1UWBA

Tyr 181 cys hiv-1 rt/8-cl tibo
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of 8-Cl and 9-Cl TIBO complexed with wild-type HIV-1 RT and 8-Cl TIBO complexed with the Tyr181Cys HIV-1 RT drug-resistant mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Aspartyl protease
molecule keywords REVERSE TRANSCRIPTASE
total genus 131
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1uwbA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1uwbA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1uwbA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1uwbA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1uwbA05
1WN7A 1S1WA 1HQUA 2YKNA 2GUIA 4DF4A 4I7FB 2FLPA 1IKVA 3T5KA 4DTPA 4U6PA 2D41A 1S0MA 4Y2AA 3SNNA 3OYIA 2AWZA 3OYHA 1FXXA 1CZ9A 4DFJA 4RUAA 4EBEA 4G3IA 4ED7A 1YVUA 2R2RA 4LQ3A 4DL2A 4MIAA 5HRSA 1HNIB 2D3ZA 1RDCA 5JUMA 1WSEA 4CJQA 3ZSRA 4DL5A 1GOBA 3ZSVA 4I2QA 4IR1A 3CFOA 4CJ3A 4CERA 1IKXA 3QETA 2I1RA 2C22A 4I9QA 4CGFA 2E6LA 4K4YA 5CZ1A 3BQ0A 3BREA 4ECXA 1RDBA 4NLTA 4HUEA 3Q8PB 1S0OA 3CJ4A 1TGOA 1RT5B 3NAIA 4KTQA 4ECWA 3QEIA 3PR4A 4DSJA 3CIZA 3V9UA 2W9CB 2HHQA 2ATQA 5I3UB 5HP1B 5KFQA 4CGGA 1S1UB 5C42A 1X9MA 3PW0A 2ASLA 3HVTB 4OLAA 5F8GA 4C8OA 3HO1A 3O4QA 4AHSA 3RWUA 1RT2B 1VRUA 2X78A 1JLFA 4FW1A 2DPJA 4IRCA 2RKIB 3L8BA 1NK6A 3L2VA 3T19A 2HNZA 3DRSB 1ZBIA 4IRDA 4M3TA 4IH6A 3OYAA 4I2PA 4KB7A 3DM2A 3GIKA 4CJ4A 5J2PA 3NCIA 1SL0A 4EBCA 4Y1DA 3VQAA 1IG9A 2IMWP 3VQ8A 1TL1B 4RNHA 4BE1A 1YTAA 1NK0A 3AA2A 1MU2A 1TV6B 3SJJA 3TI0A 4IBNA 5I42A 3AO4A 4ZP7A 1KLMA 1HYZA 3AVMA 3HPOA 3CJ5A 1X1PA 5KFGA 3V1OA 1SV5A 4EO6A 3WNGA 3RTVA 4M95A 1VSHA 4B8CA 3PX6A 4ZMMA 5KFUA 3MR5A 4IG0B 3M8RA 3KLEA 1C0TA 2OPQA 2ZKUA 2UVVA 1C0UA 4LSNB 4DTSA 1DTQA 2DFHA 4DF8A 2BR0A 4WXOA 3NGIA 1KSPA 4JV1A 1KVCA 4ID5A 4KV8B 5F9NA 2JEJA 3U3YA 1KCFA 1MMLA 2BDPA 4HKQA 2RF2B 2R8HA 1TKTB 3QYYA 5L1IA 4EP4A 3AA5X 3DOKB 2FC0A 5KFLA 4MK8A 3G10A 2BQRA 2E4LA 2A1SA 3GIIA 5KGXA 2P5OA 4QW8A 4QWDA 3OYFA 4M3ZA 4RNNA 2HHXA 4FJ5A 1NHVA 1LWCB 4FBUA 5C24B 5CZ2A 5JS1A 5CYQB 3QO9A 4W5QA 3EPGA 2HWHA 1KHWA 3CYMA 4FJNA 2IGIA 3QGGA 1JLAA 3HXMA 3NF7A 4WYLA 3SQ0A 3CQ8A 1FKPA 4RW6A 2OPRB 1LW0B 1D1UA 1RT4A 5KRTA 4O4RA 4O3QA 2LSNA 3I0SA 4K8ZA 4IG3B 5K14A 1VSJA 3E51A 1CLQA 5I42B 1RT3B 3NFAA 1TKDA 4FJJA 1RTDB 2G8FA 1JLBB 3QEWA 3GQCA 1DLOB 2YNHB 5HBMA 4TYBA 4GMJB 4RNOA 4QOZB 4TLRA 1WSJA 4W5OA 3SZ2A 4DTNA 5F8IA 2HHTA 3V6KA 1T94A 5KT5A 1KFDA 4CF0A 3MTKA 4RU9A 3PUFA 3LZJA 4ZVGA 4EO8A 4KHYA 2WOMB 3PX0A 4EEYA 4CF9A 2F8SA 1CSJA 1T03A 4HHTA 1TKXB 5DG7A 4U7CA 3PVXA 3LANA 3LP1B 5KT4A 4B9MA 2XC9A 4AH9A 1S4FA 3NH1A 4NCBA 2PYLA 1N6QA 3FFIB 5JXSA 3OHAA 2FVSA 5KT7A 2DPIA 1S1UA 2IC3B 3SV3A 3S3NA 3SUOA 4IG3A 1X9SA 1VSMA 4NZ0A 4JRQA 4TY8B 4FM2A 4HUFA 4ZTJA 1EX4A 4HCBA 1VSKA 1WAJA 3PV8A 3HP9A 1BQMA 3H5XA 1JL1A 5HROB 4DSLA 1TK0A 3O3FA 3WNHA 1TP7A 4HYKA 1UA1A 4PUOB 3DRPA 4ECRA 4ZVFA 4CIFA 4EYHB 3KLIA 5F8HA 1TKZA 2BANA 4OKJA 2KQ2A 2ZE2A 4K4UA 1C6VA 1JL2A 1LAVA 3HKWA 4CEFA 1JLEA 4DG1A 3MXMA 2WONB 5KFPA 4CJEA 1T3NA 4MKAA 4EZ9A 2FJVA 3GV8B 4Q5VA 3SCXA 3RR7A 1ZBFA 3VQBA 2OPSB 3DLEB 4YFUA 3LP1A 1S9GB 4GC7A 4BDYA 2O4IA 4NLWA 1BIZA 4KI4A 4CHPA 1IKWB 2V9WA 3QEXA 