1UW4B

The structural basis of the interaction between nonsense mediated decay factors upf2 and upf3
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
248
structure length
248
Chain Sequence
RPPLQEYVRKLLYKDLSKVTTEKVLRQMRKLPWQDQEVKDYVICCMINIWNVKYNSIHCVANLLAGLVLYQEDVGIHVVDGVLEDIRLGMEVNQPKFNQRRISSAKFLGELYNYRMVESAVIFRTLYSFTSFGVNPDGSPSSLDPPEHLFRIRLVCTILDTCGQYFDRGSSKRKLDCFLVYFQRYVWWKKSLEVWTKDHPFPIDIDYMISDTLELLRPKIKLCNSLEESIRQVQDLEREFLIKLGLVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structural Basis for the Interaction between Nonsense-Mediated Mrna Decay Factors Upf2 and Upf3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords UPF3X
total genus 95
structure length 248
sequence length 248
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02854 MIF4G MIF4G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1uw4B00
3FEYA 1PAQA 4CRWA 1N54A 5ANRA 2HM8A 4CEMA 2IOSA 3RK6A 4CT4A 1H2VC 3FEXA 2ZU6B 4B8CB 2VSXE 2IOLA 2KZTA 3JUIA 4C9BB 3D3MA 2IU1A 1HU3A 2KZTB 4GMJA 1UG3A 2VSOE 2FULA 2I2OA 1H6KA 4GMLA 3EIQC 2RG8A 2GGFA 2IONA 2NSZA 4B89A 1N52A 4JHJA 4JHKA 4IULA 3L6AA 3EIJA 1UW4B 4LUNU 4B8AA 1H2UA 1H2TC
chains in the Genus database with same CATH superfamily
4ILGA 4U8HA 3Q15A 4FP7A 1QBQA 4CGVA 1KPSB 3TWSA 4TXQA 3DXMG 2NYJA 5AN8A 1H6KA 3SBSA 2B6CA 1NL4A 4KZCA 1B89A 4FULA 3C5RA 1GW6A 4FU3A 4DX7D 2H6GA 2VTBA 5ENOD 5G05C 4AP2A 2QFCA 1MZCA 4FLHA 3ZUVB 3AAAC 4H7XA 4O1PA 4Z68A 4N3AA 4AEZC 1NZNA 4EHMA 2QYJA 4U8YD 2IOSA 2DBAA 3ZFWA 3SFZA 3D9NA 5G2NA 1SZAA 3D9JA 2DZOA 3TWTA 5JJTA 3ASOE 3RRNB 3ASDA 4ATGA 2NXPA 4EBAG 2VQ2A 2KATA 2WXMA 4GTVA 4BY6A 3HG0D 2E0IA 4DLOA 3CVUA 3OXLA 3C3OA 4GA2A 1EPUA 1FPPA 4AY5A 4RLYA 4KXKB 4U0UA 3FTSA 2V0PA 4RVBA 4Y6CA 2X3MA 3CVWA 2RD0A 1N4PA 2BUGA 3HXBA 3B13A 1A5EA 4PDXA 2GROB 4EECA 2RKKA 5LCWC 5CBOA 2CG2A 3G2UA 3ZU7B 4HFGA 2V4HC 4IN3B 4F3VA 5BUZA 3EIQC 4TXRA 1SA5A 4U0SA 3G2SA 2R5SA 4BWRA 2HM8A 4F53A 1OWOA 3TG4A 1KZOA 2ETCA 1JCSA 2DIWA 3VLFA 4KT6B 5A7DB 5EYPF 4L7TA 4A63B 4ME2A 3F6QA 2PL2A 5AAOA 4JZYA 4CT0A 5G05J 2FEZA 1OXJA 4EBAA 2L0IA 3D9LA 3V2XA 1KT0A 4L2YA 4UQYA 4I1MA 5BV1A 4HS2A 4XKBA 3FUHA 3URZA 4K5CA 3FUIA 1ELKA 3ASFA 4DX6D 2R59A 1Q2ZA 3HIZA 1H6OA 5EN5D 1FCHA 4BTBA 3LS8A 5CEAA 3KSQA 4LNBA 4K03A 1UJKA 4LCTA 1AWCB 3SI5A 1G3NB 4FHJA 4WAFA 4JC8A 3ZVVA 3AS4A 1LTXA 4U63A 5CERB 2Y1LE 4M3OA 5AJDA 1N95A 2XHEA 4C9BB 3FWVA 2P9KG 1DC2A 4JHJA 1NI1A 3EHRA 4XZ4A 4LEUA 4BT9A 3DPDA 4HI9A 1FVFA 5C2YA 2UWJG 1HO8A 4HRMB 3CQCB 3AS8A 4A3VA 4Q96A 3Q4AB 4ATZD 4FJZA 4A1SA 4GAAA 3RSEG 4G25A 3CK9A 1WG0A 2AXZA 1FVHA 4ZHBA 1NA0A 3HXEA 2YQ8A 3JQ1A 1X81A 1QQEA 2AJAA 3RAUA 1EF1C 2I1JA 2FI7A 4HI8A 4GB9A 3W9GA 1N4RA 3TWQA 1OCRE 3AJIA 3PZ1A 4CYMD 4HOQA 3IHYA 5ENSD 2WQHA 2DWZA 3N71A 1FT1A 4N5QA 4AVXA 3RK6A 3AG1E 1D8EA 5BPPA 4HQDA 4YVQC 3OTNA 3QOUA 2P9SG 1WDYA 4N39A 3ZYKA 1NP7A 3B7UX 3ZXPA 1TYQG 3L9TA 1SZ9A 4TV3A 1LD7A 3D9PA 1OCCE 3S7FA 3SY2A 2H6FA 2LXMA 5FZQA 2EQXA 1IQRA 3T5VA 3Q78A 3ZN3A 2ZIRA 3FDHA 3IV0A 4M7CA 4IYPA 4E85A 3CK7A 3L22A 3QJZA 3CSTA 4B93B 5FQ7A 2GRQB 3AU4A 1UN8A 2R05A 5CHEE 1X5BA 2C0MA 3CQGB 1Z6TA 5DIZA 2XPIA 2JLBA 3FULA 4GZ5A 4J0UA 2WMNA 2P9LG 1IXVA 5JHBA 2QY7A 3PZ4A 5D2MC 2NSZA 2P9UG 4IULA 1YA0A 5B1BE 2BEDA 3IXEA 3VTYA 2R03A 5FT9A 3ZIMA 4UWHA 3FH5A 3MV3B 4J8YA 3T8KA 4HRNA 3QARA 4OVVA 4I43A 4G8KA 1EDUA 1V55E 3DPYA 1E8ZA 5EILA 3Q47B 4OVUA 4G26A 4MLPA 3IHVA 4LUNU 3TXNA 3FTXA 1OWPA 1V54E 3NOCD 1BI8B 2EIJE 2EIKE 4GTOA 4UUCA 5FINA 4F1SA 4UWGA 4JXTA 4FC8A 1S63A 1ZU2A 3LJNA 3U4TA 3HHMA 3JUEA 3LXUX 2CHXA 4UWKA 1NFIE 3JCKC 3DSUA 2VGYA 4GZCA 4ACKA 3NZSA 5CMWA 2HYZA 3FEXA 3J5QB 5KNHD 1HU3A 4JPSA 5AYWD 4BERA 5EDSA 3V79K 2PZIA 4RSYA 4N5CA 5CECB 5CCMA 2WPVA 4I6GA 2XPZA 5ANRA 3UTMA 3UM0A 4UWFA 4MKTA 4GPKA 3LVQE 3GZSA 1IYGA 1AP7A 2I6HA 5T8IA 2WQ7A 3ASHA 5AARA 1Z3XA 2IY0C 2LNIA 1TNYA 2AW6A 1HX8A 1KZPA 4HOSA 3QB2A 1BI7B 3CVVA 3ZYQA 4RG6A 3JQ0A 2ZGGA 4PS8A 1N11A 1OY3D 3PVLA 3SGHA 3PRZA 1E90A 3ML9A 3FEYA 4GZDA 3D9KA 2R17C 3GZ2A 4JEUA 4FA6A 4FHKA 2VGEA 3AG4E 2H6IA 3Q7FA 2I1KA 5AQ7A 4MS6A 2XGOA 4HRLA 3I4RB 3FUDA 3EIJA 3CVXA 4BSZB 2PQRA 3RKVA 3CHMA 4YNDA 1JWGA 4G24A 4GYWA 1PY1A 1N0RA 4N2QA 3IBEA 1KT1A 3UT4A 5FQ6A 1BD8A 4GMJA 2JABA 4YDOA 1TNUA 2PQNA 3CHSA 3L6AA 3CK8A 4BFRA 1YCSB 4RG9A 3CKBA 2ETAA 1P5QA 4GZ6A 5H7PA 4U95D 3MKQB 2Y4TA 2V5QC 4GA1A 2VYIA 2XS8A 3LY8A 2GRPB 4UI9J 4EZLA 4G8LA 2L6BA 1QZ2A 2CHZA 2OVBA 3HVEA 2XGSA 3MJWA 4HOTA 3SHFA 2J07A 4DK5A 2IO2C 3VTXA 4NRHB 2XENA 3TWRA 2RFAA 2LO6A 5HS0A 1U2VG 5ENRD 3U9WA 4B0ZA 3LY7A 3CGHA 4JB8P 2WXNA 3RJVA 3DRAA 4PS3A 3PUJA 3EDTB 3LJ3A 4BX9A 1W3BA 4GCOA 1S70B 3UUXA 3CIAA 3E33A 5IY5E 1HH8A 3DSXA 1UW4B 3G2VA 4I1OB 3T5XA 1IHGA 4G1TA 1OCZE 3LVRE 3NOGD 3QAQA 2WXJA 4WWPA 4Y6WA 3D3MA 4OAVB 3KSLA 4HORA 1MX4A 2I2OA 3KEZA 3E37A 1DCQA 2DZNA 2EIME 1H6PA 3ESKA 3FUFA 5FIOA 1BPOA 3UKUG 3PZ2A 2FO7A 