1UW4B

The structural basis of the interaction between nonsense mediated decay factors upf2 and upf3
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
248
structure length
248
Chain Sequence
b'RPPLQEYVRKLLYKDLSKVTTEKVLRQMRKLPWQDQEVKDYVICCMINIWNVKYNSIHCVANLLAGLVLYQEDVGIHVVDGVLEDIRLGMEVNQPKFNQRRISSAKFLGELYNYRMVESAVIFRTLYSFTSFGVNPDGSPSSLDPPEHLFRIRLVCTILDTCGQYFDRGSSKRKLDCFLVYFQRYVWWKKSLEVWTKDHPFPIDIDYMISDTLELLRPKIKLCNSLEESIRQVQDLEREFLIKLGLVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UPF3X
publication title The Structural Basis for the Interaction between Nonsense-Mediated Mrna Decay Factors Upf2 and Upf3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 95
structure length 248
sequence length 248
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02854 MIF4G MIF4G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1uw4B00
4B8CB 4CT4A 3RK6A 2NSZA 2FULA 1H2UA 3EIQC 3FEYA 3EIJA 1UG3A 4LUNU 1H6KA 2GGFA 4IULA 4JHKA 1H2TC 4GMJA 5ANRA 2IU1A 2IOLA 2IONA 4B89A 2I2OA 3D3MA 2VSOE 2ZU6B 4B8AA 2RG8A 4JHJA 1H2VC 1PAQA 2KZTA 3L6AA 4CRWA 2HM8A 3JUIA 1N54A 4GMLA 4CEMA 2IOSA 2KZTB 4C9BB 1HU3A 2VSXE 1N52A 1UW4B 3FEXA
chains in the Genus database with same CATH superfamily
3Q49B 3B7TA 1LD7A 2DYRE 3UX4A 4KVMA 4N3AA 3C3RA 5CEAA 2CFZA 4GB9A 3T8MA 2WXRA 2PNNA 3OAWA 5BXUA 1K1AA 4N5QA 3HXBA 4L2LA 1GW6A 1LTXA 2B0OE 3ESLA 1IHGA 3Q9NC 4CGVA 5ENNA 1N9AA 2WXQA 2C2LA 5LX8A 2WXKA 5FZSA 1K8KG 3PDNA 3PRZA 3PZ1A 1FVHA 2P9UG 3SO8A 3FUDA 4UWHA 2HO1A 2F37A 1XNFA 2ZU6B 4AVXA 3V2OA 4G1TA 3RRUA 4C9BB 1PY1A 4GTTA 2ZGDA 4H7XA 2V0PA 3B7BA 2QFCA 4FC8A 4MRUA 2IF4A 5B3SE 1OXJA 5LOZA 2DIWA 4J7WA 4CDRA 1H2VC 5H7PA 2XGMA 2E2EA 4CDMA 5ENRD 2IFUA 4EZKA 5JJTA 2KATA 4I6GA 2PL2A 4W9RA 2L6BA 4MKTA 5B1BE 4I17A 1UG3A 4ANXA 2L6JA 4DX2A 2OEWA 4G23A 2ILRA 2Y69E 1HG5A 2HM8A 4A3VA 4KVOA 4HOQA 3PS6A 2H6GA 4LRZA 3QC1A 4GPMA 3TWQA 3D9KA 5C1DA 1HXIA 5EYPF 1HO8A 1TNZA 2L9BA 3NF1A 5JHBA 5G05J 1D8DA 2WMNA 3PZ2A 1Z3XA 4G25A 4BT9A 4JEHA 4AY5A 3CLJA 5BNWA 3SZ7A 1Q2ZA 1OWNA 2LAHA 4Q94A 2ONDA 3G2SA 3AG3E 2IO2C 4XX5A 4E6HA 2FI7A 3SY2A 3LS8A 2ETBA 3CHSA 3QWVA 3PEVB 4U0SA 5FJYA 3SFXA 3B13A 4B93B 4BESA 4NURA 4RSYA 1HU3A 1XGWA 1O1RA 3ZHEB 3ZRHA 2XCBA 2XS1A 3CVWA 5G2NA 4NIKA 1W3BA 2NC9A 4OYSA 3UM1A 1KZPA 4GTSA 5ENSD 4L2YA 4HB5A 2CG3A 2LXLA 4YDWA 2UWJG 2WXIA 4YNDA 2DZNA 3UM3A 4URKA 4APFA 1U3DA 2GRPB 2KCKA 5EDSA 4OVUA 4UWFA 4DI3A 2JEKA 2DWZA 2V4LA 3LCAA 3AG1E 4I6EA 2QYUA 4IN3B 2HR2A 1BU9A 1OWLA 3AAAC 3Q15A 1E90A 3HVEA 5HQ8A 4HOTA 2YHEA 1A5EA 4JHRA 3W9FA 3Q9UC 2J4BA 3UTMA 1DCEA 3UINC 2R03A 3PUKA 4F53A 3CVPA 4CEMA 4DJAA 2ZXWE 4TXPA 4YDEA 1E96B 1QBQA 1YMPA 2MHKA 3C3QA 4UI9K 5EILA 4EZLA 3GZ1A 5FWQA 5KNHD 1A17A 3LYAA 2KBXA 4I1OB 4K5CA 4N3CA 3NBNB 4XZ4A 3IV0A 4GZ3A 1FVFA 2L0IA 3CSTA 3PVLA 3B7RL 4K03A 5BV0A 4LNBA 3P1UA 4ANVA 1N4SA 2XEVA 4FLBA 2NYJA 1SA4A 3PREA 3UKUG 2EIJE 4F1PA 3JUEA 2VSYA 4DK5A 4I9CA 4XKBA 4G2VA 2J49A 4ZHBA 4OAUC 4B94A 3UPVA 4B8AA 3CQGB 4APOA 4H7YA 3ZNGA 2A5UA 2P2CP 4Q96A 4BETA 3ZPJA 1FPPA 2WXHA 4BERA 5JJ7A 3MV2B 2V8SE 3QNKA 4A1SA 3ZGQA 2FBNA 4G26A 3UUXA 3J5QB 4WNDA 3OXGA 5ARFA 4HBDA 3GZSA 1H19A 3LVRE 2IO3C 3CHPA 3UT8A 1BI7B 4BY6A 3BEEA 2WXGA 2YNQA 3FU3A 3MYVA 4J0UA 2WXLA 3TJPA 4LCTA 2XZDG 3R7RA 3EU5A 4I43A 4Y6CA 2R2LA 2HE0A 1UW4B 3OXFA 3Q7AA 2KCLA 1MX2A 3VLEA 2FO7A 1X81A 2QYJA 3L9TA 3D9HA 4RQIA 1LD8A 3CV0A 1HZ4A 1HFAA 3UQ3A 3GW4A 5KCMA 3OXLA 3LJNA 1IXVA 3CHMA 1Z5SC 2DYSE 1D9SA 3MX3A 3KSLA 4HORA 1AP7A 3RRNB 2A4ZA 3IEGA 4A1GA 5EN5D 5J08A 4L9PA 1S0PA 3KEZA 3I4RB 2ZGGA 2R17C 3UM2A 4G24A 1N11A 1EF1C 3FUKA 3IXEA 3I4GA 4PDXA 2XHEA 3R7QA 4JW1A 3ZFWA 3SNXA 2OVBA 3SBTB 5J90A 4GA2A 4NRHB 3ZYKA 4WNEA 5EIBE 4GTPA 4JVSA 3CK7A 1O1TA 3QOUA 3PNLB 5ENTD 4YDYA 3CQCB 4WWPA 1Y6IA 3ULYA 3JXJA 3PUJA 3ZUVB 3ABME 1MYOA 4G8KA 4ILHB 4EBAG 3BG0B 5ITZF 4GCOA 4J8EA 1OY3D 4HLEA 4DI4A 4BWRA 3IHVA 4L23A 5IY5E 3RRMB 4KT6B 4XEIG 3CGHA 5AQAA 1SZ9A 5JJ6A 3JXIA 5C2YA 1SQMA 4WWNA 2RFAA 1D8EA 3B95A 2UY1B 1KPSB 1NP7A 3RIBA 4FADA 4DPRA 2LO6A 5A7DB 4CCAA 4JB8P 3T5VA 4PS3A 3V2XA 3I5PA 3MGBA 1N4RA 4JXTA 2R59A 5CERB 5DBKA 1HG2A 1TNOA 2X6JA 4GTQA 3NOCD 3T9KA 3S7DA 3FH5A 4UWKA 4M3OA 4N2SA 2VYIA 2CG2A 2WXJA 2KXPC 3Q4AB 1U3CA 3EDTB 1V55E 3LY8A 2EINE 2YINA 3FUJA 3RU0A 5FTPA 2WMOA 5T3RA 3RJVA 3ULEG 2VSNA 1IKND 4JPSA 2AXZA 4NACA 2P9IG 4LEUA 5T8IA 5KJNA 3C3OA 5EX3A 1RZ4A 2WQ6A 3V79K 4AOFA 1TNBA 3RSEG 4D10C 2XPZA 4HOSA 1UOHA 4N3BA 1INZA 3LEWA 5D66A 2XENA 4GTOA 3TWUA 2BKKB 4KYOB 5G05C 4QFVA 3FTUA 3FUMA 4JD2G 3CVLA 3R9AB 3DEOA 1H6KA 4HRNA 4DUIA 2RKKA 3FTYA 3JCKC 4OVVA 3G2UA 3V30A 4AP2A 4GYWA 2JABA 4EQFA 1KZOA 5CEDB 3G2TA 4J8YA 2J4DA 1OCCE 4GTVA 4UWLA 3QB2A 4XI0A 5G55A 5EX0A 2V5FA 2XQ0A 1S64A 1N0RA 2WB2A 5KJMA 2XPYA 5CMWA 1H0AA 4BTBA 5FQ6A 1JWGA 3G2VA 4RG6A 2IONA 3NZSA 4B0ZA 5KJLA 2IEJA 4X8QA 3PE3A 2XEEA 2PZIA 4JA9A 3RKVA 