1UWBA

Tyr 181 cys hiv-1 rt/8-cl tibo
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of 8-Cl and 9-Cl TIBO complexed with wild-type HIV-1 RT and 8-Cl TIBO complexed with the Tyr181Cys HIV-1 RT drug-resistant mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Aspartyl protease
molecule keywords REVERSE TRANSCRIPTASE
total genus 131
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1uwbA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1uwbA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1uwbA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1uwbA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1uwbA05
3CJ0A 3WNGA 5F8MA 1O1WA 1UWBB 2ILYA 1TKXA 1J5OA 5F8IA 4NLGA 3OL6A 2O5DA 3O3HA 5J2PA 4CHOA 4AH9A 1NKCA 3GV5B 1RBTA 1HARA 3GV8B 1B9FA 2P51A 3T5KA 2D0CA 2XGPA 1IKYA 4WXWA 4BACA 1KFDA 1C1BB 3HVRA 4WZMA 5KFDA 4DLGA 4TYAA 2FLNA 3MR3A 4DFJA 4RG8A 1LWFA 1SV5A 1KFSA 5L1JA 3LP1A 2RKIB 3GILA 4DQPA 3DRSB 1LWCA 4NLXA 4I2PA 1C0TA 3RB4A 1EP4B 4TQRA 4ZP8A 2W7OA 3ZSOA 4M3ZA 1C2PA 4KE5A 2WOMA 1TAQA 4XO0A 3C6TB 3KLIB 3HT3A 1MU2B 3NAHA 2XY5A 1TKDA 4ED3A 1TQLA 4CJ5A 3CJ3A 5HROB 4FZXC 4IG3A 4CGGA 4YQWA 4F4YA 3V6DA 3KJVA 2HHSA 4CJLA 3DOKB 1BL3A 5JS2A 1RT3B 3AVKA 3V9SA 3T5HA 1QSYA 3QLHA 3RB6A 2J6SA 3M9MB 2QKBA 2HVHA 2WK4A 3VQ7A 4Y3CA 3EZ5A 2HNZB 2HB5A 3DYAA 2G8VA 3PY8A 1LWEB 4IBNA 2PYLA 3IN5A 1WAFA 3OS1A 4Y2AA 4DSLA 3MEEB 2OPQB 3IS9B 4FZZA 3PVXA 1I6JA 1Z25A 3CWJA 3NGDA 2KZMA 4KV8B 1BGXT 4NLTA 3NAEA 3PZPA 1LW0A 3CJ4A 1UAXA 2FBVA 4CEDA 1S5JA 3DLEA 4FBUA 4OPKA 2R8IA 4LH5A 4Z4CA 4CFCA 3KHHA 3O3GA 1NJWA 1HYVA 1WNEA 4PWDB 4DEZA 5KG2A 3KLEA 1BIZA 3OYJA 3NFAA 1GOCA 4K4TA 1RDRA 2XI2A 4ED8A 3Q8QB 1LAVA 1GX6A 4RW9B 3GIKA 1VRUB 1RT6A 4FK4A 4JV1A 3HP9A 1VSHA 3D45A 4KB0A 3HXMA 4KHYA 4J2AA 3ITHA 4GW6A 1SUQA 1VRTA 3QEXA 1S1XA 4Q0BA 3PX4A 1VSMA 5KFUA 1TL1B 1VSEA 5L1LA 1JLQB 1RT5B 3LZJA 2HWIA 1N5YB 3OS0A 1TVRA 3RBEA 4MK7A 1QS4A 1SH0A 3BSNA 2AU0A 1UOCA 4CK3A 4E7HA 4HUGA 1D9FA 1RT2A 4ECTA 4QOZB 4IDKA 5L1KA 4J9PA 5KFXA 4ZMMA 4IKFA 1JL1A 1J54A 3SQ2A 4YNQA 2YKMA 2YKMB 2JEIA 3M8PB 4QWCA 4DFPA 4O0IA 2R2TA 2Y1IA 4IRDA 1JIHA 4QW8A 2YNIA 3C94A 4E7LA 4O4RA 4NLOA 2WTFA 4DFMA 1JLBA 4B9LA 2B5JA 2RDJA 4ZPDA 2EX3A 1KRPA 2OH2A 2QKKA 3VN5A 4LH4A 2X6SA 4R5PB 4KSEB 2IS3A 4NLUA 4IH5A 4K8ZA 4FJLA 4DTJA 2OPRB 5KT5A 4EZ9A 4BE0A 2KQ2A 2ATLA 3SPZA 4J9QA 3DLGB 1NJYA 1SUQB 3ITHB 3G6XA 5K14B 5C42B 3NF8A 4KI4A 4E19A 3MAQA 4CFBA 1N6QA 4HYKA 3VQ5A 4JV0A 4CIEA 4EO8A 3NL0A 1R0AA 3FDSA 5CZ2A 4F50A 1N4LA 3H40A 1BCOA 5DG9A 3ZT3A 3G86A 1NOYA 2WHOA 4I2QA 3CG7A 4URQU 5KTQA 2ZD1B 3IAYA 3HVAA 4I9QA 3KLEB 4KHWA 4IQXA 1T05A 1S9EA 1KHVA 3TAMB 2VWKA 4MIAA 1TKZA 2R8HA 4H4MA 4WE1B 1ZBIA 1KCFA 3MECA 4FW1A 1FKPA 2HHXA 5KG0A 3DOLA 3MFHA 1JX4A 3K5MA 2BDPA 5KT2A 3OYEA 2D5RA 3PW2A 1WSEA 1LW0B 3T3FA 2BANA 1TK5A 1G15A 4OLBA 3M8QA 3PUFA 5KFWA 1QAIA 2OPQA 2KTQA 2FC0A 4CJTA 4B9UA 3GIJA 4FJ7A 3DLHA 1QAJA 4E3SA 4KO0A 2RF2B 3MFIA 2VG6B 2D0BA 3LPTA 4ECXA 1EKEA 2KZZA 1RDDA 4M45A 2YNFB 3BSCA 4QAGA 2ZQBA 1U4BA 4C8LA 2E4LA 3PO4A 1W9HA 4QWAA 1N56A 4MQ3A 1RDCA 2C2DA 3C6UA 4TYBA 1X1PA 3GIMA 5J2NB 4O3NA 3IG1A 1JLEB 3I0RA 4U7CA 1ZBUA 4M41A 4B9VA 3VQAA 3LWMA 1S9FA 4QWDA 4E7IA 4TY9A 2ASDA 3NF7A 3D5MA 3TVKA 3RAQA 1RILA 4RNFA 2OPSB 4C8OA 3TAGA 4ED2A 1HQEA 3ASMA 5CZ1A 1CSJA 2DY4A 1JLFB 2YNHA 3NF6A 3V6JA 3GV7B 3AVCA 2B6AB 4JS4A 4O3QA 2X6NA 1C0TB 3LP2A 3NBPA 3ZSRA 5JS1A 3LZIA 3VQ8A 3MR5A 1WSHA 2WB4A 5FDLB 2HNYB 1N48A 2UVVA 2R2SA 1KVBA 1NNDA 2W8KA 2WONB 1C1BA 4FCYA 3OHAA 2XRIA 2W9CB 1WSJA 2FBYA 1HPZB 3NGZA 3LP3A 2OZSA 3G10A 1RBVA 3LWLA 4NLDA 4DQQA 3QINA 4FW2A 2XWYA 4DSIA 3V81A 3ISND 4FS1A 3E01A 1S9EB 1A5VA 3DLKB 4PUOB 1D8YA 4KI6A 2YKNA 3GIIA 4F3OA 4R0EA 1X9SA 1RBRA 4FK0A 5DQIA 3OYLA 2HWHA 3T5LA 2XY6A 4ED1A 5F9NA 5KFGA 3SI8A 2YHAA 3AA3A 4FXDA 2P1JA 4CECA 3SUOA 4RW4B 4BDZA 3KKRA 1RTIB 5C42A 2E9TA 3KK2A 4K4UA 1RT7B 4R8UB 5L1IA 4O3SA 2XO7A 3VA3A 2E9RX 3FQKA 5KFIA 2RDIA 4AHVA 3DLGA 5FROA 4CEOA 3PJXA 4EBDA 3V1RA 2G8WA 4TLRA 4RW6B 4M3XA 2P5GA 4LSLB 4IG0B 4DG1A 1KVCA 4CHPA 1RTDA 2C22A 3SUQA 1C0MA 4Y1DA 4FJ9A 2F8TA 2B5JB 3HHKA 4K4WA 2C2EA 5HRRA 4FJXA 1RTJB 3IRXA 3QYYA 1TV6A 2FJWA 4ECQA 3MXIA 4KHUA 5J2QB 1C0UA 1XR6A 2B4JA 3PR5B 4EYHB 1DTTB 2Z1GA 5C24B 3O3FA 1S6PB 1S10A 3L3UA 1XR7A 3RBDA 4O0JA 1SKRA 5DK5A 3Q8PB 1S0MA 1NKBA 1S1TB 2WRMA 4IG0A 1U48A 4TN2A 4CJVA 1HYZA 3PO5A 4N56A 4DLEA 2W8LA 1JLQA 2IAJB 2BE2B 3KHLA 1Z4UA 4X2BA 1S1XB 4OKEA 2IJFA 3AVGA 3P1GA 3RB3A 4JRPA 4N76A 4RW7B 3OYNA 1ZBHA 3HK2A 4F3TA 3ZCMA 2V0NA 2I5JA 3HPGA 4DS4A 4ZPAA 3AVBA 4ZHRA 4QCLA 5KG5A 1FKOA 1TGOA 4FYDA 5KG3A 3H5XA 4BE1A 3QNOA 4O4GB 1T03A 3NDKA 4TSXA 3BJYA 4ZTJA 2QXFA 1QSSA 4FJKA 4IFYA 4FM0A 2E9ZA 3OYDA 4YR0A 3GYNA 4MK8A 1YT3A 2J6TA 5J2MA 1BCMA 3LP0A 1NHVA 4DSEA 5KT7A 2EHGA 1HPZA 4ECVA 3T5JA 2JEGA 2XCPA 5KT6A 2ALZA 1LV5A 2VA2A 4TXSA 3QEVA 1RT1B 5KFPA 4CJUA 2I5JB 4OKKA 4NCBA 5CYMA 4W5OA 1X9WA 5KT3A 3F9KA 4QWEA 1C1CB 3KLHB 2ZKUA 1EX4A 2ZE2B 3HL8A 1NOZA 4DTPA 5KFMA 2QK9A 4ED6A 3QLHB 1EETB 3QIPB 1L3UA 5I42B 3P83D 2GV9A 3UR0A 3OYAA 4CCHA 1NJZA 3N6MA 4CJEA 4CEAA 