZRKA 2H9HA 2YMSD 3C1KA 1DY9A 1X7AC 2JETB 3TH4H 1RRKA 3O8RA 1GJCB 4UFDH 2BY9X 4BTTB 3SHCH 4NFFA 3N7EA 2WPIS 1C2HA 1FY5A 5A09A 1V2NT 3ATMA 2ZU5A 1ZYOA 5IK2D 2WSSD 4RKOB 2F9VA 3VEQB 5EQQA 1GMDG 1ZJDA 3RXCA 1LTOA 2QN5T 3UWIA 1LCYA 1LVBA 2F9BH 1BBRE 3KHVA 1TX7A 2OBOA 3RXDA 1QURH 2C8WB 3TK6A 2B7DH 4I33A 1TRMA 2H5DA 3OFND 3BSQA 1RIWC 1FQ3A 3KQCA 1C5NH 3GY5A 1RTKA 1Z8JB 5A8XA 3EE7A 3BN9A 5ETXA 4DJZB 6CHAC 3NUMA 1MKWH 1HGTH 2ZCLP 3U9AH 1G30B 1V2TT 2FOEA 4CBOA 4K69A 3RMOH 3BTTE 3VB4A 3RU4E 3E1XB 3GY8A 2J98A 3UIRA 1Q3XA 5FAHA 1GHWH 2OQ5A 5DP7A 2ILNA 2I6QA 4HGCA 3A8BA 2WPDD 3ZVBA 1ELGA 2XYAA 2FS9A 1H9LB 2M5TA 2ZFPH 1AO5A 2PWXA 4YT7H 1EAWA 1GBBA 5F53A 1HXEH 2O8UA 3BG4C 4JCNA 4M7GA 2ESTE 4NFEA 5C17A 3DD2H 2VIVA 1KLTA 1VJ9U 4AFZA 2LELA 3GY6A 1SGFG 3MU8A 5C0UA 1O3GA 1L1NA 2W3KA 1OWIA 2FOGA 1OS8A 1KSNA 3Q3YA 2DUCA 2SGEE 1T4VH 4O97A 1BRUP 1C4Y2 3PRDA 3A7WA 5FPYA 3SJIA 1TRYA 4H6SB 2TBSA 2OLGA 1SGIB 1RFNA 1V2RT 1TFXA 1SKYE 1VKYA 3KCGH 3FOAA 1DANH 2GZ9A 1C1OA 3CS0A 3RMNH 3T25A 3VGCB 1Y3YA 5TCCA 4NSYA 4OGXA 3LIWA 4GCHF 4SGBE 1GJ7B 1SC8U 7KMEH 1UHBA 3LGVA 5FHTA 1CT0E 2Y82A 1NC6A 3A86A 2VINA 2P3TB 1TNGA 4OS7A 3HGPA 4NWKA 3T29A 1E1RD 3OY6U 1SB1H 2ZU2A 2BMGB 5GJ4B 3RP2A 1HBTH 3U8RH 3VB6A 3M7QA 2PKAA 5EPNA 5FBIA 2PHBA 1ELEE 4I8HA 4MTBA 3MU0A 2BX4A 1O5BB 1DS2E 2V3HH 1EASA 3T2NA 3TITA 2EI8A 3BTEE 2ZGJA 1EATA 4YTAA 3UUZA 3PTNA 2RCEA 2PP6A 2FEQH 1NY22 2EY4C 2ZU3A 2RFKC 5EQRA 3JZ1B 1WAYB 1SI5H 2BVSH 1IQHA 1W7XH 3LJOA 1UTJA 1WCZA 1N8OB 1YPHE 1DLEA 3SZEA 3UREA 5A0CA 1S85A 1RTLA 2OD3B 2CXVA 2OTVA 3ELAH 3GCHB 2WPHS 1GBKA 1HAPH 1O3KA 2KCPA 4UEHH 4Q7ZA 3KQEA 1HJ8A 2RA3A 2Z9JA 1FZZA 2EQNA 4GUXA 5DGJA 2KAIA 3GDUA 1XXDA 5KGOA 1EQ9A 5T6DA 2C8YB 3RC4A 2C93B 2GMTB 3RXHA 2GCHG 1Y8TA 2ZDVH 4K1SA 4DY7B 3LGIA 2C90B 4DCDA 1P05A 4GVUA 1UK4A 4JZIA 3ZYDA 1BMMH 2FM2A 4TT3D 1FY8E 2KM0A 3PMAB 3QGNB 1O3BA 5DN6D 1V2QT 2Z9KA 2P94A 1THRH 3TGJE 4NIWA 1C1MA 1AB9B 2I6SA 1GL1A 1HB0B 2GT7A 2ZDKA 4XDEA 1AHTH 1PPBH 4ISNA 2FOCA 4DVAU 4AYVB 2HPQH 1TA2A 3O8DA 1OYQA 4AN7A 4DURA 2W3IA 1UK2A 2Z3EA 5BRRE 1C5VA 4MNXA 5LPEA 3AVZA 1B0FA 1QBNA 1P2KA 1K1MA 2XC0A 4BXSA 3O8CA 2G52A 1MZAA 4OS2A 2OK5A 2PFEA 5DO4H 2VGCB 1QRWA 2BHGA 3SJ9A 2QY0B 2FODA 1P3EA 2NWNA 1NS3A 3PLKA 3RXRA 1UK3A 4WY3A 1W0YH 4WMFA 4B75A 2QXJA 3FN8A 4FUJA 3LGWA 1GGDB 3DHKH 2ZTZA 2SNWA 1GI6A 5GCHG 2XTTB 4CR5A 2ZEBA 1CBWB 2O9QA 1AVXA 2HPPH 3K65B 1F5RA 1YPGH 3OEED 4YXWD 9ESTA 1C1UH 3M3SA 2GZ8A 4NA9H 2AMPA 2TIOA 3GCNA 1Z8RA 2B9LA 3BEUA 1AVWA 3DSGA 5H4IB 1TQ0B 1C2EA 1BBRK 1LHCH 3B9FH 1EOJA 4ACAA 2R2WU 3N99A 1W8BH 2JH6D 5DP4A 3KL6A 5AVDA 1XUFA 1J8AA 3BTGE 3LGYA 4I8GA 1N6YA 3S7KB 4AFQA 2ODQA 4MPUA 5T6FA 3VPKA 1BA8B 5JBCS 4TPIZ 1O5EH 1AGJA 1QIXB 2VVCA 4Y10E 4CREA 1GJ9B 1XMNB 4FUFA 4ABHA 2AIPA 1CHOG 4XFQA 1GI7B 3L33A 2GTBA 3NRLA 2NU2E 1E37B 5HIZA 