2XGSA 1LF8A 1HH8A 2KZTB 1X5BA 3ZKJA 2MRIA 2WXOA 4HRMB 3P2BA 4A63B 5AQBA 1UN8A 3URZA 4DLQA 1FCHA 2IOLA 3E32A 2B6CA 3FY4A 1YCSB 3UM0A 4N5CA 2I6HA 1JUQA 1SW6A 2GRQB 2VSXE 3DSVA 3HRAA 4FA6A 2OOEA 3Q79A 3D9PA 2A5EA 5LP0A 5LFAA 4LSZE 4PS8A 4EZJA 3TWVA 2C0LA 2OEVA 4TXQA 3APDA 4B8CB 3EHNA 4I6JA 2E0IA 2F8YA 2FF4A 2M63A 3QDNA 4TUMA 1K1BA 2IY0C 1H6PA 1N95A 5FT9A 2LSUA 4JA7A 4G11A 2XPIA 3FUEA 1VDYA 4HI9A 1AWCB 4AV7A 3DBSA 3CKCA 5BXOA 3TAXA 4FJYA 5ENPD 3Q75A 3FDHA 4DX1A 3GYZA 4HS2A 4JEUA 2OV8A 3ZYQA 3L82A 3J5PA 3MEKA 3FU5A 5FQ8A 3F6QA 5FZQA 3FP3A 3UMVA 4C0EA 3CVNA 4AJWA 3DRAA 3UXGA 3CVXA 3TWTA 3WXXA 3ZVVA 1TEZA 5ENQD 2CHZA 3NAWA 2P9LG 3RO3A 4P29A 5D2MC 3MA5A 3SFZA 2AJAA 2P9NG 4MLPA 3S7BA 1KT1A 2GRMA 4EHMA 4YVOA 1HF8A 3D3MA 2R02A 3FUIA 1HS6A 4FP7A 2C0MA 2XRZA 3O4ZA 2RD0A 3QWWA 2LAIA 3AU5A 5CECB 4GZDA 3UT4A 2VTBA 4FHKA 5AARA 2X38A 4LUNU 1P5QA 1L5JA 3CR3A 1ZU2A 4JC8A 2VGYA 3FTZA 3U3WA 4ANUA 5HKPA 3ASHA 4DLOA 3ZHEA 1NA3A 4U04A 1E8XA 5JA4D 2L0TB 1H2UA 4ACKA 3ZYLA 3NZUA 4K5BA 3FEYA 4HNAD 3W9GA 4F6RD 4ILIA 4UUCA 2MYOA 1S63A 1OWOA 5E76A 2MOWA 4CDNA 2VJ8A 5BUZA 4U0UA 4GMLA 1S70B 2FEZA 3D9LA 1IHBA 2GROB 4U7EB 3ENEA 4J8FA 5LCWJ 3TXNA 2VGXB 3LY7A 3E33A 5AIJA 4UQZA 5KJKA 4WWOA 3AJIA 1BLXB 3S7JA 3VLFA 1SVXA 2ETAA 4HVBA 2XS8A 4AXHA 2WPVA 2BUGA 3ESKA 4NQ0A 2GRLA 3LKUA 4OAVB 4JZYA 2J8SD 2V4HC 5FINA 3LPZA 1E8ZA 5D0QD 3SQVA 3HYMB 2DCPA 3L22A 4PH4B 1TYQG 4E85A 3C98A 4HI8A 3BG1B 4WNGA 4BTAA 5AQ7A 3HXEA 4J8SA 3ZXPA 4PS7A 1ELWA 1QNFA 3HXFA 3HG0D 4LERA 5AJLA 5D0OD 4KMOA 4I1MA 1HE8A 2J07A 3VTYA 2DVWA 3DPDA 4GTRA 3CVQA 1IYGA 4IRUA 5BT1A 5KWDA 1TNYA 4ATGA 4FLHA 2LXMA 3L54A 5JMND 2YQ8A 4MBGA 4GYYA 2P9PG 2KC7A 4MS6A 4YDOA 5FQ4A 2AXVA 3PEUB 3APCA 3NQPA 2XRYA 1KT0A 1JCSA 4KBQA 1OCZE 1FT2A 3CVUA 4M7CA 1OUVA 3FTSA 3PH0C 4LNUD 4V3IA 2GRRB 2H6IA 3FULA 3D9OA 2IQCA 3DXKG 3PZ3A 4KZCA 1G3NB 1DVPA 4ZFHA 1Z3YA 5G04J 1DC2A 4QQIA 3T5XA 2AVPA 4B89A 3U66A 3ABLE 3TGOA 4AM9A 1ELRA 4CT0A 4U63A 1WG0A 1K3ZD 1QYMA 2XEHA 1E8WA 2X6HA 3CEQA 1N52A 4TRQA 2FULA 4ME2A 2VQ2A 1TNUA 2DBAA 3D9MA 1WY6A 5HRYA 4BSXA 4GMJA 3ZN3A 4AIFA 4XIFA 3QAQA 2WQ7A 4J8DA 2YHCA 2FO1E 3LDZA 4K0RA 3JQ1A 2WXNA 2X6KA 3SGHA 4GU5A 3MZLB 3ASGA 2VGEA 1YYHA 1TR4A 3JQ0A 4IULA 3U64A 1UJJA 5CBOA 4N39A 1HX8A 4G8LA 4TV3A 1NFIE 5EKQD 3FU6A 1E8YA 3RK6A 4FULA 3SD5A 4DX6D 2J9QA 2LNIA 3ZIMA 1ELKA 3C5RA 3CIAA 4PUCA 2WM9A 5EYLA 3RAUA 5AYWD 3AG4E 5CMYA 1SA5A 1O5MA 2BF0X 2R05A 5ARGA 2Y1LE 4LNGA 2AWIA 4GTMA 4EBAA 1E7VA 4L7TA 4C0MA 4I9EA 4CRWA 3HXCA 3QK0A 3EU9A 2XGOA 2ZIRA 3X2QE 4K5AB 2GW1A 3ZEFA 3DSWA 1NL4A 2H6HA 2GGFA 2CHWA 2ZISA 3UIOC 1OWPA 4FHJA 5ANRA 1ZBPA 4GYOA 3DEPA 4O1OA 3O48A 2Y3AA 1EDUA 1Z6TA 4GAAA 2F8XK 3DWLG 5HS0A 3PZDA 1UN9A 3E34A 2IJGX 4ILGA 4KXKB 4UI9J 3EIJA 3KS2A 3LJ3A 5JHAA 1DNPA 1N4PA 2X6IA 2IU1A 5FQ7A 3U4TA 2H6FA 3HVEB 3CVYA 2QC9A 1JCQA 1OCRE 3EUVA 3MKQA 3E30A 3QJZA 2UY1A 3ASDA 5FZRA 5CRVA 3IHYA 4C48B 1N94A 3S7FA 3TWRA 3ASOE 1TN8A 3FWVA 2IOSA 3UKRG 3NB2A 2I9CA 3S2AA 3DSXA 3EJNA 5AENA 3TG5A 3I3NA 3ML9A 4O60A 4ATZD 2I2OA 1WDYA 2Y4TA 3DSTA 2P9SG 3LY9A 3V31A 2HYZA 4F7AA 2PM6A 3QARA 3UIPC 2VTBB 3L13A 3G2WA 4J6IA 3N71A 3CK8A 1EPUA 3LVQE 1YA0A 2CFUA 2PM7A 4BFRA 5CRUA 1BPOA 1BD8A 2XCCA 4BT8A 2EQXA 2R5SA 1JCRA 1TN6A 3FEXA 4HFGA 1OWMA 4CYMD 4Z68A 3R9MA 4BEPA 1JWFA 3QKYA 3UI2A 4I1AA 5T4YA 1EYHA 3B7UX 4GMRA 5ENOD 3L08A 3IBEA 1MQSA 3TWSA 3E4BA 4HRLA 4GCNA 5FIOA 2V5QC 4Y6WA 1O1SA 2WXFA 4A3TA 4A55A 2EILE 5M72A 3TWXA 3PE4A 2Y4UA 2XZTG 3HHMA 3ML8A 1N54A 4BX8A 2KCVA 3SBSA 1IQRA 4RLYA 5BW8C 4BX9A 4EECA 1WM5A 1IQUA 3HIZA 3D9IA 2Q7FA 3EHRA 5KBAA 1NI1A 3FTXA 2LSVA 1TJFA 3KSQA 4DRXE 3CHQA 2NSZA 4DX7D 3Q73A 4XI9A 5LCWC 2QY7A 1WAO1 4KZ0A 4ACLA 3SF4A 4ANWA 1QQEA 3TG4A 4N2QA 5A6CA 2KZTA 2WQHA 4U95D 3SHFA 1QZ2A 3ULQA 4O6FA 4TUUA 4IYPA 3FUHA 5AJDA 4YVQC 1KLXA 1MZCA 2I1JA 4UQYA 2PQNA 3MJWA 1RW2A 1DCQA 1MJ0A 5E75A 1E7UA 3Q7FA 2WVIA 4GA1A 1H6OA 2OVFA 2GRNB 2X6FA 4GZ5A 3OTNA 3C72A 4CZ2D 3ISMC 3ASNE 3FFLA 4FJZA 3VLDA 3ZYMA 4UQXA 3GZ2A 4F1SA 2RFMA 4CGWA 2KM4A 2Y0BG 4ABNA 2EIME 3BQOA 4WNFA 4BSZB 3PZ4A 2BKGA 3KEAA 4AEZC 3PNTB 4O1PA 3MKRA 3ZXSA 4JHKA 4AY6A 4XE0A 5DIZA 3WG7E 4DX5D 2RG8A 1SZAA 4JHJA 1Y8MA 5HI7A 3ONKA 3L17A 4U0ZA 3FH7A 3ZU7B 3HXDA 4CT4A 3HDXA 3CHOA 3DSUA 4JL0A 3DPYA 1H2TC 2VSOE 2WXMA 2BEDA 4XKCA 4WAFA 3AS8A 3CSFA 3BU8A 1JPLA 4U8VD 3ONLA 3BUAA 2P9KG 1ZB1A 3SFYA 3FH8A 3MV3B 3SI5A 4GPKA 1N4QA 3ABKE 3K9IA 3EHQA 2QZAA 5G04C 5CCLA 3E37A 1FT1A 1PAQA 5AQ9A 3B7SA 2F0YA 5CCMA 4I2ZA 3TL5A 2CHXA 4RVBA 3FUNA 5CHEE 1B89A 3JYSA 2J08A 1NZNA 5BV1A 3CVVA 3JUIA 2DZOA 3ASFA 4GZCA 2AW6A 4FU3A 3AS4A 4U07A 4U96D 3CHRA 3D9NA 4GA0A 4I2WA 1OT8A 4U8YD 4HQDA 1OCOE 3AG2E 3LXUX 3D9JA 2NXPA 1TJCA 3U9WA 1MX6A 3FHEA 2EIKE 2J09A 4GZ6A 1MHQA 2PQRA 5KNGA 3UT7A 3TXMA 5AAOA 3L6AA 2OCCE 5ANLA 3APFA 2X3MA 3IKOB 4HOUA 3KAEA 3AU4A 5AN8A 3FTWA 3NOGD 2VGXA 4F3VA 2ETCA 3MCXA 4Q69A 3EIQC 3FU0A 1MX4A 3DSSA 3L16A 3FTVA 3Q47B 4RG9A 3Q5MA 1TN7A 2LUHA 3CKBA 1PC2A 3MKQB 3AS5A 5EIDA 5A23A 1NA0A 5B1AE 4LG6A 4HXIA 3FUFA 3QWPA 3CK9A 3TWWA 3KD7A 1UJKA 3EHMA 1N0QA 3VTXA 4WUYA 1V54E 2WXPA 4UWGA 4R7LA 3DXMG 3RO2A 4UI9C 1BI8B 3ZW3A 2P58C 1U2VG 2I1KA 4TXRA 5BPPA 2BTDA 4EPZA 2AXUA 2JLBA 3Q78A 5CBNA 4HLLA 4U8HA 4L1BA 3T8KA
