1UW6A

X-ray structure of acetylcholine binding protein (achbp) in complex with nicotine
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
208
structure length
208
Chain Sequence
EFDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE-BINDING PROTEIN
publication title Nicotine and Carbamylcholine Binding to Nicotinic Acetylcholine Receptors as Studied in Achbp Crystal Structures
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Glycoprotein
total genus 52
structure length 208
sequence length 208
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature
pdb deposition date 2004-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 1uw6A00
3C79A 3EHZA 3JAEA 2BYRA 3TLTA 4UXUA 3WTJA 2XYSA 2Y58A 4IL9A 3TLUA 3SQ9A 5HEUA 3LSVA 5AFKA 5L47A 4LMLA 3PMZA 4TWHA 5J5GA 4COFA 2WNLA 2XNVA 2YKSA 4ZK4A 3RIAA 5KE4A 4AFHA 3WTNA 2XYTA 4IL4A 3ZDHA 2BR7A 4QACA 4D01A 5BP0A 5J5FA 5J5IA 3ZDGA 2YN6A 4QH4A 4ZZCA 5LXBA 4X5TA 3UU5A 2Y7YA 3SIOA 3U8MA 4ILCA 3WTKA 5AINA 5BW2A 4A97A 2BYNA 4IREA 2C9TA 3UU4A 5AFHA 2XQ7A 4ZR6A 4ALXA 5KZUA 2VL0A 2XQAA 2ZJUA 2XQ6A 5AFNA 3PEOA 4XHEA 1UV6A 4UM3S 2QC1B 4ILAA 2BG9E 2W8GA 4QH5A 2Y56A 4HFHA 2WNCA 2XZ5A 3JADA 5BRXA 5HEGA 2BG9C 3RQWA 3EAMA 2XQ3A 4QAAA 5J5HA 3UU6A 3WTMA 4HFBA 5J0ZA 4WV9A 2BYSA 3UQ7A 2PH9A 5AFJA 4ZRUA 3UU3A 3TLWA 2WZYA 3T4MA 3WTIA 4HFIA 3EI0A 5L4EA 3JAFA 2BG9A 3U8JA 4BFQA 5CFBA 3WTHA 4DBMA 3RIFA 4ZJTA 4ILBA 4TNVA 2UZ6A 2YMEA 4A98A 2BG9B 4B5DA 2XQ5A 4TWDA 2WN9A 4ZK1A 3WTOA 5AFMA 3U8LA 3U8NA 3GUAA 5HCJA 4Z90A 4XK9A 2XNUA 2YMDA 2BYPA 5AFMB 2W8FA 2YOEA 3RHWA 2ZJVA 4HFCA 4HQPA 4UM3P 4UY2A 4HFEA 5HEHA 3RI5A 3C84A 3TLVA 2BJ0A 1I9BA 2Y57A 3UU8A 3WIPA 4ZZBA 2X00D 3SQ6A 3UQ4A 5L4HA 5AFLA 5FJVA 3P4WA 5SYOA 4PIRA 4UM1A 4UM3A 2BYQA 4FRRA 4NZBA 3IGQA 4EZ1A 2X00A 4LMKA 2BR8A 4HFDA 5HCMA 2XZ6A 4QABA 5IUXA 1UW6A 2XNTA 4ZJSA 4AFGA 3P50A 2XQ9A 5CO5A 5LG3A 2XQ8A 3UUBA 5HEJA 3TLSA 3SH1A 5HEOA 4LMJA 3RQUA 4Z91A 2XQ4A 1UX2A 3WTLA 4QH1A 4F8HA 4TWFA 5TVCA 5JMEA 3U8KA 2PGZA 2WNJA 4NPPA 2Y54A 4TNWA 4AFTA 3ZKRA 4BQTA
chains in the Genus database with same CATH superfamily