3CHPA 3TWVA 3HXCA 3ULYA 2KCKA 5EIBE 2Y69E 2X38A 5LCWJ 3FUMA 4J7WA 4FLBA 4JL0A 1YYHA 1E8WA 1QYMA 5AQBA 1RW2A 4R7LA 2J08A 3CVYA 4GYOA 1HS6A 5ARGA 3ZW3A 3S7JA 1WM5A 2ZU6B 3FUKA 5BT1A 3SO8A 4IRUA 2YNQA 4DX1A 3EHQA 4B94A 4ANUA 1SQMA 4X8QA 1H2VC 3L17A 4L9PA 4B8CB 2WXQA 3PE3A 5LP0A 4C0EA 3QNKA 3R9MA 3ESLA 2GRLA 1UN9A 2OCCE 5FJYA 5KJMA 3BQOA 1MYOA 4O1OA 4CDMA 5KJNA 3UKRG 4BT8A 4TRQA 3FTYA 3TGOA 2VSNA 2HE0A 4MBGA 3BUAA 2IU1A 4U07A 3NQPA 3BEEA 5LOZA 4YDWA 3RU0A 4FJYA 4N3BA 2A5EA 4TUUA 3ZHEA 3UMVA 1E8YA 2R2LA 3C3RA 1OWNA 4ZFHA 2DVWA 3JYSA 5BV0A 4MRUA 4I1AA 4W9RA 3MKQA 4BX8A 4HOUA 5J08A 1YMPA 3B7SA 1HXIA 4NQ0A 4KVOA 3UI2A 3PEVB 3ABME 2F8YA 4GCNA 3ISMC 1H2UA 3RRUA 4L1BA 2WXIA 3I4GA 5FQ4A 5G55A 4AJWA 4CCAA 3PNTB 3DSTA 2XCCA 5AQAA 2L9BA 2IOLA 5EX0A 3PNLB 4L23A 3VLEA 3TWWA 2VJ8A 2RG8A 4WWOA 5FZSA 1Y8MA 4GPMA 2WQ6A 3I3NA 3LY9A 2BKGA 2WXGA 4G11A 4ANVA 4AV7A 1LF8A 4PUCA 3NZUA 5BXUA 3D9MA 4DX5D 2GRMA 2IFUA 4RQIA 2OEVA 5KNGA 4J6IA 4URKA 2KBXA 3D9HA 3PREA 5M72A 2OOEA 4EZKA 2VSOE 3FH8A 3RIBA 2PM7A 3L82A 4YVOA 2MRIA 2VTBB 4ILIA 4EPZA 4OYSA 3ONKA 3ZGQA 5JJ6A 3GYZA 3E32A 5ANLA 3APCA 3MEKA 5EX3A 2KZTA 1ELRA 4GZ3A 3E30A 5ENQD 2J4BA 2WXHA 4DRXE 4E6HA 1JCRA 2AVPA 2E2EA 4K0RA 1ZB1A 2CFUA 5T3RA 3ZNGA 2CFZA 2MHKA 4GA0A 3KAEA 3GZ1A 5FQ8A 1IKND 1E7UA 3T9KA 4DJAA 2WMOA 3UIOC 2QYUA 4GTMA 2XEVA 2AXUA 2KXPC 2P58C 3D9IA 2IJGX 2LSVA 3LEWA 1D9SA 1SW6A 3DWLG 1OWLA 1TN7A 2X6JA 1S64A 2DYRE 4KYOB 4HNAD 4J8SA 3E4BA 2EINE 5D66A 1K1BA 4J8DA 3RRMB 3ENEA 3MGBA 2J8SD 2IO3C 4I9EA 4UI9K 1EYHA 3DSSA 3FU3A 3MX3A 4B89A 2ETBA 3AG2E 5JJ7A 3L54A 3TWXA 1UJJA 4B8AA 1E7VA 2M63A 4AXHA 3QDNA 4AIFA 2QC9A 3B95A 3HXFA 4F6RD 3LYAA 3CLJA 4OAUC 2FBNA 2FF4A 5JA4D 3AG3E 4DX2A 1UG3A 2MOWA 3FH7A 3TAXA 4G23A 3ONLA 3ZKJA 2OV8A 3APFA 1IHBA 2WXPA 2A4ZA 5ENPD 3R9AB 1N0QA 2EILE 1PC2A 1Z5SC 2VSXE 3CKCA 4ANWA 3SFXA 3QWPA 4HBDA 2XZTG 1RZ4A 4F1PA 2L0TB 3PEUB 4A3TA 4DI4A 1JWFA 1MQSA 4NURA 3CVNA 2YINA 4Q94A 4QQIA 4UWLA 3KD7A 4J8FA 3MCXA 3FU5A 5LFAA 1U3CA 1N4SA 3KEAA 3VLDA 5D0OD 2BTDA 2WXKA 4CEMA 5HQ8A 2Y4UA 5HKPA 2X6FA 2F8XK 2XEEA 1SA4A 5J90A 2XS1A 1O1RA 3EHNA 5G04J 3ZXSA 3SBTB 4NIKA 2OEWA 3RO3A 2UY1B 3PUKA 3NBNB 3KS2A 4AY6A 3DEOA 1N4QA 2X6IA 3Q7AA 5AENA 3Q9NC 2IONA 3CEQA 1HG2A 1MHQA 1TNBA 2WXFA 5KJLA 4AOFA 5JHAA 3U66A 2PM6A 3U3WA 3ZRHA 5AQ9A 3G2TA 1JPLA 1N9AA 2KCLA 2BKKB 3UM1A 4I9CA 3PH0C 3OAWA 3FUEA 5CBNA 3LPZA 2LUHA 1HE8A 3J5PA 2J09A 1TNOA 1OT8A 3RO2A 1TN6A 5B1AE 1IQUA 4JA9A 4A1GA 4HVBA 4BESA 3O4ZA 3L13A 1K8KG 3FU6A 3HRAA 3P2BA 5ENNA 2P9PG 1K1AA 4UQZA 2ZXWE 4CT4A 5A23A 3CHOA 4XEIG 4JW1A 2XZDG 4GYYA 3UQ3A 1WY6A 2C2LA 4I2WA 5B3SE 4XE0A 2L6JA 3QC1A 3JXJA 3ULEG 4ABNA 4LSZE 1MJ0A 1H2TC 3TL5A 2H6HA 1K3ZD 4GMRA 4GU5A 4D10C 1ZBPA 2XRZA 3W9FA 1L5JA 3S7DA 3Q9UC 5D0QD 3ZEFA 2IF4A 4ILHB 3CHRA 2FULA 4ANXA 3QKYA 4L2LA 3FTVA 1INZA 5KWDA 3G2WA 4F7AA 3I5PA 2YHCA 4JD2G 3B7BA 4KZ0A 4Q69A 5BW8C 1HF8A 2GRRB 2RFMA 4DUIA 1QNFA 3V31A 4WNEA 4U7EB 5AIJA 2LSUA 1N52A 2BF0X 1LD8A 1OWMA 3DSVA 2F0YA 3JXIA 1N54A 3TJPA 3FFLA 4U8VD 4BETA 3HXDA 3OXFA 2FO1E 4WUYA 2KZTB 1Z3YA 1BU9A 2XGMA 4K5BA 5ENTD 4KMOA 4YDYA 2C0LA 3TXMA 4EZJA 2V8SE 4DI3A 3CVLA 3FHEA 2IQCA 3LCAA 3DEPA 4I6JA 4LRZA 4HLEA 4LERA 2WVIA 3SQVA 3V2OA 4WNFA 3ABLE 3C72A 1TN8A 1HFAA 3LDZA 2GGFA 2KCVA 2XPYA 3ZHEB 2AWIA 3MA5A 3UPVA 3Q73A 4GTQA 1E96B 3HVEB 4V3IA 5JMND 3UXGA 2JEKA 3ML8A 2KC7A 4U96D 4I17A 3P1UA 3FU0A 4XKCA 4O60A 4YDEA 3ULQA 3UINC 2HR2A 3GW4A 4XX5A 3MKRA 3EHMA 5E75A 2WM9A 4QFVA 5E76A 2ILRA 2CG3A 3S7BA 1U3DA 2WXOA 3SFYA 4DLQA 5HI7A 4A55A 4WWNA 2P9NG 3QWVA 4APFA 1O1SA 2P2CP 5G04C 4FADA 4BTAA 4K5AB 5FZRA 2OVFA 3FTWA 2P9IG 1VDYA 3PZ3A 3FP3A 3R7QA 3B7RL 3C98A 3CSFA 5A6CA 3ZPJA 5DBKA 5KJKA 3WG7E 1HG5A 3NAWA 4APOA 1H0AA 4LNGA 3BG0B 1PAQA 3MYVA 3AS5A 5CEDB 3CVPA 5T4YA 4CDRA 3LKUA 2VGXA 5BNWA 3DXKG 3AU5A 4J8EA 4BSXA 1OUVA 2WXLA 2CHWA 4XI0A 2ZGDA 3L08A 2KM4A 4ACLA 3O48A 1TR4A 3FTZA 1O5MA 3ASGA 4JHRA 3NF1A 1TNZA 4G2VA 4WNGA 3CHQA 1SVXA 5AJLA 1H19A 3R7RA 4C48B 1TJFA 4GTRA 2XRYA 2GW1A 1NA3A 2X6HA 3ASNE 4EQFA 2HO1A 4GTSA 5LX8A 2GRNB 5EIDA 3BU8A 4HXIA 4GTTA 2XQ0A 1MX2A 1KLXA 1S0PA 3FY4A 1E8XA 2V5FA 4I2ZA 2J4DA 2B0OE 3IKOB 2Y3AA 4LNUD 5EKQD 3K9IA 2UY1A 3Q79A 4H7YA 4KBQA 3UT7A 3IEGA 2VGXB 2MYOA 1XGWA 1DNPA 2ZISA 5CRVA 1UOHA 3L16A 3S2AA 1O1TA 3B7TA 3PS6A 2VSYA 1HZ4A 1N94A 3Q49B 2PNNA 2R02A 5EYLA 3SD5A 5C1DA 2DCPA 5FTPA 1XNFA 3CR3A 1JUQA 3BG1B 3PZDA 2WXRA 3ZYMA 3QWWA 3QK0A 4TXPA 4I6EA 4CZ2D 1JCQA 3CVQA 3EUVA 3T8MA 4CRWA 5BXOA 3HDXA 3DBSA 1ELWA 3EU9A 3FTUA 4HLLA 4P29A 4U04A 4XIFA 1A17A 3ZYLA 3PDNA 4NACA 1TJCA 4N2SA 3X2QE 4AM9A 2F37A 3SNXA 4PH4B 3SF4A 2LXLA 2LAHA 4KVMA 3CV0A 2WB2A 3NB2A 3Q5MA 3UM2A 2LAIA 4HB5A 4UI9C 2XCBA 3Q75A 2AXVA 5KBAA 2Y0BG 3EJNA 2V4LA 2X6KA 1BLXB 5FWQA 2J49A 3TWUA 3TG5A 3HYMB 1DVPA 4UQXA 4PS7A 1WAO1 2A5UA 3C3QA 2XEHA 1OCOE 4DPRA 1D8DA 3FUNA 4JA7A 5CCLA 4GMLA 3ABKE 4N3CA 3UX4A 4JHKA 3UT8A 2IEJA 3MV2B 1MX6A 2J9QA 5HRYA 2NC9A 4C0MA 3APDA 3E34A 1FT2A 3WXXA 2ONDA 4WNDA 3OXGA 2QZAA 4TUMA 4BEPA 3UIPC 3D9OA 4CDNA 4LG6A 3PE4A 4JEHA 4GTPA 5KCMA 2DYSE 3EU5A 3DSWA 2I9CA 4XI9A 3SZ7A 2Q7FA 3UM3A 3V30A 4U0ZA 5CRUA 5ARFA 3JUIA 3FUJA 5CMYA 2YHEA 1TEZA 4CGWA 5ITZF 1DCEA 4JVSA 3MZLB 3U64A 1Y6IA 4O6FA