1MTUA 1FONA 1F0SA 3PWBA 3UNSA 8GCHG 3FP6E 3GCTG 1GI4A 3E0NB 1SGEE 1AN1E 5EXNA 3FANA 1OX1A 8ESTE 3UPEA 1C5QA 5TJXA 2V3OH 2JIZD 5L30H 3M61U 1FIWA 2G5NA 1WDIA 1FXYA 2XBXA 1ZPBA 4X1NU 1HAIH 2QF3A 5CHBA 2ZHEH 3SN8A 2ZPQA 1ESBA 2P8OB 1SOTA 1MAXA 4X0WU 4CH8B 3RXEA 1GHBG 1D3TB 1HAVA 1QR3E 2ZPSA 3D49H 3RXJA 5F03A 2FI4E 4OS6A 4ZXYH 4AFSA 3OSYA 3LGUA 3RXGA 5DK1A 4FU8A 1CT4E 1UW7A 1Z8IB 5GXPA 5GWZA 4QT8C 1P2IA 4XE4A 4JZFH 1H4WA 1ZPCA 2XCFA 1XKAC 1PYTD 1HRTH 1O38A 1THPB 2ANKH 4IN1A 3BTKE 3MOCA 1QZ8A 3DA9B 1BTHH 2J4IA 1E35B 3OX7U 2Z3CA 4B6EA 4LZ4B 1W2KH 4ISLA 4THNH 5A2MH 3S0NA 4KTCA 3ZVGA 1E0FD 7LPRA 1T31A 2ALVA 4Y8XA 3PV5A 3ZZ3A 2HVYB 2HVXA 1TALA 1YKTA 1Z6EA 1QB1A 4TY7A 2CK3D 1OP8A 4RT0A 3ZZ8A 1XX9A 1O3DA 1ID5H 3SNDA 4WWYA 2ZQ2A 4ZKOU 3ATKA 3GICB 1DWDH 1YPMH 2GCTC 3A7YA 5EQSA 1ZTLA 4X8UH 3DUXH 1Y3VA 4GSOA 4NIVA 4WMEA 1C1PA 1Z6JH 3SW2B 5B6OA 3OU0A 2YNBA 2BD2A 2WYGA 2CHAC 2BD5A 1YBWA 3Q76A 2C4FH 2Y6TA 1W0ZU 4YOGA 3VB7A 2D2DA 2ZQ1A 5B6LA 1LPZB 4NZQA 2SNVA 1OXGA 4LZ1H 1Z71A 3S9CA 4Y0ZE 1BMFD 1WOFA 3QWCH 2VNTA 1ELCA 1ARBA 1Y5UT 1GG6B 2HLDD 4JYTA 1FY4A 2R0KA 1YLDA 1HAZB 3QK1A 1ZSKA 3DCLA 4ABEA 2PR3A 1FMGA 1Z8GA 3F1SB 3MU1A 3U1IB 4BTUB 1ESAA 4YOJA 1AZ8A 3TU7H 3P8NA 2IOTA 4FXGH 3K9XB 4TWYA 3MH6A 4Y71A 4DW2U 2JDID 3SV6A 2TRMA 1GBEA 1C5UA 3MNSA 1K1IA 1KXCA 1XM1A 1SBWA 5A8ZA 1UTNA 2WYJA 1LVYA 1QNJA 5CHAB 1KY9A 4IS5A 1NFWA 3UOUA 1YLCA 3RXSA 4ZKNU 4Y7BA 1NRRH 2GV6A 1GVZA 1TBZH 3LT3A 1C5LH 1GDQA 3MFJA 1YF4A 2ZHQH 3W94A 1H9HE 1HAHH 2HRVA 2VIOA 2R3YA 1V3XA 3LC3A 4K1TA 4SGAE 1ETRH 3OY5U 4J2YB 2PKSB 1SFQB 2ZTYA 1O39A 2IJD1 1O3FA 1TONA 2VIPA 3E6PH 4X8TH 1YWUA 1QHRB 3O8BA 2QCYA 2Y80A 1CE5A 1P10A 2XC4A 1E36B 1O2UA 3MMGA 1A0JA 2V35A 1PPZA 1W11U 2F9NA 2P3FH 2RG3A 3M36A 5EGMA 4MNYA 3PTBA 1YC0A 2KFWA 1DWBH 1FNIA 2A5AA 2V0BA 1UTLM 5HGGA 1P04A 2G4TA 3AAUA 1TAWA 2F91A 3F2FA 1ZHRA 2BDHA 3SU5A 3ZVCA 3S7HB 1D6RA 2DE8A 2BVXH 1YM0A 2ZG0H 1TNLA 1HV7A 1YCPK 1HLTH 1DWEH 3CS7A 1O32A 1L4ZA 2LPRA 5EODA 1MCVA 4O9VA 5DP5A 3MNBA 2BXUH 1DOJA 4B2BA 1C1VH 2GP9B 4OS5A 3RMMH 3HK3B 1A5GH 1AKSA 1GMHG 3UAIC 1OPHB 4LOYH 5JDUB 2BDBA 5A8YA 5C20A 3E91A 4M9FA 2KZ4A 3CENA 2VIWA 5EIYA 4E06H 1UVOA 1GMCF 3PMJA 2TGTA 3GY4A 2RA0A 2WV4A 3HKJB 2Z94A 5EW1H 4E7NA 5FXLA 2Y5HA 1LDTT 2QXIA 2WV5A 3BTQE 5I25A 3RXPA 2NU1E 1SGYE 4FVBA 2FLBH 1F2SE 1GJAB 1OP0A 4ASUD 1LHEH 3KQ5A 1RIWB 2JH5D 2STAE 3GISB 4WMDA 4A6LA 1MU8B 2GD4B 3GY2A 1A4WH 2BD9A 3RXLA 3SU3A 2BOKA 4BOHA 1EZQA 1O2TA 3NZIA 3NWUA 4Q80A 1VGCC 1SGQE 3SU6A 2AYWA 2ODPA 3UR9A 1EB1H 2AGGX 1H1BA 1BB0B 4WXVA 3SO3A 1W13U 1XUHA 4DGJA 3ZV9A 4AC9A 2W5EA 1KLIH 4DG4A 1IQJA 3TH2H 4UE7H 1A46H 1D3QB 1EJMA 3R3GB 4X2WA 4AFUA 1FIZA 1S5SA 1V6DA 1WQVH 5T1VA 3ZZ6A 1BTUA 3ZYEA 2L74A 4ZHMU 1O3IA 1FV9A 2FDAA 5E2OA 2QYIA 1AMHA 1W14U 3TNSA 5E0JA 7GCHG 2ULLA 3MQKC 3T28A 1BOQA 1KDQA 