4F2RA 3ZSXA 2AWZA 2G8HA 1DTTA 2XC9A 2RN2A 5L9XA 3AVJA 3TI0A 1JLEA 3I0RB 3OS2A 3H2LA 5I3UA 1NK8A 1C1AA 1IKWA 4YR3A 4DWIA 1EXQA 3NHGA 1B92A 5HRPA 3KMQA 4GC7A 5D3GA 3OL9A 4DG1B 3DRSA 4K50A 1C1CA 4Y1CA 3H08A 4CEEA 2VG6A 2AX0A 4E7JA 4RW6A 5KFRA 1SV5B 3AVLA 4KTZA 5SZTA 3UIQA 3HKWA 4KREA 1CXUA 3PV8A 3CFOA 1RBUA 2AJQA 3TAFA 3M8QB 1L3VA 1RTIA 1IKYB 3DRRB 4Q5VA 4HKQA 3MR6A 3QEWA 4ELVA 4O44A 3OL8A 1RYSA 3IGNA 3VQPA 4Q8EA 5EWFA 5KFEA 3DI6B 2HHQA 4IR9A 4H4MB 1TKZB 3KNAA 3RTVA 3RR8A 1T7PA 3NCIA 2KFZA 3RMCA 1RDBA 1HJRA 5HBMB 5KFSA 4B9TA 2ZD1A 3CDWA 4O3OA 1U45A 5F8JA 4J2DA 4ZHRB 2W42A 4O44B 4I9LA 1JLGB 1JKHA 5HP1A 2E6LA 3HPHA 1U09A 2I1RA 2ETJA 3TAQA 4F4XA 3OYGA 5FDLA 5KT4A 1U04A 4CFAA 2X74A 1QE1A 3V1OA 3OL7A 3WNHA 1WLJA 4DL5A 4F2SA 3M8RA 4KRFA 1S1TA 5HRNA 4CJWA 5D3GB 3FFIA 3FQLA 2FBXA 4LD0A 3ZT1A 2RPIA 1XHXA 4E1NA 4RUAA 2J6UA 4ZPBA 4KB1A 3HYFA 4M3YA 4KAZA 3BREA 4K8XA 3M8PA 3ZT2A 4MFBA 2FVPA 1UA0A 3MR2A 4W5RA 3SFUA 1SKSA 5KFVA 4NCGA 4Z0UA 4M94A 4WXOA 3KK3B 2FLLA 1C6VA 3IG1B 4OGCA 3QGGA 1JXLA 2F8SA 3C6UB 4EYIB 4YP3A 3PW4A 5JUMA 4N41A 3V6HA 5KFAA 1MMLA 2W9BB 2O4IA 4B3OB 3KLFA 3KLHA 5C5JA 2AGOA 3HO1A 3DDKA 2HNDA 4H4OB 3QNNA 1RT4B 3KK2B 3HSTB 2OZMA 1WSFA 1YVFA 4W5NA 4EEYA 1NK9A 3HJFA 2A1SA 2V9WA 4DS5A 4FLZA 4NLWA 1XC9A 2OPPA 5FRNA 4M95A 3SQ1A 2XY8A 4ECRA 2OA8A 1S1WA 4RNNA 3V1QA 4AHTA 2ASLA 4ECSA 1IH7A 2VWJA 4PUOA 1HQUA 5J2MB 4GMJB 3MECB 4WE1A 1KLNA 1JLAA 1RAJA 3RMAA 4MKBA 3ICLA 3DLEB 1KLMB 3P5JA 1S1WB 3CM5A 2C28A 4J9MA 4ZTFA 2HW3A 4ZVGA 2OPPB 5DMRA 2V4RA 1FKOB 1SL1A 3IS9A 3G0ZA 2EC0A 2LSNA 3BGRB 4Z4IA 3OJUA 4B08A 1LWEA 5K14A 3SQ0A 4NLPA 2UVUA 4DSJA 1RT4A 2HNDB 4H4OA 1UA1A 1S0OA 4FJMA 5F8LA 3DMJA 3M8SA 3EYZA 1XI1A 2IM0A 2BE2A 4F4KA 4RU9A 5JXSA 1KHWA 3OYFA 1SKWA 1IG9A 4RUCA 2HAIA 4B8CA 2GIQA 1HQEB 4DL6A 4OL8A 4CK1A 4W5QA 1JLBB 4M42A 1IM4A 2Z1IA 4CIFA 5C24A 3G6VA 4NLSA 3U3GA 4B9MA 4KHSA 4JV2A 4MFBB 1C0UB 4ZVHA 4FLTA 2XI3A 1VK0A 1BQNB 3T1AA 1RTJA 4BE2A 1NK4A 3K59A 3V9WA 3FFIB 4DL7A 4M3TA 3QZ7A 1VSFA 4DF4A 3V6KA 3L2VA 1WSGA 1FK9B 3DLBA 5DGAA 4DF8A 3QEIA 2RKIA 2AX1A 1XWLA 1KSPA 1F21A 2FJVA 1BQMB 3ULDA 4QWBA 2RF2A 1QE1B 1LW2A 4DSFA 4JRQA 4B8AB 3NGIA 5KFFA 1NKEA 3F73A 4Q45A 1RT7A 4R8UA 4ECUA 4C8NA 2HMIA 5HP1B 1RYRA 5KG7A 4MH8A 1RT6B 1VRUA 3RWUA 1B9DA 3MTKA 1GOAA 5E41A 3DOLB 4DTMA 3M9NB 5KFYA 4XIUA 1K1QA 5F8GA 3TAMA 2G8UA 2KW4A 1TL3B 1U47A 2YKNB 4HCCA 3A2FA 3PJWA 3E01B 3QETA 4KPYA 3V81B 1J5OB 2X78A 3TAEA 2G8KA 3DI6A 4ED0A 1BIUA 4I2QB 4EP5A 1VSLA 4EBCA 1ZBFA 1R0AB 1IKXB 4CK2A 3OLAA 2AGQA 2W9CA 3AA4A 4C8KA 1ZTWA 3LAKA 3E51A 1RBSA 3HVTA 1GX5A 3D28A 4NYZA 4IOBA 2IGIA 1FXXA 3SV3A 4DU4A 4FJGA 2R2RA 3NAIA 3PHEA 1JXBA 4ECYA 1TKTB 2BQRA 2OPRA 3V9UA 2A1RA 2IA6A 4RW8B 3DYAB 3N6NA 2ASJA 2O4GA 3AA5X 4KKOB 2AQ4A 2JC1A 3DLRA 2DFEA 3SJJA 4GC6A 4W5TA 5EWEA 4O3PA 1VSJA 4CEQA 5DQGA 2B6AA 4CE9A 4ID1A 2HHTA 5HLFB 3IGVA 5I3UB 4DTXA 1BHLA 2YNIB 4N5SA 4MK9A 3NH1A 2OPSA 2DFFA 3GQCA 3EPGA 3H5YA 1Q9YA 4CESA 3EY1A 3OYMA 1HNVA 4FS2A 3AVNA 3CDUA 3B6PA 4KTQA 4IH7A 3OLBA 4OLAA 5J2NA 3SV4A 3C6TA 2GC8A 4WYWA 3QIPA 1EETA 1N5YA 4OJRA 4IH6A 5HRSA 1EP4A 4K4YA 4CGFA 2IDOA 3I8DA 1LWCB 1Y97A 4CIGA 2G8IA 4LSNA 2C2RA 3SQ4A 4KO0B 3I0SB 4NYFA 4AILC 3PW7A 3L3VA 4IRCA 1JL2A 5KFKA 1JXEA 2JLEA 3G6YA 4DTSA 4FM2A 3K5OA 5KFBA 3OYCA 1L3SA 4DFKA 4PWDA 1XR5A 1ASWA 3SUPA 5FRMA 3THVA 4Q8FA 5KI6A 2R8KA 3V4IA 3V4IB 2IC3B 4QW9A 4IFYB 3CJ2A 2GUIA 4FLVA 2VG7A 2D7SA 4CF8A 2Y1JA 3K2PA 3KHRA 4CEFA 1T03B 4ELUA 4KHMA 4ECZA 4ED7A 1ASVA 2YNGA 4J2EA 4DL3A 5EUHA 2D0AA 3MF5A 4NLRA 3MEDB 5KG4A 3RB0A 4CHYA 3KLGA 4LSNB 4J9KA 1SH3A 4EBEA 4RNOA 2UVWA 4CJFA 4FJIA 2HNZA 4WYLA 2FJXA 3I5BA 1ITGA 3S3OA 3V9ZA 4R5PA 5C25B 4NCAA 4WFZA 4RNMA 3Q8RB 4BDPA 4F8RA 1TAUA 5J1EA 3KK3A 3H4BA 2Z1JA 4ZP7A 3KJVB 1HNVB 1Q8IA 1S1UA 1S1VA 1TP7A 3M9OB 1D9DA 3OSNA 1JLCA 3DRPB 3KLVA 4IG3B 5HROA 4EP4A 4NZ0A 1MU2A 4IDKB 1VSIA 3H4DA 1GOBA 2WOMB 4CF2A 4XPEA 3V9XA 4Q44A 1HMVA 3O4QA 4I2PB 4KKOA 4Z4EA 3TR8A 2FVRA 3AV9A 5DG7A 4L8RB 1LWFB 1TL1A 2JGUA 3ZSQA 4CFDA 1VRTB 1S9GA 4CEZA 3PR4A 4FLWA 3OYIA 3TANA 5CY4A 4FJHA 5KFQA 2UVRA 3MXJA 3HVTB 1JLGA 1WN7A 4DQRA 1IKXA 2YHBA 2IM3A 3OYKA 2JEJA 3MEGB 4ID5B 3FRZA 4Q43A 5KRSA 4MIBA 4DTUA 1VSKA 4WZQA 3S3NA 3L2UA 2GBZA 2HHUA 1CZBA 4YFUA 1NK0A 1TL3A 3DLKA 4KHQA 2FLPA 2FVSA 3RMDA 4GVMA 4ZPCA 3ZSZA 1ZTTA 4EZ6A 4Y2CA 3VQSA 2HVIA 3LDSA 4DQSA 2B43A 5KG1A 1I3AA 4Z4FA 2R8GA 4B9SA 3H5UA 4HCBA 4IFVA 3SYZA 4KV8A 3H59A 1WNSA 2WONA 4OVLA 2W9AA 1RTHA 2F96A 1OS5A 3CFPA 1NK7A 2HNYA 4FBTA 2DPJA 4CGIA 3KIOA 4E1MA 3Q8SB 1LW2B 2BRKA 1DTQB 3L2QA 3ALYA 3ZSYA 1Q9XA 3I5AA 1FK9A 3U3YA 1S49A 1ZETA 2XCAA 4F4WA 4OKJA 1D0EA 1HMVB 3KK1A 1W0HA 3LPUA 2JEFA 3RRHA 2FVCA 3CJ5A 4KAIA 1RT3A 5CYQA 3DOKA 2OYQA 3AVFA 4IR1A 3L2RA 1KVAA 3KOAA 3QO9B 4KFBB 1JLCB 3DRPA 4RNHA 4Y34A 4DQIA 5DGBA 1YTAA 5DG8A 3BR9A 2DTUA 5KG6A 4G3IA 3K5LA 4KHNA 3BSAA 3NGYA 1D5AA 4ICLA 3CIZA 3LANA 2GIRA 2ZE2A 1HYSA 3PW5A 1IKVB 3AO1A 2DFHA 3LP1B 1S0NA 4LQ3A 1KTQA 4FJJA 2VG5A 4FJNA 3L8BA 1ZBLA 1BISA 3BGRA 1NK5A 2BR0A 4Z4GA 1J9AA 3QZ8A 4NLQA 5KFZA 3H5SA 2YNGB 1S4FA 2BANB 2R2UA 1S48A 3SI6A 4YR2A 