chains in the Genus database with same CATH topology
4I6JA 1OWPA 2WXGA 4G11A 4ILGA 4ANVA 4AV7A 1LF8A 4U8HA 4PUCA 4LRZA 3Q15A 3NZUA 4FP7A 4HLEA 3D9MA 4LERA 2WVIA 2GRMA 2IFUA 4WNFA 4F1SA 4CGVA 4UWGA 4JXTA 4J6IA 4URKA 3PREA 5M72A 2OOEA 4FC8A 4EZKA 2VSOE 3FH8A 1ZU2A 3RIBA 1HFAA 1H6KA 3I3NA 3LDZA 3SBSA 3U4TA 2GGFA 2KCVA 3HHMA 3LXUX 2CHXA 2PM7A 2XPYA 4KZCA 4UWKA 2AWIA 3MA5A 4YVOA 3ZHEB 2MRIA 1B89A 3JCKC 4FULA 2VGYA 1E96B 4GZCA 2VTBB 3HVEB 4ACKA 1GW6A 4FU3A 4ILIA 4V3IA 4EPZA 4OYSA 2VTBA 3ONKA 3ZGQA 5G05C 5JJ6A 3GYZA 5ANLA 3NZSA 5CMWA 2JEKA 3ML8A 2KC7A 3APCA 4AP2A 3MEKA 3FHEA 2HYZA 2QFCA 3FEXA 4I17A 5EX3A 3P1UA 2KZTA 3FU0A 1ELRA 4GZ3A 4XKCA 3ULQA 1HU3A 2J4BA 4FLHA 2HR2A 3GW4A 2WXHA 4XX5A 4JPSA 3MKRA 4H7XA 5AYWD 5EDSA 4E6HA 3EHMA 3U64A 5E75A 2WM9A 4N3AA 2AVPA 2PZIA 4QFVA 2E2EA 4AEZC 5E76A 3UPVA 1NZNA 2ILRA 4K0RA 4N5CA 4RSYA 2CFUA 5CCMA 2WPVA 5T3RA 2CFZA 4I6GA 2XPZA 2CG3A 2MHKA 5ANRA 3S7BA 4GA0A 1U3DA 2WXOA 2IOSA 3KAEA 4UWFA 2DBAA 3ZFWA 4MKTA 4GPKA 3SFZA 5HI7A 4DLQA 4A55A 4WWNA 3D9NA 5G2NA 1SZAA 3LVQE 3GZ1A 3D9JA 3GZSA 1IYGA 2I6HA 5FQ8A 5T8IA 3QWVA 5JJTA 4APFA 3RRNB 2WQ7A 3ASDA 4ATGA 1E7UA 2NXPA 3ASHA 4DJAA 4EBAG 2WMOA 1Z3XA 5G04C 4FADA 4BTAA 2LNIA 5FZRA 2OVFA 3FTWA 2XEVA 2VQ2A 2AXUA 2KATA 2WXMA 2AW6A 1HX8A 4BY6A 1VDYA 2P58C 3FP3A 4HOSA 2E0IA 3D9IA 3QB2A 3B7RL 3R7QA 2IJGX 2LSVA 3LEWA 3C98A 4DLOA 3CVUA 3CSFA 3CVVA 1OWLA 3OXLA 5A6CA 3ZPJA 4GA2A 3ZYQA 2X6JA 4RG6A 1EPUA 4AY5A 3JQ0A 4PS8A 4KYOB 4KXKB 4U0UA 5DBKA 5KJKA 4J8SA 3FTSA 2V0PA 1HG5A 3E4BA 4RVBA 4Y6CA 2X3MA 3CVWA 1Y6IA 3PVLA 3SGHA 2RD0A 3PRZA 4APOA 1H0AA 2BUGA 3B13A 1E90A 3ML9A 4J8DA 3FEYA 4PDXA 3BG0B 1PAQA 3MYVA 4EECA 3AS5A 3RRMB 4GZDA 3D9KA 3CVPA 3ENEA 2R17C 5T4YA 4CDRA 5LCWC 3MGBA 3GZ2A 4JEUA 4FA6A 2CG2A 4FHKA 3G2UA 4I9EA 4UI9K 1EYHA 3LKUA 2VGXA 4HFGA 4IN3B 4F3VA 2I1KA 5BNWA 3FU3A 4MS6A 5BUZA 2XGOA 3I4RB 3EIQC 3MX3A 4B89A 3AU5A 4J8EA 3FUDA 3L54A 4U0SA 1OUVA 4BSXA 3EIJA 1UJJA 5JJ7A 2WXLA 4B8AA 3CVXA 1E7VA 2CHWA 2M63A 2PQRA 3G2SA 4AXHA 3RKVA 3CHMA 4YNDA 1JWGA 2R5SA 3QDNA 4BWRA 4XI0A 4AIFA 3L08A 4G24A 2KM4A 2HM8A 3LYAA 1OWOA 3CLJA 4GYWA 3TG4A 3O48A 4ACLA 4F53A 1PY1A 3FTZA 2FBNA 2FF4A 4N2QA 3IBEA 2DIWA 1KT1A 3VLFA 3UT4A 4KT6B 5A7DB 5FQ6A 4GMJA 3ASGA 1UG3A 2MOWA 4JHRA 4L7TA 4ME2A 3FH7A 3NF1A 4G2VA 4G23A 4WNGA 3TAXA 2PL2A 3ONLA 3CHQA 2PQNA 3CHSA 4JZYA 5AJLA 3L6AA 1H19A 2OV8A 3R7RA 4CT0A 5G05J 1TJFA 2FEZA 3APFA 2WXPA 3CK8A 2A4ZA 4BFRA 2XRYA 4EBAA 2L0IA 4RG9A 2GW1A 3D9LA 1NA3A 3R9AB 2X6HA 3CKBA 1P5QA 1KT0A 4GZ6A 4L2YA 1PC2A 4UQYA 2VSXE 3CKCA 3MKQB 4ANWA 4EQFA 2HO1A 4I1MA 2Y4TA 5BV1A 4HS2A 4XKBA 3FUHA 3URZA 5LX8A 4GA1A 2VYIA 3FUIA 3QWPA 3LY8A 1ELKA 4UI9J 4EZLA 2L0TB 4HXIA 3PEUB 4A3TA 4DI4A 2XQ0A 3ASFA 1QZ2A 2CHZA 2OVBA 1JWFA 3HVEA 1KLXA 1S0PA 2R59A 2XGSA 3FY4A 3MJWA 1E8XA 3HIZA 2V5FA 4I2ZA 2J4DA 4HOTA 3SHFA 3IKOB 2J07A 2Y3AA 4DK5A 1MQSA 3VTXA 4NRHB 4NURA 5EKQD 1FCHA 4BTBA 3K9IA 3LS8A 2UY1A 4H7YA 4KBQA 3UT7A 3IEGA 1UJKA 4K03A 4LCTA 3CVNA 2LO6A 2VGXB 2YINA 4Q94A 3SI5A 4UWLA 1XGWA 4FHJA 4WAFA 3KD7A 1DNPA 4J8FA 4O6FA 3MCXA 4JC8A 3ZVVA 3FU5A 3U9WA 3AS4A 4U63A 4B0ZA 3LY7A 3CGHA 5LFAA 3L16A 4M3OA 1U3CA 3VLDA 5D0OD 2BTDA 2WXNA 2WXKA 3S2AA 4CEMA 5AJDA 3RJVA 2XHEA 3B7TA 3PS6A 5HQ8A 2Y4UA 4C9BB 4PS3A 2VSYA 3FWVA 1HZ4A 2X6FA 3PUJA 3EDTB 3LJ3A 4BX9A 1W3BA 4GCOA 5J90A 3UUXA 3Q49B 3CIAA 4JHJA 3SD5A 1HH8A 5C1DA 2DCPA 1UW4B 4XZ4A 3EHNA 5FTPA 1XNFA 4LEUA 4BT9A 3DPDA 1FVFA 3CR3A 5C2YA 1JUQA 3G2VA 4I1OB 5G04J 3T5XA 1IHGA 3BG1B 2UWJG 3PZDA 4G1TA 3LVRE 3ZXSA 1HO8A 3QAQA 2WXJA 3SBTB 2WXRA 3CQCB 3AS8A 3RO3A 4A3VA 4WWPA 2UY1B 4Q96A 3PUKA 4Y6WA 3D3MA 3QWWA 3ZYMA 3Q4AB 3KS2A 4AY6A 4FJZA 3QK0A 4A1SA 4I6EA 4HORA 2X6IA 2I2OA 5AENA 4GAAA 2IONA 3CEQA 1HG2A 3KEZA 4G25A 1MHQA 3CK9A 2WXFA 2AXZA 3CVQA 5KJLA 1FVHA 4AOFA 3ESKA 3FUFA 5JHAA 3U66A 2PM6A 3U3WA 3T8MA 1BPOA 1NA0A 3ZRHA 3HDXA 4CRWA 3G2TA 2FO7A 1JPLA 2KCLA 3CHPA 2YQ8A 3JQ1A 2KCKA 1QQEA 2X38A 3DBSA 4I9CA 3PH0C 1EF1C 1ELWA 3FTUA 2I1JA 4P29A 4U04A 2FI7A 4XIFA 4GB9A 3OAWA 1A17A 3FUEA 5LCWJ 3FUMA 4FLBA 3ZYLA 3LPZA 4JL0A 3PDNA 1E8WA 3LY9A 4NACA 1TJCA 4N2SA 1HE8A 4R7LA 2J08A 4AM9A 3CVYA 4GYOA 1HS6A 4HOQA 2J09A 3IHYA 2WQHA 3N71A 5ARGA 3RO2A 3SNXA 4PH4B 3SF4A 4AVXA 3ZW3A 3RK6A 1IQUA 3S7JA 1WM5A 5BPPA 4YVQC 2ZU6B 3OTNA 2LAHA 4JA9A 3FUKA 3QOUA 4A1GA 4KVMA 4HVBA 5BT1A 3CV0A 2WB2A 3Q5MA 4IRUA 4N39A 2YNQA 2LAIA 4UI9C 2XCBA 3ZYKA 3O4ZA 4B94A 3L13A 4ANUA 3FU6A 1SQMA 3P2BA 3EJNA 2V4LA 1NP7A 3B7UX 2X6KA 5ENNA 4UQZA 4CT4A 5A23A 1H2VC 3L17A 