1UW4B

The structural basis of the interaction between nonsense mediated decay factors upf2 and upf3
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
248
structure length
248
Chain Sequence
RPPLQEYVRKLLYKDLSKVTTEKVLRQMRKLPWQDQEVKDYVICCMINIWNVKYNSIHCVANLLAGLVLYQEDVGIHVVDGVLEDIRLGMEVNQPKFNQRRISSAKFLGELYNYRMVESAVIFRTLYSFTSFGVNPDGSPSSLDPPEHLFRIRLVCTILDTCGQYFDRGSSKRKLDCFLVYFQRYVWWKKSLEVWTKDHPFPIDIDYMISDTLELLRPKIKLCNSLEESIRQVQDLEREFLIKLGLVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structural Basis for the Interaction between Nonsense-Mediated Mrna Decay Factors Upf2 and Upf3
pubmed doi rcsb
molecule keywords UPF3X
source organism Homo sapiens
molecule tags Rna binding protein
total genus 95
structure length 248
sequence length 248
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02854 MIF4G MIF4G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1uw4B00
2VSOE 4IULA 2IOLA 3L6AA 2GGFA 2IONA 2IOSA 5ANRA 1PAQA 4GMJA 3FEXA 4B8AA 4B89A 1H6KA 2HM8A 2KZTA 1N52A 4CT4A 2IU1A 2VSXE 3EIQC 4JHJA 4LUNU 3JUIA 1N54A 4CRWA 4B8CB 4JHKA 2ZU6B 3D3MA 4C9BB 1UW4B 4GMLA 4CEMA 2FULA 2KZTB 3RK6A 2NSZA 1UG3A 2I2OA 1H2TC 3FEYA 1HU3A 2RG8A 3EIJA 1H2UA 1H2VC
chains in the Genus database with same CATH superfamily
4J8EA 3LKUA 5E76A 4AEZC 1S0PA 2X6KA 2DCPA 2OEVA 2AW6A 1DC2A 1JWGA 3CQGB 1TEZA 4F3VA 1N0QA 3CV0A 5BXUA 1E7UA 1NL4A 4U7EB 3HXEA 3TWUA 5C1DA 2YQ8A 3FUEA 1KT1A 3UUXA 3FUHA 3E33A 3EJNA 3MYVA 4KXKB 4R7LA 4OAVB 4J7WA 1P5QA 3D9PA 2ZGDA 4I9CA 4L2YA 4J8YA 2WQ6A 4GTVA 3EU9A 4CDMA 3UQ3A 4EZKA 5G05C 1YCSB 1TJCA 4WNDA 1SA4A 2I6HA 3FUNA 1IQUA 3T5XA 2A5UA 3MJWA 3CVWA 2R05A 3FUJA 4NIKA 2BF0X 3FWVA 3D9MA 1OWLA 3B7BA 4O1OA 2QC9A 4E85A 1INZA 1OCOE 3QWVA 2XPYA 3CGHA 5BT1A 3HVEB 4RQIA 3L22A 4Y6CA 3RKVA 3CK7A 3MV3B 4WWPA 2BKKB 3GZSA 3FULA 4FJZA 4GTSA 5KBAA 4LNUD 4A3VA 4DRXE 2FEZA 2WXHA 3L82A 4F7AA 2WXQA 5ENRD 2L6JA 4URKA 2MRIA 4V3IA 3ESLA 2OCCE 1BPOA 3ZEFA 5T3RA 2XGOA 3NOCD 5B3SE 3CK9A 1JPLA 4AVXA 1NP7A 2QYUA 2KZTB 2BKGA 1HU3A 5B1AE 5KJMA 5AIJA 1NA0A 1GW6A 3TXMA 1BLXB 4WWNA 4HORA 2UY1A 4DLQA 1UJJA 3LYAA 3X2QE 3QOUA 1N4QA 4J0UA 4I1AA 3I4GA 5CCLA 1OWPA 5ITZF 3WG7E 3EIJA 3UT8A 3E4BA 4GTTA 5CERB 4A3TA 1MX2A 5EN5D 4UWGA 1IXVA 5FQ4A 4XKBA 3GZ1A 2VTBA 3FUFA 4XX5A 1D8EA 4APOA 4TUMA 1IHBA 1LF8A 2XCCA 1HG2A 3JXIA 2IO2C 3D9OA 3IHVA 4M3OA 3ASNE 3QJZA 2P9NG 3J5PA 4N39A 1TJFA 5G55A 3FEYA 3G2SA 1KT0A 2WXMA 3CIAA 3PEUB 1SVXA 4XKCA 3HXCA 2GW1A 4HS2A 3PE3A 1A17A 4BEPA 4AXHA 4F53A 2VQ2A 3D9KA 3AG1E 4J8SA 2AXVA 5AQBA 4DX6D 3OXGA 3FUMA 2P9UG 1FVFA 4H7YA 3FTVA 3FH5A 4BSZB 1HH8A 2PQRA 2LAIA 5JMND 2Y69E 4GCOA 2GRQB 4F1SA 1IYGA 5LX8A 4U0SA 4GTRA 5FZRA 1DCQA 4I1MA 5EX0A 3R7RA 5ENNA 4HVBA 4YDOA 3ABKE 2L0TB 2R02A 3C3QA 3ZRHA 4KBQA 1V55E 4K5BA 3B7SA 1TNZA 3AU4A 3FUKA 2XZTG 3FU3A 5T8IA 5BXOA 3L17A 4C48B 3L08A 1UW4B 3APFA 5B1BE 2C0LA 1RZ4A 2KC7A 3S2AA 3B7TA 1DCEA 4H7XA 2ETCA 5KNHD 2RD0A 1O5MA 2F8XK 1JCRA 3LEWA 2WXIA 1N52A 3CVXA 4HI8A 1EPUA 1BU9A 3LPZA 2WB2A 3I4RB 4E6HA 1TYQG 4GYOA 4RVBA 3R7QA 4HOQA 3ONLA 4EZJA 3ULQA 2OEWA 3RSEG 3LVRE 1H19A 2EQXA 4KVOA 1MZCA 4CGWA 3FH7A 2WXNA 1QBQA 5E75A 1TR4A 4GU5A 4Q69A 3BG1B 3KSLA 3ABME 2WMNA 3NQPA 2NC9A 3ESKA 5LCWJ 4GTMA 1N95A 3NZUA 1KLXA 1OXJA 4MBGA 3U4TA 1H0AA 2YINA 3CHMA 4UQXA 5BUZA 5J08A 3FUDA 3CKCA 1W3BA 3JXJA 4GMJA 1BI7B 4U07A 4PDXA 1D9SA 3AG3E 5LFAA 4LRZA 5ENOD 5JHAA 1RW2A 2HYZA 1XGWA 1D8DA 4GMRA 3UXGA 3RRNB 2J9QA 4ANUA 3ZYKA 2AWIA 4UWLA 2PL2A 4EQFA 1N0RA 3ULEG 3RO3A 1SZ9A 5CMWA 3IHYA 1S64A 3L13A 1FPPA 3WXXA 3HDXA 5ARFA 3DSVA 5CBNA 1BI8B 4JC8A 4I6EA 1OWOA 1KPSB 2R03A 4I2WA 2C0MA 2AXUA 3CEQA 1MJ0A 3PE4A 1JWFA 3CHQA 4FHJA 5EYPF 4BT8A 4GTQA 4U63A 2WXKA 3B7RL 4A55A 3U66A 2WM9A 1OT8A 3CHOA 3E30A 3S7JA 4JB8P 2XHEA 2HM8A 2WXFA 3HXFA 2YHCA 3VTXA 4AV7A 4KT6B 3TGOA 5AAOA 3KEAA 4L7TA 5ENSD 3B95A 3T8KA 4IULA 4TXQA 2P2CP 4PS8A 4OVVA 4GZCA 4NACA 3HXBA 2P9KG 1H6KA 4HRLA 4DX2A 4TUUA 4L9PA 3G2UA 1ELKA 4GMLA 3LCAA 2LXLA 4DUIA 3ZYMA 4DK5A 5HKPA 2IFUA 1EYHA 1H6OA 4QFVA 4J6IA 2CG3A 3URZA 3FTSA 2OVBA 3VLFA 4L1BA 3ZIMA 1S70B 2J4BA 2P9LG 4HNAD 3B13A 1Z6TA 1KZPA 3ZHEA 3Q9NC 2VGXB 4UQYA 5CCMA 1UOHA 1V54E 3BUAA 2XS1A 1TNUA 1IQRA 3C98A 3O48A 2QZAA 5CMYA 2EIJE 3MCXA 4LNGA 3S7DA 1L5JA 1MQSA 3K9IA 3DSTA 2GROB 4ILHB 3CSFA 1TNYA 4TXRA 5H7PA 1HXIA 4IRUA 2AJAA 1Y8MA 2XPZA 2AVPA 3EHQA 2DWZA 3UX4A 3W9GA 3NF1A 4B93B 2NXPA 3FU0A 3EIQC 5FINA 2FO7A 1KZOA 1UG3A 1NFIE 3IKOB 4EHMA 2Y3AA 4FLHA 4HBDA 3TWTA 5IY5E 3L9TA 4CT4A 4L2LA 3UKUG 2EILE 3DPDA 4A63B 4GZDA 5EIDA 2B0OE 3RU0A 3ASGA 3KSQA 2WQHA 2WXOA 3L6AA 3O4ZA 1O1RA 3Q4AB 5AARA 3DSWA 4F1PA 3E34A 4B89A 3B7UX 2XGSA 4UQZA 5ENPD 3G2VA 3QB2A 5HI7A 2J07A 5G04C 4I2ZA 1H2TC 4HFGA 1O1TA 4RG9A 1H2UA 4J8FA 4AY6A 1OWMA 3V30A 4UI9C 1MHQA 1E8WA 4JEUA 3CHSA 1SA5A 1QYMA 4G25A 5FQ8A 1LD7A 3LXUX 4LSZE 4LEUA 2FO1E 1N11A 2RFAA 3LY7A 4OYSA 