3C79A 3EHZA 3JAEA 2BYRA 3TLTA 4UXUA 3WTJA 2XYSA 2Y58A 4IL9A 3TLUA 3SQ9A 5HEUA 3LSVA 5AFKA 5L47A 4LMLA 3PMZA 4TWHA 5J5GA 4COFA 2WNLA 2XNVA 2YKSA 4ZK4A 3RIAA 5KE4A 4AFHA 3WTNA 2XYTA 4IL4A 3ZDHA 2BR7A 4QACA 4D01A 5BP0A 5J5FA 5J5IA 3ZDGA 2YN6A 4QH4A 4ZZCA 5LXBA 4X5TA 3UU5A 2Y7YA 3SIOA 3U8MA 4ILCA 3WTKA 5AINA 5BW2A 4A97A 2BYNA 4IREA 2C9TA 3UU4A 5AFHA 2XQ7A 4ZR6A 4ALXA 5KZUA 2VL0A 2XQAA 2ZJUA 2XQ6A 5AFNA 3PEOA 4XHEA 1UV6A 4UM3S 2QC1B 4ILAA 2BG9E 2W8GA 4QH5A 2Y56A 4HFHA 2WNCA 2XZ5A 3JADA 5BRXA 5HEGA 2BG9C 3RQWA 3EAMA 2XQ3A 4QAAA 5J5HA 3UU6A 3WTMA 4HFBA 5J0ZA 4WV9A 2BYSA 3UQ7A 2PH9A 5AFJA 4ZRUA 3UU3A 3TLWA 2WZYA 3T4MA 3WTIA 4HFIA 3EI0A 5L4EA 3JAFA 2BG9A 3U8JA 4BFQA 5CFBA 3WTHA 4DBMA 3RIFA 4ZJTA 4ILBA 4TNVA 2UZ6A 2YMEA 4A98A 2BG9B 4B5DA 2XQ5A 4TWDA 2WN9A 4ZK1A 3WTOA 5AFMA 3U8LA 3U8NA 3GUAA 5HCJA 4Z90A 4XK9A 2XNUA 2YMDA 2BYPA 5AFMB 2W8FA 2YOEA 3RHWA 2ZJVA 4HFCA 4HQPA 4UM3P 4UY2A 4HFEA 5HEHA 3RI5A 3C84A 3TLVA 2BJ0A 1I9BA 2Y57A 3UU8A 3WIPA 4ZZBA 2X00D 3SQ6A 3UQ4A 5L4HA 5AFLA 5FJVA 3P4WA 5SYOA 4PIRA 4UM1A 4UM3A 2BYQA 4FRRA 4NZBA 3IGQA 4EZ1A 2X00A 4LMKA 2BR8A 4HFDA 5HCMA 2XZ6A 4QABA 5IUXA 1UW6A 2XNTA 4ZJSA 4AFGA 3P50A 2XQ9A 5CO5A 5LG3A 2XQ8A 3UUBA 5HEJA 3TLSA 3SH1A 5HEOA 4LMJA 3RQUA 4Z91A 2XQ4A 1UX2A 3WTLA 4QH1A 4F8HA 4TWFA 5TVCA 5JMEA 3U8KA 2PGZA 2WNJA 4NPPA 2Y54A 4TNWA 4AFTA 3ZKRA 4BQTA
chains in the Genus database with same CATH topology
3C79A 3EHZA 3JAEA 2BYRA 3TLTA 4UXUA 3WTJA 2XYSA 2Y58A 4IL9A 3TLUA 3SQ9A 5HEUA 3LSVA 5AFKA 5L47A 4LMLA 3PMZA 4TWHA 5J5GA 4COFA 2WNLA 2XNVA 2YKSA 4ZK4A 3RIAA 5KE4A 4AFHA 3WTNA 2XYTA 4IL4A 3ZDHA 2BR7A 4QACA 4D01A 5BP0A 5J5FA 5J5IA 3ZDGA 2YN6A 4QH4A 4ZZCA 5LXBA 4X5TA 3UU5A 2Y7YA 3SIOA 3U8MA 4ILCA 3WTKA 5AINA 5BW2A 4A97A 2BYNA 4IREA 2C9TA 3UU4A 5AFHA 2XQ7A 4ZR6A 4ALXA 5KZUA 2VL0A 2XQAA 2ZJUA 2XQ6A 5AFNA 3PEOA 4XHEA 1UV6A 4UM3S 2QC1B 4ILAA 2BG9E 2W8GA 4QH5A 2Y56A 4HFHA 2WNCA 2XZ5A 3JADA 5BRXA 5HEGA 2BG9C 3RQWA 3EAMA 2XQ3A 4QAAA 5J5HA 3UU6A 3WTMA 4HFBA 5J0ZA 4WV9A 2BYSA 3UQ7A 2PH9A 5AFJA 4ZRUA 3UU3A 3TLWA 2WZYA 3T4MA 3WTIA 4HFIA 3EI0A 5L4EA 3JAFA 2BG9A 3U8JA 4BFQA 5CFBA 3WTHA 4DBMA 3RIFA 4ZJTA 4ILBA 4TNVA 2UZ6A 2YMEA 4A98A 2BG9B 4B5DA 2XQ5A 4TWDA 2WN9A 4ZK1A 3WTOA 5AFMA 3U8LA 3U8NA 3GUAA 5HCJA 4Z90A 4XK9A 2XNUA 2YMDA 2BYPA 5AFMB 2W8FA 2YOEA 3RHWA 2ZJVA 4HFCA 4HQPA 4UM3P 4UY2A 4HFEA 5HEHA 3RI5A 3C84A 3TLVA 2BJ0A 