5FWQA 1SZ9A 3CHOA 4TV3A 4B8CB 2WXQA 3PE3A 4JW1A 5LP0A 4C0EA 3QNKA 4GYYA 2J49A 3D9PA 3UQ3A 3TG5A 1WY6A 3HYMB 2C2LA 4I2WA 3ESLA 2GRLA 3S7FA 1DVPA 4XE0A 2L6JA 3QC1A 5FZQA 1UN9A 2EQXA 1IQRA 5FJYA 4ABNA 5KJMA 3T5VA 1H2TC 3TL5A 3ZN3A 4GU5A 3FDHA 4D10C 1ZBPA 4CDMA 3IV0A 2XRZA 5KJNA 4UQXA 4IYPA 4PS7A 4BT8A 4E85A 1L5JA 4TRQA 3S7DA 1WAO1 2A5UA 3CK7A 3FTYA 5D0QD 3ZEFA 2IF4A 3TGOA 2VSNA 3L22A 3QJZA 4DPRA 3CSTA 4U07A 2IU1A 3NQPA 4ILHB 5FQ7A 3BEEA 3CHRA 3FUNA 4JA7A 3AU4A 5CCLA 1UN8A 4GMLA 2FULA 4ANXA 3QKYA 4L2LA 5LOZA 5CHEE 3FTVA 4N3CA 1X5BA 1INZA 3RU0A 3UX4A 2C0MA 3CQGB 4JHKA 3UT8A 4FJYA 4N3BA 3G2WA 3MV2B 4F7AA 4TUUA 3I5PA 3ZHEA 1Z6TA 2J9QA 2XPIA 5DIZA 2YHCA 3UMVA 2NC9A 2JLBA 4C0MA 3FULA 3APDA 1E8YA 4KZ0A 4Q69A 3WXXA 2ONDA 4GZ5A 1OWNA 4J0UA 5BW8C 2WMNA 1HF8A 4WNDA 3JYSA 5BV0A 4MRUA 1QNFA 4I1AA 4W9RA 4WNEA 3OXGA 3MKQA 4BX8A 4HOUA 5J08A 5JHBA 3B7SA 1HXIA 4NQ0A 2QY7A 3D9OA 5AIJA 4KVOA 4CDNA 2NSZA 3PE4A 2LSUA 1N52A 3PEVB 4JEHA 2BF0X 1YA0A 4GCNA 4IULA 5KCMA 1OWMA 1H2UA 3RRUA 4L1BA 2WXIA 3VTYA 3I4GA 5FQ4A 5G55A 4AJWA 5FT9A 3ZIMA 2I9CA 4CCAA 1N54A 3TJPA 3FFLA 3PNTB 4UWHA 3FH5A 4XI9A 3SZ7A 2XCCA 2Q7FA 3MV3B 4U0ZA 4OVVA 2L9BA 5ARFA 3QARA 4I43A 2IOLA 1EDUA 3FUJA 3JUIA 3OXFA 5EX0A 5CMYA 3PNLB 4WUYA 2KZTB 1Z3YA 1E8ZA 2YHEA 4L23A 3VLEA 1TEZA 2XGMA 4CGWA 2VJ8A 2RG8A 3Q47B 4KMOA 4WWOA 4OVUA 4G26A 2C0LA 4JVSA 3TXMA 3MZLB 4MLPA 1Y8MA 2V8SE 3IHVA 5FZSA 4DI3A 4EZJA 4LUNU 3CVLA 2WQ6A 3TXNA 3FTXA 2AXVA 2IQCA 3LCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FEY A;  1PAQ A;  4CRW A;  1N54 A;  5ANR A;  2HM8 A;  4CEM A;  2IOS A;  3RK6 A;  4CT4 A;  1H2V C;  3FEX A;  2ZU6 B;  4B8C B;  2VSX E;  2IOL A;  2KZT A;  3JUI A;  4C9B B;  3D3M A;  2IU1 A;  1HU3 A;  2KZT B;  4GMJ A;  1UG3 A;  2VSO E;  2FUL A;  2I2O A;  1H6K A;  4GML A;  3EIQ C;  2RG8 A;  2GGF A;  2ION A;  2NSZ A;  4B89 A;  1N52 A;  4JHJ A;  4JHK A;  4IUL A;  3L6A A;  3EIJ A;  1UW4 B;  4LUN U;  4B8A A;  1H2U A;  1H2T C; 
#chains in the Genus database with same CATH topology
 4ILG A;  4U8H A;  3Q15 A;  4FP7 A;  1QBQ A;  4CGV A;  1KPS B;  3TWS A;  4TXQ A;  3DXM G;  2NYJ A;  5AN8 A;  1H6K A;  3SBS A;  2B6C A;  1NL4 A;  4KZC A;  1B89 A;  4FUL A;  3C5R A;  1GW6 A;  4FU3 A;  4DX7 D;  2H6G A;  2VTB A;  5ENO D;  5G05 C;  4AP2 A;  2QFC A;  1MZC A;  4FLH A;  3ZUV B;  3AAA C;  4H7X A;  4O1P A;  4Z68 A;  4N3A A;  4AEZ C;  1NZN A;  4EHM A;  2QYJ A;  4U8Y D;  2IOS A;  2DBA A;  3ZFW A;  3SFZ A;  3D9N A;  5G2N A;  1SZA A;  3D9J A;  2DZO A;  3TWT A;  5JJT A;  3ASO E;  3RRN B;  3ASD A;  4ATG A;  2NXP A;  4EBA G;  2VQ2 A;  2KAT A;  2WXM A;  4GTV A;  4BY6 A;  3HG0 D;  2E0I A;  4DLO A;  3CVU A;  3OXL A;  3C3O A;  4GA2 A;  1EPU A;  1FPP A;  4AY5 A;  4RLY A;  4KXK B;  4U0U A;  3FTS A;  2V0P A;  4RVB A;  4Y6C A;  2X3M A;  3CVW A;  2RD0 A;  1N4P A;  2BUG A;  3HXB A;  3B13 A;  1A5E A;  4PDX A;  2GRO B;  4EEC A;  2RKK A;  5LCW C;  5CBO A;  2CG2 A;  3G2U A;  3ZU7 B;  4HFG A;  2V4H C;  4IN3 B;  4F3V A;  5BUZ A;  3EIQ C;  4TXR A;  1SA5 A;  4U0S A;  3G2S A;  2R5S A;  4BWR A;  2HM8 A;  4F53 A;  1OWO A;  3TG4 A;  1KZO A;  2ETC A;  1JCS A;  2DIW A;  3VLF A;  4KT6 B;  5A7D B;  5EYP F;  4L7T A;  4A63 B;  4ME2 A;  3F6Q A;  2PL2 A;  5AAO A;  4JZY A;  4CT0 A;  5G05 J;  2FEZ A;  1OXJ A;  4EBA A;  2L0I A;  3D9L A;  3V2X A;  1KT0 A;  4L2Y A;  4UQY A;  4I1M A;  5BV1 A;  4HS2 A;  4XKB A;  3FUH A;  3URZ A;  4K5C A;  3FUI A;  1ELK A;  3ASF A;  4DX6 D;  2R59 A;  1Q2Z A;  3HIZ A;  1H6O A;  5EN5 D;  1FCH A;  4BTB A;  3LS8 A;  5CEA A;  3KSQ A;  4LNB A;  4K03 A;  1UJK A;  4LCT A;  1AWC B;  3SI5 A;  1G3N B;  4FHJ A;  4WAF A;  4JC8 A;  3ZVV A;  3AS4 A;  1LTX A;  4U63 A;  5CER B;  2Y1L E;  4M3O A;  5AJD A;  1N95 A;  2XHE A;  4C9B B;  3FWV A;  2P9K G;  1DC2 A;  4JHJ A;  1NI1 A;  3EHR A;  4XZ4 A;  4LEU A;  4BT9 A;  3DPD A;  4HI9 A;  1FVF A;  5C2Y A;  2UWJ G;  1HO8 A;  4HRM B;  3CQC B;  3AS8 A;  4A3V A;  4Q96 A;  3Q4A B;  4ATZ D;  4FJZ A;  4A1S A;  4GAA A;  3RSE G;  4G25 A;  3CK9 A;  1WG0 A;  2AXZ A;  1FVH A;  4ZHB A;  1NA0 A;  3HXE A;  2YQ8 A;  3JQ1 A;  1X81 A;  1QQE A;  2AJA A;  3RAU A;  1EF1 C;  2I1J A;  2FI7 A;  4HI8 A;  4GB9 A;  3W9G A;  1N4R A;  3TWQ A;  1OCR E;  3AJI A;  3PZ1 A;  4CYM D;  4HOQ A;  3IHY A;  5ENS D;  2WQH A;  2DWZ A;  3N71 A;  1FT1 A;  4N5Q A;  4AVX A;  3RK6 A;  3AG1 E;  1D8E A;  5BPP A;  4HQD A;  4YVQ C;  3OTN A;  3QOU A;  2P9S G;  1WDY A;  4N39 A;  3ZYK A;  1NP7 A;  3B7U X;  3ZXP A;  1TYQ G;  3L9T A;  1SZ9 A;  4TV3 A;  1LD7 A;  3D9P A;  1OCC E;  3S7F A;  3SY2 A;  2H6F A;  2LXM A;  5FZQ A;  2EQX A;  1IQR A;  3T5V A;  3Q78 A;  3ZN3 A;  2ZIR A;  3FDH A;  3IV0 A;  4M7C A;  4IYP A;  4E85 A;  3CK7 A;  3L22 A;  3QJZ A;  3CST A;  4B93 B;  5FQ7 A;  2GRQ B;  3AU4 A;  1UN8 A;  2R05 A;  5CHE E;  1X5B A;  2C0M A;  3CQG B;  1Z6T