4B1TA 4AYYB 3TJVA 2EC9H 2F9PA 1NFXA 1HDTH 1GI2A 1KXEA 4KP0A 3ZIAD 2IN2A 2R3UA 2OC1A 1P57B 2J34A 3K6YA 1CA8B 4I8JA 4ASHA 1NU7B 2BZAA 2HALA 1AQ7A 1H8DH 3H5CB 3OE7D 2A7HA 3QDZB 3BG8A 5DP9A 4KGAA 4ZMAH 4X8SH 5JYIA 3GOVB 3TGKE 1N6XA 1P9SA 2QAAA 2ZU4A 1VCWA 3PB1E 3B23B 4MVNA 3SNBA 3BEFB 3SORA 1BRAA 2BY8X 3VFEA 4E7RG 2G5VA 2HOBA 1DVAH 3SU2A 4FUCA 1BHXF 2AGIX 5HMAA 1EKBB 1XKBC 5HM9A 1S82A 1AFQB 1BRBE 1O2IA 4TY6A 2H1UA 1SMFE 3SGQE 4ABGA 1L2EA 3PLBA 1C1RA 1E1QD 2A5IA 2KR7A 1V2ST 3HGNA 1HAOH 1DUEA 1UCYE 2BM2A 3F3BA 3SJKA 1BJUA 3LJJA 4Y8YA 1HUTH 4DOQA 1EFRD 1PFXC 1OSSA 1QTFA 4X1QU 1O0DH 1BQYA 1L1JA 2NU4E 2ZDAH 3UWJH 3KEEA 1UTOA 2CN0H 3DSOA 3ZZ4A 1QL9A 3EGKH 3L6PA 1T8OA 2F9UA 4MPVA 1O2QA 4UD9H 3PO1C 4Y76A 1TNKA 1KXDA 3G01A 4OGYA 3BF6H 3E90B 4IW4E 1XUIA 5JBTA 1LKBA 1VITH 4AOQA 4AX9H 1HIAA 1G36A 1O2OA 1ELBA 1TX6A 3LH1A 1Z1IA 1CA0B 1WYKA 3QLPH 2BDAA 1ESTA 5EXLA 1C2IA 1SL3A 2VIQA 2JETC 3RLYH 2VWOA 3N7DA 1IQKA 4YZUA 2H5CA 5F8TA 1GJ6A 1GCDA 3I29A 3A7TA 1DITH 4INLA 3UNQA 2FO9A 4ZKRU 1TNIA 4ISHH 1G3EA 3RXAA 2Z9IA 1O35A 1H8IH 1XVOA 5KECA 3Q00A 1TGTA 2VU8E 2Y7ZA 1CVWH 4MDSA 1KMHB 4Y6DA 2ZGHA 1EPTC 1O2RA 1F0RA 3FKSD 4FU7A 4ABDA 1SHHB 1GI5A 1ZLRA 1BT7A 1ZOMA 4OS4A 5FCKA 1NN6A 2R2MB 4PROA 2LNCA 3BTME 3BTFE 2GCHF 3STIA 4YOIA 1GHAG 3KQBA 1YPJH 1QA7A 2AMDA 1M9UA 1AWHB 4AZ2B 4Y7AA 1GBMA 1A5IA 1KDQB 2VWNA 2Z3DA 2GX4A 1D3PB 2PV9B 1EAIA 1DICA 1JRSA 1QA0A 5DJ7A 5DSFA 3T27A 4H4FA 1K9OE 1MD7A 1B5GH 3A7XA 1W3CA 3WW7A 1QB9A 2PSXA 3WWFA 1SQTA 2ZHFH 5FX5A 3LKWA 2HNTE 3Q77A 1TIOA 1PJPA 1BIOA 2BQ7B 3A89A 2VWMA 3H7TA 2R0LA 1WSSH 2F83A 2J9NA 1O2JA 2OC0A 1EJAA 5CE1A 3A83A 5K0HA 3MNXA 1INCA 3LU9B 3A87A 1JRTA 4NWLA 1O30A 4WH6A 4DT4A 1JXPA 6ESTA 5E2PA 1DWCH 2VH0A 1GJDB 3BV9B 4IMQA 1JIMA 5C0TA 3EQ0H 1PPHE 2STBE 4K8BA 4BAHB 1N1LA 5GCHF 2Q1JA 4GCHG 4D7GA 1VITF 3N7OA 4K5ZA 2K0QA 4BAMB 3JZ2B 4F48B 1C1NA 4Q2KA 1G2LA 1SVPA 3QZQA 2J98B 2Y5FA 3PYHA 3SUDA 2DE9A 2BXTH 2J2UA 1IQNA 1JBUH 3VGCC 1ANDA 1OHHD 4TYDA 3QTOH 6LPRA 2FMJA 1CHGA 3VXFH 5AFYH 1LPGB 1C2GA 2SGDE 4CR9A 6GCHF 2ANWA 2BDYA 3SQHE 3S69A 1UVSH 5TCAA 1G32B 3A7ZA 5C67A 1GHXH 2XWAA 5C2ZA 5EJ1A 1O3LA 3AAVA 3SZNA 4ZH8A 1C5MD 4K2YA 2KCAA 1KXFA 3EA9A 2CGAA 4AB8A 1KTSB 2EA3A 3KF2A 3HATH 1V2PT 2A32A 3PLPA 3GCOA 3QX5H 1XVMA 1RTFB 1HJAC 1V2UT 4I32A 2ODYB 3TH3H 1GL0E 4GHTA 2ZP0H 1BRCE 1T7CA 4UFFH 5F8XA 3P95A 3GCTF 4XD7D 3ATWA 1E79D 4A92A 1ETSH 5HYOA 1GPZA 1V2VT 3KGPA 8KME2 4LK4A 1E38B 3OTPA 3GYMA 3QZRA 2A4QA 2ZKSA 2A1DB 4TPYA 3A85A 1N8OC 1QL7A 3GS9A 4NSVA 2F4LA 1UJ1A 1O3HA 1UHBB 2ALPA 4YT6H 4F4OC 4P02A 3GCHC 1GCTB 2O8LA 2BD8A 2WPLS 2FZZA 4JZ1A 2PKAB 2A2QH 3SUFA 5ESTE 2ZI2H 5C1UA 5FCRA 4ESTE 4A1VA 2GMTC 3TJUA 3K2UA 1GVKB 1SQRA 3MH5A 3H09A 4A5TS 2IJOB 3C27B 3ZZDA 1UCYK 3KYFA 1DY8A 1A1RA 3MTYA 3E8LA 3LC5A 3M7TA 1O5AB 2A31A 4YO9A 1ZTKA 1AB9C 