3QWWA 4L23A 4B8AA 4U95D 5CEAA 3SHFA 4N2SA 1NI1A 4JHJA 2R17C 4BERA 4IYPA 3PUJA 3NBNB 4UUCA 3PNLB 3F6QA 1X81A 3TWSA 3EHRA 2VGEA 1OUVA 2X6JA 3LVQE 2EIKE 2XRYA 3DSXA 3TWVA 3ZPJA 3IV0A 5ARGA 4FULA 1XNFA 3ASOE 3UT7A 4DI3A 3UMVA 4GTOA 2FI7A 3D9JA 3P1UA 2PNNA 4HLLA 3V31A 2IF4A 1NA3A 1MX6A 3UM3A 2GRMA 4LERA 3ONKA 5J90A 4TV3A 1HF8A 2CFUA 2FBNA 3QWPA 4PH4B 4UWKA 1WY6A 3MKQB 3SZ7A 1LD8A 4Q94A 2R59A 5AQAA 2HR2A 4FLBA 2X6FA 3MGBA 4MS6A 4HRMB 2VSYA 1N4SA 2J49A 1YMPA 4HOSA 4GA1A 3DSSA 4EZLA 2C2LA 3HXDA 5HQ8A 2Y1LE 3RK6A 5FZSA 5FWQA 2VSOE 3Q5MA 4D10C 4DX7D 4N3BA 2WQ7A 2LO6A 5DIZA 3UM1A 2DYSE 3UPVA 3TG4A 5AN8A 4DI4A 3R9AB 4XI9A 3OTNA 2X6HA 3FTUA 4P29A 4KYOB 4GYYA 3NAWA 4GA2A 4AM9A 4HXIA 2R5SA 4XEIG 5FZQA 3CLJA 4BY6A 3EHMA 2XPIA 3PZ4A 4KZ0A 4O1PA 3JYSA 3PNTB 4JHKA 4XIFA 3TL5A 3FDHA 4YDYA 3J5QB 5G2NA 3SFYA 3CVVA 2HO1A 4I1OB 4K03A 5D0OD 3EHNA 3MZLB 2XRZA 2KATA 4JHRA 2E2EA 2CFZA 2IQCA 2OOEA 3I3NA 2H6IA 4G24A 4NQ0A 2X3MA 1HFAA 5HS0A 4LCTA 4JW1A 5JJ7A 3NOGD 1N4RA 3SFXA 1QQEA 5BV0A 4C9BB 4DX1A 2BUGA 4GZ6A 2ETBA 2XCBA 2FF4A 5KCMA 4GZ3A 2L9BA 4I9EA 5A23A 1ZB1A 2GRLA 4UI9K 1HG5A 1ZU2A 3BQOA 1X5BA 4G2VA 1SQMA 3PUKA 3RRUA 1H6PA 1TNBA 2OVFA 4B94A 3FU5A 4Y6WA 2ZGGA 5C2YA 4ACKA 1PAQA 4APFA 2A5EA 3LDZA 5EIBE 3LS8A 3PZ1A 3C5RA 4BX9A 3ZUVB 1ZBPA 3Q75A 3L54A 4GA0A 4BX8A 3FH8A 2LNIA 4NURA 2RFMA 2KM4A 3NB2A 3CKBA 2HE0A 3Q47B 4K5CA 1JCQA 1HO8A 2RG8A 3RIBA 5LP0A 3G2WA 2CG2A 4ANXA 4GYWA 1E8YA 1UN8A 4GAAA 5JA4D 5D0QD 2DBAA 2CHXA 1E8ZA 4YNDA 5HRYA 1PY1A 1S63A 4GCNA 4Q96A 1EDUA 5AQ9A 3NZSA 3BG0B 4ZHBA 3JQ0A 1PC2A 3PH0C 1AWCB 4ZFHA 3D9LA 3SY2A 5G05J 4FHKA 4I43A 5JHBA 3D9HA 3QKYA 4BETA 4CGVA 4G8KA 2E0IA 3UM0A 1YA0A 4CEMA 1HE8A 5LOZA 3OXLA 3Q9UC 3MKRA 3APDA 3PVLA 5BNWA 5FQ7A 1FT2A 5KJLA 2CHWA 5EKQD 2P9PG 1OCZE 2WXRA 3RRMB 4KMOA 1UJKA 3CVNA 5CECB 5D2MC 4GTPA 4W9RA 3UI2A 2IJGX 1UN9A 3DWLG 1SZAA 4ILGA 2QY7A 2VJ8A 3SD5A 4ACLA 2J09A 3MV2B 3U3WA 4CT0A 5G04J 4FADA 4JVSA 5BW8C 4PS7A 1FT1A 3EUVA 5KJKA 5EILA 4UI9J 1E8XA 4BESA 2VSXE 4Z68A 4JA7A 3D3MA 1LTXA 3CVUA 1U2VG 4EBAA 3FY4A 1E7VA 2MHKA 3PZ3A 3PREA 2DZOA 2YNQA 3ASFA 2QYJA 3ZW3A 5A7DB 3C3OA 3U64A 2XENA 4RG6A 4B8CB 4UWHA 3RO2A 3CVLA 2PQNA 2WPVA 3BU8A 2VGXA 4HLEA 3AU5A 3KAEA 2DYRE 2KCVA 3QK0A 2IOLA 3PEVB 2KCLA 2I1KA 2V4LA 1AP7A 1E90A 4M7CA 1HZ4A 1DNPA 5AJDA 3HRAA 4ATZD 5ANLA 3MA5A 4MLPA 4ANVA 1K1BA 2V0PA 4BWRA 2WXLA 4KZCA 3FTXA 3FP3A 4GPMA 4FU3A 4BSXA 4IN3B 4O60A 2Y4UA 4AY5A 2MOWA 5CRUA 5CBOA 3DEPA 4U8VD 3JCKC 5ENQD 1TN7A 2R2LA 3HVEA 5AENA 5D66A 4I17A 5FT9A 4TRQA 3LJ3A 2P9IG 4G1TA 1Z3YA 4XI0A 4YDWA 1N9AA 4B0ZA 4WWOA 2IONA 4MRUA 3OXFA 1ELRA 2WXJA 3I5PA 4HRNA 1OCCE 4LG6A 3DXMG 3CK8A 5BPPA 3HYMB 4U0ZA 3IXEA 5KNGA 3RAUA 2GRRB 3CHRA 3SO8A 3SF4A 3OAWA 3ASHA 1MYOA 3T9KA 2KZTA 1B89A 3V79K 2EINE 3HHMA 4AIFA 1N54A 4BTBA 2KCKA 2UY1B 2J4DA 3C72A 1HS6A 3ML9A 2V5FA 4N3CA 5DBKA 5FIOA 3T5VA 4U04A 3TJPA 3CVQA 2JLBA 1JCSA 4A1SA 4HQDA 4WNFA 3IBEA 3TWQA 4FA6A 5FJYA 3HIZA 2PM7A 4FC8A 1YYHA 2AXZA 3ASDA 1VDYA 1WG0A 4HOTA 3ML8A 3Q15A 1WM5A 4O6FA 2CHZA 2IO3C 3AS4A 2WXGA 2XEVA 3TXNA 2VTBB 1IKND 2DIWA 4FP7A 2QFCA 4K0RA 4AP2A 4N3AA 3QARA 1N4PA 1MX4A 4K5AB 3FUIA 2H6FA 4BFRA 2XEHA 5KJNA 3ISMC 1OCRE 2ZISA 4U96D 4WAFA 4CCAA 2L6BA 4N5CA 5EDSA 4RSYA 4N5QA 3QDNA 2BTDA 3PDNA 3UT4A 4ABNA 4I6JA 2JABA 3MKQA 3CHPA 2NYJA 5EYLA 2KXPC 3AAAC 5FTPA 2Y4TA 2B6CA 3UTMA 1WDYA 4JPSA 4OVUA 3C3RA 1SW6A 4EPZA 4JD2G 2XS8A 3DRAA 5CEDB 4WNEA 2OV8A 2DZNA 1Q2ZA 5AJLA 1Z3XA 3D9NA 3APCA 2FULA 3ZN3A 3DXKG 2NSZA 3PZDA 3TWWA 3VLDA 2H6GA 3QC1A 4ANWA 4CDRA 3VTYA 5AQ7A 2IOSA 2LSUA 4U0UA 3Q7AA 4AOFA 1QNFA 2XEEA 3ZYLA 4A1GA 3ZKJA 4XE0A 4HOUA 3SNXA 1HX8A 4YDEA 4PUCA 4C0MA 1TN8A 3LJNA 3SFZA 2GGFA 2IY0C 3GW4A 3W9FA 4BT9A 5JJ6A 3U9WA 2F37A 4CYMD 3KD7A 2IEJA 2PM6A 4GPKA 1U3CA 3GZ2A 3BEEA 4RLYA 4KVMA 4N2QA 3CR3A 4WUYA 3TAXA 1A5EA 2WXPA 2F0YA 2LAHA 5ANRA 4FJYA 2XZDG 1K1AA 2LSVA 3LY9A 1OWNA 4G26A 2MYOA 3ENEA 2ONDA 3G2TA 1U3DA 4JL0A 4TXPA 5BV1A 1K8KG 2VYIA 2BEDA 3ZNGA 2L0IA 4JEHA 3QAQA 3FEXA 5M72A 4QQIA 4J8DA 1NZNA 3JUEA 5EX3A 1FVHA 4NRHB 4X8QA 2EIME 1TN6A 3SBSA 3TG5A 3VLEA 3UKRG 1DVPA 3Q78A 5A6CA 3S7BA 4F6RD 3V2OA 5JJTA 3ZU7B 3Q73A 4G23A 2JEKA 3JQ1A 3E32A 4GZ5A 1JUQA 2LUHA 1N94A 2V8SE 4WNGA 2VSNA 1FCHA 2ZIRA 2V4HC 3D9IA 3S7FA 4G11A 3CVYA 2J8SD 4LUNU 3T8MA 4DX5D 1TNOA 4EBAG 4LNBA 4PS3A 5T4YA 5CHEE 3ZVVA 3AS5A 4JXTA 2KBXA 3FTWA 3FTYA 3CSTA 3SBTB 3R9MA 3TWXA 3AG2E 1QZ2A 5KWDA 2GRPB 1ELWA 2XQ0A 4HI9A 4G8LA 3ZGQA 4YVOA 3FTZA 3GYZA 1O1SA 2V5QC 3AS8A 3DSUA 3UM2A 1OY3D 2XGMA 3IEGA 1Z5SC 4EECA 4DPRA 3SGHA 3PS6A 2WMOA 3E37A 2PZIA 3Q49B 3EU5A 2YHEA 4JZYA 4JA9A 2P58C 3AG4E 3LY8A 3N71A 1BD8A 2VGYA 4YVQC 3ZXSA 3P2BA 3ZFWA 1K3ZD 2X38A 4I6GA 3EDTB 4ILIA 2X6IA 3ABLE 3UIOC 4HB5A 3L16A 1G3NB 3TWRA 5ENTD 4CZ2D 2IU1A 3FU6A 3JUIA 4DLOA 1E96B 3ZXPA 1Y6IA 2F8YA 2J08A 4OAUC 3HG0D 3Q79A 3UINC 2M63A 4UWFA 3ZYQA 1WAO1 4U8YD 4C0EA 4ATGA 4AJWA 3CQCB 2GRNB 2H6HA 2Q7FA 3AJIA 3QNKA 3KEZA 4MKTA 5CRVA 3PRZA 5AYWD 4CRWA 2P9SG 3UIPC 3FFLA 2RKKA 2DVWA 2ILRA 2I9CA 4GB9A 2ZXWE 3DEOA 2Y0BG 5FQ6A 1EF1C 4XZ4A 3PZ2A 3DBSA 3CVPA 4U8HA 3MEKA 2UWJG 2I1JA 2ZU6B 1H2VC 3Q7FA 1IHGA 5LCWC 3V2XA 3ULYA 4CDNA 3KS2A 3MX3A 2ETAA 4ME2A 3SQVA 2LXMA 2WVIA 4DJAA 3SI5A 3ZHEB 3DPYA 3RJVA 2A4ZA 3FHEA 4BTAA 2I2OA
