1UW6A

X-ray structure of acetylcholine binding protein (achbp) in complex with nicotine
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
208
structure length
208
Chain Sequence
b'EFDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE-BINDING PROTEIN
publication title Nicotine and Carbamylcholine Binding to Nicotinic Acetylcholine Receptors as Studied in Achbp Crystal Structures
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Glycoprotein
total genus 52
structure length 208
sequence length 208
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature
pdb deposition date 2004-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 1uw6A00
2YKSA 1I9BA 5AFKA 2QC1B 3TLVA 2XQAA 4WV9A 4A97A 3LSVA 5FJVA 3UUBA 3TLTA 4A98A 5KZUA 2Y7YA 2WNLA 2XNTA 3JAFA 3JADA 4ZK1A 3P50A 2XQ5A 5L4HA 2Y56A 4ILAA 3EAMA 3GUAA 5BW2A 5HEHA 5L47A 4ZZCA 4TNVA 3RQWA 3SQ6A 3T4MA 5HEGA 4UY2A 4TWDA 2YN6A 3RQUA 5KE4A 3PEOA 3WTJA 5BP0A 4HFEA 3WIPA 2ZJVA 3C79A 3IGQA 4COFA 3EHZA 5HCMA 5CO5A 2WNCA 4QH5A 5AFLA 3WTOA 4DBMA 4Z90A 3WTKA 4AFTA 4PIRA 4NZBA 4HFDA 4UM3A 4ZJSA 3TLSA 2XYTA 4ZJTA 2BR7A 5HEOA 4UM3P 2WNJA 3SQ9A 3U8KA 4HFIA 2X00D 4UM3S 2XQ4A 2XNVA 2BG9C 2W8GA 4ZR6A 4NPPA 3UU5A 2Y57A 2XQ6A 4ZK4A 3U8MA 4TWHA 5HCJA 2XYSA 3UU3A 3UQ4A 5CFBA 3UQ7A 4HFHA 2Y58A 4QH4A 5AINA 5LG3A 5AFNA 3SIOA 2X00A 4HFCA 2W8FA 3RI5A 5JMEA 2WZYA 5LXBA 2XNUA 2XZ6A 4XHEA 3ZDHA 3ZDGA 2Y54A 5HEJA 5SYOA 4QH1A 3RIFA 3RHWA 4QABA 4ALXA 5HEUA 3PMZA 4XK9A 3UU8A 4IL4A 4ILBA 5J5FA 3WTHA 5J0ZA 3C84A 2C9TA 4UM1A 5AFMA 4TWFA 2PH9A 4F8HA 2XQ3A 2BG9A 1UX2A 2BYNA 4HFBA 2XQ8A 5BRXA 5L4EA 4BQTA 2BG9E 3ZKRA 4B5DA 5J5GA 2BYPA 3TLUA 2BR8A 5AFHA 2BYRA 4FRRA 3TLWA 3WTNA 3U8LA 4AFGA 5IUXA 3P4WA 4BFQA 5J5HA 2BYSA 5AFMB 4IL9A 2WN9A 4AFHA 1UW6A 3JAEA 4QACA 4UXUA 4EZ1A 2YMDA 4LMKA 2BG9B 4Z91A 4QAAA 4LMLA 3U8JA 5TVCA 2VL0A 2XZ5A 5AFJA 4HQPA 4TNWA 4LMJA 5J5IA 2UZ6A 3EI0A 3WTIA 4ILCA 3WTLA 2PGZA 2YMEA 4X5TA 2XQ9A 3RIAA 3SH1A 4D01A 4ZRUA 2XQ7A 3UU6A 4ZZBA 3WTMA 2YOEA 2BJ0A 2ZJUA 1UV6A 3U8NA 2BYQA 4IREA 3UU4A
chains in the Genus database with same CATH superfamily