1NPMA 1K1LA 3QUMP 1QY6A 1VCPA 3KYGA 1LVMA 1BMNH 1AUJA 2THFB 1RD3B 3ATLA 2A7CA 1PYTC 1SGTA 2A4OA 1C9PA 1RXPA 1ZPZA 1GBCA 1GBHA 3Q3KA 3RXIA 3D62A 1UMAH 2KAIB 1O3EA 1UVPA 2GKVE 2VGCC 3MO3A 3PV2A 1ZR0A 4NGAH 3TK9A 3GYLB 5A0BA 1EOLA 2H9EH 3MO9A 2EEKA 5IDKA 2C8ZB 1GJ8B 2ANYA 2BY5X 2CJIA 1EP5A 2QA9E 1O5CB 4H42U 3KNXA 3T5FH 1C4V2 1TGNA 1K22H 1GGDC 4NA8A 4BAOB 3ENSB 4MLFB 2ZHDA 2Z6BD 1BTPA 4HG6A 5GDSH 1NT1A 3ZVAA 1QCPA 5JPMH 1GBJA 2Y7XA 1NFYA 5G4BA 1KYNA 1G3DA 4YESB 5JBAS 2OUAA 1HNEE 1Y5AT 1KTTB 1QFKH 5DPAA 3SBKA 1K1OA 5A0AE 1BBRH 5IYTA 1S83A 1PQ5A 4FUEA 1P03A 1MQ5A 1W10U 1SGFA 2Z7FE 1B7XB 4BXWA 4UONA 3RXFA 1FI8A 2B8OH 5EJLA 1QQ4A 2BB4A 2PUQH 5T6GA 1BUIA 2ZA5A 1O2SA 4XOJA 2O8WA 1TPPA 1KIGH 5C94A 4A7IB 2PGBB 1O34A 1S6FA 1TBQH 1SLXB 1S81A 3STJA 1HPGA 3TLOA 2BD7A 3NPSA 3RC5A 2ANMH 5JB8S 1K0HA 3PROA 3QGJA 3SNEA 2YOLA 2QXGA 4B76A 1FDPA 2GDDA 1Z7KA 3R0FA 2XWBI 1CGHA 2XOKD 4X1SU 3RXVA 1NU9A 2WUCA 2UUYA 4K1EA 3FO8D 4AORA 4ZCNA 4D76A 3F9FA 2C8XB 1LPKB 1SFIA 2XBWA 3A7VA 3MI4A 3TJOA 4B74A 2Q6DA 4Y79A 1EXFA 1UVTH 2W26A 1FN6A 3RLWH 1BMAA 1XUKA 2EI7A 1DM4B 3SGBE 2P8OC 4X6MA 1SSXA 1JWTA 1AE5A 3UQVA 2Z9LA 3F6UH 3NK8A 4I86A 4VGCC 1TMTH 1E34B 3M5NA 2BVRH 3ODFA 1GBDA 1T8MA 1ANBA 1W0KD 3EA8A 1GWAA 1NRQH 2XXLA 2AH4X 1YPLH 1O3OA 4UFEH 3MNCA 1V2JT 1C5ZB 1FN8A 3LH3A 4FUDA 3ZVFA 4YLUA 4B2CA 5EG4A 3GY7A 2HGTH 2UUJB 3BTDE 1DXPA 3A8DA 3VB5A 5HIYA 1GI9B 1V2WT 1B0EA 1AD8H 1QRZA 4X8VH 1XXFA 1BDAA 3TIUA 4JYVH 2W7SA 2BD4A 5F8ZA 5FX6A 1GMHF 1G3CA 1QRXA 1VCQA 2O8TA 3P8GA 3RXBA 4A1XA 2VB0A 1O2VA 1G9IE 1TNJA 1OWEA 3NCLA 2YMSB 3LOXA 1P0SH 4P00A 1HAVB 2NU3E 1VGCB 3P70B 1AU8A 4Z1MD 3SUEA 3WY8A 1NRNH 3D65E 4ZHAA 3QTVH 1EPTA 3Q3XA 2WHXA 4ZHLU 2AS9A 1DT2A 2BY6X 1IQMA 1O36A 2ZO3H 1OP2A 4K3JA 3UOPA 2A4RA 4CHAB 1T32A 3M5LA 1Y3UA 1KXAA 4AB9A 1F5LA 5I46H 4JZDH 4ABFA 2AERH 2ZF0H 1A0LA 1TRNA 1V2OT 3OTJE 1MTNB 1W7GH 1TA6A 4INHA 3TK5A 3KIDU 3U8OH 4Q7YA 1NROH 1ELAA 3RM2H 1WQSA 1LMWB 2ZZUH 1GG6C 1MABB 2P93A 5EW2H 5CMXH 1MKXK 2ZDMA 5L6NH 4BAKB 1BHXB 3ZVEA 3RXOA 4HFPB 1ELVA 2VWLA 1AUTC 4GAWA 1J17T 2CF8H 1O2WA 1OWJA 1TGBA 2PTNA 4Y8ZA 3A8AA 2PSYA 2QC2A 2BLQA 1P2MA 3RXKA 5HKKD 1C5SA 5LGOA 1Q2WA 3ZZ9A 5CHAC 2CMYA 2V6NA 4FUBA 2G4UA 1A3EH 3DT0H 4BNRA 4HI3A 2IPQX 1MZDA 4NIXA 6CHAB 3P17H 7ESTE 1O3AA 3ZZ7A 1GMDF 3E16B 4U2WA 1GDUA 1OWDA 2AFQB 2FYQA 2ZDLA 4ABBA 4BAQB 1VR1H 1EP6A 2BDIA 2NU0E 1EB2A 4IC5A 4R0IA 4U01A 1MKWK 1NO9H 2G51A 1O3CA 4JK5A 2K8IA 2Q6FA 2G8TA 3FAOA 1O5DH 4CRGA 3VG8A 1EX3A 4FOUC 4BTIB 1Y3XA 5DP8A 5GPIB 1G3BA 3LDXH 2J94A 1Z1JA 4RT1A 1SOZA 3ZZ5A 1ACBE 2HNTC 4AGKA 1O31A 2VBCA 3BG4B 4GPGA 3M35A 2OXSA 4B2AA 1GDNA 3U1JB 2W7UA 4Y0YE 2SGQE 5JB9S 1YCPH 2BLWA 1SQOA 1O3JA 3UB0A 3W1EA 1IQFA 5E0GA 3ODDA 1V2KT 1GMCG 1XUGA 1EJNA 4A1TA 1OYTH 3SU1A 5F6MA 3OEHD 2HNTF 2Q6GA 2A4GA 3AASA 1SGDE 1NRSH 4NCYA 