chains in the Genus database with same CATH topology
4GZDA 2HYZA 3Q49B 3B7TA 4G24A 3UT4A 4F7AA 2PM6A 4FHKA 3UX4A 4KVMA 4N3AA 3QARA 2X38A 2CFZA 4GB9A 2VTBB 3L13A 3G2WA 4J6IA 3T8MA 1EF1C 1P5QA 2WXRA 1L5JA 3FUKA 3CR3A 3N71A 4LUNU 3OAWA 3I4GA 3CK8A 4PDXA 1ZU2A 4L2LA 1EPUA 4JC8A 3LVQE 2VGYA 2XHEA 1YA0A 1GW6A 3FTZA 3ESLA 2CFUA 3R7QA 4JW1A 2PM7A 1IHGA 4BFRA 3ZFWA 3SNXA 3U3WA 1BPOA 2XCCA 4BT8A 5ENNA 4ANUA 4CGVA 3ASHA 4DLOA 2EQXA 3ZHEA 2WXQA 2C2LA 5LX8A 1NA3A 2R5SA 2WXKA 2OVBA 5FZSA 4U04A 1E8XA 3FEXA 3PDNA 4HFGA 3PRZA 1OWMA 4GA2A 2L0TB 4NRHB 3SBTB 3ZYKA 4WNEA 5J90A 1FVHA 4JVSA 3FUDA 1H2UA 4UWHA 3ZYLA 3NZUA 4ACKA 3FEYA 3CK7A 2HO1A 1XNFA 4ILIA 3QOUA 3PNLB 1OWOA 1JWFA 3QKYA 2ZU6B 3CQCB 4I1AA 4AVXA 5T4YA 4WWPA 1EYHA 3B7UX 1Y6IA 5E76A 2MOWA 3L08A 4CDNA 4G1TA 2VJ8A 3PUJA 3RRUA 5BUZA 3IBEA 4U0UA 4ILHB 4EBAG 4GMLA 3BG0B 2FEZA 4C9BB 3D9LA 4GCOA 1PY1A 4H7XA 1MQSA 3ENEA 4J8FA 2V0PA 3E4BA 5LCWJ 4J8EA 4GCNA 3TXNA 4Y6WA 2QFCA 2VGXB 4FC8A 4MRUA 4HLEA 2IF4A 3LY7A 5LOZA 4DI4A 2WXFA 4A3TA 4BWRA 3IHVA 4A55A 5AIJA 4L23A 2DIWA 3RRMB 4KT6B 4UQZA 5KJKA 4WWOA 5M72A 3CGHA 3S7JA 4CDRA 3PE4A 2Y4UA 1H2VC 3VLFA 1SZ9A 2XGMA 2E2EA 4CDMA 4HVBA 4AXHA 3HHMA 3ML8A 2WPVA 2IFUA 1N54A 5JJ6A 4BX8A 4EZKA 5JJTA 2KCVA 2KATA 4I6GA 3SBSA 1IQRA 2PL2A 2BUGA 5C2YA 1SQMA 5BW8C 4W9RA 4BX9A 4WWNA 3ESKA 4NQ0A 4EECA 2GRLA 3LKUA 4MKTA 4I17A 2UY1B 1UG3A 4ANXA 4JZYA 2L6JA 1WM5A 1IQUA 3HIZA 3LPZA 1E8ZA 1NP7A 5D0QD 3D9IA 4G23A 3RIBA 2ILRA 3HYMB 2DCPA 2Q7FA 3L22A 1HG5A 4PH4B 2HM8A 4FADA 4A3VA 3FTXA 4KVOA 2LSVA 4DPRA 4HOQA 4E85A 2LO6A 5A7DB 3PS6A 1TJFA 4CCAA 4LRZA 3C98A 3T5VA 4PS3A 3CHQA 3I5PA 3MGBA 4JXTA 2NSZA 3QC1A 4XI9A 3BG1B 2R59A 3D9KA 4WNGA 5C1DA 5LCWC 4BTAA 2QY7A 5DBKA 1WAO1 1HXIA 4KZ0A 1HO8A 1HG2A 4ACLA 3SF4A 4J8SA 4ANWA 2L9BA 2X6JA 3NF1A 5JHBA 1QQEA 5G05J 3TG4A 4PS7A 1ELWA 1QNFA 4N2QA 5A6CA 2KZTA 4LERA 2WQHA 5AJLA 3S7DA 2WMNA 3FH5A 3SHFA 5D0OD 4KMOA 4I1MA 1HE8A 4M3OA 4UWKA 1QZ2A 2VYIA 3ULQA 1Z3XA 4O6FA 2J07A 4N2SA 2CG2A 4TUUA 4IYPA 3VTYA 3FUHA 2WXJA 3Q4AB 4G25A 5AJDA 4BT9A 1U3CA 3EDTB 3DPDA 4JEHA 4AY5A 3CLJA 4YVQC 3CVQA 2VTBA 1IYGA 1KLXA 3LY8A 2I1JA 4IRUA 5BNWA 2YINA 4UQYA 2PQNA 3FUJA 3RU0A 3SZ7A 3MJWA 1OWNA 2LAHA 5BT1A 4Q94A 5FTPA 2ONDA 2WMOA 3G2SA 5T3RA 3RJVA 4ATGA 4FLHA 4XX5A 2VSNA 2FI7A 5E75A 4E6HA 3LS8A 1E7UA 3CHSA 3QWVA 3PEVB 4U0SA 5FJYA 4JPSA 3L54A 2YQ8A 2WVIA 2AXZA 4NACA 4GYYA 4GA1A 3B13A 2KC7A 2OVFA 4LEUA 4MS6A 4NURA 5T8IA 5KJNA 4RSYA 5FQ4A 5EX3A 1HU3A 1XGWA 2WQ6A 2AXVA 2X6FA 3PEUB 4GZ5A 3ZHEB 3ZRHA 4AOFA 2XCBA 3APCA 3OTNA 3CVWA 5G2NA 4D10C 3NQPA 2XPZA 2XRYA 4HOSA 1KT0A 4KBQA 3FFLA 1W3BA 4FJZA 3VLDA 3ZYMA 4N3BA 1INZA 4UQXA 3GZ2A 2NC9A 4OYSA 3LEWA 4F1SA 4CGWA 2KM4A 4KYOB 5G05C 3CVUA 4QFVA 4ABNA 1OUVA 4L2YA 3FTSA 3FTUA 3PH0C 4V3IA 4WNFA 2CG3A 3FUMA 3FULA 2UWJG 2WXIA 3D9OA 2IQCA 4YNDA 3CVLA 4KZCA 3R9AB 4AEZC 4URKA 1DVPA 4APFA 1U3DA 3PNTB 1H6KA 1Z3YA 3MKRA 5G04J 3ZXSA 2KCKA 5EDSA 4JHKA 4OVUA 4UWFA 3T5XA 2AVPA 4B89A 3U66A 4AY6A 4XE0A 3TGOA 4DI3A 2JEKA 3FTYA 4AM9A 5DIZA 2V4LA 2RG8A 1SZAA 3JCKC 1ELRA 4JHJA 4CT0A 1Y8MA 5HI7A 3ONKA 4OVVA 4U63A 3LCAA 4I6EA 3L17A 4U0ZA 3G2UA 1E8WA 4IN3B 2HR2A 2X6HA 3FH7A 3CEQA 4AP2A 1N52A 4GYWA 4CT4A 4TRQA 1OWLA 3HDXA 3CHOA 2FULA 3Q15A 2VQ2A 4ME2A 1E90A 3HVEA 4EQFA 5HQ8A 4HOTA 2YHEA 2DBAA 3D9MA 4JL0A 1WY6A 4BSXA 1H2TC 4GMJA 4JHRA 3ZN3A 2VSOE 3G2TA 4AIFA 2WXMA 2J4DA 4XIFA 3QAQA 2J4BA 4XKCA 2WQ7A 4J8DA 2YHCA 4WAFA 3AS8A 3CSFA 3LDZA 4UWLA 3PUKA 3QB2A 4XI0A 4K0RA 5G55A 1JPLA 4F53A 3JQ1A 3CVPA 5EX0A 2V5FA 4CEMA 2XQ0A 4DJAA 2WXNA 3ONLA 2X6KA 3SGHA 4GU5A 1E96B 3MZLB 2WB2A 5KJMA 3ASGA 2XPYA 5CMWA 1H0AA 4BTBA 3FH8A 3JQ0A 3MV3B 5FQ6A 3SI5A 4GPKA 2MHKA 4IULA 1JWGA 3G2VA 4RG6A 3GZ1A 3K9IA 4UI9K 4EZLA 2IONA 3NZSA 5G04C 3U64A 5FWQA 4B0ZA 5CCLA 1A17A 5KJLA 3LYAA 1UJJA 1PAQA 3PE3A 4N39A 1HX8A 2PZIA 4JA9A 3RKVA 4TV3A 2XGSA 3B7SA 1LF8A 5CCMA 4I2ZA 5EKQD 1HH8A 2KZTB 3TL5A 1X5BA 2CHXA 4I1OB 4N3CA 2MRIA 3FU6A 2WXOA 3IV0A 4XZ4A 4GZ3A 1E8YA 1FVFA 3P2BA 2L0IA 3RK6A 3CSTA 4RVBA 1UN8A 4FULA 3URZA 3FUNA 5CHEE 3PVLA 3SD5A 4DLQA 2J9QA 1FCHA 3B7RL 2IOLA 2LNIA 4K03A 3ZIMA 5BV0A 1B89A 3P1UA 2J08A 3JYSA 1ELKA 1NZNA 2XEVA 3CIAA 3FY4A 4FLBA 2WM9A 4PUCA 4ANVA 3PREA 5BV1A 5AYWD 3CVVA 4N5CA 2I6HA 3JUIA 3ASFA 1JUQA 4GZCA 2VSYA 4DK5A 5CMYA 2VSXE 4I9CA 2BF0X 4XKBA 4G2VA 2J49A 5ARGA 2AW6A 2AWIA 4FA6A 2OOEA 4FU3A 4EBAA 3D9PA 1E7VA 4B94A 3UPVA 4L7TA 5LP0A 5LFAA 4B8AA 3CQGB 4APOA 4H7YA 2A5UA 4C0MA 3AS4A 4I9EA 4U07A 4PS8A 3QK0A 4CRWA 4EZJA 3CHRA 