chains in the Genus database with same CATH topology
2J9QA 4J8EA 4U04A 3TJPA 3LKUA 4GA2A 3CVQA 4AM9A 5E76A 4ANUA 2JLBA 3ZYKA 4A1SA 4AEZC 2AWIA 4HXIA 4UWLA 3IBEA 4WNFA 2PL2A 1S0PA 2R5SA 4FA6A 4EQFA 2X6KA 5FZQA 2DCPA 5FJYA 3CLJA 2AW6A 4BY6A 3EHMA 3HIZA 3RO3A 1SZ9A 2XPIA 4KZ0A 2PM7A 3JYSA 3PNTB 4JHKA 4XIFA 3TL5A 5CMWA 1JWGA 3CQGB 4FC8A 3FDHA 2AXZA 3IHYA 1TEZA 4F3VA 3CV0A 3ASDA 1E7UA 3L13A 3WXXA 1VDYA 3HDXA 4HOTA 5G2NA 3ML8A 5C1DA 2YQ8A 3Q15A 5ARFA 1WM5A 3FUEA 4O6FA 3CVVA 1KT1A 2CHZA 2HO1A 3UUXA 3FUHA 4JC8A 4I6EA 4I1OB 4K03A 1OWOA 3AS4A 2WXGA 5D0OD 2XEVA 3EJNA 4I2WA 3TXNA 2VTBB 3MYVA 2C0MA 2AXUA 3EHNA 4KXKB 3CEQA 4R7LA 2DIWA 3MZLB 4FP7A 2XRZA 2QFCA 2KATA 1P5QA 3PE4A 3D9PA 4K0RA 1JWFA 3CHQA 4I9CA 4L2YA 2WQ6A 4JHRA 4AP2A 2E2EA 2CFZA 2IQCA 4N3AA 3QARA 4FHJA 4CDMA 3UQ3A 3FUIA 2OOEA 5G05C 4BT8A 4EZKA 4U63A 1TJCA 4WNDA 2I6HA 3FUNA 4BFRA 1IQUA 3I3NA 3T5XA 2A5UA 3MJWA 2WXKA 3CVWA 3B7RL 4A55A 3FUJA 3U66A 2BF0X 3FWVA 2WM9A 4G24A 4NQ0A 3D9MA 2X3MA 3CHOA 5KJNA 1OWLA 3S7JA 1HFAA 4WAFA 4LCTA 4JW1A 4CCAA 2XHEA 2HM8A 5JJ7A 4N5CA 5EDSA 4RSYA 2WXFA 3QDNA 1QQEA 5BV0A 2BTDA 3PDNA 4E85A 3UT4A 4C9BB 1INZA 2BUGA 2YHCA 3QWVA 4GZ6A 3VTXA 4AV7A 2XPYA 3CGHA 4ABNA 4KT6B 5BT1A 3TGOA 4I6JA 3HVEB 2XCBA 2FF4A 3L22A 5KCMA 4Y6CA 3MKQA 4L7TA 3CHPA 4GZ3A 3RKVA 3CK7A 3MV3B 4IULA 2L9BA 4WWPA 5FTPA 4I9EA 4PS8A 5A23A 2Y4TA 4OVVA 4GZCA 4JPSA 4NACA 1H6KA 3FULA 2GRLA 3GZSA 4OVUA 4UI9K 4EPZA 1HG5A 1ZU2A 4FJZA 4TUUA 1X5BA 4A3VA 4G2VA 4WNEA 2FEZA 1SQMA 3PUKA 3G2UA 2WXHA 2OV8A 5AJLA 1ELKA 4GMLA 3RRUA 4F7AA 1Z3XA 2OVFA 3D9NA 4B94A 3APCA 3FU5A 2FULA 4Y6WA 3ZN3A 5C2YA 3VLDA 2NSZA 2WXQA 3PZDA 3LCAA 4ACKA 4ANWA 3QC1A 2L6JA 4URKA 4CDRA 2MRIA 3VTYA 2IOSA 2LSUA 3ZYMA 4V3IA 3ESLA 1PAQA 4APFA 4DK5A 3LDZA 1BPOA 3ZEFA 3LS8A 2IFUA 1EYHA 4U0UA 5T3RA 4BX9A 4AOFA 1QNFA 2XGOA 3ZYLA 4A1GA 1ZBPA 4XE0A 4HOUA 3CK9A 3L54A 4GA0A 3SNXA 4BX8A 3FH8A 4QFVA 1HX8A 4J6IA 2CG3A 2LNIA 4NURA 3URZA 1JPLA 3FTSA 4PUCA 4AVXA 2KM4A 1NP7A 3CKBA 2KZTB 2OVBA 4C0MA 3Q47B 4L1BA 3VLFA 3RIBA 1HO8A 1HU3A 2J4BA 2RG8A 3ZIMA 5LP0A 3SFZA 5KJMA 3G2WA 3B13A 1Z6TA 5AIJA 2GGFA 1NA0A 3ZHEA 2CG2A 1GW6A 3TXMA 4WWNA 4ANXA 3GW4A 4GYWA 4HORA 4BT9A 2UY1A 5JJ6A 1E8YA 1UN8A 4GAAA 3U9WA 4DLQA 1UJJA 2VGXB 3LYAA 5D0QD 3KD7A 2DBAA 2CHXA 1E8ZA 4UQYA 4YNDA 5CCMA 2PM6A 1PY1A 4GPKA 1U3CA 1IQRA 3QOUA 4J0UA 4GCNA 3GZ2A 4Q96A 3C98A 3O48A 1EDUA 3BEEA 4I1AA 4KVMA 3NZSA 5CMYA 3MCXA 4N2QA 3BG0B 3CR3A 3I4GA 5CCLA 4WUYA 1OWPA 3S7DA 1L5JA 3TAXA 2WXPA 1MQSA 3EIJA 1PC2A 3JQ0A 3PH0C 3UT8A 3E4BA 2LAHA 5ANRA 4FJYA 3D9LA 3K9IA 5G05J 2LSVA 4A3TA 4FHKA 3LY9A 4ILHB 3CSFA 1OWNA 4G26A 3ENEA 2ONDA 4UWGA 3G2TA 4I43A 5JHBA 3QKYA 4CGVA 1HXIA 1U3DA 2E0IA 4IRUA 4JL0A 1Y8MA 1YA0A 5FQ4A 2XPZA 4CEMA 1HE8A 4XKBA 2AVPA 5LOZA 3GZ1A 2VTBA 3OXLA 3FUFA 4XX5A 3MKRA 5BV1A 4APOA 2VYIA 3UX4A 3APDA 3NF1A 2L0IA 3PVLA 5BNWA 4JEHA 5FQ7A 3QAQA 1LF8A 3FEXA 5M72A 2NXPA 2XCCA 1HG2A 4J8DA 5KJLA 1NZNA 2CHWA 3EIQC 3FU0A 5EX3A 3D9OA 4M3OA 3IHVA 5EKQD 1FVHA 3QJZA 4NRHB 2FO7A 4N39A 1TJFA 5G55A 1UG3A 3FEYA 3G2SA 3SBSA 3RRMB 2WXRA 3IKOB 4KMOA 3TG5A 1UJKA 3VLEA 1KT0A 2WXMA 1DVPA 2Y3AA 3CVNA 4FLHA 3CIAA 3PEUB 5A6CA 4W9RA 4XKCA 3S7BA 4HS2A 2GW1A 5JJTA 2IJGX 3PE3A 1UN9A 1A17A 4G23A 4CT4A 2JEKA 3JQ1A 4L2LA 1SZAA 4AXHA 4ILGA 4F53A 2VQ2A 3DPDA 2QY7A 4GZ5A 3D9KA 1JUQA 4GZDA 2VJ8A 3SD5A 4ACLA 2V8SE 4J8SA 2J09A 2AXVA 4WNGA 2VSNA 3RU0A 3ASGA 3MV2B 1FCHA 3U3WA 3OXGA 4CT0A 2WQHA 2WXOA 3D9IA 3FUMA 3L6AA 3O4ZA 3Q4AB 1FVFA 4H7YA 5G04J 3S7FA 4FADA 4JVSA 3FTVA 5BW8C 4B89A 3B7UX 3FH5A 4PS7A 4G11A 2XGSA 1HH8A 2PQRA 4UQZA 4UI9J 1E8XA 2LAIA 2VSXE 5KJKA 4JA7A 3CVYA 3G2VA 4LUNU 3QB2A 3T8MA 4EBAG 3D3MA 3CVUA 4EBAA 5HI7A 2J07A 5G04C 3FY4A 1E7VA 4I2ZA 4GCOA 4F1SA 1H2TC 2MHKA 4PS3A 4HFGA 1IYGA 5T4YA 5CHEE 4RG9A 3ZVVA 5LX8A 1H2UA 3AS5A 4J8FA 4U0SA 4AY6A 4JXTA 1OWMA 3PREA 5FZRA 4UI9C 3FTWA 3FTYA 3CSTA 3SBTB 2YNQA 3ASFA 1MHQA 3ZW3A 1E8WA 5A7DB 4JEUA 3CHSA 4I1MA 1QZ2A 3U64A 4G25A 5EX0A 5FQ8A 1ELWA 2XQ0A 5ENNA 3R7RA 4RG6A 4B8CB 4HVBA 3ZGQA 4UWHA 3RO2A 3CVLA 2L0TB 2PQNA 3LXUX 4YVOA 2WPVA 4LEUA 3FTZA 3GYZA 2VGXA 4HLEA 3AU5A 3ZRHA 3AS8A 3KAEA 4KBQA 2KCVA 2XGMA 3QK0A 3B7SA 2IOLA 3PEVB 3IEGA 2KCLA 3LY7A 2I1KA 4EECA 3AU4A 3FUKA 4OYSA 2V4LA 4DPRA 3QWWA 3SGHA 3PS6A 4L23A 3FU3A 4B8AA 2WMOA 1E90A 5T8IA 1HZ4A 3L17A 1DNPA 3SHFA 4N2SA 2PZIA 3Q49B 4JHJA 5AJDA 2R17C 3L08A 2YHEA 4JZYA 4IYPA 4JA9A 2P58C 3LY8A 1UW4B 3APFA 3N71A 5ANLA 3PUJA 3MA5A 4MLPA 2VGYA 4YVQC 3ZXSA 3PNLB 3P2BA 