1W0HA 4OPJA 4TQSA 3KTQA 1RT1A 4DFKA 3TQ1A 4H8KA 3V6DB 2J6SA 1RT5A 1TAQA 4FLZA 1J5OB 2G8VA 3KJVA 4F8RA 5KFXA 2J6UA 1I3AA 2WHOA 1VSLA 2PYJA 3KK2A 4CFAA 4B3OB 5CYQA 3ZSQA 4TY8A 4O55A 4HTUA 3TAMB 2HWIA 4ECUA 2YNIB 3M9NB 4E7LA 4ED2A 3ZT1A 4B9LA 3IRXB 2OPRA 2XGQA 1RCHA 3I8DA 4KO0B 4M41A 3SI8A 1JLGB 4RZRA 4QWAA 1N6QB 2R2SA 3CJ2A 4N56A 1D9DA 4EYIB 3QIDA 2IA6A 4DG1B 4FK2A 1TKXA 4EP5A 3OLAA 4UQGA 1JLCB 4RW7A 3NBPA 3GV7B 4E7HA 2GBZA 2R2TA 3DI6A 4DQRA 4OGEA 2CKWA 4GC6A 1RDDA 3SFGA 1JKHA 3HVWA 2F8EX 3SUPA 3L2WA 3OS0A 1WNEA 3BQ2A 3CM6A 4B08A 4CJ5A 2XY7A 1NOYA 3MR6A 3PO5A 4Q45A 4Q8FA 4MK7A 4E1MA 2HHSA 4E7IA 1REVA 3LZIA 3KIOA 3SYZA 1VRUB 3VN5A 1S9EB 5KFYA 4K4VA 1BQMB 3V1QA 2E9TA 4ELVA 4E7JA 4E89A 2QE5A 5D3GA 2EHGA 3OL8A 2GV9A 3UDLA 2UVWA 3HVTA 3MFIA 4DTUA 2HNYA 1ZYQA 2VA3A 4M3YA 5I3UA 3LAMA 4KKOB 2IM1A 1J53A 2VG6A 2O4GA 5T14A 2ASJA 1LAWA 1TKZB 1QSYA 4JS5A 2E6MA 4MFBB 2IDOA 2P5GA 1WSFA 1UOCA 2XCPA 4O4GB 4KHMA 3OY9A 2QKKA 4BDPA 3AVHA 3I0RB 2DY4A 3S3OA 4XPEA 4M94A 3D28A 4IH5A 1ASWA 1CXUA 3T5JA 4HUGA 4ED0A 4B9NA 4NLQA 3BR9A 4URSA 3DLHA 4J9OA 1QS4A 2UVRA 4K8XA 3DLGB 2RPIA 4TN2A 2RKIA 5FDLA 4KHWA 2HB5A 4LD0A 4DTOA 3RMBA 2C28A 3I0SB 2JEIA 2Z1GA 1S5JA 4AHCA 3IRXA 1RA6A 4Y3CA 1UA0A 2ZE2B 3SQ2A 3P5JA 4NLRA 3MAQA 4DWIA 4PWDB 4NLOA 4MK9A 4NLPA 4WFZA 3O4NA 3RB3A 2OA8A 1T05B 3RR8A 3VQ7A 2UUTA 4B9SA 3SQ4A 4ED1A 2Z1IA 3O3GA 3ISNC 2BRLA 4O0JA 4DL3A 5DGBA 4KPYA 2KZZA 2AGOA 3TWHA 2F96A 4W5NA 1SUQA 1SH3A 2XRIA 3AVNA 4DSKA 2E9RX 3L3VA 2Z1JA 4E19A 1VSEA 3VQCA 5KFRA 1HNIA 3FRZA 1IKYB 2QKBA 1DTTB 5KT6A 1NJZA 4NLGA 3NGYA 4BDZA 3IN5A 3DRRA 4ZP8A 3DLKA 2EC0A 5KG1A 3NHGA 2XO7A 2WCXA 3KK1B 4KAIA 1R0AA 2IJNA 4Q0BB 2Y1IA 1LWCA 2B6AB 4E1NA 4J9KA 4KHRA 4I9LA 1RYRA 1S9FA 3V81A 4Q0BA 3MECB 1JLCA 4O3RA 4NRTA 1B92A 4YP3A 3KK3A 2YNGB 4CK3A 2R8IA 1OS5A 5KG5A 4DLGA 2KFZA 3HT3A 3MEGA 3UR0A 3TAPA 3H98A 3N6NA 5KT3A 4YNQA 3U3GA 5SZTA 3SI6A 2D5RA 2W9BB 1VK0A 4F2SA 1XR5A 4B9VA 3KHGA 5DQGA 1C1AA 1RT1B 4ELTA 2A1RA 1RDRA 1L3VA 3AVKA 2AX1A 4CJSA 3NF9A 3ZT4A 3DMJA 4OJRA 3LPUA 4DFPA 5KFEA 3C6TB 2QV6A 4Q44A 4OKKA 1MU2B 1RILA 4NCGA 1NJWA 4IQXA 3AVBA 3M8PB 5J2NB 3KK2B 3QGIA 4FJMA 3CVKA 2FVRA 3JSMB 3NDKA 2YNGA 1VSIA 3EYZA 1REVB 1X9WA 1RYSA 1HYSA 1FK9B 2YKMB 2I5JB 4N47A 5KFZA 2B6AA 1NK8A 3P83D 4AILC 1ZTWA 1IKWA 1ITGA 5KFMA 4NYFA 2X6SA 3IG1B 2PZSA 4ZHRB 2XI2A 3DLKB 4GW6A 2YNHA 5HBMB 2FBVA 4IRKA 2HHWA 2KW4A 4KE5A 3SFUA 3RRHA 4CJVA 5E41A 3NE6A 3ULDA 2B4JA 4FJ7A 3D0PA 4IDKA 4TQRA 2AU0A 3OLBA 3BDPA 4NLXA 4K4ZA 2RDIA 1EXQA 4CGIA 4ECSA 3M8QB 2RDJA 4M3RA 4MH8A 4CEQA 4F3OA 3C95A 4CJLA 2ZQBA 4IR9A 4DQSA 3G6XA 4C8MA 3T3FA 3PO4A 3I5AA 3OJSA 1K1QA 2XI3A 4BWJA 5KFHA 4ICLA 3MEDA 3E01B 3PHEA 3VA0A 1S1XA 1VSFA 2HAIA 1HJRA 4WFYA 2R8KA 4JRPA 2C2DA 5EDWA 4J9LA 3OYDA 3B6OA 3DLEA 2OPSA 3CFRA 2OYQA 2V0NA 1NHUA 1HNVA 1U09A 1TKTA 4RW8B 4WE1B 3MEEB 1QTMA 1L3UA 4YR2A 1LWEA 1QE1A 4KAZA 3KK3B 1YVFA 3LWLA 2WB4A 1XHZA 2W9AA 4WFXA 4RUCA 4H54A 3BSNA 1FK9A 2YKMA 3NKYA 4Y2CA 4CFBA 1NK9A 3PW2A 4DS5A 1QE1B 4DQPA 4M3UA 4CFDA 3SUNA 4NRUA 4FJ9A 4F4WA 1EETA 4LSLA 4J2DA 1JXEA 2OPPB 1KFSA 2Z1HA 2JC1A 5C42B 3ZSYA 3RMAA 4IFVB 2G8HA 4I7FA 1S1XB 5KFSA 3A2FA 3G6VA 2V4QA 1RTIA 5KFNA 4CEBA 3M9MB 