2XGOA 2C0LA 3D9NA 4Q96A 4GA0A 4I2WA 3ZPJA 2WXHA 5JJ7A 3MV2B 2GW1A 2V8SE 3APDA 3QNKA 3ZEFA 4B8CB 3EHNA 4A1SA 4I6JA 2E0IA 3ZGQA 2FBNA 3LXUX 2FF4A 2NXPA 2M63A 1TJCA 3D9JA 3QDNA 4G26A 2GGFA 2CHWA 3U9WA 1OWPA 3FHEA 4FHJA 4WNDA 5ANRA 3UUXA 1ZBPA 2J09A 4GYOA 4GZ6A 3OXGA 5FT9A 3O48A 2Y3AA 1EDUA 1MHQA 1Z6TA 2LSUA 2PQRA 4GAAA 4JA7A 5ARFA 3GZSA 4G11A 3TXMA 3UT7A 1H19A 3L6AA 3PZDA 5ANLA 1UN9A 2XPIA 3APFA 3FUEA 2X3MA 3IKOB 3LVRE 1VDYA 4HOUA 3KAEA 3AU4A 3FTWA 3CHPA 4AV7A 2IJGX 3UT8A 2VGXA 4F3VA 4BY6A 3DBSA 3BEEA 2WXGA 4ILGA 3CKCA 4KXKB 3MCXA 4Q69A 3EIQC 3FU0A 4UI9J 3TAXA 3EIJA 3KS2A 2YNQA 3FU3A 4FJYA 3LJ3A 5JHAA 3MYVA 1DNPA 4J0UA 2WXLA 3FTVA 2X6IA 2IU1A 3L16A 5FQ7A 3HVEB 3U4TA 3FDHA 3Q47B 3GYZA 4RG9A 3TJPA 3CVYA 4HS2A 4JEUA 2OV8A 3Q5MA 3ZYQA 3MEKA 4LCTA 3R7RA 3FU5A 3CKBA 5FQ8A 3MKQA 4I43A 4Y6CA 5FZQA 1PC2A 3FP3A 3UMVA 4C0EA 3CVNA 3QJZA 3MKQB 1UW4B 3AS5A 3OXFA 2KCLA 2UY1A 4AJWA 3VLEA 2FO7A 3CVXA 3ASDA 3WXXA 5A23A 1NA0A 3ZVVA 5FZRA 3CV0A 1TEZA 3IHYA 2CHZA 1HZ4A 1HFAA 4HXIA 3FUFA 3S7FA 3UQ3A 3RO3A 3GW4A 4P29A 5KCMA 3QWPA 3OXLA 3CK9A 3KD7A 1UJKA 3EHMA 3VTXA 3MA5A 3FWVA 2IOSA 3SFZA 4WUYA 3CHMA 2I9CA 4MLPA 3S2AA 2WXPA 4UWGA 4R7LA 3MX3A 3S7BA 1KT1A 2GRMA 3EJNA 5AENA 3TG5A 4HORA 3RO2A 3I3NA 3ML9A 4UI9C 4YVOA 3RRNB 2A4ZA 3IEGA 4A1GA 3ZW3A 1HF8A 2I2OA 3D3MA 2P58C 3FUIA 1HS6A 4FP7A 2Y4TA 5J08A 2C0MA 2XRZA 2I1KA 3O4ZA 2RD0A 1S0PA 5BPPA 3KEZA 3I4RB 2BTDA 4EPZA 3QWWA 2AXUA 2JLBA 2LAIA 3AU5A 4U8HA 4L1BA 2R17C 3LY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B8C B;  4CT4 A;  3RK6 A;  2NSZ A;  2FUL A;  1H2U A;  3EIQ C;  3FEY A;  3EIJ A;  1UG3 A;  4LUN U;  1H6K A;  2GGF A;  4IUL A;  4JHK A;  1H2T C;  4GMJ A;  5ANR A;  2IU1 A;  2IOL A;  2ION A;  4B89 A;  2I2O A;  3D3M A;  2VSO E;  2ZU6 B;  4B8A A;  2RG8 A;  4JHJ A;  1H2V C;  1PAQ A;  2KZT A;  3L6A A;  4CRW A;  2HM8 A;  3JUI A;  1N54 A;  4GML A;  4CEM A;  2IOS A;  2KZT B;  4C9B B;  1HU3 A;  2VSX E;  1N52 A;  1UW4 B;  3FEX A; 
#chains in the Genus database with same CATH topology
 3Q49 B;  3B7T A;  1LD7 A;  2DYR E;  3UX4 A;  4KVM A;  4N3A A;  3C3R A;  5CEA A;  2CFZ A;  4GB9 A;  3T8M A;  2WXR A;  2PNN A;  3OAW A;  5BXU A;  1K1A A;  4N5Q A;  3HXB A;  4L2L A;  1GW6 A;  1LTX A;  2B0O E;  3ESL A;  1IHG A;  3Q9N C;  4CGV A;  5ENN A;  1N9A A;  2WXQ A;  2C2L A;  5LX8 A;  2WXK A;  5FZS A;  1K8K G;  3PDN A;  3PRZ A;  3PZ1 A;  1FVH A;  2P9U G;  3SO8 A;  3FUD A;  4UWH A;  2HO1 A;  2F37 A;  1XNF A;  2ZU6 B;  4AVX A;  3V2O A;  4G1T A;  3RRU A;  4C9B B;  1PY1 A;  4GTT A;  2ZGD A;  4H7X A;  2V0P A;  3B7B A;  2QFC A;  4FC8 A;  4MRU A;  2IF4 A;  5B3S E;  1OXJ A;  5LOZ A;  2DIW A;  4J7W A;  4CDR A;  1H2V C;  5H7P A;  2XGM A;  2E2E A;  4CDM A;  5ENR D;  2IFU A;  4EZK A;  5JJT A;  2KAT A;  4I6G A;  2PL2 A;  4W9R A;  2L6B A;  4MKT A;  5B1B E;  4I17 A;  1UG3 A;  4ANX A;  2L6J A;  4DX2 A;  2OEW A;  4G23 A;  2ILR A;  2Y69 E;  1HG5 A;  2HM8 A;  4A3V A;  4KVO A;  4HOQ A;  3PS6 A;  2H6G A;  4LRZ A;  3QC1 A;  4GPM A;  3TWQ A;  3D9K A;  5C1D A;  1HXI A;  5EYP F;  1HO8 A;  1TNZ A;  2L9B A;  3NF1 A;  5JHB A;  5G05 J;  1D8D A;  2WMN A;  3PZ2 A;  1Z3X A;  4G25 A;  4BT9 A;  4JEH A;  4AY5 A;  3CLJ A;  5BNW A;  3SZ7 A;  1Q2Z A;  1OWN A;  2LAH A;  4Q94 A;  2OND A;  3G2S A;  3AG3 E;  2IO2 C;  4XX5 A;  4E6H A;  2FI7 A;  3SY2 A;  3LS8 A;  2ETB A;  3CHS A;  3QWV A;  3PEV B;  4U0S A;  5FJY A;  3SFX A;  3B13 A;  4B93 B;  4BES A;  4NUR A;  4RSY A;  1HU3 A;  1XGW A;  1O1R A;  3ZHE B;  3ZRH A;  2XCB A;  2XS1 A;  3CVW A;  5G2N A;  4NIK A;  1W3B A;  2NC9 A;  4OYS A;  3UM1 A;  1KZP A;  4GTS A;  5ENS D;  4L2Y A;  4HB5 A;  2CG3 A;  2LXL A;  4YDW A;  2UWJ G;  2WXI A;  4YND A;  2DZN A;  3UM3 A;  4URK A;  4APF A;  1U3D A;  2GRP B;  2KCK A;  5EDS A;  4OVU A;  4UWF A;  4DI3 A;  2JEK A;  2DWZ A;  2V4L A;  3LCA A;  3AG1 E;  4I6E A;  2QYU A;  4IN3 B;  2HR2 A;  1BU9 A;  1OWL A;  3AAA C;  3Q15 A;  1E90 A;  3HVE A;  5HQ8 A;  4HOT A;  2YHE A;  1A5E A;  4JHR A;  3W9F A;  3Q9U C;  2J4B A;  3UTM A;  1DCE A;  3UIN C;  2R03 A;  3PUK A;  4F53 A;  3CVP A;  4CEM A;  4DJA A;  2ZXW E;  4TXP A;  4YDE A;  1E96 B;  1QBQ A;  1YMP A;  2MHK A;  3C3Q A;  4UI9 K;  5EIL A;  4EZL A;  3GZ1 A;  5FWQ A;  5KNH D;  1A17 A;  3LYA A;  2KBX A;  4I1O B;  4K5C A;  4N3C A;  3NBN B;  4XZ4 A;  3IV0 A;  4GZ3 A;  1FVF A;  2L0I A;  3CST A;  3PVL A;  3B7R L;  4K03 A;  5BV0 A;  4LNB A;  3P1U A;  4ANV A;  1N4S A;  2XEV A;  4FLB A;  2NYJ A;  1SA4 A;  3PRE A;  3UKU G;  2EIJ E;  4F1P A;  3JUE A;  2VSY A;  4DK5 A;  4I9C A;  4XKB A;  4G2V A;  2J49 A;  4ZHB A;  4OAU C;  4B94 A;  3UPV A;  4B8A A;  3CQG B;  4APO A;  4H7Y A;  3ZNG A;  2A5U A;  2P2C P;  4Q96 A;  4BET A;  3ZPJ A;  1FPP A;  2WXH A;  4BER A;  5JJ7 A;  3MV2 B;  2V8S E;  3QNK A;  4A1S A;  3ZGQ A;  2FBN A;  4G26 A;  3UUX A;  3J5Q B;  