2YKSA 1I9BA 5AFKA 2QC1B 3TLVA 2XQAA 4WV9A 4A97A 3LSVA 5FJVA 3UUBA 3TLTA 4A98A 5KZUA 2Y7YA 2WNLA 2XNTA 3JAFA 3JADA 4ZK1A 3P50A 2XQ5A 5L4HA 2Y56A 4ILAA 3EAMA 3GUAA 5BW2A 5HEHA 5L47A 4ZZCA 4TNVA 3RQWA 3SQ6A 3T4MA 5HEGA 4UY2A 4TWDA 2YN6A 3RQUA 5KE4A 3PEOA 3WTJA 5BP0A 4HFEA 3WIPA 2ZJVA 3C79A 3IGQA 4COFA 3EHZA 5HCMA 5CO5A 2WNCA 4QH5A 5AFLA 3WTOA 4DBMA 4Z90A 3WTKA 4AFTA 4PIRA 4NZBA 4HFDA 4UM3A 4ZJSA 3TLSA 2XYTA 4ZJTA 2BR7A 5HEOA 4UM3P 2WNJA 3SQ9A 3U8KA 4HFIA 2X00D 4UM3S 2XQ4A 2XNVA 2BG9C 2W8GA 4ZR6A 4NPPA 3UU5A 2Y57A 2XQ6A 4ZK4A 3U8MA 4TWHA 5HCJA 2XYSA 3UU3A 3UQ4A 5CFBA 3UQ7A 4HFHA 2Y58A 4QH4A 5AINA 5LG3A 5AFNA 3SIOA 2X00A 4HFCA 2W8FA 3RI5A 5JMEA 2WZYA 5LXBA 2XNUA 2XZ6A 4XHEA 3ZDHA 3ZDGA 2Y54A 5HEJA 5SYOA 4QH1A 3RIFA 3RHWA 4QABA 4ALXA 5HEUA 3PMZA 4XK9A 3UU8A 4IL4A 4ILBA 5J5FA 3WTHA 5J0ZA 3C84A 2C9TA 4UM1A 5AFMA 4TWFA 2PH9A 4F8HA 2XQ3A 2BG9A 1UX2A 2BYNA 4HFBA 2XQ8A 5BRXA 5L4EA 4BQTA 2BG9E 3ZKRA 4B5DA 5J5GA 2BYPA 3TLUA 2BR8A 5AFHA 2BYRA 4FRRA 3TLWA 3WTNA 3U8LA 4AFGA 5IUXA 3P4WA 4BFQA 5J5HA 2BYSA 5AFMB 4IL9A 2WN9A 4AFHA 1UW6A 3JAEA 4QACA 4UXUA 4EZ1A 2YMDA 4LMKA 2BG9B 4Z91A 4QAAA 4LMLA 3U8JA 5TVCA 2VL0A 2XZ5A 5AFJA 4HQPA 4TNWA 4LMJA 5J5IA 2UZ6A 3EI0A 3WTIA 4ILCA 3WTLA 2PGZA 2YMEA 4X5TA 2XQ9A 3RIAA 3SH1A 4D01A 4ZRUA 2XQ7A 3UU6A 4ZZBA 3WTMA 2YOEA 2BJ0A 2ZJUA 1UV6A 3U8NA 2BYQA 4IREA 3UU4A
chains in the Genus database with same CATH topology
2YKSA 1I9BA 5AFKA 2QC1B 3TLVA 2XQAA 4WV9A 4A97A 3LSVA 5FJVA 3UUBA 3TLTA 4A98A 5KZUA 2Y7YA 2WNLA 2XNTA 3JAFA 3JADA 4ZK1A 3P50A 2XQ5A 5L4HA 2Y56A 4ILAA 3EAMA 3GUAA 5BW2A 5HEHA 5L47A 4ZZCA 4TNVA 3RQWA 3SQ6A 3T4MA 5HEGA 4UY2A 4TWDA 2YN6A 3RQUA 5KE4A 3PEOA 3WTJA 5BP0A 4HFEA 3WIPA 2ZJVA 3C79A 3IGQA 4COFA 3EHZA 5HCMA 5CO5A 2WNCA 4QH5A 5AFLA 3WTOA 4DBMA 4Z90A 3WTKA 4AFTA 4PIRA 4NZBA 4HFDA 4UM3A 4ZJSA 3TLSA 2XYTA 4ZJTA 2BR7A 5HEOA 4UM3P 2WNJA 3SQ9A 3U8KA 4HFIA 2X00D 4UM3S 2XQ4A 2XNVA 2BG9C 2W8GA 4ZR6A 4NPPA 3UU5A 2Y57A 2XQ6A 4ZK4A 3U8MA 4TWHA 5HCJA 2XYSA 3UU3A 3UQ4A 5CFBA 3UQ7A 4HFHA 2Y58A 4QH4A 5AINA 5LG3A 5AFNA 3SIOA 2X00A 4HFCA 2W8FA 3RI5A 5JMEA 2WZYA 5LXBA 2XNUA 2XZ6A 4XHEA 3ZDHA 3ZDGA 2Y54A 5HEJA 5SYOA 4QH1A 3RIFA 3RHWA 4QABA 4ALXA 5HEUA 3PMZA 4XK9A 3UU8A 4IL4A 4ILBA 5J5FA 3WTHA 5J0ZA 3C84A 2C9TA 4UM1A 5AFMA 4TWFA 2PH9A 4F8HA 2XQ3A 2BG9A 1UX2A 2BYNA 4HFBA 2XQ8A 5BRXA 5L4EA 4BQTA 2BG9E 3ZKRA 4B5DA 5J5GA 2BYPA 