3ZFWA 4ANVA 1OUVA 2X6JA 2X38A 4I6GA 2C0LA 2KC7A 3LVQE 3EDTB 2V0PA 4ILIA 3B7TA 3S2AA 4BWRA 4H7XA 2XRYA 2WXLA 2X6IA 4KZCA 3ZPJA 3IV0A 3FTXA 5ARGA 2RD0A 4FULA 3FP3A 1XNFA 3L16A 3UT7A 3LEWA 2WXIA 1N52A 4FU3A 3CVXA 4BSXA 4DI3A 2IU1A 4IN3B 3UMVA 3FU6A 1EPUA 2FI7A 3JUIA 4DLOA 3LPZA 3D9JA 2WB2A 1E96B 3P1UA 3I4RB 2IF4A 1NA3A 2Y4UA 1Y6IA 4E6HA 4GYOA 2J08A 2GRMA 4AY5A 4RVBA 4LERA 3ONKA 2MOWA 3R7QA 5J90A 2M63A 4TV3A 4HOQA 1HF8A 3ONLA 4EZJA 2CFUA 2FBNA 3ULQA 4UWFA 3ZYQA 3QWPA 1WAO1 3JCKC 4PH4B 4ATGA 4C0EA 4UWKA 4AJWA 3CQCB 1WY6A 3MKQB 3LVRE 3HVEA 3SZ7A 5AENA 4Q94A 1H19A 2Q7FA 2EQXA 2R59A 4I17A 3QNKA 4KVOA 4TRQA 3LJ3A 5FT9A 3KEZA 4MKTA 2HR2A 4FLBA 4G1TA 1Z3YA 4XI0A 3FH7A 4CGWA 2X6FA 3PRZA 2WXNA 5AYWD 4B0ZA 3MGBA 5E75A 4MS6A 4WWOA 4CRWA 4GU5A 2IONA 2VSYA 4Q69A 3BG1B 4MRUA 3FFLA 2ILRA 2J49A 2I9CA 3OXFA 2WMNA 4HOSA 4GB9A 4GA1A 1ELRA 2WXJA 3NQPA 3I5PA 2NC9A 3ESKA 4EZLA 5LCWJ 5FQ6A 1EF1C 2C2LA 4XZ4A 5HQ8A 3DBSA 3CVPA 1KLXA 3NZUA 3U4TA 1H0AA 3CK8A 4U8HA 5BPPA 3MEKA 3HYMB 4U0ZA 2YINA 3RK6A 3CHMA 4UQXA 2UWJG 5FZSA 5BUZA 5J08A 2I1JA 2ZU6B 5FWQA 1H2VC 2VSOE 3CHRA 3Q5MA 1IHGA 3FUDA 4D10C 5LCWC 3SF4A 3OAWA 3CKCA 1W3BA 4CDNA 4N3BA 3KS2A 4GMJA 3MX3A 3ASHA 2WQ7A 2LO6A 5DIZA 4U07A 2KZTA 4ME2A 4PDXA 4DJAA 1B89A 2WVIA 5LFAA 3SI5A 3HHMA 4LRZA 3ZHEB 4AIFA 3UPVA 3TG4A 1N54A 3RJVA 4BTBA 2KCKA 5JHAA 2HYZA 2UY1B 2J4DA 2A4ZA 4XI9A 3R9AB 4DI4A 3FHEA 1XGWA 4BTAA 3OTNA 1HS6A 2X6HA 3FTUA 2V5FA 3ML9A 4P29A 4N3CA 5DBKA 2I2OA 3T5VA 3RRNB 4KYOB 4GYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VSO E;  4IUL A;  2IOL A;  3L6A A;  2GGF A;  2ION A;  2IOS A;  5ANR A;  1PAQ A;  4GMJ A;  3FEX A;  4B8A A;  4B89 A;  1H6K A;  2HM8 A;  2KZT A;  1N52 A;  4CT4 A;  2IU1 A;  2VSX E;  3EIQ C;  4JHJ A;  4LUN U;  3JUI A;  1N54 A;  4CRW A;  4B8C B;  4JHK A;  2ZU6 B;  3D3M A;  4C9B B;  1UW4 B;  4GML A;  4CEM A;  2FUL A;  2KZT B;  3RK6 A;  2NSZ A;  1UG3 A;  2I2O A;  1H2T C;  3FEY A;  1HU3 A;  2RG8 A;  3EIJ A;  1H2U A;  1H2V C; 
#chains in the Genus database with same CATH topology
 4J8E A;  3LKU A;  5E76 A;  4AEZ C;  1S0P A;  2X6K A;  2DCP A;  2OEV A;  2AW6 A;  1DC2 A;  1JWG A;  3CQG B;  1TEZ A;  4F3V A;  1N0Q A;  3CV0 A;  5BXU A;  1E7U A;  1NL4 A;  4U7E B;  3HXE A;  3TWU A;  5C1D A;  2YQ8 A;  3FUE A;  1KT1 A;  3UUX A;  3FUH A;  3E33 A;  3EJN A;  3MYV A;  4KXK B;  4R7L A;  4OAV B;  4J7W A;  1P5Q A;  3D9P A;  2ZGD A;  4I9C A;  4L2Y A;  4J8Y A;  2WQ6 A;  4GTV A;  3EU9 A;  4CDM A;  3UQ3 A;  4EZK A;  5G05 C;  1YCS B;  1TJC A;  4WND A;  1SA4 A;  2I6H A;  3FUN A;  1IQU A;  3T5X A;  2A5U A;  3MJW A;  3CVW A;  2R05 A;  3FUJ A;  4NIK A;  2BF0 X;  3FWV A;  3D9M A;  1OWL A;  3B7B A;  4O1O A;  2QC9 A;  4E85 A;  1INZ A;  1OCO E;  3QWV A;  2XPY A;  3CGH A;  5BT1 A;  3HVE B;  4RQI A;  3L22 A;  4Y6C A;  3RKV A;  3CK7 A;  3MV3 B;  4WWP A;  2BKK B;  3GZS A;  3FUL A;  4FJZ A;  4GTS A;  5KBA A;  4LNU D;  4A3V A;  4DRX E;  2FEZ A;  2WXH A;  3L82 A;  4F7A A;  2WXQ A;  5ENR D;  2L6J A;  4URK A;  2MRI A;  4V3I A;  3ESL A;  2OCC E;  1BPO A;  3ZEF A;  5T3R A;  2XGO A;  3NOC D;  5B3S E;  3CK9 A;  1JPL A;  4AVX A;  1NP7 A;  2QYU A;  2KZT B;  2BKG A;  1HU3 A;  5B1A E;  5KJM A;  5AIJ A;  1NA0 A;  1GW6 A;  3TXM A;  1BLX B;  4WWN A;  4HOR A;  2UY1 A;  4DLQ A;  1UJJ A;  3LYA A;  3X2Q E;  3QOU A;  1N4Q A;  4J0U A;  4I1A A;  3I4G A;  5CCL A;  1OWP A;  5ITZ F;  3WG7 E;  3EIJ A;  3UT8 A;  3E4B A;  4GTT A;  5CER B;  4A3T A;  1MX2 A;  5EN5 D;  4UWG A;  1IXV A;  5FQ4 A;  4XKB A;  3GZ1 A;  2VTB A;  3FUF A;  4XX5 A;  1D8E A;  4APO A;  4TUM A;  1IHB A;  1LF8 A;  2XCC A;  1HG2 A;  3JXI A;  2IO2 C;  3D9O A;  3IHV A;  4M3O A;  3ASN E;  3QJZ A;  2P9N G;  3J5P A;  4N39 A;  1TJF A;  5G55 A;  3FEY A;  3G2S A;  1KT0 A;  2WXM A;  3CIA A;  3PEU B;  1SVX A;  4XKC A;  3HXC A;  2GW1 A;  4HS2 A;  3PE3 A;  1A17 A;  4BEP A;  4AXH A;  4F53 A;  2VQ2 A;  3D9K A;  3AG1 E;  4J8S A;  2AXV A;  5AQB A;  4DX6 D;  3OXG A;  3FUM A;  2P9U G;  1FVF A;  4H7Y A;  3FTV A;  3FH5 A;  4BSZ B;  1HH8 A;  2PQR A;  2LAI A;  5JMN D;  2Y69 E;  4GCO A;  2GRQ B;  4F1S A;  1IYG A;  5LX8 A;  4U0S A;  4GTR A;  5FZR A;  1DCQ A;  4I1M A;  5EX0 A;  3R7R A;  5ENN A;  4HVB A;  4YDO A;  3ABK E;  2L0T B;  2R02 A;  3C3Q A;  3ZRH A;  4KBQ A;  1V55 E;  4K5B A;  3B7S A;  1TNZ A;  3AU4 A;  3FUK A;  2XZT G;  3FU3 A;  5T8I A;  5BXO A;  3L17 A;  4C48 B;  3L08 A;  1UW4 B;  3APF A;  5B1B E;  2C0L A;  1RZ4 A;  2KC7 A;  3S2A A;  3B7T A;  1DCE A;  4H7X A;  2ETC A;  5KNH D;  2RD0 A;  1O5M A;  2F8X K;  1JCR A;  3LEW A;  2WXI A;  1N52 A;  3CVX A;  4HI8 A;  1EPU A;  1BU9 A;  3LPZ A;  2WB2 A;  3I4R B;  4E6H A;  1TYQ G;  4GYO A;  4RVB A;  3R7Q A;  4HOQ A;  3ONL A;  4EZJ A;  3ULQ A;  2OEW A;  3RSE G;  3LVR E;  1H19 A;  2EQX A;  4KVO A;  1MZC A;  4CGW A;  3FH7 A;  2WXN A;  1QBQ A;  5E75 