1IHSH 3RU4T 1SGRE 1FPCH 2FI5E 2ZGXH 2JJ1D 2KCOA 1TPOA 1O33A 2F3CE 2P95A 1A7SA 3FP7E 3PV4A 1L1GA 2BDCA 1MAYA 3EE0B 1PQ8A 1YPEH 1K21H 4TSFD 4FUIA 1TE0A 1EPTB 3ZZCA 1BJVA 3UY9A 1T8LA 2R9PA 4Z6AH 3SV9A 4CRCA 1EUFA 4DIHH 1EZXC 1O5GH 1PPEE 1TMBH 1AFEH 1PPCE 2G55A 3F9GA 1GJ4H 2M2AA 3UFAA 5J4QA 3M3VA 2J95A 1A0HB 3T62A 4X6NA 2K1QA 3PRBA 3F0OA 1O37A 4ABAA 2OINA 5C1YA 5GNDA 1FAKH 5GIBA 1AKSB 1ZMNA 3NXPA 3VXEH 4ISOA 1MCTA 2UUFB 2D1JA 2V3MA 1GHAF 1CSOE 2BOHB 1GJ5H 5J4SA 1NM6A 3MHWU 4JYUH 5HM2A 2BX3A 1MMJN 2OP9A 5AHGH 5DKMA 2FOFA 3OAAD 2J92A 1ANCA 3SHAH 3SOSA 2ZCKP 3M37A 4X1PU 3U69H 1TABE 2Y81A 3F2GA 3MO6A 2AHME 2D26C 1O2XA 1SR5C 3BIUH 4ZROA 4NZLA 1C2MA 4YM9A 4HZHA 2A2XH 4XBCA 1GI0A 1S84A 3H7OA 2EI6A 4ZAEA 4MQAA 5DG6A 2IPHA 2SGFE 2XNIA 2FOMB 2FX6A 2Y5GA 4CRBA 1O3PB 3ZZBA 4KTSA 4OM9A 2ZGBH 8LPRA 1C5PA 1V2MT 1C1WH 1THSH 2UWLA 1AI8H 2XBVA 5FPTA 1AFQC 3CP7A 3SGAE 2WPKS 1K1PA 2BQWB 2BQ6B 2ZECA 1A3BH 3GDSA 3A80A 3URCA 2OC7A 1P8VC 2ZPRA 2QGRA 2XNDD 5FBEA 1TGCA 3S9AA 3RMLH 3SUGA 1MBQA 1NTPA 3SQEE 2FP7B 1V2LT 1YLNA 2AGEX 1TQ7B 3A84A 2P3UB 3BEIB 2VIDA 1MTSA 1SQAA 4ISIH 4FETA 1P12E 1FJSA 2ZIQH 2ZFQH 3LONA 1D9IA 4HTCH 2TGPZ 1UTKA 5C5NA 4ACBA 3V0XA 1HJAB 1LO6A 4Y11E 2A5KA 3SNCA 1GJBB 1QBVH 2PUXB 2GT8A 3SV7A 1O2NA 3M5OA 3HK6B 5E8EH 3VB3A 1OWHA 1FX0B 1ZJKA 2QIQA 1C5WB 4CH2B 1ZHPA 1ELDE 4KTUA 4D9RA 3SV2H 1ZSLA 3GDVA 2QF5A 4CRAA 1TWXB 2GV7A 4JMYA 4E05H 1BTZA 1P09A 4WF8A 2A45B 3V7TA 1GVLA 1BCUH 5EJZA 1WXRA 1CA0C 1GBTA 1NBMD 1ANEA 4RKJB 2L6OA 1FY1A 3RC6A 1WBGB 5ABWA 1O2GH 3FFGA 1DDJA 1IQLA 1MTWA 2GVFA 5LH8A 3RM0H 1ELTA 1O2ZA 2WPJS 5DP3A 2ZU1A 2QV1A 3TJNA 1DSTA 3TPIZ 3MYWA 1C2JA 1FY3A 2G81E 2P16A 1BMLA 1COWD 1C2DA 2RDLA 1VZQH 2QXHA 1QL8A 3ATIA 1UTMA 5C5OA 3SI4H 2FTLE 2J38A 1RS0A 2LP6A 1D4PB 4NG9H 1GBAA 5FL7D 1H9IE 4TWWA 1H8HD 1MU6B 1CQQA 1HAYB 3T26A 3TNTA 4KELA 2C3SA 1HIAB 1LQDB 2D8WA 1DPOA 1CHOF 1MQ6A 1C5TA 2VVVA 3HKIB 3TGIE 5KEDA 2GGVB 2GJGA 3EAJA 3HPTB 1ZZZA 1NESE 3FZDA 1ETTH 1MBMA 4B73A 4IC6A 1CGJE 1QJ6B 3FP8E 4O3TA 1C4U2 5EU8A 1AZZA 8GCHF 4WJG2 2WUBA 3CNRA 1FAXA 3IITA 5LPFA 4O3UA 1LVOA 1GBIA 2ASUB 1EAXA 4MG3A 3AK5A 3PM3A 1KXBA 4K60A 4UDWH 4ABIA 1F92A 2ZGCA 1PQ7A 4D8NA 1KLJH 1PPGE 1JOUB 4JZEH 3ZVDA 3A8CA 1OOKB 3ESTA 3U8TH 1K1JA 2FI3E 3MH7A 4B6FA 1VITG 1NRPH 3L3TA 1GHVH 1C2FA 1MH0A 1S6HA 2ZFSA 2OCVB 2SGAA 1GHBF 2FOBA 3DFJA 2RDEA 2WINI 2A7JA 1YPKH 2ZCHP 4I31A 4ZXXH 2QE7D 2WV9A 2ZDNA 2BLOA 3MWIU 4IBLH 1NZQH 5T3HA 3S9BA 4I8KA 3DFLA 1P06A 1TOMH 3M5MA 4U30A 1P2QA 1QGFA 1HAGE 1SG8B 1DUAA 1MD8A 1T8NA 1QQUA 4F55A 1TGSZ 2VH6A 1U6QA 1BTWA 1C9TA 3LPRA 6GCHG 1SGCA 1WTHD 2ZNKH 5K7RA 2HWLB 2BDGA 4ABJA 2PTCE 2TPIZ 2XW9A 2UWPA 1O2LA 3EDXB 1SLVB 1ZHMA 4ZUHA 2FXRA 3P6ZB 1P3CA 2GCTB 1GHYH 2XC5A 1W0JD 4X2XA 4I7YH 4XBDA 1QB6A 1OWKA 3SV8A 1IQIA 2CHAB 2BLVA 1CT2E 5FPSA 2WPMS 1S0QA 