4CE9A 4IFYA 3V6HA 1W9HA 4DQIA 5FROA 4DLEA 2FLNA 4JS4A 2AJQA 2FBXA 1TVRB 1U49A 3DYAA 2G8UA 4BWMA 3BSOA 3V9WA 4ED6A 3OSPA 3ZCMA 2R2UA 5EWFA 1HYSB 4FJIA 3UIQA 1C0TB 4NYNA 3AA3A 3OYLA 5KG4A 2JEGA 3HHKA 1J54A 4H4MA 5DGAA 3AVFA 5F8NA 5L9XA 1XI1A 4AHVA 2W42A 2FLLA 2W7PA 2IJFA 1QUVA 1JLBA 4WYWA 3ISND 5FDLB 4FLUA 3BSAA 3RB6A 2BANB 1JXLA 1JIHA 4MQ3A 4B3OA 5EUHA 5DQIA 4O3NA 4JV2A 2YNFB 1Z25A 3TAMA 4N41A 2DFEA 4CK1A 4F2RA 3VQ9A 1I39A 3KLVA 4ZTFA 3I0RA 3PJWA 4CIGA 3V1RA 5HROA 1D8YA 4CCHA 4O3PA 1I6JA 4R8UA 5KG0A 3KHRA 3V81B 5KG2A 1XR6A 3DDKA 4E3SA 2VG6B 1KLMB 3C6TA 5EWEA 4QWCA 1SL1A 3LP0A 4FW2A 1QAIA 3DLRA 4DTMA 3MEEA 2DTUA 4AHRA 1RA7A 2W8KA 3OJUA 4DTXA 3QEVA 3L2QA 1WNSA 3MFHA 3VQEA 4BE2A 4H4MB 1WAFA 3HM9A 4CHNA 1RBTA 3ZT0A 3FQKA 3EZUA 3S9HA 4NCAA 4I2PB 2ZD1B 4K4SA 3IS9A 4K50A 3NGDA 1ZBHA 2QK9A 5KG6A 3MEDB 3V6DA 4ECYA 5KT2A 1KLNA 3RB4A 4F4YA 3LAKA 5J2QA 4J9QA 5CY4A 1LWEB 1SH0A 2C2EA 3HJFA 2ZD1A 2AGPA 2UUWA 1S6PA 3K5NA 2OZMA 4DSIA 1QSLA 3OHBA 5HP1A 2HMIB 2KFNA 2OH2A 3EZ5A 3AO1A 4ED8A 3ICLA 3TAEA 3C6UA 1JLQA 3WNFA 2W9CA 5DMRA 3OYNA 2HMIA 3CG7A 3RBEA 3MR2A 3HK2A 4RW9B 4LQ9A 1L3SA 3ZT2A 3FDSA 4M45A 4CF1A 1U48A 2R8JA 4CEDA 4LH4A 1F21A 1TL1A 1UWBB 4ZHRA 4I2QB 2VG7B 3H59A 1D0EA 4FJGA 5CYMA 3BQ1A 3PJXA 1RBRA 3IGNA 3L2UA 3CJ3A 5F8MA 4CF8A 1SH2A 1S49A 3RRGA 4DU1A 3CO9A 1L3TA 1R0AB 4QWBA 1RBUA 4DSEA 4ZPDA 1Z26A 3JSMA 3RMCA 1RTDA 4KB1A 3H5SA 3AO3A 4J2AA 4WE1A 4FJHA 5DG8A 4DS4A 3AVJA 4CJPA 4O3OA 1S1TB 1BISA 3SPZA 2O5DA 4KV8A 3PW5A 3LP0B 4Q8EA 4KHNA 2YNIA 4RW4B 4RW6B 3K5LA 1Q9XA 3S3MA 4J2EA 4CGDA 1S1WB 3G6YA 2HHUA 4KBIA 1QQCA 3V9ZA 5CYMB 4JUZA 1QHTA 3TAQA 4ECVA 1WLJA 2FVCA 3ZSXA 4CJFA 3PZPA 4CHZA 3I5BA 1TK8A 3FSIA 5SWMA 3EPIA 3DMJB 1S10A 1BQNB 2RN2A 3LPTA 4XIUA 4RNFA 1TL3A 4YMEA 3KHHA 4ECZA 2IAJA 1XR7A 3NL0A 2YV0X 3KKSA 3HSTB 2IM2A 3SPYA 3KLFB 1RTHB 1FKPB 1ZBLA 2ATLA 2OPPA 5KFVA 2Q3SA 2XY5A 4F4KA 2FJXA 4YR0A 3ZSWA 3ITHA 2W7OA 1J9AA 2Y1JA 3MF5A 5JS2A 1U45A 1EP4A 1HMVB 4TXSA 2VG5B 4R5PB 3NH0A 3TVKA 4Q43A 2G8KA 3KNAA 3H2LA 3KLIB 3WNEA 4NLUA 2VG7A 4DL6A 5EU7A 4CFCA 2XY6A 3DI6B 3H5UA 1IH7A 4H4OB 4OL8A 4KB0A 1C0UB 5KG7A 4J9SA 5F8LA 4Z4EA 4DL7A 4FLVA 4E7KA 4L8RB 4Y1CA 2FVQA 3QESA 5C5JA 1N4LA 4PWDA 4CJUA 3ALYA 4PQUA 2RF2A 3GV5B 4JLHA 4FLWA 4CHOA 2XHBA 4FJ8A 1RT4B 3QIPB 5DLFA 3GILA 2YHBA 3OVNA 4IKAA 3H4BA 1Q8IA 4B8AB 3LP2A 4R0EA 3RMDA 2OPQB 2FBTA 4ZPBA 4X2BA 3TABA 2YHAA 1ASVA 4M3XA 4XO0A 4O44B 2IS3A 4OLBA 1BIUA 3T1AA 4Z4IA 1Z4UA 4KFBA 4YR3A 3GIJA 2HNZB 4CHQA 4FLYA 5L1KA 5HLFB 2VWKA 4TY9A 2R8GA 1Q9YA 3DOLB 3ITHB 4E0DA 4EBDA 3MR3A 1S6QA 4K4XA 3DOKA 3OYGA 3PR5B 4DEZA 1TV6A 4C8LA 1S6QB 2AQ4A 3BGRB 4KRFA 4PY5A 1K1SA 3OYMA 4KHSA 3P1GA 3TANA 3KLHB 1LW2A 1SKWA 4IFVA 5J1EB 4KO0A 2R7YA 3QIPA 3PW7A 4ECTA 4F4ZA 1N5YA 1WSIA 3M8SA 1BI4A 2G8IA 4KHUA 4BACA 1BHLA 3OS1A 1FKOB 4FLXA 3U6FA 1BCMA 2X6NA 4IG0A 4F50A 3M8QA 1W25A 1IKXB 3AVAA 4C8KA 2BQ3A 3Q8QB 2WOMA 3H40A 5KI6A 1A5VA 2HNYB 4FK0A 3K59A 1A5WA 2KTQA 5D3GB 2GIQA 3T5HA 4RW4A 1D5AA 4IDKB 3V9SA 3C94A 4ID1A 3N6LA 3PX4A 3MXIA 4B9TA 3SUQA 1EP4B 1S9EA 2QXFA 3QNNA 4ZPCA 3AVLA 1S1TA 3HYFA 4WZQA 4N5SA 5KFOA 4QW9A 3OYBA 3KOAA 3DLGA 2DFFA 2XCAA 2WONA 4IKFA 4J9PA 2E9ZA 3BJYA 1N56A 3F73A 