A;  1TR4 A;  4GU5 A;  4Q69 A;  3BG1 B;  3KSL A;  3ABM E;  2WMN A;  3NQP A;  2NC9 A;  3ESK A;  5LCW J;  4GTM A;  1N95 A;  3NZU A;  1KLX A;  1OXJ A;  4MBG A;  3U4T A;  1H0A A;  2YIN A;  3CHM A;  4UQX A;  5BUZ A;  5J08 A;  3FUD A;  3CKC A;  1W3B A;  3JXJ A;  4GMJ A;  1BI7 B;  4U07 A;  4PDX A;  1D9S A;  3AG3 E;  5LFA A;  4LRZ A;  5ENO D;  5JHA A;  1RW2 A;  2HYZ A;  1XGW A;  1D8D A;  4GMR A;  3UXG A;  3RRN B;  2J9Q A;  4ANU A;  3ZYK A;  2AWI A;  4UWL A;  2PL2 A;  4EQF A;  1N0R A;  3ULE G;  3RO3 A;  1SZ9 A;  5CMW A;  3IHY A;  1S64 A;  3L13 A;  1FPP A;  3WXX A;  3HDX A;  5ARF A;  3DSV A;  5CBN A;  1BI8 B;  4JC8 A;  4I6E A;  1OWO A;  1KPS B;  2R03 A;  4I2W A;  2C0M A;  2AXU A;  3CEQ A;  1MJ0 A;  3PE4 A;  1JWF A;  3CHQ A;  4FHJ A;  5EYP F;  4BT8 A;  4GTQ A;  4U63 A;  2WXK A;  3B7R L;  4A55 A;  3U66 A;  2WM9 A;  1OT8 A;  3CHO A;  3E30 A;  3S7J A;  4JB8 P;  2XHE A;  2HM8 A;  2WXF A;  3HXF A;  2YHC A;  3VTX A;  4AV7 A;  4KT6 B;  3TGO A;  5AAO A;  3KEA A;  4L7T A;  5ENS D;  3B95 A;  3T8K A;  4IUL A;  4TXQ A;  2P2C P;  4PS8 A;  4OVV A;  4GZC A;  4NAC A;  3HXB A;  2P9K G;  1H6K A;  4HRL A;  4DX2 A;  4TUU A;  4L9P A;  3G2U A;  1ELK A;  4GML A;  3LCA A;  2LXL A;  4DUI A;  3ZYM A;  4DK5 A;  5HKP A;  2IFU A;  1EYH A;  1H6O A;  4QFV A;  4J6I A;  2CG3 A;  3URZ A;  3FTS A;  2OVB A;  3VLF A;  4L1B A;  3ZIM A;  1S70 B;  2J4B A;  2P9L G;  4HNA D;  3B13 A;  1Z6T A;  1KZP A;  3ZHE A;  3Q9N C;  2VGX B;  4UQY A;  5CCM A;  1UOH A;  1V54 E;  3BUA A;  2XS1 A;  1TNU A;  1IQR A;  3C98 A;  3O48 A;  2QZA A;  5CMY A;  2EIJ E;  3MCX A;  4LNG A;  3S7D A;  1L5J A;  1MQS A;  3K9I A;  3DST A;  2GRO B;  4ILH B;  3CSF A;  1TNY A;  4TXR A;  5H7P A;  1HXI A;  4IRU A;  2AJA A;  1Y8M A;  2XPZ A;  2AVP A;  3EHQ A;  2DWZ A;  3UX4 A;  3W9G A;  3NF1 A;  4B93 B;  2NXP A;  3FU0 A;  3EIQ C;  5FIN A;  2FO7 A;  1KZO A;  1UG3 A;  1NFI E;  3IKO B;  4EHM A;  2Y3A A;  4FLH A;  4HBD A;  3TWT A;  5IY5 E;  3L9T A;  4CT4 A;  4L2L A;  3UKU G;  2EIL E;  3DPD A;  4A63 B;  4GZD A;  5EID A;  2B0O E;  3RU0 A;  3ASG A;  3KSQ A;  2WQH A;  2WXO A;  3L6A A;  3O4Z A;  1O1R A;  3Q4A B;  5AAR A;  3DSW A;  4F1P A;  3E34 A;  4B89 A;  3B7U X;  2XGS A;  4UQZ A;  5ENP D;  3G2V A;  3QB2 A;  5HI7 A;  2J07 A;  5G04 C;  4I2Z A;  1H2T C;  4HFG A;  1O1T A;  4RG9 A;  1H2U A;  4J8F A;  4AY6 A;  1OWM A;  3V30 A;  4UI9 C;  1MHQ A;  1E8W A;  4JEU A;  3CHS A;  1SA5 A;  1QYM A;  4G25 A;  5FQ8 A;  1LD7 A;  3LXU X;  4LSZ E;  4LEU A;  2FO1 E;  1N11 A;  2RFA A;  3LY7 A;  4OYS A;  3QWW A;  4L23 A;  4B8A A;  4U95 D;  5CEA A;  3SHF A;  4N2S A;  1NI1 A;  4JHJ A;  2R17 C;  4BER A;  4IYP A;  3PUJ A;  3NBN B;  4UUC A;  3PNL B;  3F6Q A;  1X81 A;  3TWS A;  3EHR A;  2VGE A;  1OUV A;  2X6J A;  3LVQ E;  2EIK E;  2XRY A;  3DSX A;  3TWV A;  3ZPJ A;  3IV0 A;  5ARG A;  4FUL A;  1XNF A;  3ASO E;  3UT7 A;  4DI3 A;  3UMV A;  4GTO A;  2FI7 A;  3D9J A;  3P1U A;  2PNN A;  4HLL A;  3V31 A;  2IF4 A;  1NA3 A;  1MX6 A;  3UM3 A;  2GRM A;  4LER A;  3ONK A;  5J90 A;  4TV3 A;  1HF8 A;  2CFU A;  2FBN A;  3QWP A;  4PH4 B;  4UWK A;  1WY6 A;  3MKQ B;  3SZ7 A;  1LD8 A;  4Q94 A;  2R59 A;  5AQA A;  2HR2 A;  4FLB A;  2X6F A;  3MGB A;  4MS6 A;  4HRM B;  2VSY A;  1N4S A;  2J49 A;  1YMP A;  4HOS A;  4GA1 A;  3DSS A;  4EZL A;  2C2L A;  3HXD A;  5HQ8 A;  2Y1L E;  3RK6 A;  5FZS A;  5FWQ A;  2VSO E;  3Q5M A;  4D10 C;  4DX7 D;  4N3B A;  2WQ7 A;  2LO6 A;  5DIZ A;  3UM1 A;  2DYS E;  3UPV A;  3TG4 A;  5AN8 A;  4DI4 A;  3R9A B;  4XI9 A;  3OTN A;  2X6H A;  3FTU A;  4P29 A;  4KYO B;  4GYY A;  3NAW A;  4GA2 A;  4AM9 A;  4HXI A;  2R5S A;  4XEI G;  5FZQ A;  3CLJ A;  4BY6 A;  3EHM A;  2XPI A;  3PZ4 A;  4KZ0 A;  4O1P A;  3JYS A;  3PNT B;  4JHK A;  4XIF A;  3TL5 A;  3FDH A;  4YDY A;  3J5Q B;  5G2N A;  3SFY A;  3CVV A;  2HO1 A;  4I1O B;  4K03 A;  5D0O D;  3EHN A;  3MZL B;  2XRZ A;  2KAT A;  4JHR A;  2E2E A;  2CFZ A;  2IQC A;  2OOE A;  3I3N A;  2H6I A;  4G24 A;  4NQ0 A;  2X3M A;  1HFA A;  5HS0 A;  4LCT A;  4JW1 A;  5JJ7 A;  3NOG D;  1N4R A;  3SFX A;  1QQE A;  5BV0 A;  4C9B B;  4DX1 A;  2BUG A;  4GZ6 A;  2ETB A;  2XCB A;  2FF4 A;  5KCM A;  4GZ3 A;  2L9B A;  4I9E A;  5A23 A;  1ZB1 A;  2GRL A;  4UI9 K;  1HG5 A;  1ZU2 A;  3BQO A;  1X5B A;  4G2V A;  1SQM A;  3PUK A;  3RRU A;  1H6P A;  1TNB A;  2OVF A;  4B94 A;  3FU5 A;  4Y6W A;  2ZGG A;  5C2Y A;  4ACK A;  1PAQ A;  4APF A;  2A5E A;  3LDZ A;  5EIB E;  3LS8 A;  3PZ1 A;  3C5R A;  4BX9 A;  3ZUV B;  1ZBP A;  3Q75 A;  3L54 A;  4GA0 A;  4BX8 A;  3FH8 A;  2LNI A;  4NUR A;  2RFM A;  2KM4 A;  3NB2 A;  3CKB A;  2HE0 A;  3Q47 B;  4K5C A;  1JCQ A;  1HO8 A;  2RG8 A;  3RIB A;  5LP0 A;  3G2W A;  2CG2 A;  4ANX A;  4GYW A;  1E8Y A;  1UN8 A;  4GAA A;  5JA4 D;  5D0Q D;  2DBA A;  2CHX A;  1E8Z A;  4YND A;  5HRY A;  1PY1 A;  1S63 A;  4GCN A;  