2XBYA 3BTWE 2OBQA 3SYJA 1G2MA 1OKXA 1TNHA 1TB6H 1BITA 2F43B 4MPWA 3PMBB 2W6ID 1AY6H 1T4UH 1DLKB 1TBRH 3B8JA 2TGDA 1EZSC 4IGDA 1NBME 1GBLA 1SLUB 2JH0D 3UTUH 3OYPA 3D23A 4J1YA 2FOHA 3WWBA 3PMHB 4RSPA 2FWWA 1K2I1 3UNRA 1CBWC 4DIIH 3MU5A 3EYDA 4KKDA 4GHQA 4VGCB 1WU1A 3V13A 3RXQA 4MNVA 1Y59T 2F9OA 1AVGH 1O2KA 3W95A 2BYAX 5EPYA 1JMOH 2ZC9H 4XBBA 1F7ZA 3U98H 1ZMJA 2B5TB 2CV3A 1GI3A 1GCTC 3E3TA 2PW8H 3A88A 4UFGH 1XUJA 4AG1A 2HLCA 3URDA 1ABJH 1SGNE 1GI1A 1J14A 2FIRH 1DXWA 1WUNH
chains in the Genus database with same CATH topology
1AIXH 1UCYH 4D9QA 3EA7A 3SNAA 5HXFA 1GHZA 2CF9H 4XSKU 2B0FA 3ZZAA 3SU4A 2VVUA 1Q31A 1UTPA 4K8YA 3I78A 1C1SA 1ORFA 1D6WA 1TPAE 2BZ6H 1WTGH 4WH8A 3UR6A 4X6PA 2FYRA 2AEIH 4NA7A 3SJ8A 2ZWLH 4CRFA 1C2KA 2UWOA 1IQGA 2FESH 3RXMA 2ZFRH 3P8OA 4JK6A 3F9EA 3KQDA 4BANB 2P59A 2BY7X 3M7UA 1J16A 4F49A 1O2MA 4FUHA 9LPRA 2VJ1A 1BZXE 1SHYA 1TMUH 1NFUA 1CGIE 2ZFTA 1LKAA 2ZTXA 3V12A 4IMZA 1C1QA 1ZRBA 1F0TA 2FPZA 3LGTA 2GDEH 1ZGVA 3AW1A 1L4DA 4WXIA 1O3MA 3QN7A 2PLXA 2AMQA 3RXTA 1QJ1B 4Z0KA 1O2PA 4Q7XA 1AE8H 1K28D 1K1NA 4IN2A 4FU9A 1SLWB 2UUKB 1O2HA 1PQAA 2SGPE 3SI3H 1Y5BT 4MPXA 1JIRA 2Z9GA 1LHGH 2ZHWH 4MNWA 4GLYA 1HYLA 3KN2A 1BTXA 1VJAU 3NKKA 1SGPE 1FUJA 2BD3A 1ABIH 1LHFH 3MH4A 3RUOA 1EAUA 1HXFH 3PWCA 4D7FA 1G37A 1S0RA 4ZKSU 3BIVH 1P9UA 3RDZA 1C2LA 4X1RU 5E0HA 1RGQA 1HJ9A 4AGJA 2AIQA 2FS8A 4I8LA 1EZUC 4YLQH 1C5RA 5PTPA 1GBFA 1P01A 2H6MA 1FPHH 1UO6A 5SGAE 5AF9H 1DE7H 3SU0A 1P2NA 1F5KU 1A61H 1P11E 1ELFA 3A82A 1D3DB 1O2YA 4FVDA 2TGAA 1IQEA 1A2CH 3V3MA 1P02A 1A5HA 2SFAA 1C5OH 3QO6A 1WV7H 1C5YB 4LXBH 1HAXB 2JKHA 4X6OA 2FX4A 1ZGIA 5C1XA 2A0QB 1HFDA 3RU4D 3P8FA 2XCNA 1DSUA 7GCHF 4R8TB 1AWFH 3GY3A 5LPRA 1O3NA 1W12U 1FLEE 3IWMA 2FOAA 3A81A 4FUGA 4RN6A 1DX5M 5L2ZH 2FLRH 1MTVA 4AG2A 1QBOA 4NIYA 1IOEA 1BTYA 1C1TA 2PGQB 2OC8A 3M3TA 4OS1A 2XRCA 4CBNA 4INKA 4B71A 4X2YA 4CRDA 1TPSA 1DFPA 1YYY1 2BTCE 1YP9A 1L0ZA 1Y3WA 3F9HA 1J15A 1CO7E 1PPFE 1F0UA 1YGCH 2PKSC 3E0PB 1TX8A 5EXMA 1MUEB 1C5XB 3FVFB 1TOCB 3F68H 2YNAA 1CU1A 3P92A 3UQOA 3BTHE 1TYNA 1P2JA 1GI8B 1HCGA 1J9CH 1TLDA 5C3NA 2H9TH 5BPEA 2ZFFH 4O03A 1QJ7B 2G00A 4DT7B 3ZV8A 5DP6A 3PO1B 1LQEA 5L2YH 1ZTJA 1O5FH 1ZSJA 4X2VA 1SPJA 4CHAC 1UTQA 2OQUA 3RXUA 5AFZH 3FZZA 2O8MA 2FTMA 1ZMLA 3ITIA 1P2OA 3IG6B 1YCPM 1IHTH 3AW0A 3TVJB 1YPHC 3I77A 2H2ZA 1MTNC 4U32A 1ARCA 1RJXB 2QF0A 5EOKA 5ESBA 3SJOA 4H6TA 1MKXH 1IAUA 4WVPE 5JBBS 3K6ZA 2GZ7A 1UVUH 1LHDH 3MU4A 1ZRKA 2H9HA 3C1KA 1DY9A 1X7AC 2JETB 3TH4H 1RRKA 3O8RA 1GJCB 4UFDH 2BY9X 4BTTB 3SHCH 4NFFA 2WPIS 1C2HA 1FY5A 5A09A 1V2NT 3ATMA 2ZU5A 1ZYOA 4RKOB 2F9VA 3VEQB 5EQQA 1GMDG 1ZJDA 3RXCA 1LTOA 2QN5T 3UWIA 1LCYA 1LVBA 2F9BH 1BBRE 3KHVA 1TX7A 2OBOA 3RXDA 1QURH 2C8WB 3TK6A 2B7DH 4I33A 1TRMA 2H5DA 3BSQA 1RIWC 1FQ3A 3KQCA 1C5NH 3GY5A 1RTKA 1Z8JB 5A8XA 3BN9A 5ETXA 4DJZB 6CHAC 