A;  5DIZ A;  2XPI A;  2JLB A;  3FUL A;  4GZ5 A;  4J0U A;  2WMN A;  2P9L G;  1IXV A;  5JHB A;  2QY7 A;  3PZ4 A;  5D2M C;  2NSZ A;  2P9U G;  4IUL A;  1YA0 A;  5B1B E;  2BED A;  3IXE A;  3VTY A;  2R03 A;  5FT9 A;  3ZIM A;  4UWH A;  3FH5 A;  3MV3 B;  4J8Y A;  3T8K A;  4HRN A;  3QAR A;  4OVV A;  4I43 A;  4G8K A;  1EDU A;  1V55 E;  3DPY A;  1E8Z A;  5EIL A;  3Q47 B;  4OVU A;  4G26 A;  4MLP A;  3IHV A;  4LUN U;  3TXN A;  3FTX A;  1OWP A;  1V54 E;  3NOC D;  1BI8 B;  2EIJ E;  2EIK E;  4GTO A;  4UUC A;  5FIN A;  4F1S A;  4UWG A;  4JXT A;  4FC8 A;  1S63 A;  1ZU2 A;  3LJN A;  3U4T A;  3HHM A;  3JUE A;  3LXU X;  2CHX A;  4UWK A;  1NFI E;  3JCK C;  3DSU A;  2VGY A;  4GZC A;  4ACK A;  3NZS A;  5CMW A;  2HYZ A;  3FEX A;  3J5Q B;  5KNH D;  1HU3 A;  4JPS A;  5AYW D;  4BER A;  5EDS A;  3V79 K;  2PZI A;  4RSY A;  4N5C A;  5CEC B;  5CCM A;  2WPV A;  4I6G A;  2XPZ A;  5ANR A;  3UTM A;  3UM0 A;  4UWF A;  4MKT A;  4GPK A;  3LVQ E;  3GZS A;  1IYG A;  1AP7 A;  2I6H A;  5T8I A;  2WQ7 A;  3ASH A;  5AAR A;  1Z3X A;  2IY0 C;  2LNI A;  1TNY A;  2AW6 A;  1HX8 A;  1KZP A;  4HOS A;  3QB2 A;  1BI7 B;  3CVV A;  3ZYQ A;  4RG6 A;  3JQ0 A;  2ZGG A;  4PS8 A;  1N11 A;  1OY3 D;  3PVL A;  3SGH A;  3PRZ A;  1E90 A;  3ML9 A;  3FEY A;  4GZD A;  3D9K A;  2R17 C;  3GZ2 A;  4JEU A;  4FA6 A;  4FHK A;  2VGE A;  3AG4 E;  2H6I A;  3Q7F A;  2I1K A;  5AQ7 A;  4MS6 A;  2XGO A;  4HRL A;  3I4R B;  3FUD A;  3EIJ A;  3CVX A;  4BSZ B;  2PQR A;  3RKV A;  3CHM A;  4YND A;  1JWG A;  4G24 A;  4GYW A;  1PY1 A;  1N0R A;  4N2Q A;  3IBE A;  1KT1 A;  3UT4 A;  5FQ6 A;  1BD8 A;  4GMJ A;  2JAB A;  4YDO A;  1TNU A;  2PQN A;  3CHS A;  3L6A A;  3CK8 A;  4BFR A;  1YCS B;  4RG9 A;  3CKB A;  2ETA A;  1P5Q A;  4GZ6 A;  5H7P A;  4U95 D;  3MKQ B;  2Y4T A;  2V5Q C;  4GA1 A;  2VYI A;  2XS8 A;  3LY8 A;  2GRP B;  4UI9 J;  4EZL A;  4G8L A;  2L6B A;  1QZ2 A;  2CHZ A;  2OVB A;  3HVE A;  2XGS A;  3MJW A;  4HOT A;  3SHF A;  2J07 A;  4DK5 A;  2IO2 C;  3VTX A;  4NRH B;  2XEN A;  3TWR A;  2RFA A;  2LO6 A;  5HS0 A;  1U2V G;  5ENR D;  3U9W A;  4B0Z A;  3LY7 A;  3CGH A;  4JB8 P;  2WXN A;  3RJV A;  3DRA A;  4PS3 A;  3PUJ A;  3EDT B;  3LJ3 A;  4BX9 A;  1W3B A;  4GCO A;  1S70 B;  3UUX A;  3CIA A;  3E33 A;  5IY5 E;  1HH8 A;  3DSX A;  1UW4 B;  3G2V A;  4I1O B;  3T5X A;  1IHG A;  4G1T A;  1OCZ E;  3LVR E;  3NOG D;  3QAQ A;  2WXJ A;  4WWP A;  4Y6W A;  3D3M A;  4OAV B;  3KSL A;  4HOR A;  1MX4 A;  2I2O A;  3KEZ A;  3E37 A;  1DCQ A;  2DZN A;  2EIM E;  1H6P A;  3ESK A;  3FUF A;  5FIO A;  1BPO A;  3UKU G;  3PZ2 A;  2FO7 A;  3CHP A;  3TWV A;  3HXC A;  3ULY A;  2KCK A;  5EIB E;  2Y69 E;  2X38 A;  5LCW J;  3FUM A;  4J7W A;  4FLB A;  4JL0 A;  1YYH A;  1E8W A;  1QYM A;  5AQB A;  1RW2 A;  4R7L A;  2J08 A;  3CVY A;  4GYO A;  1HS6 A;  5ARG A;  3ZW3 A;  3S7J A;  1WM5 A;  2ZU6 B;  3FUK A;  5BT1 A;  3SO8 A;  4IRU A;  2YNQ A;  4DX1 A;  3EHQ A;  4B94 A;  4ANU A;  1SQM A;  4X8Q A;  1H2V C;  3L17 A;  4L9P A;  4B8C B;  2WXQ A;  3PE3 A;  5LP0 A;  4C0E A;  3QNK A;  3R9M A;  3ESL A;  2GRL A;  1UN9 A;  2OCC E;  5FJY A;  5KJM A;  3BQO A;  1MYO A;  4O1O A;  4CDM A;  5KJN A;  3UKR G;  4BT8 A;  4TRQ A;  3FTY A;  3TGO A;  2VSN A;  2HE0 A;  4MBG A;  3BUA A;  2IU1 A;  4U07 A;  3NQP A;  3BEE A;  5LOZ A;  4YDW A;  3RU0 A;  4FJY A;  4N3B A;  2A5E A;  4TUU A;  3ZHE A;  3UMV A;  1E8Y A;  2R2L A;  3C3R A;  1OWN A;  4ZFH A;  2DVW A;  3JYS A;  5BV0 A;  4MRU A;  4I1A A;  4W9R A;  3MKQ A;  4BX8 A;  4HOU A;  5J08 A;  1YMP A;  3B7S A;  1HXI A;  4NQ0 A;  4KVO A;  3UI2 A;  3PEV B;  3ABM E;  2F8Y A;  4GCN A;  3ISM C;  1H2U A;  3RRU A;  4L1B A;  2WXI A;  3I4G A;  5FQ4 A;  5G55 A;  4AJW A;  4CCA A;  3PNT B;  3DST A;  2XCC A;  5AQA A;  2L9B A;  2IOL A;  5EX0 A;  3PNL B;  4L23 A;  3VLE A;  3TWW A;  2VJ8 A;  2RG8 A;  4WWO A;  5FZS A;  1Y8M A;  4GPM A;  2WQ6 A;  3I3N A;  3LY9 A;  2BKG A;  2WXG A;  4G11 A;  4ANV A;  4AV7 A;  1LF8 A;  4PUC A;  3NZU A;  5BXU A;  3D9M A;  4DX5 D;  2GRM A;  2IFU A;  4RQI A;  2OEV A;  5KNG A;  4J6I A;  4URK A;  2KBX A;  3D9H A;  3PRE A;  5M72 A;  2OOE A;  4EZK A;  2VSO E;  3FH8 A;  3RIB A;  2PM7 A;  3L82 A;  4YVO A;  2MRI A;  2VTB B;  4ILI A;  4EPZ A;  4OYS A;  3ONK A;  3ZGQ A;  5JJ6 A;  3GYZ A;  3E32 A;  5ANL A;  3APC A;  3MEK A;  5EX3 A;  2KZT A;  1ELR A;  4GZ3 A;  3E30 A;  5ENQ D;  2J4B A;  2WXH A;  4DRX E;  4E6H A;  1JCR A;  2AVP A;  2E2E A;  4K0R A;  1ZB1 A;  2CFU A;  5T3R A;  3ZNG A;  2CFZ A;  2MHK A;  4GA0 A;  3KAE A;  3GZ1 A;  5FQ8 A;  1IKN D;  1E7U A;  3T9K A;  4DJA A;  2WMO A;  3UIO C;  2QYU A;  4GTM A;  2XEV A;  2AXU A;  2KXP C;  2P58 C;  3D9I A;  2IJG X;  2LSV A;  3LEW A;  1D9S A;  1SW6 A;  3DWL G;  1OWL A;  1TN7 A;  2X6J A;  1S64 A;  2DYR E;  4KYO B;  4HNA D;  4J8S A;  3E4B A;  2EIN E;  5D66 A;  1K1B A;  4J8D A;  3RRM B;  