3K5MA 4ZVHA 4AHTA 2EX3A 1RTJB 2HNDA 1ASUA 3UPFA 3UQSA 1YTUA 1JLAB 2CJQA 2ETJA 2D7SA 4FZZA 1BGXT 2BE2B 4TYAA 3TARA 3AA4A 5J2NA 4QWEA 1HQEA 2UVUA 1XHXA 5C24A 5J2MB 2JLEA 1HNVB 2PY5A 3KLGA 3LP2B 2JEFA 1S48A 1J5OA 4CIEA 3HVRA 2NUBA 4RW9A 3D45A 3AO5A 4FS2A 4XPCA 4KKOA 3JYTB 1KTQA 1S97A 2P1JA 3BGRA 3OYEA 3HPGA 1S9GA 1NKCA 3FFIA 4WXWA 4DTJA 1GX5A 2XY8A 5KFCA 3V4IB 4FCYA 2ILYA 5KGWA 3KJVB 3QERA 3RB0A 5J2QB 4ID5B 5F9LA 3GIMA 1C1BB 2VWJA 1IO2A 4F3TA 2FBYA 1VSDA 4ELUA 3CM5A 4KFBB 1LWFB 2J6TA 4MIBA 3K57A 3QGHA 1JXBA 1HPZA 4RW7B 2ALZA 3VQDA 3DYAB 3NAEA 4IOBA 3CDUA 2B5JA 4M3WA 4ECQA 1JLEB 1IKYA 5KFJA 3TAFA 1RTHA 2ILZA 1B9FA 3RBDA 4KI6A 4O0IA 4FM1A 2IAJB 4FZYA 2FVPA 1RBVA 5DLGA 3QIOA 3NGZA 4DL4A 1ZETA 3BSCA 1BQNA 3CDWA 3KD5E 5C25B 3DRPB 3L3UA 4KSEB 4K4WA 1G15A 3RAQA 1S1VB 4CECA 2AX0A 4CJKA 4NLSA 4DMNA 1KHVA 1S1VA 4G1QA 3M8PA 4MFBA 4TSXA 3VQ5A 4NCGB 1TQLA 3MXJA 3LDSA 1ZBUA 2HHVA 4R5PA 1NKEA 1NJYA 3ASMA 3QLHA 3FQLA 1RT2A 3V6JA 4PQUB 1NK7A 3CWJA 5DG9A 3V4IA 3OL6A 4QPXA 3KD1E 1S6PB 3T5LA 2HVIA 1SKRA 5KFBA 3V9XA 1IKVB 2IBKA 1SUQB 3DOLA 3VQ6A 1TL3B 3TR8A 1HQUB 3D5MA 3PW4A 4KTWA 3OYCA 1NJXA 1UAXA 4O3SA 4CJRA 1C2PA 5T7BA 1U47A 5EWGA 3I5CA 1VRTA 1NK4A 1JKHB 1O1WA 3IGVA 1UWBA 1KRPA 4KREA 2WTFA 4CGJA 1RT6B 1EKEA 4O4GA 3TAGA 1TVRA 3K2PA 5FRNA 5KFAA 4URGA 3AV9A 4CEAA 1RNHA 3IAYA 4DFMA 4Z0UA 4CGHA 2YNFA 3VQPA 3KLFA 4OKEA 1N5YB 1RTIB 4W5TA 1HARA 2AGQA 1WSHA 3ZSZA 1CZBA 1LW2B 2P51A 1A5XA 3VQQA 1EETB 4LSLB 1S0NA 3ZT3A 4FJXA 1TAUA 2W8LA 4ZP9A 2D0AA 4R8UB 2X74A 4FM0A 5FRMA 2JC0A 1CXQA 5DK5A 4FVMA 1K6YA 3G86A 4GVMA 4Z4GA 3KLGB 1T03B 5HRNA 3DLBA 4QAGA 4FXDA 1GOAA 1HQEB 4MKBA 1RTJA 2HNDB 2ASDA 3OYKA 2OZSA 2WRMA 3HPHA 2BE2A 5KRSA 3H08A 1ZTTA 2WK4A 3IS9B 4DU4A 3K58A 4O5BA 2I5JA 3LALA 1DLOA 1C1BA 1RDAA 2FJWA 4DTRA 3NF6A 5HRRA 1XC9A 1GOCA 4PA1A 2D0CA 4CJWA 4DSFA 1FKOA 1RAJA 1D9FA 2IM0A 1C1CA 3H4DA 5K14B 1BCOA 4FK4A 3OL7A 1B9DA 4IFYB 2KZMA 1JLGA 4ICLB 1JLQB 3QZ8A 3HP6A 4ZPAA 1U4BA 2IOCA 5KFTA 4RG8A 3E01A 1T8EA 1YT3A 3CFPA 1LW0A 1SL2A 1JX4A 3N6MA 4NLVA 4Y34A 3QO9B 4Z4HA 4F4XA 4WZMA 5KFKA 3M9OB 2B43A 4NLDA 5HLFA 5L1JA 3AVIA 1NOZA 4URQU 1BL3A 5HRPA 5L1LA 4AHUA 2G8WA 3THVA 3NF8A 5KFDA 3NBPB 2VG5A 1GX6A 3KK1A 3SQ1A 3AVCA 3OS2A 4CESA 2C2RA 4M42A 3NAHA 2BGGA 4KTZA 2XGPA 5J2PB 4OGCA 5F8JA 4HVJA 1XWLA 4EZ6A 3LWMA 3L2RA 1KVAA 4ED3A 3AO2A 4J9RA 4OVLA 3QLHB 4LSNA 3CDEA 1TK5A 1NKBA 2V4RA 4OPKA 4O44A 4BE0A 4RNMA 3OL9A 2XWYA 3F9KA 3PY8A 4DU3A 4RW8A 2BQUA 1DTQB 4HCCA 1T05A 4FLTA 4J9MA 3GYNA 2BRKA 5KFWA 1HYVA 3RAXA 3KMSA 4G1QB 5KG3A 3Q8SB 4N76A 5C25A 4JV0A 2ITGA 2JGUA 4C8NA 1QSSA 3KHLA 4LH5A 1BI4B 3EY1A 1RT7B 4ZP6A 2IC3A 4NLYA 1SKSA 5KFFA 1RBSA 3C6UB 1SV5B 2W9BA 2HVHA 5J1EA 1RT7A 2GC8A 4CEOA 3KLHA 4NYZA 5J2MA 1C1CB 3HL8A 4H4OA 4CEEA 3OYJA 4FJKA 4LY7A 3SV4A 3ZSOA 4IH7A 3OSNA 3B6PA 3QEPA 1RT6A 3MEGB 3KMQA 2B5JB 3DM2B 3O3HA 2VA2A 2GIRA 3H5YA 3DRSA 4FZXC 3AVGA 2YKNB 1VRTB 3IG1A 4DQQA 2IM3A 1IM4A 3MECA 1HMVA 4CK2A 4FYDA 1HPZB 1JLFB 1L5UA 1T7PA 3QZ7A 5KFIA 4Z4CA 2D3UA 1QAJA 1LV5A 1U04A 3LP3A 1DTTA 1N48A 5KTQA 3VQSA 3Q8RB 3VA3A 3DRRB 1RT3A 4QCLA 1C0MA 4W5RA 3QNOA 5DQHA 4CJTA 2D0BA 3JYTA 4CF2A 2F8TA 3CJ0A 4K4TA 1KVBA 4J9NA 4B9UA 1Y97A 3QINA 1WSGA 3NH2A 1LWFA 4FBTA 1NK5A 4CHYA 4FS1A 4J2BA 2HW3A 3NMAA 1HRHA 4PUOA 4Z4FA 3KLEB 4KHQA 3VQ4A 4ZVEA 4CEZA 3G0ZA 4FJLA 4YQWA 3KKRA 3HVAA 1NNDA 3K5OA