4WND A;  3OXG A;  5ARF A;  4HBD A;  3GZS A;  1H19 A;  3LVR E;  2IO3 C;  3CHP A;  3UT8 A;  1BI7 B;  4BY6 A;  3BEE A;  2WXG A;  2YNQ A;  3FU3 A;  3MYV A;  4J0U A;  2WXL A;  3TJP A;  4LCT A;  2XZD G;  3R7R A;  3EU5 A;  4I43 A;  4Y6C A;  2R2L A;  2HE0 A;  1UW4 B;  3OXF A;  3Q7A A;  2KCL A;  1MX2 A;  3VLE A;  2FO7 A;  1X81 A;  2QYJ A;  3L9T A;  3D9H A;  4RQI A;  1LD8 A;  3CV0 A;  1HZ4 A;  1HFA A;  3UQ3 A;  3GW4 A;  5KCM A;  3OXL A;  3LJN A;  1IXV A;  3CHM A;  1Z5S C;  2DYS E;  1D9S A;  3MX3 A;  3KSL A;  4HOR A;  1AP7 A;  3RRN B;  2A4Z A;  3IEG A;  4A1G A;  5EN5 D;  5J08 A;  4L9P A;  1S0P A;  3KEZ A;  3I4R B;  2ZGG A;  2R17 C;  3UM2 A;  4G24 A;  1N11 A;  1EF1 C;  3FUK A;  3IXE A;  3I4G A;  4PDX A;  2XHE A;  3R7Q A;  4JW1 A;  3ZFW A;  3SNX A;  2OVB A;  3SBT B;  5J90 A;  4GA2 A;  4NRH B;  3ZYK A;  4WNE A;  5EIB E;  4GTP A;  4JVS A;  3CK7 A;  1O1T A;  3QOU A;  3PNL B;  5ENT D;  4YDY A;  3CQC B;  4WWP A;  1Y6I A;  3ULY A;  3JXJ A;  3PUJ A;  3ZUV B;  3ABM E;  1MYO A;  4G8K A;  4ILH B;  4EBA G;  3BG0 B;  5ITZ F;  4GCO A;  4J8E A;  1OY3 D;  4HLE A;  4DI4 A;  4BWR A;  3IHV A;  4L23 A;  5IY5 E;  3RRM B;  4KT6 B;  4XEI G;  3CGH A;  5AQA A;  1SZ9 A;  5JJ6 A;  3JXI A;  5C2Y A;  1SQM A;  4WWN A;  2RFA A;  1D8E A;  3B95 A;  2UY1 B;  1KPS B;  1NP7 A;  3RIB A;  4FAD A;  4DPR A;  2LO6 A;  5A7D B;  4CCA A;  4JB8 P;  3T5V A;  4PS3 A;  3V2X A;  3I5P A;  3MGB A;  1N4R A;  4JXT A;  2R59 A;  5CER B;  5DBK A;  1HG2 A;  1TNO A;  2X6J A;  4GTQ A;  3NOC D;  3T9K A;  3S7D A;  3FH5 A;  4UWK A;  4M3O A;  4N2S A;  2VYI A;  2CG2 A;  2WXJ A;  2KXP C;  3Q4A B;  1U3C A;  3EDT B;  1V55 E;  3LY8 A;  2EIN E;  2YIN A;  3FUJ A;  3RU0 A;  5FTP A;  2WMO A;  5T3R A;  3RJV A;  3ULE G;  2VSN A;  1IKN D;  4JPS A;  2AXZ A;  4NAC A;  2P9I G;  4LEU A;  5T8I A;  5KJN A;  3C3O A;  5EX3 A;  1RZ4 A;  2WQ6 A;  3V79 K;  4AOF A;  1TNB A;  3RSE G;  4D10 C;  2XPZ A;  4HOS A;  1UOH A;  4N3B A;  1INZ A;  3LEW A;  5D66 A;  2XEN A;  4GTO A;  3TWU A;  2BKK B;  4KYO B;  5G05 C;  4QFV A;  3FTU A;  3FUM A;  4JD2 G;  3CVL A;  3R9A B;  3DEO A;  1H6K A;  4HRN A;  4DUI A;  2RKK A;  3FTY A;  3JCK C;  4OVV A;  3G2U A;  3V30 A;  4AP2 A;  4GYW A;  2JAB A;  4EQF A;  1KZO A;  5CED B;  3G2T A;  4J8Y A;  2J4D A;  1OCC E;  4GTV A;  4UWL A;  3QB2 A;  4XI0 A;  5G55 A;  5EX0 A;  2V5F A;  2XQ0 A;  1S64 A;  1N0R A;  2WB2 A;  5KJM A;  2XPY A;  5CMW A;  1H0A A;  4BTB A;  5FQ6 A;  1JWG A;  3G2V A;  4RG6 A;  2ION A;  3NZS A;  4B0Z A;  5KJL A;  2IEJ A;  4X8Q A;  3PE3 A;  2XEE A;  2PZI A;  4JA9 A;  3RKV A;  2XGS A;  1LF8 A;  1HH8 A;  2KZT B;  1X5B A;  3ZKJ A;  2MRI A;  2WXO A;  4HRM B;  3P2B A;  4A63 B;  5AQB A;  1UN8 A;  3URZ A;  4DLQ A;  1FCH A;  2IOL A;  3E32 A;  2B6C A;  3FY4 A;  1YCS B;  3UM0 A;  4N5C A;  2I6H A;  1JUQ A;  1SW6 A;  2GRQ B;  2VSX E;  3DSV A;  3HRA A;  4FA6 A;  2OOE A;  3Q79 A;  3D9P A;  2A5E A;  5LP0 A;  5LFA A;  4LSZ E;  4PS8 A;  4EZJ A;  3TWV A;  2C0L A;  2OEV A;  4TXQ A;  3APD A;  4B8C B;  3EHN A;  4I6J A;  2E0I A;  2F8Y A;  2FF4 A;  2M63 A;  3QDN A;  4TUM A;  1K1B A;  2IY0 C;  1H6P A;  1N95 A;  5FT9 A;  2LSU A;  4JA7 A;  4G11 A;  2XPI A;  3FUE A;  1VDY A;  4HI9 A;  1AWC B;  4AV7 A;  3DBS A;  3CKC A;  5BXO A;  3TAX A;  4FJY A;  5ENP D;  3Q75 A;  3FDH A;  4DX1 A;  3GYZ A;  4HS2 A;  4JEU A;  2OV8 A;  3ZYQ A;  3L82 A;  3J5P A;  3MEK A;  3FU5 A;  5FQ8 A;  3F6Q A;  5FZQ A;  3FP3 A;  3UMV A;  4C0E A;  3CVN A;  4AJW A;  3DRA A;  3UXG A;  3CVX A;  3TWT A;  3WXX A;  3ZVV A;  1TEZ A;  5ENQ D;  2CHZ A;  3NAW A;  2P9L G;  3RO3 A;  4P29 A;  5D2M C;  3MA5 A;  3SFZ A;  2AJA A;  2P9N G;  4MLP A;  3S7B A;  1KT1 A;  2GRM A;  4EHM A;  4YVO A;  1HF8 A;  3D3M A;  2R02 A;  3FUI A;  1HS6 A;  4FP7 A;  2C0M A;  2XRZ A;  3O4Z A;  2RD0 A;  3QWW A;  2LAI A;  3AU5 A;  5CEC B;  4GZD A;  3UT4 A;  2VTB A;  4FHK A;  5AAR A;  2X38 A;  4LUN U;  1P5Q A;  1L5J A;  3CR3 A;  1ZU2 A;  4JC8 A;  2VGY A;  3FTZ A;  3U3W A;  4ANU A;  5HKP A;  3ASH A;  4DLO A;  3ZHE A;  1NA3 A;  4U04 A;  1E8X A;  5JA4 D;  2L0T B;  1H2U A;  4ACK A;  3ZYL A;  3NZU A;  4K5B A;  3FEY A;  4HNA D;  3W9G A;  4F6R D;  4ILI A;  4UUC A;  2MYO A;  1S63 A;  1OWO A;  5E76 A;  2MOW A;  4CDN A;  2VJ8 A;  5BUZ A;  4U0U A;  4GML A;  1S70 B;  2FEZ A;  3D9L A;  1IHB A;  2GRO B;  4U7E B;  3ENE A;  4J8F A;  5LCW J;  3TXN A;  2VGX B;  3LY7 A;  3E33 A;  5AIJ A;  4UQZ A;  5KJK A;  4WWO A;  3AJI A;  1BLX B;  3S7J A;  3VLF A;  1SVX A;  2ETA A;  4HVB A;  2XS8 A;  4AXH A;  2WPV A;  2BUG A;  3ESK A;  4NQ0 A;  2GRL A;  3LKU A;  4OAV B;  4JZY A;  2J8S D;  2V4H C;  5FIN A;  3LPZ A;  1E8Z A;  5D0Q D;  3SQV A;  3HYM B;  2DCP A;  3L22 A;  4PH4 B;  1TYQ G;  4E85 A;  3C98 A;  4HI8 A;  3BG1 B;  4WNG A;  4BTA A;  5AQ7 A;  3HXE A;  4J8S A;  3ZXP A;  4PS7 A;  1ELW A;  1QNF A;  3HXF