3ENE A;  3MGB A;  2J8S D;  2IO3 C;  4I9E A;  4UI9 K;  1EYH A;  3DSS A;  3FU3 A;  3MX3 A;  4B89 A;  2ETB A;  3AG2 E;  5JJ7 A;  3L54 A;  3TWX A;  1UJJ A;  4B8A A;  1E7V A;  2M63 A;  4AXH A;  3QDN A;  4AIF A;  2QC9 A;  3B95 A;  3HXF A;  4F6R D;  3LYA A;  3CLJ A;  4OAU C;  2FBN A;  2FF4 A;  5JA4 D;  3AG3 E;  4DX2 A;  1UG3 A;  2MOW A;  3FH7 A;  3TAX A;  4G23 A;  3ONL A;  3ZKJ A;  2OV8 A;  3APF A;  1IHB A;  2WXP A;  2A4Z A;  5ENP D;  3R9A B;  1N0Q A;  2EIL E;  1PC2 A;  1Z5S C;  2VSX E;  3CKC A;  4ANW A;  3SFX A;  3QWP A;  4HBD A;  2XZT G;  1RZ4 A;  4F1P A;  2L0T B;  3PEU B;  4A3T A;  4DI4 A;  1JWF A;  1MQS A;  4NUR A;  3CVN A;  2YIN A;  4Q94 A;  4QQI A;  4UWL A;  3KD7 A;  4J8F A;  3MCX A;  3FU5 A;  5LFA A;  1U3C A;  1N4S A;  3KEA A;  3VLD A;  5D0O D;  2BTD A;  2WXK A;  4CEM A;  5HQ8 A;  2Y4U A;  5HKP A;  2X6F A;  2F8X K;  2XEE A;  1SA4 A;  5J90 A;  2XS1 A;  1O1R A;  3EHN A;  5G04 J;  3ZXS A;  3SBT B;  4NIK A;  2OEW A;  3RO3 A;  2UY1 B;  3PUK A;  3NBN B;  3KS2 A;  4AY6 A;  3DEO A;  1N4Q A;  2X6I A;  3Q7A A;  5AEN A;  3Q9N C;  2ION A;  3CEQ A;  1HG2 A;  1MHQ A;  1TNB A;  2WXF A;  5KJL A;  4AOF A;  5JHA A;  3U66 A;  2PM6 A;  3U3W A;  3ZRH A;  5AQ9 A;  3G2T A;  1JPL A;  1N9A A;  2KCL A;  2BKK B;  3UM1 A;  4I9C A;  3PH0 C;  3OAW A;  3FUE A;  5CBN A;  3LPZ A;  2LUH A;  1HE8 A;  3J5P A;  2J09 A;  1TNO A;  1OT8 A;  3RO2 A;  1TN6 A;  5B1A E;  1IQU A;  4JA9 A;  4A1G A;  4HVB A;  4BES A;  3O4Z A;  3L13 A;  1K8K G;  3FU6 A;  3HRA A;  3P2B A;  5ENN A;  2P9P G;  1K1A A;  4UQZ A;  2ZXW E;  4CT4 A;  5A23 A;  3CHO A;  4XEI G;  4JW1 A;  2XZD G;  4GYY A;  3UQ3 A;  1WY6 A;  2C2L A;  4I2W A;  5B3S E;  4XE0 A;  2L6J A;  3QC1 A;  3JXJ A;  3ULE G;  4ABN A;  4LSZ E;  1MJ0 A;  1H2T C;  3TL5 A;  2H6H A;  1K3Z D;  4GMR A;  4GU5 A;  4D10 C;  1ZBP A;  2XRZ A;  3W9F A;  1L5J A;  3S7D A;  3Q9U C;  5D0Q D;  3ZEF A;  2IF4 A;  4ILH B;  3CHR A;  2FUL A;  4ANX A;  3QKY A;  4L2L A;  3FTV A;  1INZ A;  5KWD A;  3G2W A;  4F7A A;  3I5P A;  2YHC A;  4JD2 G;  3B7B A;  4KZ0 A;  4Q69 A;  5BW8 C;  1HF8 A;  2GRR B;  2RFM A;  4DUI A;  1QNF A;  3V31 A;  4WNE A;  4U7E B;  5AIJ A;  2LSU A;  1N52 A;  2BF0 X;  1LD8 A;  1OWM A;  3DSV A;  2F0Y A;  3JXI A;  1N54 A;  3TJP A;  3FFL A;  4U8V D;  4BET A;  3HXD A;  3OXF A;  2FO1 E;  4WUY A;  2KZT B;  1Z3Y A;  1BU9 A;  2XGM A;  4K5B A;  5ENT D;  4KMO A;  4YDY A;  2C0L A;  3TXM A;  4EZJ A;  2V8S E;  4DI3 A;  3CVL A;  3FHE A;  2IQC A;  3LCA A;  3DEP A;  4I6J A;  4LRZ A;  4HLE A;  4LER A;  2WVI A;  3SQV A;  3V2O A;  4WNF A;  3ABL E;  3C72 A;  1TN8 A;  1HFA A;  3LDZ A;  2GGF A;  2KCV A;  2XPY A;  3ZHE B;  2AWI A;  3MA5 A;  3UPV A;  3Q73 A;  4GTQ A;  1E96 B;  3HVE B;  4V3I A;  5JMN D;  3UXG A;  2JEK A;  3ML8 A;  2KC7 A;  4U96 D;  4I17 A;  3P1U A;  3FU0 A;  4XKC A;  4O60 A;  4YDE A;  3ULQ A;  3UIN C;  2HR2 A;  3GW4 A;  4XX5 A;  3MKR A;  3EHM A;  5E75 A;  2WM9 A;  4QFV A;  5E76 A;  2ILR A;  2CG3 A;  3S7B A;  1U3D A;  2WXO A;  3SFY A;  4DLQ A;  5HI7 A;  4A55 A;  4WWN A;  2P9N G;  3QWV A;  4APF A;  1O1S A;  2P2C P;  5G04 C;  4FAD A;  4BTA A;  4K5A B;  5FZR A;  2OVF A;  3FTW A;  2P9I G;  1VDY A;  3PZ3 A;  3FP3 A;  3R7Q A;  3B7R L;  3C98 A;  3CSF A;  5A6C A;  3ZPJ A;  5DBK A;  5KJK A;  3WG7 E;  1HG5 A;  3NAW A;  4APO A;  1H0A A;  4LNG A;  3BG0 B;  1PAQ A;  3MYV A;  3AS5 A;  5CED B;  3CVP A;  5T4Y A;  4CDR A;  3LKU A;  2VGX A;  5BNW A;  3DXK G;  3AU5 A;  4J8E A;  4BSX A;  1OUV A;  2WXL A;  2CHW A;  4XI0 A;  2ZGD A;  3L08 A;  2KM4 A;  4ACL A;  3O48 A;  1TR4 A;  3FTZ A;  1O5M A;  3ASG A;  4JHR A;  3NF1 A;  1TNZ A;  4G2V A;  4WNG A;  3CHQ A;  1SVX A;  5AJL A;  1H19 A;  3R7R A;  4C48 B;  1TJF A;  4GTR A;  2XRY A;  2GW1 A;  1NA3 A;  2X6H A;  3ASN E;  4EQF A;  2HO1 A;  4GTS A;  5LX8 A;  2GRN B;  5EID A;  3BU8 A;  4HXI A;  4GTT A;  2XQ0 A;  1MX2 A;  1KLX A;  1S0P A;  3FY4 A;  1E8X A;  2V5F A;  4I2Z A;  2J4D A;  2B0O E;  3IKO B;  2Y3A A;  4LNU D;  5EKQ D;  3K9I A;  2UY1 A;  3Q79 A;  4H7Y A;  4KBQ A;  3UT7 A;  3IEG A;  2VGX B;  2MYO A;  1XGW A;  1DNP A;  2ZIS A;  5CRV A;  1UOH A;  3L16 A;  3S2A A;  1O1T A;  3B7T A;  3PS6 A;  2VSY A;  1HZ4 A;  1N94 A;  3Q49 B;  2PNN A;  2R02 A;  5EYL A;  3SD5 A;  5C1D A;  2DCP A;  5FTP A;  1XNF A;  3CR3 A;  1JUQ A;  3BG1 B;  3PZD A;  2WXR A;  3ZYM A;  3QWW A;  3QK0 A;  4TXP A;  4I6E A;  4CZ2 D;  1JCQ A;  3CVQ A;  3EUV A;  3T8M A;  4CRW A;  5BXO A;  3HDX A;  3DBS A;  1ELW A;  3EU9 A;  3FTU A;  4HLL A;  4P29 A;  4U04 A;  4XIF A;  1A17 A;  3ZYL A;  3PDN A;  4NAC A;  1TJC A;  4N2S A;  3X2Q E;  4AM9 A;  2F37 A;  3SNX A;  4PH4 B;  3SF4 A;  2LXL A;  2LAH A;  4KVM A;  3CV0 A;  2WB2 A;  3NB2 A;  3Q5M A;  3UM2 A;  2LAI A;  4HB5 A;  4UI9 C;  2XCB A;  3Q75 A;  2AXV A;  5KBA A;  2Y0B G;  3EJN A;  2V4L A;  2X6K A;  1BLX B;  5FWQ A;  2J49 A;  3TWU A;  3TG5 A;  3HYM B;  1DVP A;  4UQX A;  4PS7 A;  1WAO 1;  2A5U A;  3C3Q A;  2XEH A;  1OCO E;  4DPR A;  1D8D A;  3FUN A;  4JA7 A;  5CCL A;  4GML A;  3ABK E;  4N3C A;  3UX4 A;  4JHK A;  3UT8 A;  2IEJ A;  3MV2 B;  1MX6 A;  2J9Q A;  5HRY A;  2NC9 A;  4C0M A;  3APD A;  3E34 A;  1FT2 A;  3WXX A;  2OND A;  4WND A;  3OXG A;  2QZA A;  4TUM A;  4BEP A;  3UIP C;  3D9O A;  4CDN A;  4LG6 A;  3PE4 A;  4JEH A;  4GTP A;  5KCM A;  2DYS E;  3EU5 A;  3DSW A;  2I9C A;  4XI9 A;  3SZ7 A;  2Q7F A;  3UM3 A;  3V30 A;  4U0Z A;  5CRU A;  5ARF A;  3JUI A;  3FUJ A;  5CMY A;  2YHE A;  1TEZ A;  4CGW A;  5ITZ F;  1DCE A;  4JVS A;  3MZL B;  3U64 A;  1Y6I A;  4O6F A; 