1I9BA 2Y57A 3UU8A 3WIPA 4ZZBA 2X00D 3SQ6A 3UQ4A 5L4HA 5AFLA 5FJVA 3P4WA 5SYOA 4PIRA 4UM1A 4UM3A 2BYQA 4FRRA 4NZBA 3IGQA 4EZ1A 2X00A 4LMKA 2BR8A 4HFDA 5HCMA 2XZ6A 4QABA 5IUXA 1UW6A 2XNTA 4ZJSA 4AFGA 3P50A 2XQ9A 5CO5A 5LG3A 2XQ8A 3UUBA 5HEJA 3TLSA 3SH1A 5HEOA 4LMJA 3RQUA 4Z91A 2XQ4A 1UX2A 3WTLA 4QH1A 4F8HA 4TWFA 5TVCA 5JMEA 3U8KA 2PGZA 2WNJA 4NPPA 2Y54A 4TNWA 4AFTA 3ZKRA 4BQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C79 A;  3EHZ A;  3JAE A;  2BYR A;  3TLT A;  4UXU A;  3WTJ A;  2XYS A;  2Y58 A;  4IL9 A;  3TLU A;  3SQ9 A;  5HEU A;  3LSV A;  5AFK A;  5L47 A;  4LML A;  3PMZ A;  4TWH A;  5J5G A;  4COF A;  2WNL A;  2XNV A;  2YKS A;  4ZK4 A;  3RIA A;  5KE4 A;  4AFH A;  3WTN A;  2XYT A;  4IL4 A;  3ZDH A;  2BR7 A;  4QAC A;  4D01 A;  5BP0 A;  5J5F A;  5J5I A;  3ZDG A;  2YN6 A;  4QH4 A;  4ZZC A;  5LXB A;  4X5T A;  3UU5 A;  2Y7Y A;  3SIO A;  3U8M A;  4ILC A;  3WTK A;  5AIN A;  5BW2 A;  4A97 A;  2BYN A;  4IRE A;  2C9T A;  3UU4 A;  5AFH A;  2XQ7 A;  4ZR6 A;  4ALX A;  5KZU A;  2VL0 A;  2XQA A;  2ZJU A;  2XQ6 A;  5AFN A;  3PEO A;  4XHE A;  1UV6 A;  4UM3 S;  2QC1 B;  4ILA A;  2BG9 E;  2W8G A;  4QH5 A;  2Y56 A;  4HFH A;  2WNC A;  2XZ5 A;  3JAD A;  5BRX A;  5HEG A;  2BG9 C;  3RQW A;  3EAM A;  2XQ3 A;  4QAA A;  5J5H A;  3UU6 A;  3WTM A;  4HFB A;  5J0Z A;  4WV9 A;  2BYS A;  3UQ7 A;  2PH9 A;  5AFJ A;  4ZRU A;  3UU3 A;  3TLW A;  2WZY A;  3T4M A;  3WTI A;  4HFI A;  3EI0 A;  5L4E A;  3JAF A;  2BG9 A;  3U8J A;  4BFQ A;  5CFB A;  3WTH A;  4DBM A;  3RIF A;  4ZJT A;  4ILB A;  4TNV A;  2UZ6 A;  2YME A;  4A98 A;  2BG9 B;  4B5D A;  2XQ5 A;  4TWD A;  2WN9 A;  4ZK1 A;  3WTO A;  5AFM A;  3U8L A;  3U8N A;  3GUA A;  5HCJ A;  4Z90 A;  4XK9 A;  2XNU A;  2YMD A;  2BYP A;  5AFM B;  2W8F A;  2YOE A;  3RHW A;  2ZJV A;  4HFC A;  4HQP A;  4UM3 P;  4UY2 A;  4HFE A;  5HEH A;  3RI5 A;  3C84 A;  3TLV A;  2BJ0 A;  1I9B A;  2Y57 A;  3UU8 A;  3WIP A;  4ZZB A;  2X00 D;  3SQ6 A;  3UQ4 A;  5L4H A;  5AFL A;  5FJV A;  3P4W A;  5SYO A;  4PIR A;  4UM1 A;  4UM3 A;  2BYQ A;  4FRR A;  4NZB A;  3IGQ A;  4EZ1 A;  2X00 A;  4LMK A;  2BR8 A;  4HFD A;  5HCM A;  2XZ6 A;  4QAB A;  5IUX A;  1UW6 A;  2XNT A;  4ZJS A;  4AFG A;  3P50 A;  2XQ9 A;  5CO5 A;  5LG3 A;  2XQ8 A;  3UUB A;  5HEJ A;  3TLS A;  3SH1 A;  5HEO A;  4LMJ A;  3RQU A;  4Z91 A;  2XQ4 A;  1UX2 A;  3WTL A;  4QH1 A;  4F8H A;  4TWF A;  5TVC A;  5JME A;  3U8K A;  2PGZ A;  2WNJ A;  4NPP A;  2Y54 A;  4TNW A;  4AFT A;  3ZKR A;  4BQT A; 