A;  3HG0 D;  4LER A;  5AJL A;  5D0O D;  4KMO A;  4I1M A;  1HE8 A;  2J07 A;  3VTY A;  2DVW A;  3DPD A;  4GTR A;  3CVQ A;  1IYG A;  4IRU A;  5BT1 A;  5KWD A;  1TNY A;  4ATG A;  4FLH A;  2LXM A;  3L54 A;  5JMN D;  2YQ8 A;  4MBG A;  4GYY A;  2P9P G;  2KC7 A;  4MS6 A;  4YDO A;  5FQ4 A;  2AXV A;  3PEU B;  3APC A;  3NQP A;  2XRY A;  1KT0 A;  1JCS A;  4KBQ A;  1OCZ E;  1FT2 A;  3CVU A;  4M7C A;  1OUV A;  3FTS A;  3PH0 C;  4LNU D;  4V3I A;  2GRR B;  2H6I A;  3FUL A;  3D9O A;  2IQC A;  3DXK G;  3PZ3 A;  4KZC A;  1G3N B;  1DVP A;  4ZFH A;  1Z3Y A;  5G04 J;  1DC2 A;  4QQI A;  3T5X A;  2AVP A;  4B89 A;  3U66 A;  3ABL E;  3TGO A;  4AM9 A;  1ELR A;  4CT0 A;  4U63 A;  1WG0 A;  1K3Z D;  1QYM A;  2XEH A;  1E8W A;  2X6H A;  3CEQ A;  1N52 A;  4TRQ A;  2FUL A;  4ME2 A;  2VQ2 A;  1TNU A;  2DBA A;  3D9M A;  1WY6 A;  5HRY A;  4BSX A;  4GMJ A;  3ZN3 A;  4AIF A;  4XIF A;  3QAQ A;  2WQ7 A;  4J8D A;  2YHC A;  2FO1 E;  3LDZ A;  4K0R A;  3JQ1 A;  2WXN A;  2X6K A;  3SGH A;  4GU5 A;  3MZL B;  3ASG A;  2VGE A;  1YYH A;  1TR4 A;  3JQ0 A;  4IUL A;  3U64 A;  1UJJ A;  5CBO A;  4N39 A;  1HX8 A;  4G8L A;  4TV3 A;  1NFI E;  5EKQ D;  3FU6 A;  1E8Y A;  3RK6 A;  4FUL A;  3SD5 A;  4DX6 D;  2J9Q A;  2LNI A;  3ZIM A;  1ELK A;  3C5R A;  3CIA A;  4PUC A;  2WM9 A;  5EYL A;  3RAU A;  5AYW D;  3AG4 E;  5CMY A;  1SA5 A;  1O5M A;  2BF0 X;  2R05 A;  5ARG A;  2Y1L E;  4LNG A;  2AWI A;  4GTM A;  4EBA A;  1E7V A;  4L7T A;  4C0M A;  4I9E A;  4CRW A;  3HXC A;  3QK0 A;  3EU9 A;  2XGO A;  2ZIR A;  3X2Q E;  4K5A B;  2GW1 A;  3ZEF A;  3DSW A;  1NL4 A;  2H6H A;  2GGF A;  2CHW A;  2ZIS A;  3UIO C;  1OWP A;  4FHJ A;  5ANR A;  1ZBP A;  4GYO A;  3DEP A;  4O1O A;  3O48 A;  2Y3A A;  1EDU A;  1Z6T A;  4GAA A;  2F8X K;  3DWL G;  5HS0 A;  3PZD A;  1UN9 A;  3E34 A;  2IJG X;  4ILG A;  4KXK B;  4UI9 J;  3EIJ A;  3KS2 A;  3LJ3 A;  5JHA A;  1DNP A;  1N4P A;  2X6I A;  2IU1 A;  5FQ7 A;  3U4T A;  2H6F A;  3HVE B;  3CVY A;  2QC9 A;  1JCQ A;  1OCR E;  3EUV A;  3MKQ A;  3E30 A;  3QJZ A;  2UY1 A;  3ASD A;  5FZR A;  5CRV A;  3IHY A;  4C48 B;  1N94 A;  3S7F A;  3TWR A;  3ASO E;  1TN8 A;  3FWV A;  2IOS A;  3UKR G;  3NB2 A;  2I9C A;  3S2A A;  3DSX A;  3EJN A;  5AEN A;  3TG5 A;  3I3N A;  3ML9 A;  4O60 A;  4ATZ D;  2I2O A;  1WDY A;  2Y4T A;  3DST A;  2P9S G;  3LY9 A;  3V31 A;  2HYZ A;  4F7A A;  2PM6 A;  3QAR A;  3UIP C;  2VTB B;  3L13 A;  3G2W A;  4J6I A;  3N71 A;  3CK8 A;  1EPU A;  3LVQ E;  1YA0 A;  2CFU A;  2PM7 A;  4BFR A;  5CRU A;  1BPO A;  1BD8 A;  2XCC A;  4BT8 A;  2EQX A;  2R5S A;  1JCR A;  1TN6 A;  3FEX A;  4HFG A;  1OWM A;  4CYM D;  4Z68 A;  3R9M A;  4BEP A;  1JWF A;  3QKY A;  3UI2 A;  4I1A A;  5T4Y A;  1EYH A;  3B7U X;  4GMR A;  5ENO D;  3L08 A;  3IBE A;  1MQS A;  3TWS A;  3E4B A;  4HRL A;  4GCN A;  5FIO A;  2V5Q C;  4Y6W A;  1O1S A;  2WXF A;  4A3T A;  4A55 A;  2EIL E;  5M72 A;  3TWX A;  3PE4 A;  2Y4U A;  2XZT G;  3HHM A;  3ML8 A;  1N54 A;  4BX8 A;  2KCV A;  3SBS A;  1IQR A;  4RLY A;  5BW8 C;  4BX9 A;  4EEC A;  1WM5 A;  1IQU A;  3HIZ A;  3D9I A;  2Q7F A;  3EHR A;  5KBA A;  1NI1 A;  3FTX A;  2LSV A;  1TJF A;  3KSQ A;  4DRX E;  3CHQ A;  2NSZ A;  4DX7 D;  3Q73 A;  4XI9 A;  5LCW C;  2QY7 A;  1WAO 1;  4KZ0 A;  4ACL A;  3SF4 A;  4ANW A;  1QQE A;  3TG4 A;  4N2Q A;  5A6C A;  2KZT A;  2WQH A;  4U95 D;  3SHF A;  1QZ2 A;  3ULQ A;  4O6F A;  4TUU A;  4IYP A;  3FUH A;  5AJD A;  4YVQ C;  1KLX A;  1MZC A;  2I1J A;  4UQY A;  2PQN A;  3MJW A;  1RW2 A;  1DCQ A;  1MJ0 A;  5E75 A;  1E7U A;  3Q7F A;  2WVI A;  4GA1 A;  1H6O A;  2OVF A;  2GRN B;  2X6F A;  4GZ5 A;  3OTN A;  3C72 A;  4CZ2 D;  3ISM C;  3ASN E;  3FFL A;  4FJZ A;  3VLD A;  3ZYM A;  4UQX A;  3GZ2 A;  4F1S A;  2RFM A;  4CGW A;  2KM4 A;  2Y0B G;  4ABN A;  2EIM E;  3BQO A;  4WNF A;  4BSZ B;  3PZ4 A;  2BKG A;  3KEA A;  4AEZ C;  3PNT B;  4O1P A;  3MKR A;  3ZXS A;  4JHK A;  4AY6 A;  4XE0 A;  5DIZ A;  3WG7 E;  4DX5 D;  2RG8 A;  1SZA A;  4JHJ A;  1Y8M A;  5HI7 A;  3ONK A;  3L17 A;  4U0Z A;  3FH7 A;  3ZU7 B;  3HXD A;  4CT4 A;  3HDX A;  3CHO A;  3DSU A;  4JL0 A;  3DPY A;  1H2T C;  2VSO E;  2WXM A;  2BED A;  4XKC A;  4WAF A;  3AS8 A;  3CSF A;  3BU8 A;  1JPL A;  4U8V D;  3ONL A;  3BUA A;  2P9K G;  1ZB1 A;  3SFY A;  3FH8 A;  3MV3 B;  3SI5 A;  4GPK A;  1N4Q A;  3ABK E;  3K9I A;  3EHQ A;  2QZA A;  5G04 C;  5CCL A;  3E37 A;  1FT1 A;  1PAQ A;  5AQ9 A;  3B7S A;  2F0Y A;  5CCM A;  4I2Z A;  3TL5 A;  2CHX A;  4RVB A;  3FUN A;  5CHE E;  1B89 A;  3JYS A;  2J08 A;  1NZN A;  5BV1 A;  3CVV A;  3JUI A;  2DZO A;  3ASF A;  4GZC A;  2AW6 A;  4FU3 A;  3AS4 A;  4U07 A;  4U96 D;  3CHR A;  3D9N A;  4GA0 A;  4I2W A;  1OT8 A;  4U8Y D;  4HQD A;  1OCO E;  3AG2 E;  3LXU X;  3D9J A;  2NXP A;  1TJC A;  3U9W A;  1MX6 A;  3FHE A;  2EIK E;  2J09 A;  4GZ6 A;  1MHQ A;  2PQR A;  5KNG A;  3UT7 A;  3TXM A;  5AAO A;  3L6A A;  2OCC E;  5ANL A;  3APF A;  2X3M A;  3IKO B;  4HOU A;  3KAE A;  3AU4 A;  5AN8 A;  3FTW A;  3NOG D;  2VGX A;  4F3V A;  2ETC A;  3MCX A;  4Q69 A;  3EIQ C;  3FU0 A;  1MX4 A;  3DSS A;  3L16 A;  3FTV A;  3Q47 B;  4RG9 A;  3Q5M A;  1TN7 A;  2LUH A;  3CKB A;  1PC2 A;  3MKQ B;  3AS5 A;  5EID A;  5A23 A;  1NA0 A;  5B1A E;  4LG6 A;  4HXI A;  3FUF A;  3QWP A;  3CK9 A;  3TWW A;  3KD7 A;  1UJK A;  3EHM A;  1N0Q A;  3VTX A;  4WUY A;  1V54 E;  2WXP A;  4UWG A;  4R7L A;  3DXM G;  3RO2 A;  4UI9 C;  1BI8 B;  3ZW3 A;  2P58 C;  1U2V G;  2I1K A;  4TXR A;  5BPP A;  2BTD A;  4EPZ A;  2AXU A;  2JLB A;  3Q78 A;  5CBN A;  4HLL A;  4U8H A;  4L1B A;  3T8K A; 