3NUMA 1MKWH 1HGTH 2ZCLP 3U9AH 1G30B 1V2TT 2FOEA 4CBOA 4K69A 3RMOH 3BTTE 3VB4A 3RU4E 3E1XB 3GY8A 3UIRA 1Q3XA 5FAHA 1GHWH 2OQ5A 5DP7A 2ILNA 2I6QA 4HGCA 3A8BA 3ZVBA 1ELGA 2XYAA 2FS9A 1H9LB 2M5TA 2ZFPH 1AO5A 2PWXA 4YT7H 1EAWA 1GBBA 1HXEH 2O8UA 3BG4C 4JCNA 4M7GA 2ESTE 4NFEA 3DD2H 2VIVA 1KLTA 1VJ9U 4AFZA 3GY6A 1SGFG 3MU8A 1O3GA 1L1NA 2W3KA 1OWIA 2FOGA 1OS8A 1KSNA 3Q3YA 2DUCA 2SGEE 1T4VH 4O97A 1BRUP 1C4Y2 3A7WA 5FPYA 3SJIA 1TRYA 4H6SB 2TBSA 2OLGA 1SGIB 1RFNA 1V2RT 1TFXA 3KCGH 1DANH 2GZ9A 1C1OA 3CS0A 3RMNH 3T25A 3VGCB 1Y3YA 5TCCA 4NSYA 4OGXA 3LIWA 4GCHF 4SGBE 1GJ7B 1SC8U 7KMEH 1UHBA 3LGVA 5FHTA 1CT0E 2Y82A 1NC6A 3A86A 2VINA 2P3TB 1TNGA 4OS7A 3HGPA 4NWKA 3T29A 3OY6U 1SB1H 2ZU2A 2BMGB 5GJ4B 3RP2A 1HBTH 3U8RH 3VB6A 3M7QA 2PKAA 5EPNA 5FBIA 2PHBA 1ELEE 4I8HA 4MTBA 3MU0A 2BX4A 1O5BB 1DS2E 2V3HH 1EASA 3T2NA 3TITA 2EI8A 3BTEE 2ZGJA 1EATA 4YTAA 3UUZA 3PTNA 2RCEA 2FEQH 1NY22 2ZU3A 5EQRA 3JZ1B 1WAYB 1SI5H 2BVSH 1IQHA 1W7XH 3LJOA 1UTJA 1WCZA 1N8OB 1YPHE 1DLEA 3UREA 5A0CA 1S85A 1RTLA 2OD3B 2CXVA 2OTVA 3ELAH 3GCHB 2WPHS 1GBKA 1HAPH 1O3KA 4UEHH 4Q7ZA 3KQEA 1HJ8A 2RA3A 2Z9JA 1FZZA 4GUXA 5DGJA 2KAIA 3GDUA 1XXDA 1EQ9A 5T6DA 2C8YB 3RC4A 2C93B 2GMTB 3RXHA 2GCHG 1Y8TA 2ZDVH 4K1SA 4DY7B 3LGIA 2C90B 4DCDA 1P05A 4GVUA 1UK4A 4JZIA 3ZYDA 1BMMH 2FM2A 1FY8E 3PMAB 3QGNB 1O3BA 1V2QT 2Z9KA 2P94A 1THRH 3TGJE 4NIWA 1C1MA 1AB9B 2I6SA 1GL1A 1HB0B 2GT7A 2ZDKA 4XDEA 1AHTH 1PPBH 4ISNA 2FOCA 4DVAU 4AYVB 2HPQH 1TA2A 3O8DA 1OYQA 4AN7A 4DURA 2W3IA 1UK2A 2Z3EA 5BRRE 1C5VA 4MNXA 5LPEA 3AVZA 1B0FA 1QBNA 1P2KA 1K1MA 2XC0A 4BXSA 3O8CA 2G52A 1MZAA 4OS2A 2PFEA 5DO4H 2VGCB 1QRWA 2BHGA 3SJ9A 2QY0B 2FODA 1P3EA 2NWNA 1NS3A 3PLKA 3RXRA 1UK3A 4WY3A 1W0YH 4WMFA 4B75A 2QXJA 4FUJA 3LGWA 1GGDB 3DHKH 2ZTZA 2SNWA 1GI6A 5GCHG 2XTTB 4CR5A 2ZEBA 1CBWB 2O9QA 1AVXA 2HPPH 3K65B 1F5RA 1YPGH 9ESTA 1C1UH 3M3SA 2GZ8A 4NA9H 2AMPA 2TIOA 3GCNA 1Z8RA 2B9LA 3BEUA 1AVWA 5H4IB 1TQ0B 1C2EA 1BBRK 1LHCH 3B9FH 1EOJA 2R2WU 1W8BH 2JH6D 5DP4A 3KL6A 5AVDA 1XUFA 1J8AA 3BTGE 3LGYA 4I8GA 1N6YA 3S7KB 4AFQA 2ODQA 4MPUA 5T6FA 3VPKA 1BA8B 5JBCS 4TPIZ 1O5EH 1AGJA 1QIXB 2VVCA 4Y10E 4CREA 1GJ9B 1XMNB 4FUFA 4ABHA 2AIPA 1CHOG 4XFQA 1GI7B 3L33A 2GTBA 2NU2E 1E37B 1MTUA 1FONA 1F0SA 3PWBA 3UNSA 8GCHG 3FP6E 3GCTG 1GI4A 3E0NB 1SGEE 1AN1E 5EXNA 3FANA 1OX1A 8ESTE 3UPEA 1C5QA 5TJXA 2V3OH 5L30H 3M61U 1FIWA 2G5NA 1FXYA 2XBXA 1ZPBA 4X1NU 1HAIH 2QF3A 2ZHEH 3SN8A 2ZPQA 1ESBA 2P8OB 1SOTA 1MAXA 4X0WU 4CH8B 3RXEA 1GHBG 1D3TB 1HAVA 1QR3E 2ZPSA 3D49H 3RXJA 5F03A 2FI4E 4OS6A 4ZXYH 4AFSA 3OSYA 3LGUA 3RXGA 5DK1A 4FU8A 1CT4E 1Z8IB 5GXPA 5GWZA 4QT8C 1P2IA 4XE4A 4JZFH 1H4WA 1ZPCA 2XCFA 1XKAC 1PYTD 1HRTH 1O38A 1THPB 2ANKH 4IN1A 3BTKE 3MOCA 3DA9B 1BTHH 2J4IA 1E35B 3OX7U 2Z3CA 4LZ4B 1W2KH 4ISLA 4THNH 5A2MH 3S0NA 4KTCA 3ZVGA 1E0FD 7LPRA 1T31A 2ALVA 4Y8XA 3ZZ3A 