chains in the Genus database with same CATH superfamily
2X1AA 1S72S 1S1WA 1HQUA 4JI6F 3ZO7A 4BC7A 4DF4A 2ZVSA 3P45B 1IKVA 3UR3C 4CT8A 1S0MA 5K20B 4Y2AA 3QB0A 2HBJA 4PXBA 4ED5A 3X1LB 4DFJA 4RUAA 4EBEA 5K9FA 4G3IA 4ED7A 1U1QA 1FNMA 4BRMA 4MIAA 4A5BA 1RDCA 4HI2A 2VU5A 5A0YA 4CH1A 1R31A 2K8GA 1WG1A 3ZSRA 2CQPA 3IM8A 1HI8A 3MOJB 1WC3A 2W4DA 4IR1A 4CJ3A 3GP9A 1W7AA 3ZZ0A 2XEXA 3BZQA 2I1RA 4Y0WA 2RJZA 1W26A 4ECXA 1RBAA 3FKBA 4DDFA 4UOGA 1V4TA 3PR4A 3CIZA 1RBLA 1TUVA 4B17A 1X9MA 3PW0A 2LU2A 3AJ1A 2Q6BA 3GYXB 4C8OA 2GZOA 3AGRA 1DAXA 3O4QA 3H45C 2G2ZA 5IT9Y 4DJBA 1PAEX 4P2MA 2DPJA 2AV5A 3DRSB 3UN2A 1N36K 1F5AA 1U2VB 3IBFB 4G1IA 3NCIA 3HHNB 3OFHA 2VFSA 5ETVA 4BE1A 2YWHA 1UPPA 4WCEL 2MKSA 3ELHA 3LTOA 4OZ1A 5GINA 4IBNA 4QIVA 5I42A 4PL7A 4JI2K 2FHOB 1HYZA 3AVMA 1XC3A 4GMKA 2P9LB 3AODA 3KNGA 1U25A 3RW7A 3CDAA 4NZ6A 1FNOA 4BG9A 4GV6A 2M0GB 1N0UA 4BR4A 1CC8A 3PX6A 2X1FA 5KFUA 4OYBA 3MR5A 2A5XA 1VHXA 3FEZA 1SC1B 3OUYB 2ZKUA 4ES3A 4QIFA 4HH1A 3ENHA 3VTIA 2ASMA 3G8TA 4WXOA 4OLOA 4JV1A 1KVCA 1B0TA 3D2FA 4ID5A 2JEJA 3U3YA 2B4VA 4C0BA 1KQGB 1P90A 5BPLA 2CQHA 4HT5A 1E6YB 3N79A 3L6QA 3T1HF 3JAMU 3AA5X 3DOKB 3CMES 2LQ8A 1KR4A 5HVFA 4ILGB 1Y9OA 2FC0A 5KFLA 3Q0AA 4MK8A 1HKAA 3G10A 4CD1A 2QSFA 2JNJA 4NI2A 5BN9A 1CVJA 3OYFA 3ZLJA 4M3ZA 1MN7A 3POTB 3D6RA 3PYDA 4GVLA 1G3OA 2DXEA 1BWFO 1WB9A 1RAEB 2HWHA 3MPDA 4CW7B 1AYEA 4QYZK 2IGIA 2CADA 5AZIB 2WVFA 4WYLA 3SQ0A 1DJ0A 5AXKA 3CQ8A 4RW6A 4KHPF 2EWSA 5H9FK 1LW0B 3GG0A 1VQOS 4OYZA 5H1SV 3MMBA 2F40A 1F1BB 5I42B 3NFAA 2YKOA 4DX6A 3H6EA 4P6QA 1CULA 3O6QA 3KDOA 3GQCA 3D9BA 3MPUB 2YNHB 2XMVA 4QOZB 3SZ2A 4JV5K 1LK5A 1BWVA 5F8IA 4WFBQ 2HHTA 1TZ0A 4H03B 4RU9A 3LZJA 4EO8A 2O8EB 3TW0A 2WOMB 1PCAA 4NMXA 4EEYA 2MQPA 3GYGA 5ETKA 2OUGA 3HZ6A 1CSJA 1Q7LB 2KRBA 2LEPA 1S4FA 3NH1A 2AW0A 4WFAL 4LF7K 2PYLA 3FFIB 5JXSA 4JK8A 3WXLA 5KT7A 5AJ3F 2O8CB 1ZBSA 2C2MB 1YI2S 1VCTA 2KU7A 4ZKAA 3CJAA 4NZ0A 1HNWK 1SQKA 1ICEB 1U1OA 3B8HA 4FM2A 3D1QA 4HCBA 3PV8A 2KM8C 1WWHA 1WAJA 1SC3B 2Q6CA 1D9AA 1TK0A 2DIUA 3GIRA 4YB7A 2K3KA 1TP7A 2HWTA 4PUOB 3DRPA 4EYHB 2DGWA 2MLXA 5F8HA 1TKZA 4JKAA 4A59A 1NAQA 2ZE2A 2KQ2A 2CNOB 3THYA 5E26A 1LAVA 3VETA 4CEFA 3GFZA 1WTFA 3MXMA 2WONB 4CJEA 3I4PA 5LT5A 4RBUA 4DR5K 3SCXA 4BCAA 3RR7A 3BDEA 4G65A 1ZBFA 4I6YA 1S9GB 4FF3A 4GC7A 4BDYA 4NLWA 4CHPA 1KTVA 2HK3A 4ER8A 4OPJA 4A8KA 1RT1A 1EZZB 1H98A 2V9KA 4A5AA 2CDQA 5K8MA 2J6SA 1NPPA 1FWKA 2I7PA 2G8VA 4F8RA 2J6UA 1VSLA 2IBOA 1BU6O 3PRDA 3R6LB 3KK2A 1GLEG 4CFAA 1JXVA 1U7LA 4CT9A 3TAMB 2CA9A 4ECUA 3Q83A 2XQCA 2XGQA 3PIOL 2CZ9A 3SI8A 1JLGB 1N6QB 2R2SA 3CJ2A 4WJBA 1D9DA 2R7RA 5BRFA 2E1AA 2CPIA 1Q5VA 3OLAA 1JLCB 4RW7A 2L41A 2MDAA 2B7CB 3DI6A 4OGEA 1QAXA 2CKWA 4GC6A 3ZTSA 1JKHA 5FPNA 3HVWA 2F8EX 3L2WA 2UU9K 3OS0A 1RAOA 1GXTA 1VIXA 1Q0NA 1RHJB 1FT8A 2ASYA 4Q8FA 3NWRA 3MMVA 2VBZA 4P7VA 2DNNA 4ELVA 3PEJA 2QE5A 5IOLA 2WW4A 2MLYA 3O5TB 3SXLA 4JKGB 2UVWA 1NEEA 2G13A 4X64J 3SAGA 2XHWA 4PG5A 2JVOA 3UD5A 4JKGA 2O4GA 1LAWA 2ZH2A 1KVIA 3CJKA 4LMZA 2E6MA 2P9UA 1RAFB 8RUCA 2YI1A 1YIJS 4FPAA 3GJTB 