#chains in the Genus database with same CATH homology
 4GZD A;  2HYZ A;  3Q49 B;  3B7T A;  4G24 A;  3UT4 A;  4F7A A;  2PM6 A;  4FHK A;  3UX4 A;  4KVM A;  4N3A A;  3QAR A;  2X38 A;  2CFZ A;  4GB9 A;  2VTB B;  3L13 A;  3G2W A;  4J6I A;  3T8M A;  1EF1 C;  1P5Q A;  2WXR A;  1L5J A;  3FUK A;  3CR3 A;  3N71 A;  4LUN U;  3OAW A;  3I4G A;  3CK8 A;  4PDX A;  1ZU2 A;  4L2L A;  1EPU A;  4JC8 A;  3LVQ E;  2VGY A;  2XHE A;  1YA0 A;  1GW6 A;  3FTZ A;  3ESL A;  2CFU A;  3R7Q A;  4JW1 A;  2PM7 A;  1IHG A;  4BFR A;  3ZFW A;  3SNX A;  3U3W A;  1BPO A;  2XCC A;  4BT8 A;  5ENN A;  4ANU A;  4CGV A;  3ASH A;  4DLO A;  2EQX A;  3ZHE A;  2WXQ A;  2C2L A;  5LX8 A;  1NA3 A;  2R5S A;  2WXK A;  2OVB A;  5FZS A;  4U04 A;  1E8X A;  3FEX A;  3PDN A;  4HFG A;  3PRZ A;  1OWM A;  4GA2 A;  2L0T B;  4NRH B;  3SBT B;  3ZYK A;  4WNE A;  5J90 A;  1FVH A;  4JVS A;  3FUD A;  1H2U A;  4UWH A;  3ZYL A;  3NZU A;  4ACK A;  3FEY A;  3CK7 A;  2HO1 A;  1XNF A;  4ILI A;  3QOU A;  3PNL B;  1OWO A;  1JWF A;  3QKY A;  2ZU6 B;  3CQC B;  4I1A A;  4AVX A;  5T4Y A;  4WWP A;  1EYH A;  3B7U X;  1Y6I A;  5E76 A;  2MOW A;  3L08 A;  4CDN A;  4G1T A;  2VJ8 A;  3PUJ A;  3RRU A;  5BUZ A;  3IBE A;  4U0U A;  4ILH B;  4EBA G;  4GML A;  3BG0 B;  2FEZ A;  4C9B B;  3D9L A;  4GCO A;  1PY1 A;  4H7X A;  1MQS A;  3ENE A;  4J8F A;  2V0P A;  3E4B A;  5LCW J;  4J8E A;  4GCN A;  3TXN A;  4Y6W A;  2QFC A;  2VGX B;  4FC8 A;  4MRU A;  4HLE A;  2IF4 A;  3LY7 A;  5LOZ A;  4DI4 A;  2WXF A;  4A3T A;  4BWR A;  3IHV A;  4A55 A;  5AIJ A;  4L23 A;  2DIW A;  3RRM B;  4KT6 B;  4UQZ A;  5KJK A;  4WWO A;  5M72 A;  3CGH A;  3S7J A;  4CDR A;  3PE4 A;  2Y4U A;  1H2V C;  3VLF A;  1SZ9 A;  2XGM A;  2E2E A;  4CDM A;  4HVB A;  4AXH A;  3HHM A;  3ML8 A;  2WPV A;  2IFU A;  1N54 A;  5JJ6 A;  4BX8 A;  4EZK A;  5JJT A;  2KCV A;  2KAT A;  4I6G A;  3SBS A;  1IQR A;  2PL2 A;  2BUG A;  5C2Y A;  1SQM A;  5BW8 C;  4W9R A;  4BX9 A;  4WWN A;  3ESK A;  4NQ0 A;  4EEC A;  2GRL A;  3LKU A;  4MKT A;  4I17 A;  2UY1 B;  1UG3 A;  4ANX A;  4JZY A;  2L6J A;  1WM5 A;  1IQU A;  3HIZ A;  3LPZ A;  1E8Z A;  1NP7 A;  5D0Q D;  3D9I A;  4G23 A;  3RIB A;  2ILR A;  3HYM B;  2DCP A;  2Q7F A;  3L22 A;  1HG5 A;  4PH4 B;  2HM8 A;  4FAD A;  4A3V A;  3FTX A;  4KVO A;  2LSV A;  4DPR A;  4HOQ A;  4E85 A;  2LO6 A;  5A7D B;  3PS6 A;  1TJF A;  4CCA A;  4LRZ A;  3C98 A;  3T5V A;  4PS3 A;  3CHQ A;  3I5P A;  3MGB A;  4JXT A;  2NSZ A;  3QC1 A;  4XI9 A;  3BG1 B;  2R59 A;  3D9K A;  4WNG A;  5C1D A;  5LCW C;  4BTA A;  2QY7 A;  5DBK A;  1WAO 1;  1HXI A;  4KZ0 A;  1HO8 A;  1HG2 A;  4ACL A;  3SF4 A;  4J8S A;  4ANW A;  2L9B A;  2X6J A;  3NF1 A;  5JHB A;  1QQE A;  5G05 J;  3TG4 A;  4PS7 A;  1ELW A;  1QNF A;  4N2Q A;  5A6C A;  2KZT A;  4LER A;  2WQH A;  5AJL A;  3S7D A;  2WMN A;  3FH5 A;  3SHF A;  5D0O D;  4KMO A;  4I1M A;  1HE8 A;  4M3O A;  4UWK A;  1QZ2 A;  2VYI A;  3ULQ A;  1Z3X A;  4O6F A;  2J07 A;  4N2S A;  2CG2 A;  4TUU A;  4IYP A;  3VTY A;  3FUH A;  2WXJ A;  3Q4A B;  4G25 A;  5AJD A;  4BT9 A;  1U3C A;  3EDT B;  3DPD A;  4JEH A;  4AY5 A;  3CLJ A;  4YVQ C;  3CVQ A;  2VTB A;  1IYG A;  1KLX A;  3LY8 A;  2I1J A;  4IRU A;  5BNW A;  2YIN A;  4UQY A;  2PQN A;  3FUJ A;  3RU0 A;  3SZ7 A;  3MJW A;  1OWN A;  2LAH A;  5BT1 A;  4Q94 A;  5FTP A;  2OND A;  2WMO A;  3G2S A;  5T3R A;  3RJV A;  4ATG A;  4FLH A;  4XX5 A;  2VSN A;  2FI7 A;  5E75 A;  4E6H A;  3LS8 A;  1E7U A;  3CHS A;  3QWV A;  3PEV B;  4U0S A;  5FJY A;  4JPS A;  3L54 A;  2YQ8 A;  2WVI A;  2AXZ A;  4NAC A;  4GYY A;  4GA1 A;  3B13 A;  2KC7 A;  2OVF A;  4LEU A;  4MS6 A;  4NUR A;  5T8I A;  5KJN A;  4RSY A;  5FQ4 A;  5EX3 A;  1HU3 A;  1XGW A;  2WQ6 A;  2AXV A;  2X6F A;  3PEU B;  4GZ5 A;  3ZHE B;  3ZRH A;  4AOF A;  2XCB A;  3APC A;  3OTN A;  3CVW A;  5G2N A;  4D10 C;  3NQP A;  2XPZ A;  2XRY A;  4HOS A;  1KT0 A;  4KBQ A;  3FFL A;  1W3B A;  4FJZ A;  3VLD A;  3ZYM A;  4N3B A;  1INZ A;  4UQX A;  3GZ2 A;  2NC9 A;  4OYS A;  3LEW A;  4F1S A;  4CGW A;  2KM4 A;  4KYO B;  5G05 C;  3CVU A;  4QFV A;  4ABN A;  1OUV A;  4L2Y A;  3FTS A;  3FTU A;  3PH0 C;  4V3I A;  4WNF A;  