1XHZA 1T8EA 4KHRA 1ZYQA 3OY9A 1KLMA 3AA2A 3LP0B 1FKPB 2VA3A 1HNIA 5KRTA 3VQ4A 4K4SA 1JLAB 3JYTA 4TY8A 3PX6A 3QIOA 3KHGA 5DLFA 1HQUB 5J2PB 4CJ4A 5T7BA 3VQ9A 4DU3A 4FVMA 3QERA 4AHRA 1HRHA 1TKXB 2ITGA 1UWBA 4O4GA 4AHUA 4PQUA 3AO5A 4CJ3A 2DPIA 1S6QB 4G1QA 4WFYA 4DL4A 2IM1A 5F9LA 2UUWA 1IO2A 4RW7A 4I7FB 3QIDA 4YMEA 2PYJA 3KLFB 4HHTA 1HYSB 1L5UA 3VQEA 3OVNA 3NKYA 3S3MA 5KFOA 1RDAA 2PZSA 1SL0A 2JC0A 5EU7A 4NLYA 5DQHA 3EZUA 2R7YA 3AO3A 3CO9A 3QGIA 4NCGB 3WNFA 3CYMA 1S6PA 3TARA 1WSIA 2IM2A 4OGEA 4CHQA 2UUTA 3QO9A 3T19A 3LAMA 3JSMA 2QE5A 3VQ6A 3IRXB 5CYQB 3U6FA 3UQSA 3CDEA 4J2BA 4CJRA 3ISNC 5SWMA 1RT2B 4CJPA 3TWHA 3BQ1A 3SUNA 3C95A 4LY7A 2BQ3A 4NRTA 4IKAA 3QGHA 2XGQA 2HHVA 4LSLA 2Q3SA 2IJNA 1QHTA 1REVA 4RW8A 1RT5A 4BDYA 4URSA 4RZRA 3CM6A 4OPJA 3QESA 1TKTA 3ZT0A 4Q0BB 4J9LA 4ELTA 2D3UA 5KGXA 3AVHA 1JKHB 4RW4A 4ZP6A 4ECWA 1U49A 4CGDA 4EO6A 4NYNA 4JS5A 4NRUA 4AHSA 1DLOB 3RMBA 4O5BA 2ILZA 4PQUB 2XY7A 3RR7A 5HBMA 1T94A 4FJ5A 3NE6A 2XHBA 4H8KA 3CVKA 3CQ8A 3L2WA 1RCHA 4URGA 3JYTB 4TY8B 2E6MA 4H54A 3B6OA 3DM2B 4TQSA 3EPIA 3SNNA 4HVJA 4FJ8A 2KFNA 3DRRA 2BQUA 4Z4HA 2HMIB 3ZSVA 4E89A 3VQQA 1L3TA 4CGHA 1S9GB 3OYHA 1TK0A 4AHCA 3MEEA 4CHNA 3K5NA 4QPXA 2VG5B 2IMWP 1BQMA 4ZVFA 1QQCA 3D0PA 1REVB 5F8HA 1IKVA 3LP2B 3NBPB 3TQ1A 1NK6A 2HHWA 1IKWB 5KFJA 4NLVA 4CJKA 1JLFA 2YNHB 1BI4B 4CJSA 4FLXA 3VA0A 1BQNA 3KD5E 3BDPA 4J9NA 4DTOA 1Z26A 2F8EX 3V6DB 1W25A 1NJXA 1S1VB 1S1UB 1NHUA 4KFBA 4F4ZA 4XPCA 3AVIA 4CERA 3KMSA 4K4ZA 1A5XA 1J53A 4BWMA 5J1EB 3NF9A 4M3RA 3KLIA 5I42A 1BI4A 3TABA 5C25A 4KBIA 4U6PA 2NUBA 3AVMA 3RAXA 2IBKA 4HUFA 5EWGA 2R8JA 2YNFA 3DMJB 4CF0A 2BGGA 3UPFA 5EDWA 3VQCA 3RRGA 1QSLA 3KLGB 1DTQA 5CYMB 4ZVEA 3NMAA 5F8NA 2D41A 4E7KA 2WCXA 2YV0X 1RT1A 1A5WA 2PY5A 2AGPA 4C8MA 4B9NA 3ZSWA 3K58A 4M3UA 2QV6A 4K4XA 3OYBA 4DSKA 4CF1A 1VSDA 2VG7B 4JLHA 3BSOA 3DM2A 2IC3A 5KFLA 4UQGA 1HNIB 4O3RA 1T05B 3BQ2A 1K6YA 3HM9A 1LAWA 1RA6A 2CKWA 1TK8A 4HTUA 4N47A 4FZYA 1DLOA 3S9HA 3K57A 4O55A 4ID5A 3MEGA 3OSPA 1QUVA 2FBTA 3LALA 3TAPA 1I39A 4DTNA 1N6QB 4CJQA 3O4NA 3UDLA 1YTUA 3I0SA 4J9SA 4MKAA 3QEPA 4K4VA 2FVQA 4DU1A 3AO4A 2D3ZA 4J9RA 3H98A 2W7PA 1SH2A 4B3OA 1S97A 2W9BA 3NH2A 4CF9A 4ICLB 5KFCA 5KFHA 3KKSA 3SZ2A 2IAJA 3FSIA 3VQDA 3PX0A 4HUEA 3AO2A 2IOCA 3AVAA 4ZP9A 3SCXA 4JUZA 3WNEA 3KTQA 2P5OA 3ZT4A 5T14A 4DMNA 3BQ0A 3JSMB 1RA7A 4DL2A 5J2QA 2BRLA 1CXQA 1X9MA 1TV6B 2V4QA 1CZ9A 3SPYA 4FLUA 3OHBA 4FM1A 3VQBA 3N6LA 5HLFA 4WFXA 4IRKA 3HP6A 4BWJA 5DLGA 5KFNA 1QTMA 2G8FA 1RTDB 3KK1B 1TVRB 2ATQA 1T3NA 4PY5A 4J9OA 3HVWA 1RNHA 1YVUA 1SL2A 4DTRA 1D1UA 3CFRA 3OJSA 5KGWA 4CEBA 4CGJA 3SFGA 3PW0A 1RTHB 4I7FA 4KTWA 4KB7A 4FLYA 4PA1A 3KD1E 3MEDA 1K1SA 4IFVB 3HPOA 1WAJA 4G1QB 4M3WA 1S6QA 3NH0A 5KFTA 3MXMA 4RW9A 3I5CA 2Z1HA 4CHZA 4FK2A 4LQ9A 4E0DA 2CJQA 1CLQA 1ASUA
chains in the Genus database with same CATH superfamily
3WNGA 2ILYA 1J5OA 5F8IA 2G1HA 4QU7A 2MZTA 4X4PA 2OGUA 2E5LJ 4FSVA 1P8ZA 1NKCA 3ZTSA 2EBGA 1HARA 4M5KA 2JWKA 1LNQA 3MPVA 5HVGA 3HLUA 1KBRA 2D0CA 2XGPA 4KH4A 2GHVC 3QT6A 3LM2A 2V52B 4NMLA 1HWJA 3J7Z5 1KFDA 2JLFA 1C1BB 4WZMA 1YKWA 2GWKA 4LRBA 2OHDA 1RCOB 2CVIA 7AT1B 2RQMA 1TZ0A 1LWFA 2W4PA 5A6WA 3UVJB 3GILA 4DQPA 2QT7A 3F5TA 4NLXA 1JJ2M 2W7OA 1SKUB 1C2PA 1TAQA 3KUEA 3WQUA 2PGCA 3C6TB 4C3LA 4HDHA 3HT3A 3NAHA 2KG0A 1TKDA 1TQLA 4F0KA 3I56S 1GLDG 5F2RA 4F4YA 1YHQS 1OYDA 2LEAA 1URNA 1VQPN 5LY3A 2Q6BA 3DOKB 1RT3B 3AVKA 2P2CB 4LF9J 3W2VB 2IDEA 1WTFA 2J6SA 4ITSA 5ETNA 2HVHA 4LFAF 2FC8A 4Y3CA 1FD8A 1X4CA 2G8VA 5TKWA 1TUUA 2FZGB 1Z25A 1I6JA 3NGDA 1N8RO 2B51A 2M52A 3PZPA 1LW0A 2FBVA 4BR7A 3MURP 2HBMA 3DLEA 4R0JA 2VHGA 4M8LA 4QS8A 2R8IA 5H9EJ 4W98A 2EVZA 2GCFA 2GVZA 2A41A 1NSKL 3NNAA 4DN9A 1F9EB 2CQPA 2MTLA 1FEEA 3L09A 3S01A 4DEZA 4HLBA 5KG2A 3KLEA 3NRBA 1KQSR 2NPIA 4GMKA 3NFAA 1RGIA 5E3RA 2CNNB 2KYXA 2WW8A 3MUMP 3B8AX 1RDRA 4JI5F 2WSEC 1LAVA 1Y9OA 3ZZZA 4LBIA 4KB0A 2G2ZA 3S1TA 2LDYA 4AF1A 3HXMA 4FWLA 4C1NI 4KHYA 2AEJA 4J2AA 3A8KA 4GW6A 1SUQA 3KDNA 2OAUA 3GU0A 2VPYB 4RL1A 2QA4G 3PX4A 2BJDA 1UEUA 2GV1A 1JLQB 5CA5A 4ED4A 3FZ2A 3OS0A 3SCJE 3NCQA 2QMWA 1SH0A 4PXEA 4UUWA 3W1YC 2AU0A 2ZF5O 1NCLA 1D9FA 3EEQA 4IDKA 2ZNYA 3KNGA 4ZMMA 3Q7CA 4IKFA 4YNQA 2XG8A 3W61A 2KKZA 2QGFB 1OYEA 2E2QA 4OZ5A 2R2TA 2JFDA 3AA9A 1AROP 1RAOA 3V5RA 2U1AA 4OYWA 1U6BA 4F7VA 3TUZC 4RBVA 2GMJA 2RDJA 3PIOQ 4LF7K 2WB1D 4A59A 3QGPA 1VQ6N 1NU0A 3GJQB 4LF8J 4KSEB 5LM7E 2KQ2A 1ICEB 2ATLA 4J9QA 3DLGB 1H73A 4I68A 1NJYA 1YITN 1SUQB 3DFEA 2JL9A 1XQIA 5K14B 1HR0F 5C42B 1RWXB 2F4VK 3ZNUA 4KI4A 3ZTOA 3CW2C 3MAQA 4CFBA 4Y2IA 3M2VA 2ATCB 1HNXJ 4CIOA 5MAOA 5C7PA 3H40A 3ZT3A 3G86A 4I2QA 4URQU 1EARA 2POKA 2ZD1B 2Q79A 2HF3A 1Y00A 4I9QA 4GKJK 4F25A 3KLEB 4MDAA 4JK9A 4CVNE 4KHWA 4X64K 1VQON 4JI3J 3BDEA 1HBMB 2EBEA 4LSZB 2EFQA 1P9QC 1JX4A 5KT2A 3OYEA 3EGWB 1LW0B 1VQLN 3EWGA 1AYEA 4Y0FA 3E9PA 4OLBA 2VL1A 1Y64A 5G0RA 4K2JA 3W65A 2O8BA 4CJTA 4B9UA 1PJ5A 4FJ7A 3DLHA 1Q8KA 4KO0A 3LPTA 4ECXA 1HA1A 1SBRA 1RDDA 5BR9A 2RSQA 4M45A 2YNFB 4IEEA 1NWKA 2ZQBA 4C8LA 5LSLA 3PO4A 2DNPA 4DR4F 2JSXA 1TMJA 5T7LB 3GTYX 4CLSA 4FYWB 1KR4A 4DV3J 4WKYA 2KHCA 4O3NA 3I0RA 