4CZJA 1HHQA 2AYMA 4BDPA 2DY4A 3I0RB 3O9SA 4XPEA 3D28A 4IH5A 1CXUA 2X1GA 5AXMA 3T5JA 1WSRA 4M7YA 4URSA 3VAKA 1QS4A 3ZC4A 2DGXA 1HKBA 2CDRB 2LXFA 3I96A 3G71N 4K8XA 2RKIA 3L9ZA 1R8CA 1Q79A 1VIOA 4GVEA 3KUHA 3ENBA 4JI7K 1FRKA 1N88A 1Q53A 2E44A 3G9CA 2C28A 2FQQB 4LF8J 4DR3K 3Q23A 1LEOA 5C2DA 3OPKA 1J5EK 2ZE2B 3SQ2A 3P5JA 1QY7A 1XMQK 5C0YA 3BM7A 4NLOA 3OR2B 1NDKA 4JK9A 3GR1A 2ZH3A 2EFQA 4WFZA 3MM5B 3RB3A 3SSRA 1T05B 4XK8C 3I4HX 4YB5A 4GO5X 3M2UA 4ED1A 2Z1IA 3M8ZA 3JQKA 4ILLA 2W41A 4F67A 4DL3A 3H3NO 2RAQA 2QRRA 4A8QA 2PA3A 2AGOA 2F96A 3B8AX 1SH3A 2VBYA 2OTJN 4DPWA 1VSEA 4H0OA 3SBMA 3T1HK 1TR0A 2RB7A 3FZFA 3NHGA 2E20A 3O44A 2W25A 3S8SA 2IJNA 2P9IB 2OTLN 4E1NA 4J9KA 1YJWS 2IVNA 4I9LA 1S9FA 3V81A 4Q0BA 2CPXA 2DVIA 1JLCA 3MM8A 5JVHQ 2YNGB 2MKCA 4K0KF 2E5HA 2KFZA 3HT3A 1FFWB 4QIGA 1SI9A 3MEGA 3UR0A 4XH5A 5ETQA 4KHPJ 1KN6A 5AFUA 1TU0B 3SI6A 4U67L 3CCES 4B9VA 2GUPA 1RT1B 3EEQA 1L3VA 4B1YB 3DOMA 3DMJA 6FD1A 3C6TB 5IT0A 4OKKA 1MU2B 1NJWA 3NVMA 3KG1A 2IDEA 3AVBA 4BC3A 4FJMA 3JSMB 1VSIA 1REVB 4NL5A 1HYSA 1FK9B 3G82A 3HSDA 1QVFR 2NUHA 3VGVA 5KFZA 2B6AA 2WW8A 1NK8A 1Q82T 3P83D 4AYBD 4K0KJ 5KFMA 2EW9A 5ELZA 2X6SA 4TU9A 2RSQA 2VCPA 2XI2A 3DLKB 4OPAA 1FFSB 4AM7A 5K8OA 3SFUA 4B1ZA 3NE6A 3AOBA 3ULDA 2ZM6K 1YKWA 2MQLA 3TQEA 2UU9J 1YJNS 3W62A 2VD3A 2QWPA 1RWWB 4NLXA 2RHKA 1FCAA 4I6AA 4K4ZA 2RDIA 2MGZB 1KAYA 2RT3A 2OP5A 5C10A 4JD2A 3W63A 2Y8WA 1FJGF 2P9IA 1YQHA 3O9UA 2M8DB 3TZYA 1S0VA 4DQSA 4C8MA 2P8IA 3P39A 3PO4A 3W60A 4ITSA 2FGCA 2HGMA 2V67A 1N8RT 1FJGJ 4ICLA 3E01B 1Q86O 1FJ7A 1NBEB 5AE3A 4FWSA 1HJRA 1U26A 4H0PA 2VQEK 2C2DA 4QJVA 4U9RA 2COLA 1VJWA 2B9XA 2UUAJ 1YJNN 1NHUA 1OJ4A 2KFYA 2F9JA 4MLHA 4WE1B 2DHAA 3NRBA 3VF2A 1LWEA 2LA4A 2IVMA 3CETA 1FRMA 1YVFA 1U2VA 2KLAA 1X3NA 1JMTA 2W9AA 5JVGL 3KVGA 1FK9A 3G82B 1SC6A 4J9UE 4F02A 4DX5A 1UZHA 3TUJC 1QE1B 1PILA 1R8AA 2GFFA 3UO0A 3UVJA 1AUDA 3DLLL 1IUJA 2LA6A 4NRUA 1M90T 4X66F 4FJ9A 1UZDA 5KQDA 1X7VA 2NZTA 7FDRA 4OLPA 2VONA 2J7UA 3OR1B 4ZS6A 3QSYB 3RMAA 4IFVB 4I7FA 1KQKA 2DHGA 3G6VA 2V4QA 3CTRA 2QXLA 3CJ1A 2OKQA 1YJWN 3M9MB 1VQYA 4CE9A 1VHIA 2P9CA 4DQIA 5FROA 3EGVA 3TU5A 3MZIA 1TVRB 2KL8A 3DDNA 4O23A 1ROFA 2VIHA 1WUAA 4BWMA 3BSOA 2G0CA 1IBMK 3V9WA 3OSPA 4DR3J 2QEXN 1FX2A 3PYFA 3E9LA 1HYSB 4FJIA 2CPFA 2R7OA 4LF5J 1J54A 1LNQA 4TU8A 1FW6A 5F8NA 3MX2A 4CTAB 4FPBA 2W7PA 1G6BA 2IJFA 3FK4A 5SUHA 1QUVA 4JI6J 2ACYA 1VDHA 5M1NA 4LUBA 2F65A 2XSJA 3RB6A 5HQMA 3FSXA 2CYYA 1H2VZ 3IFEA 5DQIA 4H5RA 2WVBA 5MLCQ 2UV8A 2RH3A 3QRRA 2DFEA 4F2RA 2W2NP 4UTGA 4HL9A 2PIIA 3Q89A 2NRRA 3PJWA 4NA1A 3EMTA 3V1RA 1NJIT 4LF7J 5HROA 2R3VA 4O3PA 2ZHOA 3KHRA 1Y4ZB 3J81Y 5KG2A 2WVEA 3CC2S 1XR6A 4DR7F 1VI7A 4E3SA 4DV6J 4W92B 2PEBA 3AB4B 4RKUC 3MCMA 4FW2A 1IR2A 3VEXA 1EX8A 1X4FA 2C2OB 2ZBQA 4DTMA 4Z7CA 4EFHA 4O5FA 3UNYA 4BR9A 3ZT0A 3FQKA 4JOUA 1VQPN 4M8LA 3DRXA 3IS9A 3H2UB 4OYXA 1FNXH 4K50A 4ZCLA 3CCQN 5KG6A 1S6OA 4ECYA 2Z56B 3RB4A 4JI8F 2ZOGA 3LAKA 5J2QA 2XLJA 4J9QA 5CY4A 1E6VA 1SH0A 2C2EA 2ZD1A 2AGPA 5IV3A 1V6HA 3RZAA 2J76E 2UUWA 1FJCA 3MCNA 1QSLA 3D2EB 3OHBA 3OVAA 4Y28C 2KFNA 4L73A 2OH2A 4YOVA 4IDHA 4ZDNA 3E9OA 3C6UA 1U6BA 4KGZB 5A2QY 3OYNA 1Q7YT 3CG7A 3RBEA 4RW9B 2XBPA 1IBLF 1WDDA 3FDSA 4M45A 