#chains in the Genus database with same CATH homology
 4I6J A;  1OWP A;  2WXG A;  4G11 A;  4ILG A;  4ANV A;  4AV7 A;  1LF8 A;  4U8H A;  4PUC A;  4LRZ A;  3Q15 A;  3NZU A;  4FP7 A;  4HLE A;  3D9M A;  4LER A;  2WVI A;  2GRM A;  2IFU A;  4WNF A;  4F1S A;  4CGV A;  4UWG A;  4JXT A;  4J6I A;  4URK A;  3PRE A;  5M72 A;  2OOE A;  4FC8 A;  4EZK A;  2VSO E;  3FH8 A;  1ZU2 A;  3RIB A;  1HFA A;  1H6K A;  3I3N A;  3LDZ A;  3SBS A;  3U4T A;  2GGF A;  2KCV A;  3HHM A;  3LXU X;  2CHX A;  2PM7 A;  2XPY A;  4KZC A;  4UWK A;  2AWI A;  3MA5 A;  4YVO A;  3ZHE B;  2MRI A;  1B89 A;  3JCK C;  4FUL A;  2VGY A;  1E96 B;  4GZC A;  2VTB B;  3HVE B;  4ACK A;  1GW6 A;  4FU3 A;  4ILI A;  4V3I A;  4EPZ A;  4OYS A;  2VTB A;  3ONK A;  3ZGQ A;  5G05 C;  5JJ6 A;  3GYZ A;  5ANL A;  3NZS A;  5CMW A;  2JEK A;  3ML8 A;  2KC7 A;  3APC A;  4AP2 A;  3MEK A;  3FHE A;  2HYZ A;  2QFC A;  3FEX A;  4I17 A;  5EX3 A;  3P1U A;  2KZT A;  3FU0 A;  1ELR A;  4GZ3 A;  4XKC A;  3ULQ A;  1HU3 A;  2J4B A;  4FLH A;  2HR2 A;  3GW4 A;  2WXH A;  4XX5 A;  4JPS A;  3MKR A;  4H7X A;  5AYW D;  5EDS A;  4E6H A;  3EHM A;  3U64 A;  5E75 A;  2WM9 A;  4N3A A;  2AVP A;  2PZI A;  4QFV A;  2E2E A;  4AEZ C;  5E76 A;  3UPV A;  1NZN A;  2ILR A;  4K0R A;  4N5C A;  4RSY A;  2CFU A;  5CCM A;  2WPV A;  5T3R A;  2CFZ A;  4I6G A;  2XPZ A;  2CG3 A;  2MHK A;  5ANR A;  3S7B A;  4GA0 A;  1U3D A;  2WXO A;  2IOS A;  3KAE A;  4UWF A;  2DBA A;  3ZFW A;  4MKT A;  4GPK A;  3SFZ A;  5HI7 A;  4DLQ A;  4A55 A;  4WWN A;  3D9N A;  5G2N A;  1SZA A;  3LVQ E;  3GZ1 A;  3D9J A;  3GZS A;  1IYG A;  2I6H A;  5FQ8 A;  5T8I A;  3QWV A;  5JJT A;  4APF A;  3RRN B;  2WQ7 A;  3ASD A;  4ATG A;  1E7U A;  2NXP A;  3ASH A;  4DJA A;  4EBA G;  2WMO A;  1Z3X A;  5G04 C;  4FAD A;  4BTA A;  2LNI A;  5FZR A;  2OVF A;  3FTW A;  2XEV A;  2VQ2 A;  2AXU A;  2KAT A;  2WXM A;  2AW6 A;  1HX8 A;  4BY6 A;  1VDY A;  2P58 C;  3FP3 A;  4HOS A;  2E0I A;  3D9I A;  3QB2 A;  3B7R L;  3R7Q A;  2IJG X;  2LSV A;  3LEW A;  3C98 A;  4DLO A;  3CVU A;  3CSF A;  3CVV A;  1OWL A;  3OXL A;  5A6C A;  3ZPJ A;  4GA2 A;  3ZYQ A;  2X6J A;  4RG6 A;  1EPU A;  4AY5 A;  3JQ0 A;  4PS8 A;  4KYO B;  4KXK B;  4U0U A;  5DBK A;  5KJK A;  4J8S A;  3FTS A;  2V0P A;  1HG5 A;  3E4B A;  4RVB A;  4Y6C A;  2X3M A;  3CVW A;  1Y6I A;  3PVL A;  3SGH A;  2RD0 A;  3PRZ A;  4APO A;  1H0A A;  2BUG A;  3B13 A;  1E90 A;  3ML9 A;  4J8D A;  3FEY A;  4PDX A;  3BG0 B;  1PAQ A;  3MYV A;  4EEC A;  3AS5 A;  3RRM B;  4GZD A;  3D9K A;  3CVP A;  3ENE A;  2R17 C;  5T4Y A;  4CDR A;  5LCW C;  3MGB A;  3GZ2 A;  4JEU A;  4FA6 A;  2CG2 A;  4FHK A;  3G2U A;  4I9E A;  4UI9 K;  1EYH A;  3LKU A;  2VGX A;  4HFG A;  4IN3 B;  4F3V A;  2I1K A;  5BNW A;  3FU3 A;  4MS6 A;  5BUZ A;  2XGO A;  3I4R B;  3EIQ C;  3MX3 A;  4B89 A;  3AU5 A;  4J8E A;  3FUD A;  3L54 A;  4U0S A;  1OUV A;  4BSX A;  3EIJ A;  1UJJ A;  5JJ7 A;  2WXL A;  4B8A A;  3CVX A;  1E7V A;  2CHW A;  2M63 A;  2PQR A;  3G2S A;  4AXH A;  3RKV A;  3CHM A;  4YND A;  1JWG A;  2R5S A;  3QDN A;  4BWR A;  4XI0 A;  4AIF A;  3L08 A;  4G24 A;  2KM4 A;  2HM8 A;  3LYA A;  1OWO A;  3CLJ A;  4GYW A;  3TG4 A;  3O48 A;  4ACL A;  4F53 A;  1PY1 A;  3FTZ A;  2FBN A;  2FF4 A;  4N2Q A;  3IBE A;  2DIW A;  1KT1 A;  3VLF A;  3UT4 A;  4KT6 B;  5A7D B;  5FQ6 A;  4GMJ A;  3ASG A;  1UG3 A;  2MOW A;  4JHR A;  4L7T A;  4ME2 A;  3FH7 A;  3NF1 A;  4G2V A;  4G23 A;  4WNG A;  3TAX A;  2PL2 A;  3ONL A;  3CHQ A;  2PQN A;  3CHS A;  4JZY A;  5AJL A;  3L6A A;  1H19 A;  2OV8 A;  3R7R A;  4CT0 A;  5G05 J;  1TJF A;  2FEZ A;  3APF A;  2WXP A;  3CK8 A;  2A4Z A;  4BFR A;  2XRY A;  4EBA A;  2L0I A;  4RG9 A;  2GW1 A;  3D9L A;  1NA3 A;  3R9A B;  2X6H A;  3CKB A;  1P5Q A;  1KT0 A;  4GZ6 A;  4L2Y A;  1PC2 A;  4UQY A;  2VSX E;  3CKC A;  3MKQ B;  4ANW A;  4EQF A;  2HO1 A;  4I1M A;  2Y4T A;  5BV1 A;  4HS2 A;  4XKB A;  3FUH A;  3URZ A;  5LX8 A;  4GA1 A;  2VYI A;  3FUI A;  3QWP A;  3LY8 A;  1ELK A;  4UI9 J;  4EZL A;  2L0T B;  4HXI A;  3PEU B;  4A3T A;  4DI4 A;  2XQ0 A;  3ASF A;  1QZ2 A;  2CHZ A;  2OVB A;  1JWF A;  3HVE A;  1KLX A;  1S0P A;  2R59 A;  2XGS