#chains in the Genus database with same CATH topology
 3C79 A;  3EHZ A;  3JAE A;  2BYR A;  3TLT A;  4UXU A;  3WTJ A;  2XYS A;  2Y58 A;  4IL9 A;  3TLU A;  3SQ9 A;  5HEU A;  3LSV A;  5AFK A;  5L47 A;  4LML A;  3PMZ A;  4TWH A;  5J5G A;  4COF A;  2WNL A;  2XNV A;  2YKS A;  4ZK4 A;  3RIA A;  5KE4 A;  4AFH A;  3WTN A;  2XYT A;  4IL4 A;  3ZDH A;  2BR7 A;  4QAC A;  4D01 A;  5BP0 A;  5J5F A;  5J5I A;  3ZDG A;  2YN6 A;  4QH4 A;  4ZZC A;  5LXB A;  4X5T A;  3UU5 A;  2Y7Y A;  3SIO A;  3U8M A;  4ILC A;  3WTK A;  5AIN A;  5BW2 A;  4A97 A;  2BYN A;  4IRE A;  2C9T A;  3UU4 A;  5AFH A;  2XQ7 A;  4ZR6 A;  4ALX A;  5KZU A;  2VL0 A;  2XQA A;  2ZJU A;  2XQ6 A;  5AFN A;  3PEO A;  4XHE A;  1UV6 A;  4UM3 S;  2QC1 B;  4ILA A;  2BG9 E;  2W8G A;  4QH5 A;  2Y56 A;  4HFH A;  2WNC A;  2XZ5 A;  3JAD A;  5BRX A;  5HEG A;  2BG9 C;  3RQW A;  3EAM A;  2XQ3 A;  4QAA A;  5J5H A;  3UU6 A;  3WTM A;  4HFB A;  5J0Z A;  4WV9 A;  2BYS A;  3UQ7 A;  2PH9 A;  5AFJ A;  4ZRU A;  3UU3 A;  3TLW A;  2WZY A;  3T4M A;  3WTI A;  4HFI A;  3EI0 A;  5L4E A;  3JAF A;  2BG9 A;  3U8J A;  4BFQ A;  5CFB A;  3WTH A;  4DBM A;  3RIF A;  4ZJT A;  4ILB A;  4TNV A;  2UZ6 A;  2YME A;  4A98 A;  2BG9 B;  4B5D A;  2XQ5 A;  4TWD A;  2WN9 A;  4ZK1 A;  3WTO A;  5AFM A;  3U8L A;  3U8N A;  3GUA A;  5HCJ A;  4Z90 A;  4XK9 A;  2XNU A;  2YMD A;  2BYP A;  5AFM B;  2W8F A;  2YOE A;  3RHW A;  2ZJV A;  4HFC A;  4HQP A;  4UM3 P;  4UY2 A;  4HFE A;  5HEH A;  3RI5 A;  3C84 A;  3TLV A;  2BJ0 A;  1I9B A;  2Y57 A;  3UU8 A;  3WIP A;  4ZZB A;  2X00 D;  3SQ6 A;  3UQ4 A;  5L4H A;  5AFL A;  5FJV A;  3P4W A;  5SYO A;  4PIR A;  4UM1 A;  4UM3 A;  2BYQ A;  4FRR A;  4NZB A;  3IGQ A;  4EZ1 A;  2X00 A;  4LMK A;  2BR8 A;  4HFD A;  5HCM A;  2XZ6 A;  4QAB A;  5IUX A;  1UW6 A;  2XNT A;  4ZJS A;  4AFG A;  3P50 A;  2XQ9 A;  5CO5 A;  5LG3 A;  2XQ8 A;  3UUB A;  5HEJ A;  3TLS A;  3SH1 A;  5HEO A;  4LMJ A;  3RQU A;  4Z91 A;  2XQ4 A;  1UX2 A;  3WTL A;  4QH1 A;  4F8H A;  4TWF A;  5TVC A;  5JME A;  3U8K A;  2PGZ A;  2WNJ A;  4NPP A;  2Y54 A;  4TNW A;  4AFT A;  3ZKR A;  4BQT A; 