4J91A 4M41A 2NZTA 4B9VA 3QNWB 1SQEA 1S9FA 2KXFA 1HNXK 3NLCA 4X4QA 3NF7A 3D5MA 1VCTA 1HWIA 3RAQA 4DB3A 2OPSB 1SJ4P 2QWNA 1H2TZ 2ASYA 4ED2A 3BBFA 3BGOP 2YNHA 3OHRA 2DR7A 2CG4A 5AQSA 4ZVPB 5THWA 2KVIA 3LP2A 3PSFA 3LF0A 2GW8A 4H03B 3ET6B 2MXYA 1JNZB 2E2NA 2W8KA 1U25A 3DU5A 1C1BA 3MCMA 5AQOA 2XRIA 3R7SB 2V6AA 2X3DA 2HEKA 3LTOA 4DV2K 3QINA 3UD3P 4DSIA 2Y1RI 1SC4B 4JV5J 1S9EB 4PXCA 1UJ6A 3DHXA 4F3OA 3AD7C 2CPXA 4JOUA 1X9SA 1K47A 4FWRA 3K17A 3ZEUB 4KR0B 4J5OA 5F9NA 2ZITA 5IQQA 2P1JA 4CECA 3SUOA 2YTCA 2V51B 1MW7A 1W2BM 3KK2A 4K4UA 1RT7B 3VA3A 1DFDA 4AHVA 4CEOA 3PJXA 4FVCA 4M3XA 3EVWA 2P5GA 2E29A 3ULHA 4B3RF 4LSLB 4IG0B 5EHHA 3ZTPA 4CHPA 1HL6A 1KC8T 1PJ6A 2IIHA 3J81O 2C22A 1C0MA 2DNGA 3PYGA 5LJWA 2R7QA 4S0MA 4FJXA 3QYYA 2V8DA 1EWRA 1NGAA 4YOUA 2DK2A 2B4JA 4EYHB 2C2ZB 3O3FA 1S10A 3US5A 4O0JA 3TVZA 1VHFA 3Q8PB 5B0GA 3BR8A 3WEEB 2HLTA 3T1HK 2W7AA 3C7NA 2WRMA 4DJBA 2UUBJ 4DLEA 2W8LA 2BXJA 2CQ0A 2BE2B 2E1AA 1VQ4N 3PFEA 3PCOB 3W9IA 5BR8J 5K5MA 2CNLB 4RW7B 2V50A 2E1CA 3ZCMA 2V0NA 3HSCA 1ZZFA 4QCLA 1U8SA 2WTUA 1FKOA 3QATA 2GAHC 4DV2J 4FYDA 3SAGA 4LREA 3CC2N 1XMQJ 3HHEA 1OIAA 4EGLA 2ZVSA 3OYDA 2IRYA 3Q8YA 1EZZB 3GYNA 4FPRA 4QQBA 4JKFA 2VFTA 3KG1A 2ZJPQ 4DSEA 3ZLJA 1GLAG 3DOMA 5KT7A 3P6YC 4L3NA 4UY8O 2XS5A 1RFQA 3T5JA 1VQ8N 1GTHA 5KT6A 4LIRA 4JI6J 3BV8A 2B3TB 5AZIB 2O8FB 4CJUA 4OKKA 2HG4A 2FSNA 3F9KA 3OPKA 2HYIB 1G6BA 1EX4A 3HL8A 3EM1A 3EKSA 4X64J 2QK9A 1DEJA 4ED6A 1MN9A 1EETB 5I42B 4OPHA 3MAHA 2GUPA 3OYAA 1RWNB 4JHDB 4CO4A 4HT7A 3DGPB 4CEAA 3ZZTA 4UZCA 4QU6A 3ZSXA 1WSVA 2AWZA 4WBFA 2KT3A 2RN2A 3FZFA 1NB7A 3IO1A 4LF4K 1PKUA 2CWKA 4PWUA 1SI9A 3H2LA 1CJTB 2DXEA 4DWIA 2QRRA 4UOHA 1B92A 5HRPA 2AYBA 4BRDA 1BA0A 3FSYA 5JVHL 2RUSA 3AFGA 3DRSA 1Y3JA 2VG6A 2AX0A 2WC9A 5K8MA 3D6FB 3AVLA 4KTZA 2CADA 1T3OA 3CMEN 2UU9J 3PJ9A 3GJTB 3CFOA 1RBUA 1L3VA 1FJCA 1FDNA 1IKYB 3DRRB 4Q5VA 2LECA 4BREA 4ELVA 3DDIA 3H8YA 5BYRA 2EFVA 3SXLA 4RPFA 2HBLA 1NB2A 4Q8EA 3G6ES 4Q2MA 3ZZUA 4J7CA 4JI0J 2VBZA 2P9LA 1CJVB 2FHOB 2ZNZA 2KFZA 3FBFA 3ZZOA 4YDUC 1V9OA 3RMCA 1FDBA 1FNMA 2JOQA 1J5EJ 1HJRA 5KFSA 4PRFA 3A3PB 2P9LB 1QHAA 3BPSP 5JVGL 5GAHU 4LR7A 4DBQA 4LRAA 2CGLA 3ENQA 3QICA 1YJWN 1FRKA 1R8CA 1JLGB 2M88A 5HP1A 2E6LA 3HPHA 4NYPA 5F3ZA 9RUBA 3GOIA 1VBKA 2DHXA 5FDLA 4I0WA 2AYEA 3G82B 2NRRA 2ZH3A 2CJKA 2QWPA 4PL8A 1S1TA 2RE1A 1VQ9N 2UUAJ 2UUCF 1R59O 4FXWA 1PC4A 3FFIA 2P9CA 4LD0A 3O80A 3ZT1A 2CG8A 1XHXA 2J6UA 4YHHF 4KB1A 3HYFA 4M3YA 2EC2A 4BRAA 4DV3F 4HL9A 3ZT2A 4MFBA 2FVPA 3MR2A 1YRUA 2RHSB 2GX9A 3KG0A 2RS2A 3SFUA 2Z2YB 4NCGA 4MTPA 4WXOA 4P2XA 1C6VA 1JXLA 2F8SA 4LF2A 2YHWA 3D9BA 3MPYA 2QM1A 3PW4A 3MD1A 1FJ7A 2MKSA 4UY8T 4LF9K 3GFXA 1ZH5A 3KLFA 4IOXA 4DR5K 1PSDA 1YVFA 2YWGA 2DHAA 2HBQB 3HJFA 4X4VA 5B0AA 2O8FA 1LWXA 4EFHA 4DS5A 2OPPA 2N7YA 4WJBA 4ECRA 3O9QA 2CPEA 2APOA 1JQGA 1RISA 2ASMA 2P9NB 1JLAA 4JKGB 4MKBA 2OTJN 2VODA 1KLMB 3P5JA 2PDAA 1S1WB 3CM5A 1GMWA 1IJEB 4UOFA 2VFVA 2C3UA 4X62F 5DMRA 1FKOB 3WIUA 3IS9A 5MLCV 1NXIA 3BGRB 1HKBA 4LF8F 3HFZB 4NLPA 1RT4A 3M5RA 2VQEF 2P8IA 1OPIA 3DMJA 3FCHA 1GQEA 1XI1A 2BE2A 2MQ8A 1X4BA 3GCXP 2HAIA 1HI1A 1N5VA 5BR8F 3C7NB 1ESVA 3MM5A 1FJGF 2PT0A 4W5QA 5SUHA 2UYTA 1P90A 4WP3A 2UXBK 4HI1A 4CIFA 4HR2A 3CJSA 4CLUA 3KZBA 4DV2F 4JV2A 4P9SA 4YY3K 2Y0SD 1HKGA 2RB7A 3T1AA 1EQMA 5BJRA 5IC6B 1RWVB 4OX7A 1PC5A 3NOCA 2YKPA 1M0SA 4LVNP 2DYAA 4DF8A 1D9AA 2RKIA 1E6VB 1F21A 4NE9C 2RF2A 2HAFA 3R5AA 1I51B 4N8NA 2C1EB 4C8ZA 1HHTP 3CETA 1VK8A 1Q4RA 1RT7A 4ECUA 4LF9F 2WVFA 5F1XA 3GP9A 8RUCA 3D3BJ 2MQQA 1JJ4A 1GOAA 2VZ9A 3UNGC 5KQDA 5F8GA 1GH8A 1TL3B 4G9ZA 2Q66A 5D15A 4B9QA 3PJWA 3BF4A 2UU9K 2MHNA 3AQPA 4FWNA 4CD1A 3UWTA 2IA0A 4EBCA 2J0WA 2OELA 1R0AB 1H74A 2D3O1 2PEHA 3CJ8A 1Q8BA 3E51A 4IOBA 2IGIA 2CPJA 4USHA 3PHEA 2XB2D 5ETVA 1SCJB 1TKTB 2BQRA 3JTPA 4KRWA 3MM8A 3DYAB 3AA5X 5AQVA 2P9UA 4KKOB 2K1RA 4DKWA 2FF6A 3DLRA 4CEQA 5CD4A 3IR5B 2HHTA 2QW9A 1UW4A 4XDCA 2RAQA 2LDIA 1CJUA 3RRKA 2OPSA 3NH1A 3D4JA 3GQCA 4JI2K 3JQJA 4JAXA 3OYMA 3AJDA 3EICA 2KT2A 4FS2A 3AVNA 4IH7A 4YY3F 2OTJS 3P4IA 3QIPA 3SAFA 2W24A 3TWZA 4FWQA 1GLFO 2A5XA 5DS7A 4DR7J 3AXMA 2DNZA 2C2RA 1PYSB 3OR2B 4KO0B 3I0SB 4ZN3A 5C0YA 1GAOA 2ZUGA 1E6YB 2CH6A 4CWBA 5JLFA 4IRCA 2MDAA 2V7YA 2VASA 1XNQK 2FDNA 3K5OA 1QQMA 4Z94A 1ZPVA 4JI1F 1RAHB 2KM8C 2YVSA 4UOCA 2WAQD 4XH4A 3OTDA 4FP9A 1T03B 2ABYA 1CULA 4KHMA 3QRRA 3HCXA 1ASVA 2YNGA 3I33A 4L73A 4J2EA 3U7JA 2PSZA 1CBKA 4MYUA 5EN1A 2AP1A 2XMTA 3KJQB 3MF5A 3PKMA 1FRMA 4BLGA 3CULA 3DLLQ 1YJRA 5C15A 4OQJA 5EX3A 2PFUA 1WBBA 3KLGA 3N4QA 1WKKA 3FCWA 4CJFA 4FJIA 2VC0A 3OVBA 1UW9A 5KAKA 4GKKJ 4J8FA 4BRIA 1S6UA 4P75A 1EWQA 4BDPA 3TJ8A 5GMEA 3R2DJ 4ER8A 3H4BA 2Z1JA 4ZP7A 3KJVB 1HNVB 1S1UA 1S1VA 3M9OB 3WX8A 3KLVA 3DRPB 4RX6A 3ILLA 5HROA 4GNIA 4JKBA 1HBNA 4ZPVR 2BOAA 2GGPB 4PG6A 3NY0A 4IDKB 1KQSM 3H4DA 3PHTA 2CQIA 2G1DA 2HFNA 2OUGA 4DPOA 4JYAJ 1WKJA 2R7UA 4L8RB 5JJBA 1NDPA 4LF6J 3HZEA 3ZSQA 1XMOK 1VGYA 5D4OA 1S9GA 2IFXA 3PR4A 3M6UA 3C16B 3CIPA 4JV5K 1MSWD 1BC6A 2DR6A 3VAJA 3ENHA 2HQCA 3FRZA 2KDOA 4KBOA 4DTUA 1VSKA 2LA4A 4RUBA 5EGYA 5HJYA 2H5JB 2GBZA 1RBLA 3DLKA 2FLPA 1SPBP 4TU7A 1B64A 