4YOTA 4YHHJ 3HJVA 1V3SA 4LH4A 1F21A 1CS4A 5IT9O 2VGMA 4D3GA 1X0FA 3D6HB 2DO0A 1RBRA 3RGIA 2OEMA 5F8MA 2V94A 5A8RB 5FPDA 3CO9A 1R0AB 3M3ZA 2MPUA 1RBUA 5EN1A 4DV2F 4X62K 3H5SA 4WE1A 4JNEA 3C0BA 4CJPA 4O3OA 1ZS6A 3CCQS 4AF1A 2VDIA 1U6ZA 4KV8A 2MZJA 2YNIA 5AQSA 3M32A 2V4JA 1LK7A 2HHUA 4KBIA 3JSRA 3WDOA 4CJFA 4CHZA 3I5BA 5SWMA 3G96A 1BQNB 2RN2A 3LPTA 4RNFA 1TL3A 2OFHX 1ATNA 2NYIA 3KKSA 1DURA 1K8AO 4BREA 3MM6B 5KFVA 1X5TA 1NNEA 2EFOA 2NLWA 2FJDB 4NWBA 3OTEA 2VQFJ 2EK1A 4B3TF 1U1RA 2VC0A 2QA1A 4NA3A 1NPKA 2GCFA 4R5PB 3BBFA 4CNZA 1ZOTA 3CGIA 2KKHA 2OD4A 3D66A 1PJ7A 3H2LA 3KLIB 2H1YA 4RTFD 5AJ3J 4UT4A 3MURP 1RU1A 2R7XA 5EU7A 1R0CB 1HNZK 3EKUA 4KB0A 5KG7A 4CLZA 1WEZA 3VVUA 1WTBA 3R9LA 3DN9A 3EDRB 4Y1CA 1AFJA 1JJHA 2FHJD 2HSTA 3CXCR 1F5CA 4PG4A 3ALYA 3C6HA 1SIZA 4CZMA 4NX9A 4JLHA 3DXKA 3BS9A 1X4HA 4CHOA 3QIPB 5DLFA 2GHWA 2YX1A 2YPYA 4IKAA 3H4BA 1VLOA 5DJBA 3C15B 4A8WA 4RBTA 4YORA 2RS2A 1GLAG 1RABB 3F41A 3RMDA 1ZAXA 2FBTA 5C15A 2YHAA 2G2YA 2IS3A 1QHAA 1BIUA 3T1AA 4KIAA 3J7A1 4KFBA 3J7AN 4K8RA 1NDLA 3QT5A 4FLYA 5L1KA 2G1HA 2VWKA 4TY9A 4DR2J 3ITHB 3UB5A 2DH9A 1CC7A 1CULB 3DOKA 4FDFA 4DN0A 2O66A 1Y5NB 4K0KK 1TV6A 3ENQA 3MHYA 3O3LA 4PY5A 4DR2F 1PC5A 3CJTA 3KLHB 5CHIA 3ILIA 2MLZA 5J1EB 2KVIA 4OX9J 3IWNC 1BHNA 3PW7A 4ECTA 1FRHA 1N5YA 2JX2A 3O6WA 1FRLA 3C14B 4WIQA 1BI4A 1P1TA 2G8IA 1FE0A 1VISA 4FLXA 1BQXA 4CIOA 4F50A 3DWLA 2ZZMA 5GAHP 4ZJQA 3ZYYX 3I87A 3W9IA 4C8KA 2BMBA 2WOMA 1BWEA 1KEKA 2B3TB 4YDDB 2W2PP 4IEIA 3D7SB 1ZZFA 2OO4A 2KTQA 2C3OA 4KYZA 3T5HA 4X65K 4RW4A 1EKRA 4QZVB 4B9TA 1HKGA 4CM0A 2ROGA 2IIHA 5AJ3K 3RAMA 3OBWA 3CSKA 4PWWA 2LFVA 1S1TA 3MMCA 3CCZA 4LBIA 2DFFA 4IKFA 2E9ZA 1H6KX 2W24A 1N56A 4PL8A 2BUPA 3W5ZA 4FWKA 1ASUA 1YTUA 2ETJA 4FZZA 1BGXT 1R0BG 4A61A 2FSJA 3M2VB 3AA4A 1NGAA 4QWEA 2HQGA 1XHXA 2PY5A 3KLGA 1S48A 1J5OA 4QYZJ 2DR5A 3CCSN 3KJNB 3JXOA 1YHQS 3U1NA 3CD7A 5I4MA 1KTQA 2ZOFA 2HBLA 4WXWA 1GX5A 1QQMA 2XY8A 2NPFA 4FCYA 5KGWA 3KJVB 3RB0A 3TSPA 4OZLA 3FBFA 3R9PA 2VWJA 4PZVA 3M6XA 2FBYA 3O1WA 1LWFB 4PG8A 1MDUB 5M2PA 2VODA 2XO6A 2YPZA 2ZWPA 2N82B 4IOBA 2XZTB 4RLEA 2B5JA 4K2XA 4FM1A 1L3KA 3MWPA 4FZYA 1RBVA 3QIOA 4OI1A 1FDDA 2QLJB 1BQNA 2A3ZA 3CDWA 5C25B 3L3UA 1G15A 2W01A 2LVWA 1S1VB 5AQRA 1PO6A 2M4MA 4BRNA 4CJKA 4NO7A 4G1QA 4UZCA 3EXYA 3ZX2A 3MM9B 4NCGB 2BUNA 2CUYA 2CH5A 2HHVA 2BKNA 4R5PA 3UE2A 3QLHA 4B3SJ 4DB3A 4NA2A 1RT2A 3V6JA 2QMWA 2UUCK 4JI0K 1NK7A 4PRFA 1RAGB 3V4IA 1Q16B 3OL6A 3GJRB 2CJYB 2XS7A 3WZ0A 3KD1E 3SQGA 2F63A 1G1XA 1X60A 2HVIA 2UXBJ 4W90B 4DV5K 1IKVB 1TL3B 3TR8A 3M7VA 4DR7K 3ONQA 1RJJA 4PKIA 3M2RB 3CJ7A 3PW4A 3OYCA 2Q3PA 1UAXA 4ED4A 1N36F 5GADU 1U47A 1VRTA 1JKHB 1O1WA 2GAHC 3VMFB 1KRPA 3VGSA 3UDCA 1H73A 1YLXA 3SBGA 2JVRA 1KAZA 4IWVA 2ATCB 5FRNA 4CEAA 2ASPA 2W7AA 4Z0UA 4YY3K 4CGHA 2YNFA 2MMYA 2L48A 4W5TA 2AGQA 3PG9A 2RRAA 3ZSZA 1OKJA 3VQQA 3O4WA 4FJXA 3SCJE 4ZP9A 5C2FA 2DYAA 2FY1A 1CG2A 4R8UB 4FVMA 1K6YA 3ZZZA 3BN4A 4GVMA 5AQJA 3KLGB 2XZDB 3I6PA 5HRNA 4QAGA 1R43A 2UXDF 1T02A 5J1PA 3TJ9A 1RTJA 2HNDB 2XG8A 2OZSA 5JMVA 2WRMA 5B0FA 4Z2XA 5GMDA 1Q81T 3HDSA 3ZETB 5LMNK 2NUUG 3DXMB 5ETLA 3IS9B 4DU4A 4O5BA 3LALA 1DLOA 1RDAA 3NF6A 3LM9A 3W61A 4HHUA 4CJWA 4DSFA 1A0OB 1C1CA 3W65A 