#chains in the Genus database with same CATH homology
 3C79 A;  3EHZ A;  3JAE A;  2BYR A;  3TLT A;  4UXU A;  3WTJ A;  2XYS A;  2Y58 A;  4IL9 A;  3TLU A;  3SQ9 A;  5HEU A;  3LSV A;  5AFK A;  5L47 A;  4LML A;  3PMZ A;  4TWH A;  5J5G A;  4COF A;  2WNL A;  2XNV A;  2YKS A;  4ZK4 A;  3RIA A;  5KE4 A;  4AFH A;  3WTN A;  2XYT A;  4IL4 A;  3ZDH A;  2BR7 A;  4QAC A;  4D01 A;  5BP0 A;  5J5F A;  5J5I A;  3ZDG A;  2YN6 A;  4QH4 A;  4ZZC A;  5LXB A;  4X5T A;  3UU5 A;  2Y7Y A;  3SIO A;  3U8M A;  4ILC A;  3WTK A;  5AIN A;  5BW2 A;  4A97 A;  2BYN A;  4IRE A;  2C9T A;  3UU4 A;  5AFH A;  2XQ7 A;  4ZR6 A;  4ALX A;  5KZU A;  2VL0 A;  2XQA A;  2ZJU A;  2XQ6 A;  5AFN A;  3PEO A;  4XHE A;  1UV6 A;  4UM3 S;  2QC1 B;  4ILA A;  2BG9 E;  2W8G A;  4QH5 A;  2Y56 A;  4HFH A;  2WNC A;  2XZ5 A;  3JAD A;  5BRX A;  5HEG A;  2BG9 C;  3RQW A;  3EAM A;  2XQ3 A;  4QAA A;  5J5H A;  3UU6 A;  3WTM A;  4HFB A;  5J0Z A;  4WV9 A;  2BYS A;  3UQ7 A;  2PH9 A;  5AFJ A;  4ZRU A;  3UU3 A;  3TLW A;  2WZY A;  3T4M A;  3WTI A;  4HFI A;  3EI0 A;  5L4E A;  3JAF A;  2BG9 A;  3U8J A;  4BFQ A;  5CFB A;  3WTH A;  4DBM A;  3RIF A;  4ZJT A;  4ILB A;  4TNV A;  2UZ6 A;  2YME A;  4A98 A;  2BG9 B;  4B5D A;  2XQ5 A;  4TWD A;  2WN9 A;  4ZK1 A;  3WTO A;  5AFM A;  3U8L A;  3U8N A;  3GUA A;  5HCJ A;  4Z90 A;  4XK9 A;  2XNU A;  2YMD A;  2BYP A;  5AFM B;  2W8F A;  2YOE A;  3RHW A;  2ZJV A;  4HFC A;  4HQP A;  4UM3 P;  4UY2 A;  4HFE A;  5HEH A;  3RI5 A;  3C84 A;  3TLV A;  2BJ0 A;  1I9B A;  2Y57 A;  3UU8 A;  3WIP A;  4ZZB A;  2X00 D;  3SQ6 A;  3UQ4 A;  5L4H A;  5AFL A;  5FJV A;  3P4W A;  5SYO A;  4PIR A;  4UM1 A;  4UM3 A;  2BYQ A;  4FRR A;  4NZB A;  3IGQ A;  4EZ1 A;  2X00 A;  4LMK A;  2BR8 A;  4HFD A;  5HCM A;  2XZ6 A;  4QAB A;  5IUX A;  1UW6 A;  2XNT A;  4ZJS A;  4AFG A;  3P50 A;  2XQ9 A;  5CO5 A;  5LG3 A;  2XQ8 A;  3UUB A;  5HEJ A;  3TLS A;  3SH1 A;  5HEO A;  4LMJ A;  3RQU A;  4Z91 A;  2XQ4 A;  1UX2 A;  3WTL A;  4QH1 A;  4F8H A;  4TWF A;  5TVC A;  5JME A;  3U8K A;  2PGZ A;  2WNJ A;  4NPP A;  2Y54 A;  4TNW A;  4AFT A;  3ZKR A;  4BQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...