1VQSA 1ILYA 3FE1A 1ZTTA 1U0HB 2YPZA 3IRWP 3VQSA 4U7BA 1DY3A 3HSZA 1BA1A 2DCUB 4L72B 2B43A 2NYIA 2NLWA 3FBBA 2R7OA 5ETKA 3BN7A 4B9SA 5EXWA 1ZM3A 4HCBA 5E2QA 1NUEA 5AQQA 2WONA 5K8OA 1OS5A 1RWPB 2IBOA 3CFPA 4FBTA 4CGIA 2QC3A 3KIOA 1LW2B 1DTQB 5B0DA 3I5AA 1FK9A 2WSCC 4DR5F 5EY4A 4P10A 1FEHA 4F9OA 2XCAA 1W0HA 3LPUA 2YJFA 1NG9A 3GBTA 3W2VA 1RT3A 5CYQA 3DOKA 3AVFA 2WVBA 1KVAA 2DHGA 1FERA 4KFBB 3DRPA 5H9FK 1VQ8S 5J1NA 5DG8A 3BR9A 2MQPA 1FF2A 2DTUA 1BUPA 2CZVC 2NR0A 2VKRA 4K8RA 3R5BA 3LANA 2GIRA 1U1NA 4BRQA 2ZE2A 4DR2J 3PW5A 2FGOA 3CC2S 3VWSA 1S0NA 3G25A 3M3ZA 2VG5A 3R1XA 5GVQA 3L8BA 5ETSA 3MX5A 4ID8A 4OJGA 3MPUB 4PHTX 5KFZA 3H5SA 4M5MA 2YNGB 1S4FA 2CJ9A 2BJ7A 4WFAL 5D6GA 1Z05A 3OY9A 1YJVA 4IOCQ 4ZCMA 1K0VA 1X4EA 3CMAN 2H54B 1FKPB 1HNIA 4NXMK 3UCUP 3AB2B 5DLFA 2IIRA 2YCHA 1YI2N 3QERA 1CPZA 4WQ4A 1HRHA 2ITGA 4O4GA 3Q89A 4PQUA 3W2WB 1HW9A 2HGNA 3AO5A 4YOTA 2SXLA 4YN3B 3ZZPA 4U7UD 3NP5A 5L9NA 1FRLA 4DL0C 4Y00A 1KXPA 3QIDA 2GIFA 4LVOP 2A3JA 2PYJA 2G13A 1HKCA 3ULEA 2DNRA 4NX9A 5BRDA 3U1NA 4C2MA 1RDAA 3UFCX 5AE1A 2DNLA 1XMQK 2JC0A 4Q7AA 1Q86T 1AT1B 3EZUA 2R7YA 2OMOA 3UDEA 3AY9A 4OGEA 4CHQA 3QO9A 3MM6A 3T19A 4FWSA 2QE5A 4I64A 3BF3A 4MAKA 9ATCB 3UQSA 4J2BA 4CJRA 2BX6A 3MR7A 5D4PA 4LY7A 3LDOA 4KGZB 4NRTA 3J8AA 4JB8B 2XGQA 2Q3SA 2JVOA 3CM6A 4X4SA 2XMUA 2W6LA 1TKTA 2O67A 4RU2A 4A8MP 4IO9Q 3L4QA 2D3UA 4H4KA 1TTHB 3IXQA 5CABA 1JKHB 4DR3F 4ZP6A 3SCIE 4CGDA 1J6ZA 2JX2A 2DPNA 4NYNA 2MKJA 4JS5A 2D0OA 1Q7YT 2VBYA 2EFOA 3RMBA 4NLCA 1CC8A 1PILA 2BV3A 5AQMA 3HDSA 5A76A 3NE6A 1NGJA 4H8KA 1KOOA 4DPXA 1QLNA 3E2EA 1PYTA 2XBPA 3B6OA 4TQSA 3D0HE 3LDQA 1X60A 3R1LA 4LRDA 1U1LA 4ZLJA 2ERRA 1Y11A 2P9KB 4E89A 3VQQA 1VQMN 2F4VF 1NM1A 1WG1A 1TK0A 1PO6A 4CHNA 4QPXA 4XDDA 1HNXF 3ZO7A 2IMWP 4B3SF 4ZVFA 1QQCA 3FZHA 2HLUA 2AKWB 3NBPB 2OO4A 1IBMK 1S4EA 5H9EK 2VQEJ 2CJBA 1YBTA 4JI4F 2QL5B 1IKWB 5AJ3K 4NLVA 2H1YA 1JLFA 4CJSA 4D3GA 4FLXA 4BVOA 2UV8G 1XMQF 5TKYA 4DPTA 2LXFA 4DTOA 1Z26A 1KC8O 3O4WA 1NJXA 3R97A 1K9MT 1FXDA 4XPCA 4F4ZA 4OJ1A 4CERA 1KD1T 3THYA 5J1EB 4DV0J 3K8VA 3NF9A 3KLIA 4M3RA 1BI4A 4KBIA 4U6PA 2K7KA 1T44A 3AVMA 2R8JA 2DIVA 3DMJB 3LQVA 1PBUA 2XZTB 3VQCA 4OHWA 4ZJQA 3ILOA 1CS4B 2BACA 4NL5A 4AT1B 3VF4A 5F8NA 1U1OA 4BRNA 4E7KA 1FO1A 4EWTA 1RABB 2DEJA 4B1XB 3P5TL 1A5WA 1CQMA 5I4MA 2PY5A 3THTA 2VOOA 1YJTA 1OQ3A 2VG7B 2P5VA 1Q81O 1XMBA 3BSOA 3VAFA 3DM2A 4LFAK 2P9NA 4NA3A 3FEZA 1VQ6S 4IO9L 1UZHA 4QYZK 4ZVSB 3HM9A 1TK8A 4HTUA 2B8PA 1GLBG 3S7RA 4FZYA 4GV3A 2RRNA 1RWWB 3GL1A 2PEBA 5HJXA 3MEGA 3AAWB 3CCRS 3LALA 1I39A 2NXEA 2VFSA 2BE7D 2HRUA 5BYQA 1VQ4S 4J9SA 4K4VA 1WEXA 2QEXN 2W7PA 4LBPA 5KFHA 2A2CA 5KFCA 1U8WA 2RNEA 1LK7A 1U0SA 2V2ZA 4B3SK 3AVAA 1ATSA 3PIPQ 2NXUA 5I9EB 2AJ2A 4PXDA 1BO5O 4JI0F 3OTCA 4YB5A 3D7SB 3BQ0A 1I1GA 3LO3A 3JSMB 2HZVA 5J2QA 2ZBQA 1CZ9A 4Y65A 5C2FA 3K5PA 4WFXA 2G8FA 2E5JA 1OVYA 2BTFA 1TVRB 2P6SA 1F5CA 3P45B 4PY5A 2C2MB 4ZIVA 3TOQA 1YVUA 3HVWA 2EW9A 4WFNL 4CNZA 3TZWA 1FWKA 4DV5J 3OJSA 2UXDJ 3SMSA 4CGJA 2Q43A 3PW0A 4I7FA 4KTWA 3A12A 4FLYA 4IFVB 4LFBK 3HPOA 4G1QB 1S6QA 5KFTA 5FD1A 1YJNS 4YOXA 3M2UA 4RW9A 4KH5A 3TSPA 3A3NB 2Z1HA 1I94F 4CHZA 2BUPA 4LQ9A 3HTVA 4WK1A 4E0DA 1JWWA 3O6QA 4ZVOB 3CJ0A 2FSKA 1O1WA 4QIGA 5IQ6A 1TKXA 3CD6N 5IC4B 1IR2A 1RHKB 3U1LA 2RHKA 3OL6A 2O5DA 5DZ7A 1SAZA 3H7HB 3GWCA 1RAFB 1RBTA 4H5NA 5DDPC 5GIPA 2N3OA 1UETA 3QAUA 4C1NK 2YHXA 3T5KA 5DZ6A 2RILA 3ETMA 4PYAA 4JI1J 1IKYA 4BACA 1O6XA 1WF0A 3HVRA 4ZPWR 3P3DA 1VC5A 2NUHA 1YJ9N 2W41A 3JXUA 3TZYA 3O6WA 5HO4A 4DFJA 3G4SS 1QZ5A 1Y5IB 2HQ3A 1CS4A 5L1JA 4DXLA 4X64F 3DRSB 4I69A 4B3MJ 1C0TA 1H0HB 1YI2S 1EP4B 1HUXA 2IRXA 3KLIB 1MU2B 1Y5NB 3NXZA 4CJ5A 4MLHA 4FZXC 4PXBA 4YQWA 4JD2A 3C46A 4KGXB 3TA0A 4B3TK 2AJ0A 1BL3A 3W9JA 2GQ2A 3AHPA 1NGFA 5JS2A 3RB6A 1W7AA 3LA0A 1OH8A 2QKBA 3CDAA 5KQ8A 1VS3A 3CMQA 2V8HA 4Z2XA 5FLXU 4DPWA 4NEYA 3PY8A 2RE2A 1LWEB 5CAAA 5E5NA 4Y2AA 4ISEA 1DAXA 1I5OB 4PL7A 1MG7A 5AZIA 3A8JA 3CWJA 2KZMA 4YEAA 4KV8B 3CT9A 2MJNA 3PYDA 2PMZD 4ZJOA 2NRHA 4BRCA 1ZAWA 2DITA 2OTLN 2XS7A 4BC7A 4CEDA 3I9ZA 4EFAC 3J80O 3DOMB 1Z6RA 4U9RA 2CIMA 4LH5A 5A2QY 4CFCA 3KHHA 1NJWA 1YVNA 4CBWA 4JI4J 3JQKA 1BIZA 3P96A 3LDLA 3OYJA 4BQLA 4OHVA 2B9EA 4K4TA 2AD9A 4ED8A 3Q8QB 1DRZA 1VRUB 2AT1B 1CJKA 4FK4A 3HP9A 1TU0B 5HAOA 3N5BA 1X5PA 2MQOA 2G0JA 1VYAA 4ENOA 1T9VA 1NPPA 1TL1B 3O1BA 2FHMA 2HWIA 2R7WA 1N5YB 4DUYJ 3EDQB 4MK7A 4NOHA 1YBUA 3GZ7A 3OXLA 4I6WA 2O01C 4HUGA 2YXLA 3RW6A 5L1KA 1D4XA 4LC9B 4NXNK 3SQ2A 2PE8A 3AOCA 4DFPA 4QWCA 1U2CA 4RTFD 3DXMB 1B3TA 4QW8A 3C94A 5JICA 3OVAA 3H42A 3O9RA 4DFMA 1JLBA 1YIJS 2DHHA 2OJ3A 3FUYA 2IVPA 2EX3A 1WUUA 1KRPA 3BZKA 5F3TA 2QKKA 2UXBF 2GJIA 2X6SA 3EDRB 4NLUA 4FJLA 1GTEA 1S59A 4BE0A 2DRDA 1YWXA 4OLOA 2PMWA 4FKXA 2V2VA 4LF4J 3QQCD 3BKUA 3D2WA 4MIWA 4E19A 1NGDA 3NL0A 3R3LA 2GO9A 3FDSA 3ZETA 2HS0A 2FUG9 4YDDB 4PKHA 1NOYA 3W2WA 4OV1A 5GAGP 2E5LF 2IPOB 3QFHA 3RJMB 1VBZA 4CH7A 4DV4J 1H7XA 2DCLA 4L6V3 1UVJA 1S9EA 3TAMB 2VWKA 3FZKA 4V19J 4BC5A 1TKZA 4H4MA 4WE1B 1NPKA 2KYZA 2EFPA 2HHXA 1FKPA 4QR2A 3DOLA 4QIEA 1HHSA 2D5RA 1WSEA 1Y7PA 2QSWA 1TK5A 4M5JA 3PNIA 4AL6A 3M8QA 1IBKJ 1X4FA 