2HVXA 1TALA 1YKTA 1Z6EA 1QB1A 4TY7A 1OP8A 3ZZ8A 1XX9A 1O3DA 1ID5H 3SNDA 4WWYA 2ZQ2A 4ZKOU 3ATKA 3GICB 1DWDH 1YPMH 2GCTC 3A7YA 5EQSA 1ZTLA 4X8UH 3DUXH 1Y3VA 4GSOA 4NIVA 4WMEA 1C1PA 1Z6JH 3SW2B 5B6OA 3OU0A 2YNBA 2BD2A 2WYGA 2CHAC 2BD5A 1YBWA 3Q76A 2C4FH 2Y6TA 1W0ZU 4YOGA 3VB7A 2D2DA 2ZQ1A 1LPZB 4NZQA 2SNVA 1OXGA 4LZ1H 1Z71A 3S9CA 4Y0ZE 1WOFA 3QWCH 2VNTA 1ELCA 1ARBA 1Y5UT 1GG6B 4JYTA 1FY4A 2R0KA 1YLDA 1HAZB 3QK1A 1ZSKA 4ABEA 2PR3A 1FMGA 1Z8GA 3F1SB 3MU1A 3U1IB 4BTUB 1ESAA 4YOJA 1AZ8A 3TU7H 3P8NA 2IOTA 4FXGH 3K9XB 4TWYA 3MH6A 4Y71A 4DW2U 3SV6A 2TRMA 1GBEA 1C5UA 3MNSA 1K1IA 1KXCA 1XM1A 1SBWA 5A8ZA 1UTNA 2WYJA 1LVYA 1QNJA 5CHAB 1KY9A 4IS5A 1NFWA 3UOUA 1YLCA 3RXSA 4ZKNU 4Y7BA 1NRRH 2GV6A 1GVZA 1TBZH 3LT3A 1C5LH 1GDQA 3MFJA 1YF4A 2ZHQH 3W94A 1H9HE 1HAHH 2HRVA 2VIOA 2R3YA 1V3XA 3LC3A 4K1TA 4SGAE 1ETRH 3OY5U 4J2YB 2PKSB 1SFQB 2ZTYA 1O39A 3E6PH 1O3FA 1TONA 2VIPA 4X8TH 1QHRB 3O8BA 2QCYA 2Y80A 1CE5A 1P10A 2XC4A 1E36B 1O2UA 3MMGA 1A0JA 2V35A 1PPZA 1W11U 2F9NA 2P3FH 2RG3A 3M36A 5EGMA 4MNYA 3PTBA 1YC0A 1DWBH 1FNIA 2A5AA 2V0BA 1UTLM 5HGGA 1P04A 2G4TA 3AAUA 1TAWA 2F91A 1ZHRA 2BDHA 3SU5A 3ZVCA 3S7HB 1D6RA 2DE8A 2BVXH 1YM0A 2ZG0H 1TNLA 1HV7A 1YCPK 1HLTH 1DWEH 3CS7A 1O32A 1L4ZA 2LPRA 5EODA 1MCVA 4O9VA 5DP5A 3MNBA 2BXUH 1DOJA 4B2BA 1C1VH 2GP9B 4OS5A 3RMMH 3HK3B 1A5GH 1AKSA 1GMHG 1OPHB 4LOYH 5JDUB 2BDBA 5A8YA 5C20A 3E91A 3CENA 2VIWA 4E06H 1UVOA 1GMCF 3PMJA 2TGTA 3GY4A 2RA0A 2WV4A 3HKJB 2Z94A 5EW1H 4E7NA 5FXLA 2Y5HA 1LDTT 2QXIA 2WV5A 3BTQE 5I25A 3RXPA 2NU1E 1SGYE 4FVBA 2FLBH 1F2SE 1GJAB 1OP0A 1LHEH 1RIWB 2JH5D 2STAE 3GISB 4WMDA 4A6LA 1MU8B 2GD4B 3GY2A 1A4WH 2BD9A 3RXLA 3SU3A 2BOKA 4BOHA 1EZQA 1O2TA 3NZIA 3NWUA 4Q80A 1VGCC 1SGQE 3SU6A 2AYWA 2ODPA 3UR9A 1EB1H 2AGGX 1H1BA 1BB0B 4WXVA 3SO3A 1W13U 1XUHA 4DGJA 3ZV9A 2W5EA 1KLIH 4DG4A 1IQJA 3TH2H 4UE7H 1A46H 1D3QB 1EJMA 3R3GB 4X2WA 4AFUA 1FIZA 1S5SA 1V6DA 1WQVH 3ZZ6A 1BTUA 3ZYEA 4ZHMU 1O3IA 1FV9A 2FDAA 5E2OA 2QYIA 1AMHA 1W14U 3TNSA 5E0JA 7GCHG 2ULLA 3T28A 1BOQA 1KDQA 4B1TA 4AYYB 3TJVA 2EC9H 2F9PA 1NFXA 1HDTH 1GI2A 1KXEA 4KP0A 2IN2A 2R3UA 2OC1A 1P57B 2J34A 3K6YA 1CA8B 4I8JA 4ASHA 1NU7B 2BZAA 2HALA 1AQ7A 1H8DH 3H5CB 2A7HA 3QDZB 3BG8A 5DP9A 4KGAA 4ZMAH 4X8SH 5JYIA 3GOVB 3TGKE 1N6XA 1P9SA 2QAAA 2ZU4A 1VCWA 3PB1E 3B23B 4MVNA 3SNBA 3BEFB 3SORA 1BRAA 2BY8X 3VFEA 4E7RG 2G5VA 2HOBA 1DVAH 3SU2A 4FUCA 1BHXF 2AGIX 5HMAA 1EKBB 1XKBC 5HM9A 1S82A 1AFQB 1BRBE 1O2IA 4TY6A 2H1UA 1SMFE 3SGQE 4ABGA 1L2EA 3PLBA 1C1RA 2A5IA 1V2ST 3HGNA 1HAOH 1DUEA 1UCYE 2BM2A 3SJKA 1BJUA 3LJJA 4Y8YA 1HUTH 4DOQA 1PFXC 1OSSA 1QTFA 4X1QU 1O0DH 1BQYA 1L1JA 2NU4E 2ZDAH 3UWJH 3KEEA 1UTOA 2CN0H 3ZZ4A 1QL9A 3EGKH 3L6PA 1T8OA 2F9UA 4MPVA 1O2QA 4UD9H 3PO1C 4Y76A 1TNKA 1KXDA 3G01A 4OGYA 3BF6H 3E90B 4IW4E 1XUIA 5JBTA 1LKBA 1VITH 4AOQA 4AX9H 1HIAA 1G36A 1O2OA