3TLUA 2BR8A 5AFHA 2BYRA 4FRRA 3TLWA 3WTNA 3U8LA 4AFGA 5IUXA 3P4WA 4BFQA 5J5HA 2BYSA 5AFMB 4IL9A 2WN9A 4AFHA 1UW6A 3JAEA 4QACA 4UXUA 4EZ1A 2YMDA 4LMKA 2BG9B 4Z91A 4QAAA 4LMLA 3U8JA 5TVCA 2VL0A 2XZ5A 5AFJA 4HQPA 4TNWA 4LMJA 5J5IA 2UZ6A 3EI0A 3WTIA 4ILCA 3WTLA 2PGZA 2YMEA 4X5TA 2XQ9A 3RIAA 3SH1A 4D01A 4ZRUA 2XQ7A 3UU6A 4ZZBA 3WTMA 2YOEA 2BJ0A 2ZJUA 1UV6A 3U8NA 2BYQA 4IREA 3UU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YKS A;  1I9B A;  5AFK A;  2QC1 B;  3TLV A;  2XQA A;  4WV9 A;  4A97 A;  3LSV A;  5FJV A;  3UUB A;  3TLT A;  4A98 A;  5KZU A;  2Y7Y A;  2WNL A;  2XNT A;  3JAF A;  3JAD A;  4ZK1 A;  3P50 A;  2XQ5 A;  5L4H A;  2Y56 A;  4ILA A;  3EAM A;  3GUA A;  5BW2 A;  5HEH A;  5L47 A;  4ZZC A;  4TNV A;  3RQW A;  3SQ6 A;  3T4M A;  5HEG A;  4UY2 A;  4TWD A;  2YN6 A;  3RQU A;  5KE4 A;  3PEO A;  3WTJ A;  5BP0 A;  4HFE A;  3WIP A;  2ZJV A;  3C79 A;  3IGQ A;  4COF A;  3EHZ A;  5HCM A;  5CO5 A;  2WNC A;  4QH5 A;  5AFL A;  3WTO A;  4DBM A;  4Z90 A;  3WTK A;  4AFT A;  4PIR A;  4NZB A;  4HFD A;  4UM3 A;  4ZJS A;  3TLS A;  2XYT A;  4ZJT A;  2BR7 A;  5HEO A;  4UM3 P;  2WNJ A;  3SQ9 A;  3U8K A;  4HFI A;  2X00 D;  4UM3 S;  2XQ4 A;  2XNV A;  2BG9 C;  2W8G A;  4ZR6 A;  4NPP A;  3UU5 A;  2Y57 A;  2XQ6 A;  4ZK4 A;  3U8M A;  4TWH A;  5HCJ A;  2XYS A;  3UU3 A;  3UQ4 A;  5CFB A;  3UQ7 A;  4HFH A;  2Y58 A;  4QH4 A;  5AIN A;  5LG3 A;  5AFN A;  3SIO A;  2X00 A;  4HFC A;  2W8F A;  3RI5 A;  5JME A;  2WZY A;  5LXB A;  2XNU A;  2XZ6 A;  4XHE A;  3ZDH A;  3ZDG A;  2Y54 A;  5HEJ A;  5SYO A;  4QH1 A;  3RIF A;  3RHW A;  4QAB A;  4ALX A;  5HEU A;  3PMZ A;  4XK9 A;  3UU8 A;  4IL4 A;  4ILB A;  5J5F A;  3WTH A;  5J0Z A;  3C84 A;  2C9T A;  4UM1 A;  5AFM A;  4TWF A;  2PH9 A;  4F8H A;  2XQ3 A;  2BG9 A;  1UX2 A;  2BYN A;  4HFB A;  2XQ8 A;  5BRX A;  5L4E A;  4BQT A;  2BG9 E;  3ZKR A;  4B5D A;  5J5G A;  2BYP A;  3TLU A;  2BR8 A;  5AFH A;  2BYR A;  4FRR A;  3TLW A;  3WTN A;  3U8L A;  4AFG A;  5IUX A;  3P4W A;  4BFQ A;  5J5H A;  2BYS A;  5AFM B;  4IL9 A;  2WN9 A;  4AFH A;  1UW6 A;  3JAE A;  4QAC A;  4UXU A;  4EZ1 A;  2YMD A;  4LMK A;  2BG9 B;  4Z91 A;  4QAA A;  4LML A;  3U8J A;  5TVC A;  2VL0 A;  2XZ5 A;  5AFJ A;  4HQP A;  4TNW A;  4LMJ A;  5J5I A;  2UZ6 A;  3EI0 A;  3WTI A;  4ILC A;  3WTL A;  2PGZ A;  2YME A;  4X5T A;  2XQ9 A;  3RIA A;  3SH1 A;  4D01 A;  4ZRU A;  2XQ7 A;  3UU6 A;  4ZZB A;  3WTM A;  2YOE A;  2BJ0 A;  2ZJU A;  1UV6 A;  3U8N A;  2BYQ A;  4IRE A;  3UU4 A; 