2ASOA 4O8KA 2HQFA 3MOZA 3HKZD 1N34F 3ET6A 1QAJA 2DNNA 4CM2A 2X3GA 1X5TA 1WC4A 2JLGA 4P7VA 2D0BA 1EKEA 3CJAA 3I9V9 3OR1B 3BSCA 4QAGA 1U4BA 1HNZK 4PKDB 3IDHA 1N56A 1RDCA 3C6UA 4CZKA 3NG8A 5J2NB 2Y0BB 3IG1A 4U7CA 1HI0P 4C0BA 3LWMA 1KN6A 4TY9A 5D4NA 5H1SV 3TVKA 1RILA 4RNFA 1ZPWX 3A1YG 1RHQB 3TAGA 1APSA 1M1GA 5D77A 3WXLA 2B6AB 4JS4A 4KJIA 5HQMA 3O9TA 3AQOA 1XEZA 3UCZP 1H6KX 2X6NA 3JB9k 1B7FA 3ZSRA 5JS1A 4CO3A 3LZIA 2X1AA 3MGJA 1YF5L 3R27A 1S3XA 3VAHA 1Z1ZA 1NNDA 3FZLA 1G2EA 3TX8A 2O8BB 4RWTA 2WONB 3RSEB 2FHKA 1PJ7A 2OEJA 4V19X 1RDWX 2FBYA 3NGZA 3LP3A 1R8BA 2OZSA 2V4JB 1VQMS 3K89A 3C65A 4FPIA 3T1YJ 4FW2A 4KHPK 2XWYA 3V81A 4FS1A 1D09B 4PAAA 1A5VA 3DLKB 2F9WA 1D8YA 4KI6A 2YKNA 4BS2A 4R0EA 1RB0A 2PI5A 4B3MF 2KFYA 5DQIA 4LFCF 2DRAA 5DM6Q 1RBRA 4FK0A 2HQIA 4ED1A 4CLWA 4ALZA 3M2VB 1CZAN 3AA3A 3FRYA 4FXDA 2E8AA 1V3ZA 4RW4B 4BDZA 1RTIB 5C42A 4ES1A 4IOAL 4G65A 5L1IA 3NVKA 2XO7A 1R8PA 3VAGA 3DLGA 5FROA 4EBDA 1OVQA 4NASA 3CCQS 5IS2A 4TLRA 1VQNS 1HIYA 4B3SJ 1KVCA 5E7OB 3HHKA 5JVGQ 3CNQP 1WDTA 2FJWA 4ECQA 1XR6A 4C0HA 3GFYA 1T9UA 1DTTB 4BGBA 5AQHA 1HBUA 1XR7A 3K7RA 3RBDA 3C14B 1H7WA 2DH9A 5LMUK 1S0MA 3SSSA 5AQTA 4NYOA 4Z37A 3B54A 1JLQA 2IAJB 4CLZA 2MZJA 1Z4UA 2C2KB 4X2BA 3AVGA 3P1GA 3OYNA 1NMNA 1ZBHA 4F3TA 2V69A 1X3MA 3GG0A 5BPNA 4DS4A 4ZPAA 4I6YA 1TGOA 2AZ1A 1OKJA 3H5XA 4G1PA 3VGKA 1T03A 2CA9A 3NDKA 4TSXA 5RUBA 1OH7A 4RJVA 4FM0A 4YR0A 4XH1A 3CPWM 3K0SA 3TU5A 1SJ3P 1FT8A 1T02A 3T69A 3LP0A 2UZAA 1NJIT 1ULRA 2G4BA 1RACB 1PIEA 3DKDA 4X84A 1RHRB 2VA2A 3AODA 1RT1B 3R5CA 1F3VA 2I5JB 1E6YA 1UVKA 2ZHOA 4U8VA 1S72N 3CD0A 2CQ4A 2VC1A 1WOQA 2XMKA 3GFZA 1RE1B 5E84A 2O8CA 4Y2KA 4QWEA 3DRXA 3GLJA 3MMVA 1OH5A 3F44A 1XUPO 1N36J 3QIPB 3NMUA 5KOWA 1HX1A 4OZLA 4F0HA 1NJZA 2RQKA 4FZVA 3Q24A 2N7CA 3QJPA 2K2PA 1T9YA 2HMPA 2G8HA 1ATNA 2XC9A 3OS2A 3ZX0A 3MK6A 1NK8A 1C4CA 3WX4A 4CBUA 5BPMA 1HJOA 3VAIA 3IM9A 3MCNA 5D3GA 2JJ4D 3ONQA 4DG1B 3I32A 5CD4H 1C1CA 2B4OA 2HS3A 4IXCA 4Y1CA 2HZAA 5AQNA 1U02A 4RW6A 2P9EA 3GMGA 4PG7A 5IT0A 3KK7A 1HNWJ 2MY8A 2LU1A 1NO8A 5SZTA 2A18A 3HKWA 4KREA 1CXUA 3PV8A 2W25A 1NGEA 3TAFA 3M8QB 3D1HA 3MPWA 3MR6A 2Q36A 3OL8A 2PC6A 3IKMA 2OD6A 4B1YB 4K5SA 3I6PA 1MMNA 2Y3YA 1Q82T 2HHQA 4H4MB 1TKZB 3KNAA 3RTVA 2EPIA 1QZ6A 1VIXA 2V2QA 3W63A 1RDBA 5M1NA 3CPWR 1YZ7A 2E88A 3VHQA 5HBMB 2NPFA 4P74A 3VESA 4NA2A 4IO8A 3GG4A 4OX8A 3LOUA 4UF4A 4CI6A 4LF8K 2V68A 4ZHRB 4RBTA 2X1FA 2P6TA 3O9SA 4WCEL 2W2OP 3CCWA 1U09A 5T41A 2C3OA 3SQGB 5G4DA 5ETRA 4F4XA 5F0XA 2X74A 5BN9A 4ZCLA 3WNHA 3FVYA 2HBZB 4A5AA 2HBKA 4KGVB 3M8RA 4ZLLA 3CO0P 1A7GE 3H25A 3EZWA 1YZ6A 2XMAA 3FQLA 4A4JA 3Q2SC 2RPIA 4E1NA 4BRFA 4JI8F 4KAZA 1Q5VA 1VAZA 1UTAA 4IYQA 2OSQA 4NI2A 3BEGB 2QG9B 3BO2A 1OSDA 2ROPA 2IRUA 1OMSA 1CLFA 1SKSA 4AD6A 4Z0UA 1HW8A 2GMLA 4B3RJ 3JTNA 1V3SA 2B9YA 3QGGA 3MM5B 4H5VA 1UJ4A 3E3XA 3N4WA 4CM0A 2DB1A 4P71A 1GEHA 1VRQC 4OJHA 5JUMA 3TPQA 1HQ2A 4CTAB 3KLHA 1BMQB 2CQDA 3GSDA 1I3OB 1LXNA 1RT4B 3J81j 3E9LA 2FD2A 2RVJA 2OZMA 2HSEB 3CSKA 3HRGA 4JI2F 2A1SA 2CXEA 4PEOA 4DX5A 2PAVA 4M95A 3UR3C 4ZVRB 1P1TA 4DI6A 1S1WA 3L3CA 1U26A 1RADB 4BR2A 2VWJA 4ECSA 1TELA 4X62J 4PUOA 3TSQA 2M8HA 4EK2A 3MECB 1FW6A 1EHWA 3HM8A 4WYBA 4BY9C 1RAJA 3RMAA 1R0BG 3UW1A 4JI3F 2DKOB 4ED5A 4CO5A 4ZTFA 5IWAF 2HW3A 5HMYA 2OPPB 2BOPA 4C98A 1DKGD 3C8YA 3C66A 4DMZA 2EC0A 2JZ5A 2LSNA 4ZLPA 1LWEA 5LOQA 1N33F 4AM6A 3Q23A 4MT1A 3Q83A 3DDNA 1N36K 1R6VA 2H5IB 5C10A 5IT4A 4QPTA 1KHWA 1IG9A 4B8CA 1GMUA 2B0GA 1HQEB 4CK1A 4OL8A 4YORA 1VC0A 1VQYA 2DO0A 3R2CJ 3DWLA 1LQ9A 4KHSA 4MFBB 1C0UB 5E0OA 2XI3A 1VK0A 1BQNB 4GVBA 4MLEA 1DQ8A 4BC4A 3FFIB 2JWNA 3T1HJ 1S72S 2UXCF 4M3TA 1VSFA 3V6KA 3CHWA 2J4RA 4ETXA 1RHUB 2MZRA 5GAGU 5DGAA 3T1YF 5BREA 2AX1A 1XWLA 4OZ1A 4QWBA 1MA9B 4AYBD 4B8AB 1NGCA 5KFFA 1RGVA 4Q45A 1M5KC 4R8UA 2R7RA 5HOOA 5HP1B 3QWUA 4DCOB 2PBDA 4C48A 4MH8A 1WF1A 1RT6B 2CDRB 2BJ3A 2WVDA 3M6WA 3MTKA 3PYFA 4PKGA 4HACA 2HKEA 1UEVA 3D6TB 2A2DA 1U6ZA 1K1QA 3H46O 1ROFA 2CQ3A 4HCCA 3AJ2A 2EEYA 7FDRA 2CZ9A 2X78A 3CD7A 5BN8A 2QA4N 4K0KF 3TAEA 4OMFG 3HMJG 2MKIA 4FYYB 1TL5A 4HACB 1ZBFA 1H2UX 2DNHA 4DR6F 3OLAA 2NXCA 2AGQA 1NBWA 1RBSA 3J7YI 3HVTA 1GX5A 3D28A 4X65K 2VYPA 2AW0A 2Z2ZA 3SV3A 4A8QA 1FXXA 2HVZA 4FJGA 2R2RA 3QSIA 3OFEA 3M2RA 2OPRA 3V9UA 4RW8B 3N6NA 1MROB 2ASJA 1T6DA 2O4GA 4IEIA 4QZVB 4BR4A 2GNKA 3L4IA 1U24A 2H48B 4GC6A 2RMLA 4W5TA 3POTB 1FI4A 5EWEA 1VR6A 2FHJD 1K9MO 4CE9A 4PG8A 4CYUB 3K8WA 5L39A 4DTXA 1CJTA 2YNIB 2W1BA 4DX6A 2V63A 4YDXA 3NGTA 2CPHA 4MK9A 1K44A 4B1UB 2YI1A 3EPGA 3H5YA 1Q9YA 4AM7A 1ELOA 4CESA 2DGQA 3EY1A 3CJBA 2VH7A 2XMJA 1Q16B 2OD4A 1EETA 2B8QA 4IH6A 2VPWB 1BWVA 3GSIA 3D2FB 1VIOA 2IDOA 3I8DA 1OY6A 1LWCB 4JK8A 4LR8A 3SQ4A 1SC1B 3P49B 1ACMB 4AILC 1DQ9A 3R6GB 3AGKA 3VALA 2LU2A 3L3VA 3JTOA 5KFKA 4H4KC 3MAAA 1JXEA 1UFLA 2JLEA 3D0GE 4DTSA 1OQ6A 2YKQA 5BYSA 3W3SA 3QMQA 3A13A 5GADP 2NXNA 4PWDA 1XR5A 3RU0A 3SUPA 1U1QA 4DZ6A 2GX8A 4YOWA 5KI6A 2R8KA 3V4IA 1Q18A 5AQRA 2ACMA 4U96A 3DCAA 3CJ2A 4FLVA 3CCMS 2VG7A 2O8DA 1R8AA 4ELUA 3AJ1A 1H38A 4PABA 1YX2A 4TNOA 1NDCA 2DR5A 2D0AA 5ITHA 1U2VB 1Q82O 1G7CB 4CHYA 4CLKA 4LSNB 3M8WA 2XO6A 4GKJJ 