4Q96 A;  1EDU A;  5AQ9 A;  3NZS A;  3BG0 B;  4ZHB A;  3JQ0 A;  1PC2 A;  3PH0 C;  1AWC B;  4ZFH A;  3D9L A;  3SY2 A;  5G05 J;  4FHK A;  4I43 A;  5JHB A;  3D9H A;  3QKY A;  4BET A;  4CGV A;  4G8K A;  2E0I A;  3UM0 A;  1YA0 A;  4CEM A;  1HE8 A;  5LOZ A;  3OXL A;  3Q9U C;  3MKR A;  3APD A;  3PVL A;  5BNW A;  5FQ7 A;  1FT2 A;  5KJL A;  2CHW A;  5EKQ D;  2P9P G;  1OCZ E;  2WXR A;  3RRM B;  4KMO A;  1UJK A;  3CVN A;  5CEC B;  5D2M C;  4GTP A;  4W9R A;  3UI2 A;  2IJG X;  1UN9 A;  3DWL G;  1SZA A;  4ILG A;  2QY7 A;  2VJ8 A;  3SD5 A;  4ACL A;  2J09 A;  3MV2 B;  3U3W A;  4CT0 A;  5G04 J;  4FAD A;  4JVS A;  5BW8 C;  4PS7 A;  1FT1 A;  3EUV A;  5KJK A;  5EIL A;  4UI9 J;  1E8X A;  4BES A;  2VSX E;  4Z68 A;  4JA7 A;  3D3M A;  1LTX A;  3CVU A;  1U2V G;  4EBA A;  3FY4 A;  1E7V A;  2MHK A;  3PZ3 A;  3PRE A;  2DZO A;  2YNQ A;  3ASF A;  2QYJ A;  3ZW3 A;  5A7D B;  3C3O A;  3U64 A;  2XEN A;  4RG6 A;  4B8C B;  4UWH A;  3RO2 A;  3CVL A;  2PQN A;  2WPV A;  3BU8 A;  2VGX A;  4HLE A;  3AU5 A;  3KAE A;  2DYR E;  2KCV A;  3QK0 A;  2IOL A;  3PEV B;  2KCL A;  2I1K A;  2V4L A;  1AP7 A;  1E90 A;  4M7C A;  1HZ4 A;  1DNP A;  5AJD A;  3HRA A;  4ATZ D;  5ANL A;  3MA5 A;  4MLP A;  4ANV A;  1K1B A;  2V0P A;  4BWR A;  2WXL A;  4KZC A;  3FTX A;  3FP3 A;  4GPM A;  4FU3 A;  4BSX A;  4IN3 B;  4O60 A;  2Y4U A;  4AY5 A;  2MOW A;  5CRU A;  5CBO A;  3DEP A;  4U8V D;  3JCK C;  5ENQ D;  1TN7 A;  2R2L A;  3HVE A;  5AEN A;  5D66 A;  4I17 A;  5FT9 A;  4TRQ A;  3LJ3 A;  2P9I G;  4G1T A;  1Z3Y A;  4XI0 A;  4YDW A;  1N9A A;  4B0Z A;  4WWO A;  2ION A;  4MRU A;  3OXF A;  1ELR A;  2WXJ A;  3I5P A;  4HRN A;  1OCC E;  4LG6 A;  3DXM G;  3CK8 A;  5BPP A;  3HYM B;  4U0Z A;  3IXE A;  5KNG A;  3RAU A;  2GRR B;  3CHR A;  3SO8 A;  3SF4 A;  3OAW A;  3ASH A;  1MYO A;  3T9K A;  2KZT A;  1B89 A;  3V79 K;  2EIN E;  3HHM A;  4AIF A;  1N54 A;  4BTB A;  2KCK A;  2UY1 B;  2J4D A;  3C72 A;  1HS6 A;  3ML9 A;  2V5F A;  4N3C A;  5DBK A;  5FIO A;  3T5V A;  4U04 A;  3TJP A;  3CVQ A;  2JLB A;  1JCS A;  4A1S A;  4HQD A;  4WNF A;  3IBE A;  3TWQ A;  4FA6 A;  5FJY A;  3HIZ A;  2PM7 A;  4FC8 A;  1YYH A;  2AXZ A;  3ASD A;  1VDY A;  1WG0 A;  4HOT A;  3ML8 A;  3Q15 A;  1WM5 A;  4O6F A;  2CHZ A;  2IO3 C;  3AS4 A;  2WXG A;  2XEV A;  3TXN A;  2VTB B;  1IKN D;  2DIW A;  4FP7 A;  2QFC A;  4K0R A;  4AP2 A;  4N3A A;  3QAR A;  1N4P A;  1MX4 A;  4K5A B;  3FUI A;  2H6F A;  4BFR A;  2XEH A;  5KJN A;  3ISM C;  1OCR E;  2ZIS A;  4U96 D;  4WAF A;  4CCA A;  2L6B A;  4N5C A;  5EDS A;  4RSY A;  4N5Q A;  3QDN A;  2BTD A;  3PDN A;  3UT4 A;  4ABN A;  4I6J A;  2JAB A;  3MKQ A;  3CHP A;  2NYJ A;  5EYL A;  2KXP C;  3AAA C;  5FTP A;  2Y4T A;  2B6C A;  3UTM A;  1WDY A;  4JPS A;  4OVU A;  3C3R A;  1SW6 A;  4EPZ A;  4JD2 G;  2XS8 A;  3DRA A;  5CED B;  4WNE A;  2OV8 A;  2DZN A;  1Q2Z A;  5AJL A;  1Z3X A;  3D9N A;  3APC A;  2FUL A;  3ZN3 A;  3DXK G;  2NSZ A;  3PZD A;  3TWW A;  3VLD A;  2H6G A;  3QC1 A;  4ANW A;  4CDR A;  3VTY A;  5AQ7 A;  2IOS A;  2LSU A;  4U0U A;  3Q7A A;  4AOF A;  1QNF A;  2XEE A;  3ZYL A;  4A1G A;  3ZKJ A;  4XE0 A;  4HOU A;  3SNX A;  1HX8 A;  4YDE A;  4PUC A;  4C0M A;  1TN8 A;  3LJN A;  3SFZ A;  2GGF A;  2IY0 C;  3GW4 A;  3W9F A;  4BT9 A;  5JJ6 A;  3U9W A;  2F37 A;  4CYM D;  3KD7 A;  2IEJ A;  2PM6 A;  4GPK A;  1U3C A;  3GZ2 A;  3BEE A;  4RLY A;  4KVM A;  4N2Q A;  3CR3 A;  4WUY A;  3TAX A;  1A5E A;  2WXP A;  2F0Y A;  2LAH A;  5ANR A;  4FJY A;  2XZD G;  1K1A A;  2LSV A;  3LY9 A;  1OWN A;  4G26 A;  2MYO A;  3ENE A;  2OND A;  3G2T A;  1U3D A;  4JL0 A;  4TXP A;  5BV1 A;  1K8K G;  2VYI A;  2BED A;  3ZNG A;  2L0I A;  4JEH A;  3QAQ A;  3FEX A;  5M72 A;  4QQI A;  4J8D A;  1NZN A;  3JUE A;  5EX3 A;  1FVH A;  4NRH B;  4X8Q A;  2EIM E;  1TN6 A;  3SBS A;  3TG5 A;  3VLE A;  3UKR G;  1DVP A;  3Q78 A;  5A6C A;  3S7B A;  4F6R D;  3V2O A;  5JJT A;  3ZU7 B;  3Q73 A;  4G23 A;  2JEK A;  3JQ1 A;  3E32 A;  4GZ5 A;  1JUQ A;  2LUH A;  1N94 A;  2V8S E;  4WNG A;  2VSN A;  1FCH A;  2ZIR A;  2V4H C;  3D9I A;  3S7F A;  4G11 A;  3CVY A;  2J8S D;  4LUN U;  3T8M A;  4DX5 D;  1TNO A;  4EBA G;  4LNB A;  4PS3 A;  5T4Y A;  5CHE E;  3ZVV A;  3AS5 A;  4JXT A;  2KBX A;  3FTW A;  3FTY A;  3CST A;  3SBT B;  3R9M A;  3TWX A;  3AG2 E;  1QZ2 A;  5KWD A;  2GRP B;  1ELW A;  2XQ0 A;  4HI9 A;  4G8L A;  3ZGQ A;  4YVO A;  3FTZ A;  3GYZ A;  1O1S A;  2V5Q C;  3AS8 A;  3DSU A;  3UM2 A;  1OY3 D;  2XGM A;  3IEG A;  1Z5S C;  4EEC A;  4DPR A;  3SGH A;  3PS6 A;  2WMO A;  3E37 A;  2PZI A;  3Q49 B;  3EU5 A;  2YHE A;  4JZY A;  4JA9 A;  2P58 C;  3AG4 E;  3LY8 A;  3N71 A;  1BD8 A;  2VGY A;  4YVQ C;  3ZXS A;  3P2B A;  3ZFW A;  1K3Z D;  2X38 A;  4I6G A;  3EDT B;  4ILI A;  2X6I A;  3ABL E;  3UIO C;  4HB5 A;  3L16 A;  1G3N B;  3TWR A;  5ENT D;  4CZ2 D;  2IU1 A;  3FU6 A;  3JUI A;  4DLO A;  1E96 B;  3ZXP A;  1Y6I A;  2F8Y A;  2J08 A;  4OAU C;  3HG0 D;  3Q79 A;  3UIN C;  2M63 A;  4UWF A;  3ZYQ A;  1WAO 1;  4U8Y D;  4C0E A;  4ATG A;  4AJW A;  3CQC B;  2GRN B;  2H6H A;  2Q7F A;  3AJI A;  3QNK A;  3KEZ A;  4MKT A;  5CRV A;  3PRZ A;  5AYW D;  4CRW A;  2P9S G;  3UIP C;  3FFL A;  2RKK A;  2DVW A;  2ILR A;  2I9C A;  4GB9 A;  2ZXW E;  3DEO A;  2Y0B G;  5FQ6 A;  1EF1 C;  4XZ4 A;  3PZ2 A;  3DBS A;  3CVP A;  4U8H A;  3MEK A;  2UWJ G;  2I1J A;  2ZU6 B;  1H2V C;  3Q7F A;  1IHG A;  5LCW C;  3V2X A;  3ULY A;  4CDN A;  3KS2 A;  3MX3 A;  2ETA A;  4ME2 A;  3SQV A;  2LXM A;  2WVI A;  4DJA A;  3SI5 A;  3ZHE B;  3DPY A;  3RJV A;  2A4Z A;  3FHE A;  4BTA A;  2I2O A; 