#chains in the Genus database with same CATH topology
 2YKS A;  1I9B A;  5AFK A;  2QC1 B;  3TLV A;  2XQA A;  4WV9 A;  4A97 A;  3LSV A;  5FJV A;  3UUB A;  3TLT A;  4A98 A;  5KZU A;  2Y7Y A;  2WNL A;  2XNT A;  3JAF A;  3JAD A;  4ZK1 A;  3P50 A;  2XQ5 A;  5L4H A;  2Y56 A;  4ILA A;  3EAM A;  3GUA A;  5BW2 A;  5HEH A;  5L47 A;  4ZZC A;  4TNV A;  3RQW A;  3SQ6 A;  3T4M A;  5HEG A;  4UY2 A;  4TWD A;  2YN6 A;  3RQU A;  5KE4 A;  3PEO A;  3WTJ A;  5BP0 A;  4HFE A;  3WIP A;  2ZJV A;  3C79 A;  3IGQ A;  4COF A;  3EHZ A;  5HCM A;  5CO5 A;  2WNC A;  4QH5 A;  5AFL A;  3WTO A;  4DBM A;  4Z90 A;  3WTK A;  4AFT A;  4PIR A;  4NZB A;  4HFD A;  4UM3 A;  4ZJS A;  3TLS A;  2XYT A;  4ZJT A;  2BR7 A;  5HEO A;  4UM3 P;  2WNJ A;  3SQ9 A;  3U8K A;  4HFI A;  2X00 D;  4UM3 S;  2XQ4 A;  2XNV A;  2BG9 C;  2W8G A;  4ZR6 A;  4NPP A;  3UU5 A;  2Y57 A;  2XQ6 A;  4ZK4 A;  3U8M A;  4TWH A;  5HCJ A;  2XYS A;  3UU3 A;  3UQ4 A;  5CFB A;  3UQ7 A;  4HFH A;  2Y58 A;  4QH4 A;  5AIN A;  5LG3 A;  5AFN A;  3SIO A;  2X00 A;  4HFC A;  2W8F A;  3RI5 A;  5JME A;  2WZY A;  5LXB A;  2XNU A;  2XZ6 A;  4XHE A;  3ZDH A;  3ZDG A;  2Y54 A;  5HEJ A;  5SYO A;  4QH1 A;  3RIF A;  3RHW A;  4QAB A;  4ALX A;  5HEU A;  3PMZ A;  4XK9 A;  3UU8 A;  4IL4 A;  4ILB A;  5J5F A;  3WTH A;  5J0Z A;  3C84 A;  2C9T A;  4UM1 A;  5AFM A;  4TWF A;  2PH9 A;  4F8H A;  2XQ3 A;  2BG9 A;  1UX2 A;  2BYN A;  4HFB A;  2XQ8 A;  5BRX A;  5L4E A;  4BQT A;  2BG9 E;  3ZKR A;  4B5D A;  5J5G A;  2BYP A;  3TLU A;  2BR8 A;  5AFH A;  2BYR A;  4FRR A;  3TLW A;  3WTN A;  3U8L A;  4AFG A;  5IUX A;  3P4W A;  4BFQ A;  5J5H A;  2BYS A;  5AFM B;  4IL9 A;  2WN9 A;  4AFH A;  1UW6 A;  3JAE A;  4QAC A;  4UXU A;  4EZ1 A;  2YMD A;  4LMK A;  2BG9 B;  4Z91 A;  4QAA A;  4LML A;  3U8J A;  5TVC A;  2VL0 A;  2XZ5 A;  5AFJ A;  4HQP A;  4TNW A;  4LMJ A;  5J5I A;  2UZ6 A;  3EI0 A;  3WTI A;  4ILC A;  3WTL A;  2PGZ A;  2YME A;  4X5T A;  2XQ9 A;  3RIA A;  3SH1 A;  4D01 A;  4ZRU A;  2XQ7 A;  3UU6 A;  4ZZB A;  3WTM A;  2YOE A;  2BJ0 A;  2ZJU A;  1UV6 A;  3U8N A;  2BYQ A;  4IRE A;  3UU4 A; 