A;  3FY4 A;  3MJW A;  1E8X A;  3HIZ A;  2V5F A;  4I2Z A;  2J4D A;  4HOT A;  3SHF A;  3IKO B;  2J07 A;  2Y3A A;  4DK5 A;  1MQS A;  3VTX A;  4NRH B;  4NUR A;  5EKQ D;  1FCH A;  4BTB A;  3K9I A;  3LS8 A;  2UY1 A;  4H7Y A;  4KBQ A;  3UT7 A;  3IEG A;  1UJK A;  4K03 A;  4LCT A;  3CVN A;  2LO6 A;  2VGX B;  2YIN A;  4Q94 A;  3SI5 A;  4UWL A;  1XGW A;  4FHJ A;  4WAF A;  3KD7 A;  1DNP A;  4J8F A;  4O6F A;  3MCX A;  4JC8 A;  3ZVV A;  3FU5 A;  3U9W A;  3AS4 A;  4U63 A;  4B0Z A;  3LY7 A;  3CGH A;  5LFA A;  3L16 A;  4M3O A;  1U3C A;  3VLD A;  5D0O D;  2BTD A;  2WXN A;  2WXK A;  3S2A A;  4CEM A;  5AJD A;  3RJV A;  2XHE A;  3B7T A;  3PS6 A;  5HQ8 A;  2Y4U A;  4C9B B;  4PS3 A;  2VSY A;  3FWV A;  1HZ4 A;  2X6F A;  3PUJ A;  3EDT B;  3LJ3 A;  4BX9 A;  1W3B A;  4GCO A;  5J90 A;  3UUX A;  3Q49 B;  3CIA A;  4JHJ A;  3SD5 A;  1HH8 A;  5C1D A;  2DCP A;  1UW4 B;  4XZ4 A;  3EHN A;  5FTP A;  1XNF A;  4LEU A;  4BT9 A;  3DPD A;  1FVF A;  3CR3 A;  5C2Y A;  1JUQ A;  3G2V A;  4I1O B;  5G04 J;  3T5X A;  1IHG A;  3BG1 B;  2UWJ G;  3PZD A;  4G1T A;  3LVR E;  3ZXS A;  1HO8 A;  3QAQ A;  2WXJ A;  3SBT B;  2WXR A;  3CQC B;  3AS8 A;  3RO3 A;  4A3V A;  4WWP A;  2UY1 B;  4Q96 A;  3PUK A;  4Y6W A;  3D3M A;  3QWW A;  3ZYM A;  3Q4A B;  3KS2 A;  4AY6 A;  4FJZ A;  3QK0 A;  4A1S A;  4I6E A;  4HOR A;  2X6I A;  2I2O A;  5AEN A;  4GAA A;  2ION A;  3CEQ A;  1HG2 A;  3KEZ A;  4G25 A;  1MHQ A;  3CK9 A;  2WXF A;  2AXZ A;  3CVQ A;  5KJL A;  1FVH A;  4AOF A;  3ESK A;  3FUF A;  5JHA A;  3U66 A;  2PM6 A;  3U3W A;  3T8M A;  1BPO A;  1NA0 A;  3ZRH A;  3HDX A;  4CRW A;  3G2T A;  2FO7 A;  1JPL A;  2KCL A;  3CHP A;  2YQ8 A;  3JQ1 A;  2KCK A;  1QQE A;  2X38 A;  3DBS A;  4I9C A;  3PH0 C;  1EF1 C;  1ELW A;  3FTU A;  2I1J A;  4P29 A;  4U04 A;  2FI7 A;  4XIF A;  4GB9 A;  3OAW A;  1A17 A;  3FUE A;  5LCW J;  3FUM A;  4FLB A;  3ZYL A;  3LPZ A;  4JL0 A;  3PDN A;  1E8W A;  3LY9 A;  4NAC A;  1TJC A;  4N2S A;  1HE8 A;  4R7L A;  2J08 A;  4AM9 A;  3CVY A;  4GYO A;  1HS6 A;  4HOQ A;  2J09 A;  3IHY A;  2WQH A;  3N71 A;  5ARG A;  3RO2 A;  3SNX A;  4PH4 B;  3SF4 A;  4AVX A;  3ZW3 A;  3RK6 A;  1IQU A;  3S7J A;  1WM5 A;  5BPP A;  4YVQ C;  2ZU6 B;  3OTN A;  2LAH A;  4JA9 A;  3FUK A;  3QOU A;  4A1G A;  4KVM A;  4HVB A;  5BT1 A;  3CV0 A;  2WB2 A;  3Q5M A;  4IRU A;  4N39 A;  2YNQ A;  2LAI A;  4UI9 C;  2XCB A;  3ZYK A;  3O4Z A;  4B94 A;  3L13 A;  4ANU A;  3FU6 A;  1SQM A;  3P2B A;  3EJN A;  2V4L A;  1NP7 A;  3B7U X;  2X6K A;  5ENN A;  4UQZ A;  4CT4 A;  5A23 A;  1H2V C;  3L17 A;  5FWQ A;  1SZ9 A;  3CHO A;  4TV3 A;  4B8C B;  2WXQ A;  3PE3 A;  4JW1 A;  5LP0 A;  4C0E A;  3QNK A;  4GYY A;  2J49 A;  3D9P A;  3UQ3 A;  3TG5 A;  1WY6 A;  3HYM B;  2C2L A;  4I2W A;  3ESL A;  2GRL A;  3S7F A;  1DVP A;  4XE0 A;  2L6J A;  3QC1 A;  5FZQ A;  1UN9 A;  2EQX A;  1IQR A;  5FJY A;  4ABN A;  5KJM A;  3T5V A;  1H2T C;  3TL5 A;  3ZN3 A;  4GU5 A;  3FDH A;  4D10 C;  1ZBP A;  4CDM A;  3IV0 A;  2XRZ A;  5KJN A;  4UQX A;  4IYP A;  4PS7 A;  4BT8 A;  4E85 A;  1L5J A;  4TRQ A;  3S7D A;  1WAO 1;  2A5U A;  3CK7 A;  3FTY A;  5D0Q D;  3ZEF A;  2IF4 A;  3TGO A;  2VSN A;  3L22 A;  3QJZ A;  4DPR A;  3CST A;  4U07 A;  2IU1 A;  3NQP A;  4ILH B;  5FQ7 A;  3BEE A;  3CHR A;  3FUN A;  4JA7 A;  3AU4 A;  5CCL A;  1UN8 A;  4GML A;  2FUL A;  4ANX A;  3QKY A;  4L2L A;  5LOZ A;  5CHE E;  3FTV A;  4N3C A;  1X5B A;  1INZ A;  3RU0 A;  3UX4 A;  2C0M A;  3CQG B;  4JHK A;  3UT8 A;  4FJY A;  4N3B A;  3G2W A;  3MV2 B;  4F7A A;  4TUU A;  3I5P A;  3ZHE A;  1Z6T A;  2J9Q A;  2XPI A;  5DIZ A;  2YHC A;  3UMV A;  2NC9 A;  2JLB A;  4C0M A;  3FUL A;  3APD A;  1E8Y A;  4KZ0 A;  4Q69 A;  3WXX A;  2OND A;  4GZ5 A;  1OWN A;  4J0U A;  5BW8 C;  2WMN A;  1HF8 A;  4WND A;  3JYS A;  5BV0 A;  4MRU A;  1QNF A;  4I1A A;  4W9R A;  4WNE A;  3OXG A;  3MKQ A;  4BX8 A;  4HOU A;  5J08 A;  5JHB A;  3B7S A;  1HXI A;  4NQ0 A;  2QY7 A;  3D9O A;  5AIJ A;  4KVO A;  4CDN A;  2NSZ A;  3PE4 A;  2LSU A;  1N52 A;  3PEV B;  4JEH A;  2BF0 X;  1YA0 A;  4GCN A;  4IUL A;  5KCM A;  1OWM A;  1H2U A;  3RRU A;  4L1B A;  2WXI A;  3VTY A;  3I4G A;  5FQ4 A;  5G55 A;  4AJW A;  5FT9 A;  3ZIM A;  2I9C A;  4CCA A;  1N54 A;  3TJP A;  3FFL A;  3PNT B;  4UWH A;  3FH5 A;  4XI9 A;  3SZ7 A;  2XCC A;  2Q7F A;  3MV3 B;  4U0Z A;  4OVV A;  2L9B A;  5ARF A;  3QAR A;  4I43 A;  2IOL A;  1EDU A;  3FUJ A;  3JUI A;  3OXF A;  5EX0 A;  5CMY A;  3PNL B;  4WUY A;  2KZT B;  1Z3Y A;  1E8Z A;  2YHE A;  4L23 A;  3VLE A;  1TEZ A;  2XGM A;  4CGW A;  2VJ8 A;  2RG8 A;  3Q47 B;  4KMO A;  4WWO A;  4OVU A;  4G26 A;  2C0L A;  4JVS A;  3TXM A;  3MZL B;  4MLP A;  1Y8M A;  2V8S E;  3IHV A;  5FZS A;  4DI3 A;  4EZJ A;  4LUN U;  3CVL A;  2WQ6 A;  3TXN A;  3FTX A;  2AXV A;  2IQC A;  3LCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...