#chains in the Genus database with same CATH homology
 2J9Q A;  4J8E A;  4U04 A;  3TJP A;  3LKU A;  4GA2 A;  3CVQ A;  4AM9 A;  5E76 A;  4ANU A;  2JLB A;  3ZYK A;  4A1S A;  4AEZ C;  2AWI A;  4HXI A;  4UWL A;  3IBE A;  4WNF A;  2PL2 A;  1S0P A;  2R5S A;  4FA6 A;  4EQF A;  2X6K A;  5FZQ A;  2DCP A;  5FJY A;  3CLJ A;  2AW6 A;  4BY6 A;  3EHM A;  3HIZ A;  3RO3 A;  1SZ9 A;  2XPI A;  4KZ0 A;  2PM7 A;  3JYS A;  3PNT B;  4JHK A;  4XIF A;  3TL5 A;  5CMW A;  1JWG A;  3CQG B;  4FC8 A;  3FDH A;  2AXZ A;  3IHY A;  1TEZ A;  4F3V A;  3CV0 A;  3ASD A;  1E7U A;  3L13 A;  3WXX A;  1VDY A;  3HDX A;  4HOT A;  5G2N A;  3ML8 A;  5C1D A;  2YQ8 A;  3Q15 A;  5ARF A;  1WM5 A;  3FUE A;  4O6F A;  3CVV A;  1KT1 A;  2CHZ A;  2HO1 A;  3UUX A;  3FUH A;  4JC8 A;  4I6E A;  4I1O B;  4K03 A;  1OWO A;  3AS4 A;  2WXG A;  5D0O D;  2XEV A;  3EJN A;  4I2W A;  3TXN A;  2VTB B;  3MYV A;  2C0M A;  2AXU A;  3EHN A;  4KXK B;  3CEQ A;  4R7L A;  2DIW A;  3MZL B;  4FP7 A;  2XRZ A;  2QFC A;  2KAT A;  1P5Q A;  3PE4 A;  3D9P A;  4K0R A;  1JWF A;  3CHQ A;  4I9C A;  4L2Y A;  2WQ6 A;  4JHR A;  4AP2 A;  2E2E A;  2CFZ A;  2IQC A;  4N3A A;  3QAR A;  4FHJ A;  4CDM A;  3UQ3 A;  3FUI A;  2OOE A;  5G05 C;  4BT8 A;  4EZK A;  4U63 A;  1TJC A;  4WND A;  2I6H A;  3FUN A;  4BFR A;  1IQU A;  3I3N A;  3T5X A;  2A5U A;  3MJW A;  2WXK A;  3CVW A;  3B7R L;  4A55 A;  3FUJ A;  3U66 A;  2BF0 X;  3FWV A;  2WM9 A;  4G24 A;  4NQ0 A;  3D9M A;  2X3M A;  3CHO A;  5KJN A;  1OWL A;  3S7J A;  1HFA A;  4WAF A;  4LCT A;  4JW1 A;  4CCA A;  2XHE A;  2HM8 A;  5JJ7 A;  4N5C A;  5EDS A;  4RSY A;  2WXF A;  3QDN A;  1QQE A;  5BV0 A;  2BTD A;  3PDN A;  4E85 A;  3UT4 A;  4C9B B;  1INZ A;  2BUG A;  2YHC A;  3QWV A;  4GZ6 A;  3VTX A;  4AV7 A;  2XPY A;  3CGH A;  4ABN A;  4KT6 B;  5BT1 A;  3TGO A;  4I6J A;  3HVE B;  2XCB A;  2FF4 A;  3L22 A;  5KCM A;  4Y6C A;  3MKQ A;  4L7T A;  3CHP A;  4GZ3 A;  3RKV A;  3CK7 A;  3MV3 B;  4IUL A;  2L9B A;  4WWP A;  5FTP A;  4I9E A;  4PS8 A;  5A23 A;  2Y4T A;  4OVV A;  4GZC A;  4JPS A;  4NAC A;  1H6K A;  3FUL A;  2GRL A;  3GZS A;  4OVU A;  4UI9 K;  4EPZ A;  1HG5 A;  1ZU2 A;  4FJZ A;  4TUU A;  1X5B A;  4A3V A;  4G2V A;  4WNE A;  2FEZ A;  1SQM A;  3PUK A;  3G2U A;  2WXH A;  2OV8 A;  5AJL A;  1ELK A;  4GML A;  3RRU A;  4F7A A;  1Z3X A;  2OVF A;  3D9N A;  4B94 A;  3APC A;  3FU5 A;  2FUL A;  4Y6W A;  3ZN3 A;  5C2Y A;  3VLD A;  2NSZ A;  2WXQ A;  3PZD A;  3LCA A;  4ACK A;  4ANW A;  3QC1 A;  2L6J A;  4URK A;  4CDR A;  2MRI A;  3VTY A;  2IOS A;  2LSU A;  3ZYM A;  4V3I A;  3ESL A;  1PAQ A;  4APF A;  4DK5 A;  3LDZ A;  1BPO A;  3ZEF A;  3LS8 A;  2IFU A;  1EYH A;  4U0U A;  5T3R A;  4BX9 A;  4AOF A;  1QNF A;  2XGO A;  3ZYL A;  4A1G A;  1ZBP A;  4XE0 A;  4HOU A;  3CK9 A;  3L54 A;  4GA0 A;  3SNX A;  4BX8 A;  3FH8 A;  4QFV A;  1HX8 A;  4J6I A;  2CG3 A;  2LNI A;  4NUR A;  3URZ A;  1JPL A;  3FTS A;  4PUC A;  4AVX A;  2KM4 A;  1NP7 A;  3CKB A;  2KZT B;  2OVB A;  4C0M A;  3Q47 B;  4L1B A;  3VLF A;  3RIB A;  1HO8 A;  1HU3 A;  2J4B A;  2RG8 A;  3ZIM A;  5LP0 A;  3SFZ A;  5KJM A;  3G2W A;  3B13 A;  1Z6T A;  5AIJ A;  2GGF A;  1NA0 A;  3ZHE A;  2CG2 A;  1GW6 A;  3TXM A;  4WWN A;  4ANX A;  3GW4 A;  4GYW A;  4HOR A;  4BT9 A;  2UY1 A;  5JJ6 A;  1E8Y A;  1UN8 A;  4GAA A;  3U9W A;  4DLQ A;  1UJJ A;  2VGX B;  3LYA A;  5D0Q D;  3KD7 A;  2DBA A;  2CHX A;  1E8Z A;  4UQY A;  4YND A;  5CCM A;  2PM6 A;  1PY1 A;  4GPK A;  1U3C A;  1IQR A;  3QOU A;  4J0U A;  4GCN A;  3GZ2 A;  4Q96 A;  3C98 A;  3O48 A;  1EDU A;  3BEE A;  4I1A A;  4KVM A;  3NZS A;  5CMY A;  3MCX A;  4N2Q A;  3BG0 B;  3CR3 A;  3I4G A;  5CCL A;  4WUY A;  1OWP A;  3S7D A;  1L5J A;  3TAX A;  2WXP A;  1MQS A;  3EIJ A;  1PC2 A;  3JQ0 A;  3PH0 C;  3UT8 A;  3E4B A;  2LAH A;  5ANR A;  4FJY A;  3D9L A;  3K9I A;  5G05 J;  2LSV A;  4A3T A;  4FHK A;  3LY9 A;  4ILH B;  3CSF A;  1OWN A;  4G26 A;  3ENE A;  2OND A;  4UWG A;  3G2T A;  4I43 A;  5JHB A;  3QKY A;  4CGV A;  1HXI A;  1U3D A;  2E0I A;  4IRU A;  4JL0 A;  1Y8M A;  1YA0 A;  5FQ4 A;  2XPZ A;  4CEM A;  1HE8 A;  4XKB A;  2AVP A;  5LOZ A;  3GZ1 A;  2VTB