2DH7A 4J9KA 4EBEA 2LLZA 4RNOA 3RUBL 3OW2M 2HNZA 2AEFA 4DV0F 3C15A 1ITGA 1N0UA 3S3OA 4AQYF 5M1OA 1F1BB 4R5PA 2V7ZA 4WFZA 4RNMA 3MM7A 3MX2A 3EVMA 1RKIA 4F8RA 5J1EA 4ILLA 1UZDA 1EQYA 1D9DA 3OSNA 1JLCA 4IG3B 4YB6A 2ZWHA 2MEWA 5F0UA 4UZBA 1S57A 3ISZA 3VF0B 1GOBA 3NGUA 2WOMB 2DGUA 2FY8A 1ZM9A 1MDUB 3BEXA 4I2PB 3ELHA 5D0HA 2FVRA 1T95A 3P8BB 4K25A 3AV9A 3FKBA 4DDFA 3MN7A 4DV4K 1R27B 3K0JA 1M90T 4CFDA 4FLWA 3OYIA 1G4CA 5CY4A 5KFQA 3MXJA 1IV0A 5D0GA 2FF3B 5HSPA 1VHXA 4DUTA 1WN7A 4C9DA 1RKJA 1IKXA 4RKUC 3OYKA 2JEJA 1Q0NA 1FWLA 2E5GA 3ZEUA 3WQPA 4M7XA 3VQTA 4WZQA 2RDDA 1T9TA 4M7YA 3NNCA 4K59A 1CZBA 4YFUA 4KHQA 3OBIA 2FVSA 4JKDA 3TJAA 4LJMA 3J80U 2R4FA 2Z0GA 3MMCB 4EZ6A 4C0OC 1X8DA 1X7VA 4O5FA 4XTTA 4DQSA 4Z4FA 2R8GA 3ENOA 1AZSA 3GCWP 3SYZA 4OYXA 1WNSA 2DRBA 1RI7A 4FVUA 4CZEA 4OVLA 1RTHA 4OI4A 2FIUA 4USKA 3ZNJ1 4KY3A 4YOYA 2DPJA 4UT4A 5M2UA 1WOSA 4X66J 1JB0C 4R79A 3ALYA 3ZSYA 4JEPA 1Q9XA 3THXB 1GMVA 1S49A 5KPZA 1SQKA 1HMVB 3P38A 5LJ3Y 1ZA1B 4WFBL 1NH8A 3OD2A 2QL9B 5CCLA 1IG8A 5LJVA 1KVIA 2JDJA 2OYQA 4IR1A 3L2RA 3ENVA 2BBEA 3KOAA 3F9MA 3QO9B 3FNNA 4HH0A 1YXQA 3T9NA 1FDAA 2ZUAA 4X4NA 1YTAA 2MB0B 6FDRA 1YAGA 4H5WA 1TL4A 5H1SQ 1DBDA 3A5MC 2ROGA 1PAEX 2EK1A 2KXHA 1VHIA 1D5AA 4OPAA 2BJEA 2ZM6J 2BUNA 4EUVA 4JI4K 1ZAXA 1YRTA 2H5EA 2BM0A 4KH1B 1KTQA 4UOGA 4A48A 1ZBLA 1BISA 2IYGA 3HOTA 3SAHA 4LF5J 3QZ8A 4H0XB 1HNZJ 2JVRA 1MLAA 4AE5A 3CXCR 3BBCA 3AH6A 1ZYQA 3D0IE 2Z30B 3CB4A 3J7ZT 1N5QA 3AA2A 3LP0B 2W2MP 3VEXA 1HBOB 3BZCA 1GNKA 2XMMA 3FJ2A 4WWSA 5D4LA 5AFUA 4TY8A 3PX6A 3QIOA 1XTZA 1SJ1A 3KHGA 1HQUB 5J2PB 3TJ9A 1S6OA 3VQ9A 4DU3A 2OFHX 4FWPA 1UWBA 3G8QA 4IZ9A 2VJVA 4DV7F 4H0YB 2WUSA 2K3KA 4WF9Q 3W3DA 1V3RA 2D74B 4CJ3A 3R8YA 3UNYA 3H3OB 4WFYA 2IM1A 3A4TA 2CJXB 2F7TA 4BRKA 4WP8A 3VF2A 2XZWA 2PO4A 2PFDA 1DJ0A 3L7OA 3VEWA 4YMEA 1QAXA 2HHHF 4DUZF 4KGKA 3VPZA 1U2FA 3OVNA 1YK9A 3AA8A 2PZSA 1SL0A 3BKFA 3GYXB 3JSYA 5AQGA 2YX7A 5DQHA 6AT1B 4YOVA 3CYMA 3TARA 1WSIA 4DR7K 2UUTA 3PRBA 3AXKA 3M4XA 1GLJO 4C7QA 3VQ6A 5CYQB 3U6FA 4ILMA 3ISNC 1B0PA 1HR0K 4J90A 1P27B 4J9VA 3I4PA 3EL2A 4IKAA 2D9OA 2IJNA 2KH9A 4BDYA 1UVMA 4RZRA 3QRQA 4OPJA 3QESA 5DDOC 5GAEU 4GO7X 3ENAA 2YX1A 4RW4A 1BU6O 1U49A 2DGOA 4EO6A 1BE4A 2LVWA 1M1KT 1U0HA 1DLOB 2XY7A 2DXFA 1N32J 1YBAA 2UXDK 3CCTA 3CVKA 4K43A 4TY8B 3T41A 1HWUA 3ZC4A 2M70A 4H54A 3SSQA 5IM0A 3EPIA 3D67A 4DUZJ 1JJ2R 2MSSA 4DV1F 3IAM9 2BH1A 4O8UA 2PMHA 4Z4HA 3DNCA 2HMIB 3VEOA 1S9GB 4BRMA 3MI7X 3A8YA 1SS6A 3OYHA 2FJAB 2HRTA 3K5NA 4BC9A 2XHCA 2MQMA 1IR0A 5F8HA 1N88A 3HZ6A 3TX0A 4DUYK 2AV5A 3M8ZA 4LF6F 1FNXH 2KKHA 5KFJA 3D68A 5IT9U 2YWWA 4CLFA 3NMRA 4HHHA 3BDPA 4J9NA 5CCMA 3OTOK 2AEMA 1W26A 2L41A 1IBMJ 1S1VB 1S1UB 1NHUA 1M5OC 2NQPA 3AVIA 2VBWA 4WTOB 1J53A 4BWMA 2HWTA 2QEXS 4TLQA 2DD8S 4IOCL 3D3CJ 1EB0A 1OH6A 3NEKA 1AFIA 1KAYA 5EDWA 3KLGB 3RBXA 5CYMB 1K8KB 1HNZF 1SZ2A 2YKAA 3T1HF 4OYZA 3DGVA 2MLZA 3ATVA 2J9DA 2AGPA 4C8MA 4C8YA 1J5EF 1RWOB 4B9NA 3K58A 3ZSWA 4M3UA 2QV6A 4K4XA 4B3MK 1AZSB 1P9YA 3UO0A 3AD8C 1C4AA 3HI9A 3OYBA 1WJ9A 4CLPA 3O2IA 4C23A 1VSDA 4JLHA 4J37A 2ZGYA 3JXOA 5KFLA 2QA1A 3VF6A 3A8IA 4UQGA 4O3RA 1WHVA 1RA6A 3WT0A 4WQ5C 5LJ5Y 3K9JA 5EX0A 2CQGA 3CXCM 3J7AP 1ITPA 3ZETB 1BLUA 2H4WB 4CO0A 1Q8LA 4DTNA 2ADCA 2H51B 2QWQA 3QT7A 3LPEA 3KUHA 3I0SA 2FVQA 4FF4A 3H98A 4EU0A 4A61A 4B3OA 2W9BA 3NH2A 4CZMA 3CJQA 3SZ2A 1DZ5A 5LL6Z 4WK3A 2XNRA 2LKZA 5IV4A 3PACA 4DR2F 2P5OA 4A57A 2C3MA 2MQLA 3C2PA 3DXMA 2K3IA 2HFUA 1RA7A 3JAMU 1TV6B 1RU1A 4FLUA 1WD6A 3OHBA 2L48A 3VQBA 2J9CA 2GJFA 5KPRA 4IRKA 3HP6A 1FTRA 2HQGA 3TTDA 1RTDB 2HPUA 4MO5A 2R7SA 4GKJF 4MYTA 3MM7B 4HWIA 2CNKB 1T3NA 3CCLS 1NMEB 2VB6A 4J9OA 1AUDA 2MLXA 3VMFB 1SL2A 4DTRA 3CFRA 1MWMA 2ZJQQ 5AXNA 5KGWA 3SFGA 1FA0A 1RTHB 3PG9A 2OLWA 3I4HX 5DM6L 3W7BA 4OYOA 3H6EA 3NH0A 3I5CA 3G9CA 4JN4A 4QR0A 4FK2A 2RH3A 3ID8A 3PYEA 2O8DB 4H5TA 2F9TA 4XK8C 4CHOA 4CBXA 3GV5B 4X4RA 2CYYA 2DIUA 4DUYF 3CCVN 2CVEA 2NLXA 2ZH5A 1VQ7N 1B9FA 5E3CA 1RTZA 4ZIWA 2QJ3A 4DX8H 1T6CA 3CJ1A 3WDOA 4G1IA 3CCLN 1FESA 4FWKA 2Z2MA 3M32A 2J0XA 4TYAA 3MR3A 4OZ3A 1SV5A 2Z57B 4CO1A 2XYPB 3LP1A 2RKIB 3VTHA 3CJRA 1LWCA 3CCZA 3PIOL 4I2PA 1X0FA 3RB4A 4TU8A 4TQRA 2XSFA 3ZSOA 1NZ8A 1T0TV 4KE5A 3RBZA 3TUJC 2WOMA 5DETA 4ETZA 2GFFA 5ETMA 2OP5A 2BVZA 4CT8A 2MGZA 2IDLA 1HNWK 4ED3A 4QOTA 1JNRB 3X1LB 3SBGA 3CJ3A 2YQ1A 5LSRA 4IG3A 3OA9A 4BCAA 4JI5J 4DR2K 2HHSA 4CJLA 1BY9A 3PSIA 4DR3J 2LCWA 4OYAA 4EHUA 4ILHA 2VJUA 3V9SA 1FFSB 1QSYA 4CYUA 3POTA 3VQ7A 1RLCL 3EZ5A 4A8FA 2HNZB 1VISA 5CH7B 2NRXA 3W0LA 2HB5A 2BEFA 1MROA 1R3NA 4IBNA 4USMA 3IN5A 3OS1A 2PYLA 2ITMA 4DSLA 3MEEB 3L9ZA 1FDDA 3HX9A 3OW2R 2OPQB 1EIYB 3IS9B 3R3TA 3SBMA 1MN7A 4DHVA 2K8GA 4ERDA 3H2UB 2HHHJ 1SIZA 4K0KJ 2KRBA 4NLTA 2RUGA 5LXRA 3CJ4A 1S5JA 4CZFA 4F67A 4BR5A 4A8OA 1RU2A 4WCEQ 4JKGA 4OI2A 8AT1B 2NS1B 3MMBB 2NREA 3ZFVA 3N4PA 4ILRA 1IM6A 1WNEA 3ZZ0A 4PWDB 3CC7S 1TL7A 1C0FA 3M1VB 1X9JA 5AXLA 1FRJA 3R9LA 2IYIA 1GOCA 4KH0B 2QXLA 4CI0B 3ENBA 4RW9B 3GIKA 4ZITA 1RT6A 4JV1A 2XMVA 1VSHA 1KQKA 1CEZA 3ITHA 1VRTA 2J7KA 2JHEA 1WELA 5KFUA 1WHXA 3CD5A 1VSEA 2YQ0A 5L1LA 4MJKA 1X4GA 3M30B 4L3QA 3BM7A 1XC3A 