#chains in the Genus database with same CATH homology
 2YKS A;  1I9B A;  5AFK A;  2QC1 B;  3TLV A;  2XQA A;  4WV9 A;  4A97 A;  3LSV A;  5FJV A;  3UUB A;  3TLT A;  4A98 A;  5KZU A;  2Y7Y A;  2WNL A;  2XNT A;  3JAF A;  3JAD A;  4ZK1 A;  3P50 A;  2XQ5 A;  5L4H A;  2Y56 A;  4ILA A;  3EAM A;  3GUA A;  5BW2 A;  5HEH A;  5L47 A;  4ZZC A;  4TNV A;  3RQW A;  3SQ6 A;  3T4M A;  5HEG A;  4UY2 A;  4TWD A;  2YN6 A;  3RQU A;  5KE4 A;  3PEO A;  3WTJ A;  5BP0 A;  4HFE A;  3WIP A;  2ZJV A;  3C79 A;  3IGQ A;  4COF A;  3EHZ A;  5HCM A;  5CO5 A;  2WNC A;  4QH5 A;  5AFL A;  3WTO A;  4DBM A;  4Z90 A;  3WTK A;  4AFT A;  4PIR A;  4NZB A;  4HFD A;  4UM3 A;  4ZJS A;  3TLS A;  2XYT A;  4ZJT A;  2BR7 A;  5HEO A;  4UM3 P;  2WNJ A;  3SQ9 A;  3U8K A;  4HFI A;  2X00 D;  4UM3 S;  2XQ4 A;  2XNV A;  2BG9 C;  2W8G A;  4ZR6 A;  4NPP A;  3UU5 A;  2Y57 A;  2XQ6 A;  4ZK4 A;  3U8M A;  4TWH A;  5HCJ A;  2XYS A;  3UU3 A;  3UQ4 A;  5CFB A;  3UQ7 A;  4HFH A;  2Y58 A;  4QH4 A;  5AIN A;  5LG3 A;  5AFN A;  3SIO A;  2X00 A;  4HFC A;  2W8F A;  3RI5 A;  5JME A;  2WZY A;  5LXB A;  2XNU A;  2XZ6 A;  4XHE A;  3ZDH A;  3ZDG A;  2Y54 A;  5HEJ A;  5SYO A;  4QH1 A;  3RIF A;  3RHW A;  4QAB A;  4ALX A;  5HEU A;  3PMZ A;  4XK9 A;  3UU8 A;  4IL4 A;  4ILB A;  5J5F A;  3WTH A;  5J0Z A;  3C84 A;  2C9T A;  4UM1 A;  5AFM A;  4TWF A;  2PH9 A;  4F8H A;  2XQ3 A;  2BG9 A;  1UX2 A;  2BYN A;  4HFB A;  2XQ8 A;  5BRX A;  5L4E A;  4BQT A;  2BG9 E;  3ZKR A;  4B5D A;  5J5G A;  2BYP A;  3TLU A;  2BR8 A;  5AFH A;  2BYR A;  4FRR A;  3TLW A;  3WTN A;  3U8L A;  4AFG A;  5IUX A;  3P4W A;  4BFQ A;  5J5H A;  2BYS A;  5AFM B;  4IL9 A;  2WN9 A;  4AFH A;  1UW6 A;  3JAE A;  4QAC A;  4UXU A;  4EZ1 A;  2YMD A;  4LMK A;  2BG9 B;  4Z91 A;  4QAA A;  4LML A;  3U8J A;  5TVC A;  2VL0 A;  2XZ5 A;  5AFJ A;  4HQP A;  4TNW A;  4LMJ A;  5J5I A;  2UZ6 A;  3EI0 A;  3WTI A;  4ILC A;  3WTL A;  2PGZ A;  2YME A;  4X5T A;  2XQ9 A;  3RIA A;  3SH1 A;  4D01 A;  4ZRU A;  2XQ7 A;  3UU6 A;  4ZZB A;  3WTM A;  2YOE A;  2BJ0 A;  2ZJU A;  1UV6 A;  3U8N A;  2BYQ A;  4IRE A;  3UU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...