A;  3OXL A;  3FUF A;  4XX5 A;  3MKR A;  5BV1 A;  4APO A;  2VYI A;  3UX4 A;  3APD A;  3NF1 A;  2L0I A;  3PVL A;  5BNW A;  4JEH A;  5FQ7 A;  3QAQ A;  1LF8 A;  3FEX A;  5M72 A;  2NXP A;  2XCC A;  1HG2 A;  4J8D A;  5KJL A;  1NZN A;  2CHW A;  3EIQ C;  3FU0 A;  5EX3 A;  3D9O A;  4M3O A;  3IHV A;  5EKQ D;  1FVH A;  3QJZ A;  4NRH B;  2FO7 A;  4N39 A;  1TJF A;  5G55 A;  1UG3 A;  3FEY A;  3G2S A;  3SBS A;  3RRM B;  2WXR A;  3IKO B;  4KMO A;  3TG5 A;  1UJK A;  3VLE A;  1KT0 A;  2WXM A;  1DVP A;  2Y3A A;  3CVN A;  4FLH A;  3CIA A;  3PEU B;  5A6C A;  4W9R A;  4XKC A;  3S7B A;  4HS2 A;  2GW1 A;  5JJT A;  2IJG X;  3PE3 A;  1UN9 A;  1A17 A;  4G23 A;  4CT4 A;  2JEK A;  3JQ1 A;  4L2L A;  1SZA A;  4AXH A;  4ILG A;  4F53 A;  2VQ2 A;  3DPD A;  2QY7 A;  4GZ5 A;  3D9K A;  1JUQ A;  4GZD A;  2VJ8 A;  3SD5 A;  4ACL A;  2V8S E;  4J8S A;  2J09 A;  2AXV A;  4WNG A;  2VSN A;  3RU0 A;  3ASG A;  3MV2 B;  1FCH A;  3U3W A;  3OXG A;  4CT0 A;  2WQH A;  2WXO A;  3D9I A;  3FUM A;  3L6A A;  3O4Z A;  3Q4A B;  1FVF A;  4H7Y A;  5G04 J;  3S7F A;  4FAD A;  4JVS A;  3FTV A;  5BW8 C;  4B89 A;  3B7U X;  3FH5 A;  4PS7 A;  4G11 A;  2XGS A;  1HH8 A;  2PQR A;  4UQZ A;  4UI9 J;  1E8X A;  2LAI A;  2VSX E;  5KJK A;  4JA7 A;  3CVY A;  3G2V A;  4LUN U;  3QB2 A;  3T8M A;  4EBA G;  3D3M A;  3CVU A;  4EBA A;  5HI7 A;  2J07 A;  5G04 C;  3FY4 A;  1E7V A;  4I2Z A;  4GCO A;  4F1S A;  1H2T C;  2MHK A;  4PS3 A;  4HFG A;  1IYG A;  5T4Y A;  5CHE E;  4RG9 A;  3ZVV A;  5LX8 A;  1H2U A;  3AS5 A;  4J8F A;  4U0S A;  4AY6 A;  4JXT A;  1OWM A;  3PRE A;  5FZR A;  4UI9 C;  3FTW A;  3FTY A;  3CST A;  3SBT B;  2YNQ A;  3ASF A;  1MHQ A;  3ZW3 A;  1E8W A;  5A7D B;  4JEU A;  3CHS A;  4I1M A;  1QZ2 A;  3U64 A;  4G25 A;  5EX0 A;  5FQ8 A;  1ELW A;  2XQ0 A;  5ENN A;  3R7R A;  4RG6 A;  4B8C B;  4HVB A;  3ZGQ A;  4UWH A;  3RO2 A;  3CVL A;  2L0T B;  2PQN A;  3LXU X;  4YVO A;  2WPV A;  4LEU A;  3FTZ A;  3GYZ A;  2VGX A;  4HLE A;  3AU5 A;  3ZRH A;  3AS8 A;  3KAE A;  4KBQ A;  2KCV A;  2XGM A;  3QK0 A;  3B7S A;  2IOL A;  3PEV B;  3IEG A;  2KCL A;  3LY7 A;  2I1K A;  4EEC A;  3AU4 A;  3FUK A;  4OYS A;  2V4L A;  4DPR A;  3QWW A;  3SGH A;  3PS6 A;  4L23 A;  3FU3 A;  4B8A A;  2WMO A;  1E90 A;  5T8I A;  1HZ4 A;  3L17 A;  1DNP A;  3SHF A;  4N2S A;  2PZI A;  3Q49 B;  4JHJ A;  5AJD A;  2R17 C;  3L08 A;  2YHE A;  4JZY A;  4IYP A;  4JA9 A;  2P58 C;  3LY8 A;  1UW4 B;  3APF A;  3N71 A;  5ANL A;  3PUJ A;  3MA5 A;  4MLP A;  2VGY A;  4YVQ C;  3ZXS A;  3PNL B;  3P2B A;  3ZFW A;  4ANV A;  1OUV A;  2X6J A;  2X38 A;  4I6G A;  2C0L A;  2KC7 A;  3LVQ E;  3EDT B;  2V0P A;  4ILI A;  3B7T A;  3S2A A;  4BWR A;  4H7X A;  2XRY A;  2WXL A;  2X6I A;  4KZC A;  3ZPJ A;  3IV0 A;  3FTX A;  5ARG A;  2RD0 A;  4FUL A;  3FP3 A;  1XNF A;  3L16 A;  3UT7 A;  3LEW A;  2WXI A;  1N52 A;  4FU3 A;  3CVX A;  4BSX A;  4DI3 A;  2IU1 A;  4IN3 B;  3UMV A;  3FU6 A;  1EPU A;  2FI7 A;  3JUI A;  4DLO A;  3LPZ A;  3D9J A;  2WB2 A;  1E96 B;  3P1U A;  3I4R B;  2IF4 A;  1NA3 A;  2Y4U A;  1Y6I A;  4E6H A;  4GYO A;  2J08 A;  2GRM A;  4AY5 A;  4RVB A;  4LER A;  3ONK A;  2MOW A;  3R7Q A;  5J90 A;  2M63 A;  4TV3 A;  4HOQ A;  1HF8 A;  3ONL A;  4EZJ A;  2CFU A;  2FBN A;  3ULQ A;  4UWF A;  3ZYQ A;  3QWP A;  1WAO 1;  3JCK C;  4PH4 B;  4ATG A;  4C0E A;  4UWK A;  4AJW A;  3CQC B;  1WY6 A;  3MKQ B;  3LVR E;  3HVE A;  3SZ7 A;  5AEN A;  4Q94 A;  1H19 A;  2Q7F A;  2EQX A;  2R59 A;  4I17 A;  3QNK A;  4KVO A;  4TRQ A;  3LJ3 A;  5FT9 A;  3KEZ A;  4MKT A;  2HR2 A;  4FLB A;  4G1T A;  1Z3Y A;  4XI0 A;  3FH7 A;  4CGW A;  2X6F A;  3PRZ A;  2WXN A;  5AYW D;  4B0Z A;  3MGB A;  5E75 A;  4MS6 A;  4WWO A;  4CRW A;  4GU5 A;  2ION A;  2VSY A;  4Q69 A;  3BG1 B;  4MRU A;  3FFL A;  2ILR A;  2J49 A;  2I9C A;  3OXF A;  2WMN A;  4HOS A;  4GB9 A;  4GA1 A;  1ELR A;  2WXJ A;  3NQP A;  3I5P A;  2NC9 A;  3ESK A;  4EZL A;  5LCW J;  5FQ6 A;  1EF1 C;  2C2L A;  4XZ4 A;  5HQ8 A;  3DBS A;  3CVP A;  1KLX A;  3NZU A;  3U4T A;  1H0A A;  3CK8 A;  4U8H A;  5BPP A;  3MEK A;  3HYM B;  4U0Z A;  2YIN A;  3RK6 A;  3CHM A;  4UQX A;  2UWJ G;  5FZS A;  5BUZ A;  5J08 A;  2I1J A;  2ZU6 B;  5FWQ A;  1H2V C;  2VSO E;  3CHR A;  3Q5M A;  1IHG A;  3FUD A;  4D10 C;  5LCW C;  3SF4 A;  3OAW A;  3CKC A;  1W3B A;  4CDN A;  4N3B A;  3KS2 A;  4GMJ A;  3MX3 A;  3ASH A;  2WQ7 A;  2LO6 A;  5DIZ A;  4U07 A;  2KZT A;  4ME2 A;  4PDX A;  4DJA A;  1B89 A;  2WVI A;  5LFA A;  3SI5 A;  3HHM A;  4LRZ A;  3ZHE B;  4AIF A;  3UPV A;  3TG4 A;  1N54 A;  3RJV A;  4BTB A;  2KCK A;  5JHA A;  2HYZ A;  2UY1 B;  2J4D A;  2A4Z A;  4XI9 A;  3R9A B;  4DI4 A;  3FHE A;  1XGW A;  4BTA A;  3OTN A;  1HS6 A;  2X6H A;  3FTU A;  2V5F A;  3ML9 A;  4P29 A;  4N3C A;  5DBK A;  2I2O A;  3T5V A;  3RRN B;  4KYO B;  4GYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...