1TVRA 4HHUA 3RBEA 4DCPB 4HTJA 4CK3A 4E7HA 4I6MB 1RT2A 5I3PA 1YG0A 4QOZB 3IFEA 5KFXA 1JL1A 1J54A 3A0IX 1I94J 2YKMA 3WZ0A 2YKMB 2JEIA 4ANEA 3D54A 2Y1IA 1AB8A 4IRDA 1JIHA 4DR4J 2YNIA 4E7LA 2F3JA 1B0VA 1JCGA 2VKZG 3UN5A 2GS8A 4ZPDA 3EZOA 2OH2A 3VERA 3VN5A 4P73A 4IH5A 1J27A 2XYGB 1O51A 4DTJA 2OPRB 5KT5A 4EZ9A 2G0CA 4QJVA 3ITHB 2FLOA 3G6XA 3UI3A 1AUSL 1TFWA 2KL8A 2LQ9A 2XSJA 3NF8A 1NGBA 3CGIA 1S99A 4HYKA 3DHWC 5CZ2A 2CZ4A 5DG9A 3T1YK 4XEIA 2Z58B 3IAYA 3PFOA 3M1VA 4OJ3A 2EXUA 4IQXA 2M0GB 4RCHA 1GXTA 5GIOA 5AQUA 1TUYA 3LGNA 4MIAA 2R8HA 1ZBIA 3DLJA 3MECA 3C6HA 3SBTA 4FW1A 4QIVA 3MPDA 3W9HA 3MFHA 3K5MA 1UEKA 2VQFK 3T3FA 2WVEA 2BANA 3HOSA 1RP5A 1G15A 1FX4A 5B0FA 2LP4A 3CJCA 5GADU 3PUFA 5E3AA 1QAIA 2OPQA 2FC0A 4PG4A 1M90O 3MFIA 2VG6B 1EAYC 1IJFB 3BZQA 2KO1A 2KZZA 2IJRA 4E98A 5ETLA 1LOTB 4FNIA 2Y1LB 4JI7K 3QFUA 1W9HA 2V5HG 1YJUA 3VEYA 2R7TA 2C2DA 1U1MA 1X1PA 4GVBB 3GIMA 3VETA 5E3QA 4C97A 3GJSB 4LF1A 1ZBUA 2ZZNA 2M8DB 3VQAA 3GONA 2QL7B 4E7IA 2H9ZA 2L9DA 3F2KA 4NI2B 4F3MA 2MGZB 1HQEA 4FYXB 1YIJN 1BHNA 1CSJA 1RBAA 1JLFB 3V6JA 3GV7B 3V2UC 5BPLA 1N8RT 3VGMA 5ETOA 4ZJLA 3BB5A 3NBPA 3MR5A 1WSHA 3WC0A 2I9SA 3T7ZA 2HNYB 1N48A 2R2SA 5LL6d 4FWMA 2BJ1A 1S76D 3HHLC 3SQGA 1YGYA 1O5JA 4FOIA 2MZSA 3OHAA 1YHQN 4FOEA 2W9CB 2A10A 3WXMB 3FFKB 4PYDA 4M1KA 1RBVA 3LWLA 4DQQA 4WU3A 3O8MA 1XERA 1FFGB 3E01A 5D78A 1FCAA 3CJ9A 4PUOB 4X66K 4AL7A 5JLHA 4BC3A 4C3MA 2HWHA 3RZAA 2GQCA 2XY6A 3Q8VA 3SI8A 2FPHX 5KFGA 3VR1A 3CD6S 2YHAA 3V4MA 3MZIA 4EMDA 3KKRA 4O3SA 2E9RX 3FQKA 2RDIA 1SVDA 1UKUA 2F40A 2OTLS 3V1RA 1SQFA 4RW6B 1Q1KA 2GHWA 1E4FT 4DG1A 2EG2A 1RTDA 3SUQA 4FJ9A 1S12A 2F8TA 2B5JB 3TEGA 3GYGA 4M63A 4K4WA 2C2EA 4W90B 5HRRA 1RTJB 2VIHA 3TTFA 4K0KK 3UD4P 1TV6A 3MXIA 4KHUA 1BQXA 2CPDA 3FC9A 3WUHA 5C24B 4OI1A 3BO4A 3L3UA 2ZJQL 1ZC6A 4YDUA 5HANA 5DK5A 1BUXA 1SXLA 3KKFA 3NNHA 4IG0A 3HULA 4TN2A 4CJVA 1HYZA 3PO5A 2HVDA 4N56A 3M1FA 4BRGA 4ISGA 3MUTP 3VENA 3FR0A 2P9SA 1R7IA 1S1XB 5GAHP 1GLCG 2N4DA 2DR8A 2BABA 2UXBJ 3J7AN 1H2VZ 4YB1P 5HVFA 1LCUA 3FMWA 3CERA 2I5JA 1MMDA 2A6MA 3HPGA 3AVBA 4ZHRA 1HKAA 4OV6A 3CCJN 4D3HA 4X62K 1TMMA 5KG3A 2VBXA 1NBEB 4DV4F 3QNOA 3PRDA 4RWXA 4O4GB 2MMYA 3BJYA 8ATCB 3ZZRA 1NMDA 3D7EO 1QSSA 4FJKA 1N33K 1WC6A 2ZH8A 2M7SA 4IFYA 2E9ZA 2IVOA 3B4DA 1UL3A 2QO3A 1YT3A 2DH8A 4AFFA 5J2MA 2E5HA 2MLYA 2YWFA 1BCMA 1O0PA 1RWKB 4X66F 2EHGA 1TUVA 3GG1A 2Q1NA 1KAZA 2A40A 1X4HA 2XCPA 1LV5A 2W4CA 4B3TJ 1NSQA 3Q22A 3QEVA 3QDKA 4NCBA 3EKUA 3MDQA 5CYMA 1Y3KA 1X9WA 3AARA 5M1QA 3R6LB 1TYQA 5AZJA 3R6MA 1C1CB 2ZE2B 1RAAB 1NOZA 4LBHA 1Z2LA 3GB0A 4GKKK 5I3QA 2AJFE 1FVSA 5K8NA 1K73T 3QLHB 4GY2B 1L3UA 3P83D 2DNQA 4F02A 2GV9A 3S8SA 4OX6A 4CRJA 1EKSA 2AMCB 2C2OB 4O23A 4CCHA 3N6MA 4CJEA 4OI0A 1HBUB 3MM9A 3B4MA 2EK6A 1FJGJ 3TZXA 2DVIA 1DTTA 5B09A 1QM9A 3AVJA 4AXJA 3FSXA 3TI0A 3I0RB 3DJCA 2IVYA 4BBYA 3I87A 3CCUS 1C1AA 4YR3A 2ZDOA 1EXQA 3NHGA 1D8ZA 5L8RC 1H72C 3KMQA 4GC7A 3ID6A 5FIIA 3Q86A 2O8CB 4CEEA 4E7JA 5KFRA 4DHYA 3IBFB 2QLBB 1WWHA 3UIQA 3CCMN 5GMKa 3QBCA 4BRHA 4GRSA 4USIA 3FBCA 4DQ8A 1RTIA 2QLWA 3E8OA 4HKQA 3QEWA 4O44A 1IVZA 4JI0K 4IOAQ 1JCEA 1RYSA 1FD2A 3VQPA 5EWFA 3NCRA 1F60B 3LH2S 1A0OB 1ZA2B 3BY5A 3HI0A 2PA3A 2J7UA 3BGFA 3RR8A 1FVQA 4PQAA 2CAJA 2H65B 2Q1LA 5CZVA 2ZZTA 4B9TA 5CQGA 1T9WA 5JMNA 2ZD1A 3CDWA 4O3OA 2DTJA 4PPDA 2B4VA 5F8JA 3H3NO 3CC7N 2V4JA 4J2DA 4I1TA 1K0TA 5HATA 4O44B 2LMIA 4DR1F 5MLCQ 1JJCB 4I9LA 1QQOA 4V19S 3C16A 3L95X 2FXUA 1WC5A 2ZVIA 3OYGA 2O3DA 4CFAA 3V1OA 1I94K 3OL7A 1WLJA 1BG3A 2E44A 4DL5A 3QAEA 3O08A 5AQWA 4F2SA 2BYCA 4C4WA 3GE1A 2FBXA 3C14A 4WP9A 3RYLA 3JSRA 4PPZA 2QWLA 4M5IA 1HBNB 2BKNA 3BREA 2HHHK 4K8XA 3R8EA 1WUAA 3S41A 2HK3A 5KFVA 2IVFB 2DGTA 1MNEA 4M94A 2B4UA 4U95A 2FLLA 3IG1B 1Y10A 3C6UB 1CQNA 2ZC4A 4EYIB 4LUBA 2O8EB 4N41A 4WQ4C 1IQZA 1MMLA 2JWLA 5C5JA 3QWPA 4LFAJ 4H4OB 3QNNA 3CCSS 2PN6A 4W5NA 2G9OA 3EGZA 4FLZA 4NLWA 2XY8A 1UCNA 2CJAA 3GJRB 4A8SA 4JI7F 4AHTA 2ASLA 1IH7A 2IY5B 1HQUA 5J2MB 1FFWB 4WE1A 2GVZB 2D69A 5A8RB 3DLEB 3CMES 4B17A 2MKKA 5CHIA 3Q2TC 1Z2ZA 5AQXA 4M5NA 4J9MA 2WBMA 3A5LC 2UUBK 2V4RA 3PIPL 3CCRN 1SL1A 4OZJA 3OJUA 1Q86O 3HHNB 3OR2A 4DSJA 2UVUA 2ZWPA 2HNDB 4KQZA 1UA1A 4FJMA 3EYZA 2ALYB 2IM0A 4F4KA 3H45C 1RLDA 5JXSA 3Q7BA 4DU7A 4RUCA 3EE8A 3EMTA 5M2RA 4QYRA 1JLBB 3KJFB 4M42A 2DNYA 4NWBA 1VQLS 3B82A 5C24A 3GFHA 2D0PA 4NLSA 2VPXB 1LEOA 4ZVHA 3PRVA 2CQBA 4I6AA 3EXYA 2NRZA 1RTJA 2ZH2A 1QVGM 1NK4A 4JKCA 3K59A 3V9WA 4DL7A 5JMVA 4DV0K 1YJ7A 4DF4A 5IXUA 2KU7A 1KD1O 2HK2A 3CE8A 3DLBA 2C3PA 1SJFA 3UVJA 2FJVA 1BQMB 1QE1B 3ATUA 4CZLA 3EJMA 3NGIA 4AXIA 2YBVA 3CC4N 4C8NA 1RYRA 5KG7A 5DO2A 3UE5A 3F41A 4ISFA 2AYMA 2F1FA 4HT5A 4LF4F 1CJKB 1VRUA 4N7TA 1B9DA 1NLVA 4DR7F 1F5AA 1VFJA 3BYRA 5E41A 4OX9J 2EWSA 3DOLB 2ZM6F 3MMCA 4BG8A 1UPMB 1WG4A 5KFYA 4W92B 4TKTA 3TUPA 3TAMA 2G8UA 1U47A 2KW4A 4PKIA 1WOOA 3E01B 3QETA 4KPYA 1J5OB 3DI6A 4ED0A 1MWYA 4EP5A 1VSLA 2E1YA 2FGCA 1IBMF 1GMWD 1IKXB 2W9CA 4C8KA 1IWAA 1ZTWA 1IBCB 5AQIA 4NYZA 2GAGC 3NAIA 1JXBA 5C2DA 3JSBA 4NA1A 1S7IA 2A1RA 2KVQE 2IA6A 4ZA1A 4A62A 2AQ4A 2JC1A 1RAIB 1RCXB 2VV5A 1VSJA 4BROA 1U6FA 4ID1A 5HLFB