2CG3 A;  3FUM A;  3FUL A;  2UWJ G;  2WXI A;  3D9O A;  2IQC A;  4YND A;  3CVL A;  4KZC A;  3R9A B;  4AEZ C;  4URK A;  1DVP A;  4APF A;  1U3D A;  3PNT B;  1H6K A;  1Z3Y A;  3MKR A;  5G04 J;  3ZXS A;  2KCK A;  5EDS A;  4JHK A;  4OVU A;  4UWF A;  3T5X A;  2AVP A;  4B89 A;  3U66 A;  4AY6 A;  4XE0 A;  3TGO A;  4DI3 A;  2JEK A;  3FTY A;  4AM9 A;  5DIZ A;  2V4L A;  2RG8 A;  1SZA A;  3JCK C;  1ELR A;  4JHJ A;  4CT0 A;  1Y8M A;  5HI7 A;  3ONK A;  4OVV A;  4U63 A;  3LCA A;  4I6E A;  3L17 A;  4U0Z A;  3G2U A;  1E8W A;  4IN3 B;  2HR2 A;  2X6H A;  3FH7 A;  3CEQ A;  4AP2 A;  1N52 A;  4GYW A;  4CT4 A;  4TRQ A;  1OWL A;  3HDX A;  3CHO A;  2FUL A;  3Q15 A;  2VQ2 A;  4ME2 A;  1E90 A;  3HVE A;  4EQF A;  5HQ8 A;  4HOT A;  2YHE A;  2DBA A;  3D9M A;  4JL0 A;  1WY6 A;  4BSX A;  1H2T C;  4GMJ A;  4JHR A;  3ZN3 A;  2VSO E;  3G2T A;  4AIF A;  2WXM A;  2J4D A;  4XIF A;  3QAQ A;  2J4B A;  4XKC A;  2WQ7 A;  4J8D A;  2YHC A;  4WAF A;  3AS8 A;  3CSF A;  3LDZ A;  4UWL A;  3PUK A;  3QB2 A;  4XI0 A;  4K0R A;  5G55 A;  1JPL A;  4F53 A;  3JQ1 A;  3CVP A;  5EX0 A;  2V5F A;  4CEM A;  2XQ0 A;  4DJA A;  2WXN A;  3ONL A;  2X6K A;  3SGH A;  4GU5 A;  1E96 B;  3MZL B;  2WB2 A;  5KJM A;  3ASG A;  2XPY A;  5CMW A;  1H0A A;  4BTB A;  3FH8 A;  3JQ0 A;  3MV3 B;  5FQ6 A;  3SI5 A;  4GPK A;  2MHK A;  4IUL A;  1JWG A;  3G2V A;  4RG6 A;  3GZ1 A;  3K9I A;  4UI9 K;  4EZL A;  2ION A;  3NZS A;  5G04 C;  3U64 A;  5FWQ A;  4B0Z A;  5CCL A;  1A17 A;  5KJL A;  3LYA A;  1UJJ A;  1PAQ A;  3PE3 A;  4N39 A;  1HX8 A;  2PZI A;  4JA9 A;  3RKV A;  4TV3 A;  2XGS A;  3B7S A;  1LF8 A;  5CCM A;  4I2Z A;  5EKQ D;  1HH8 A;  2KZT B;  3TL5 A;  1X5B A;  2CHX A;  4I1O B;  4N3C A;  2MRI A;  3FU6 A;  2WXO A;  3IV0 A;  4XZ4 A;  4GZ3 A;  1E8Y A;  1FVF A;  3P2B A;  2L0I A;  3RK6 A;  3CST A;  4RVB A;  1UN8 A;  4FUL A;  3URZ A;  3FUN A;  5CHE E;  3PVL A;  3SD5 A;  4DLQ A;  2J9Q A;  1FCH A;  3B7R L;  2IOL A;  2LNI A;  4K03 A;  3ZIM A;  5BV0 A;  1B89 A;  3P1U A;  2J08 A;  3JYS A;  1ELK A;  1NZN A;  2XEV A;  3CIA A;  3FY4 A;  4FLB A;  2WM9 A;  4PUC A;  4ANV A;  3PRE A;  5BV1 A;  5AYW D;  3CVV A;  4N5C A;  2I6H A;  3JUI A;  3ASF A;  1JUQ A;  4GZC A;  2VSY A;  4DK5 A;  5CMY A;  2VSX E;  4I9C A;  2BF0 X;  4XKB A;  4G2V A;  2J49 A;  5ARG A;  2AW6 A;  2AWI A;  4FA6 A;  2OOE A;  4FU3 A;  4EBA A;  3D9P A;  1E7V A;  4B94 A;  3UPV A;  4L7T A;  5LP0 A;  5LFA A;  4B8A A;  3CQG B;  4APO A;  4H7Y A;  2A5U A;  4C0M A;  3AS4 A;  4I9E A;  4U07 A;  4PS8 A;  3QK0 A;  4CRW A;  4EZJ A;  3CHR A;  2XGO A;  2C0L A;  3D9N A;  4Q96 A;  4GA0 A;  4I2W A;  3ZPJ A;  2WXH A;  5JJ7 A;  3MV2 B;  2GW1 A;  2V8S E;  3APD A;  3QNK A;  3ZEF A;  4B8C B;  3EHN A;  4A1S A;  4I6J A;  2E0I A;  3ZGQ A;  2FBN A;  3LXU X;  2FF4 A;  2NXP A;  2M63 A;  1TJC A;  3D9J A;  3QDN A;  4G26 A;  2GGF A;  2CHW A;  3U9W A;  1OWP A;  3FHE A;  4FHJ A;  4WND A;  5ANR A;  3UUX A;  1ZBP A;  2J09 A;  4GYO A;  4GZ6 A;  3OXG A;  5FT9 A;  3O48 A;  2Y3A A;  1EDU A;  1MHQ A;  1Z6T A;  2LSU A;  2PQR A;  4GAA A;  4JA7 A;  5ARF A;  3GZS A;  4G11 A;  3TXM A;  3UT7 A;  1H19 A;  3L6A A;  3PZD A;  5ANL A;  1UN9 A;  2XPI A;  3APF A;  3FUE A;  2X3M A;  3IKO B;  3LVR E;  1VDY A;  4HOU A;  3KAE A;  3AU4 A;  3FTW A;  3CHP A;  4AV7 A;  2IJG X;  3UT8 A;  2VGX A;  4F3V A;  4BY6 A;  3DBS A;  3BEE A;  2WXG A;  4ILG A;  3CKC A;  4KXK B;  3MCX A;  4Q69 A;  3EIQ C;  3FU0 A;  4UI9 J;  3TAX A;  3EIJ A;  3KS2 A;  2YNQ A;  3FU3 A;  4FJY A;  3LJ3 A;  5JHA A;  3MYV A;  1DNP A;  4J0U A;  2WXL A;  3FTV A;  2X6I A;  2IU1 A;  3L16 A;  5FQ7 A;  3HVE B;  3U4T A;  3FDH A;  3Q47 B;  3GYZ A;  4RG9 A;  3TJP A;  3CVY A;  4HS2 A;  4JEU A;  2OV8 A;  3Q5M A;  3ZYQ A;  3MEK A;  4LCT A;  3R7R A;  3FU5 A;  3CKB A;  5FQ8 A;  3MKQ A;  4I43 A;  4Y6C A;  5FZQ A;  1PC2 A;  3FP3 A;  3UMV A;  4C0E A;  3CVN A;  3QJZ A;  3MKQ B;  1UW4 B;  3AS5 A;  3OXF A;  2KCL A;  2UY1 A;  4AJW A;  3VLE A;  2FO7 A;  3CVX A;  3ASD A;  3WXX A;  5A23 A;  1NA0 A;  3ZVV A;  5FZR A;  3CV0 A;  1TEZ A;  3IHY A;  2CHZ A;  1HZ4 A;  1HFA A;  4HXI A;  3FUF A;  3S7F A;  3UQ3 A;  3RO3 A;  3GW4 A;  4P29 A;  5KCM A;  3QWP A;  3OXL A;  3CK9 A;  3KD7 A;  1UJK A;  3EHM A;  3VTX A;  3MA5 A;  3FWV A;  2IOS A;  3SFZ A;  4WUY A;  3CHM A;  2I9C A;  4MLP A;  3S2A A;  2WXP A;  4UWG A;  4R7L A;  3MX3 A;  3S7B A;  1KT1 A;  2GRM A;  3EJN A;  5AEN A;  3TG5 A;  4HOR A;  3RO2 A;  3I3N A;  3ML9 A;  4UI9 C;  4YVO A;  3RRN B;  2A4Z A;  3IEG A;  4A1G A;  3ZW3 A;  1HF8 A;  2I2O A;  3D3M A;  2P58 C;  3FUI A;  1HS6 A;  4FP7 A;  2Y4T A;  5J08 A;  2C0M A;  2XRZ A;  2I1K A;  3O4Z A;  2RD0 A;  1S0P A;  5BPP A;  3KEZ A;  3I4R B;  2BTD A;  4EPZ A;  3QWW A;  2AXU A;  2JLB A;  2LAI A;  3AU5 A;  4U8H A;  4L1B A;  2R17 C;  3LY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...