1XMOK 2QYGA 3UDEA 4IFYB 4DR5F 1JLGA 3IR5B 1VJQA 5JLHA 5FLXY 1FX4A 3BR8A 5L39A 1M5PC 3KYLA 5KFTA 4RG8A 3E01A 1T8EA 1YT3A 4LBPA 1LW0A 1SL2A 3J80U 3N6MA 2HVDA 1YWXA 1BOTO 1IBCB 4LF6J 2JRSA 2Z2YB 2FJEB 3OTOK 4F4XA 5CYJA 4X64K 4FN5A 2HZAA 3UN3A 3M9OB 3M2VA 1KKHA 4DU7A 1VQ4N 3ZTPA 1NOZA 1UFLA 1GLJO 4AHUA 5LY3A 2OFGX 3QBCA 3CCRN 1FDAA 2G8WA 2I38A 2WB1D 2VG5A 3J7AP 3KK1A 1XTZA 2NQPA 1HWJA 4D3HA 1X3MA 4CWBA 3NAHA 4OHZA 5HOOA 1NZ8A 1S4EA 2Z2ZA 4OGCA 2UP1A 1KVAA 2B4PA 4AFFA 2UZAA 3W64A 4LSNA 2HPUA 3CDEA 1TK5A 1NKBA 3LQVA 1HNXJ 4WQ5A 4O44A 2I8EA 2M5YA 1AB8A 3OL9A 4ES1A 3W7BA 3H3OB 1FJGK 4RW8A 4HCCA 5DDRC 4FLTA 3PCOB 1KDNA 3PLAA 3I32A 5KG3A 3WT0A 3QRQA 4MTPA 4BRKA 3TOQA 3BO3A 2IC3A 1WC6A 1SKSA 5KFFA 4X64F 2W9BA 2HVHA 3GPAA 2H54B 5DS7A 1I5OB 3RU0A 3FCVA 2JWNA 2ADCA 2ZJRL 3KLHA 4ZCIA 2QWMA 1OY6A 3KG0A 3OYJA 4FJKA 3B6PA 3J7ZT 3MEGB 4FPRA 2ZBIA 3NVKA 3NEKA 1MWKA 2Y0BB 3J80Y 4Y00A 4JKBA 2IM3A 2IHR1 1IM4A 4USKA 1FRJA 4CK2A 3GONA 1HPZB 1JLFB 1L5UA 5AE2A 3MD1A 2F7TA 4Z4CA 1Q78A 1K73O 4DUTA 1FE4A 1N48A 3LDQA 3VQSA 4NZ7A 1BUXA 1GAOA 4QCLA 5DQHA 2KXFA 2Y1LB 3FRYA 4B9UA 1Y97A 2GHPA 2DD8S 3QINA 1WSGA 4ZN1A 3KJQB 4OYMA 2PN6A 1YBAA 5KOXA 1GXUA 4CHYA 2NRVA 4YOEA 4J2BA 3MUTP 3G0ZA 2ZWOA 4YQWA 3ZNUA 1EJ7L 4BS2A 1NNDA 2VBXA 1FJEB 1T0TV 1HBUB 2Z30B 1C0FA 2GUIA 4MDAA 4DTPA 4JI2F 1IJEB 3SNNA 3VGMA 4QS7A 3O08A 3H8YA 3OYIA 1FXXA 3R8EA 2R2RA 4DL2A 4BVPA 2ERRA 2J0QD 2L9WA 1WSEA 1KQSM 3GG1A 4CJQA 4DL5A 3ZSVA 3CFOA 4CERA 3IBWA 3QETA 2E6LA 3CD6S 4LIWA 5EVZA 3CD5A 1UFWA 4C23A 5CZ1A 3BQ0A 2P6SA 3BREA 5CXTA 4HUEA 3POTA 3VEYA 4NXNK 4ENOA 1RT5B 4F36A 4KC5A 2J0XA 2BABA 4KTQA 3QT7A 4B02A 3F0NA 2DR7A 3V9UA 2HHQA 4YB6A 3QAUA 5I3UB 1FDNA 4CGGA 3DKDA 4P72A 1VK8A 3HVTB 4DCJB 2Q0RA 1DEJA 3EVWA 2HEKA 4DX7A 3HO1A 2XLKA 1KVKA 3LDOA 3DHXA 1X5OA 2J9EA 4HLBA 4CNYA 2X78A 4QR2A 1JLFA 2IVOA 4IRCA 2PC6A 1NK6A 3O9RA 3T19A 1VQPS 1BMQB 4IRDA 3OYAA 4FVUA 4ANDA 1FXLA 1APSA 4I2PA 1LOTB 4LFCJ 5J2PA 3P5TL 2M3DA 3VQAA 5D15A 2UUCJ 1TL1B 2O67A 1DKGD 1MU2A 4OHVA 4B3MF 2QTDA 3CI5A 4F9OA 4HEA9 1X5SA 3TI0A 3GOIA 3SJJA 3DOMB 2V8DA 1X1PA 5KFGA 2D74B 4CLPA 5EHHA 5E3RA 4CZHA 3RTVA 1VSHA 1NRKA 4CJ7A 3OA9A 3MGJA 4ZLNA 5A6WA 4DV4K 2A3JA 2IDLA 1C0TA 2OPQA 1YITN 4L72B 3QBWA 2DFHA 2OANA 4WQ5C 3HHDA 4MYTA 1RGIA 4XEIA 5HMWA 2EFGA 2MSTA 3K89A 3NGIA 3PKYA 1OSCA 4DUZJ 2MQ8A 3G6EN 1KCFA 1MMLA 2BDPA 2A2DA 1GFWB 4BRHA 2L9NA 2WSEC 2VPXB 5LMNJ 4F25A 5LM7E 1EQMA 5LL6Z 1XMOF 2XZWA 3CF5Q 3U02A 3ZTOA 3S7RA 1YK9A 3QMQA 4LF4K 5HMXA 3UD4P 4OZ2A 1PJ6A 1DZ5A 4RNNA 2HHXA 4FJ5A 1NHVA 1LWCB 2HAFA 2U1AA 4FBUA 5JS1A 3K8VA 1RZMA 4PHTX 3QO9A 2X3GA 4W5QA 3HBTA 5LJ5Y 3CYMA 4WP3A 4KGXB 3NY0A 3HXMA 3L3CA 4PPDA 1KC8O 1FKPA 3EM1A 5CCMA 1RT4A 5KRTA 2LSNA 3MWTA 3E9PA 4Z7YA 1RT3B 3SMZA 4FJJA 4EGLA 1RTDB 1JLBB 2HQDA 2K1RB 3QEWA 4I1TA 4OX9K 2WTUA 5HBMA 4RNOA 3QMLA 3ZZUA 3V6KA 5KT5A 4LFAJ 3MTKA 4OYOA 1H3DA 4ZVGA 5CABA 3CCWA 3D1HA 3EICA 1IV0A 1T03A 2R7VA 5DG7A 5L38A 3PVXA 4KY3A 5F2RA 5AQLA 2H4WB 2Z57B 1BE4A 2FB0A 1N33F 3OHAA 2G1DA 1LOUA 3AA9A 4WTYA 1M1KT 1S1UA 2BW7A 2MSSA 2W2OP 1KXPA 4LF7F 1X9SA 3KJFB 4KH6A 2DH7A 4B3MK 5KPRA 3MXHP 2FZCB 3WNHA 1JJ2M 3C19A 3MMAA 2V5HG 1W7WA 3PDNA 4IO9L 3JSBA 2QWOA 4WKYA 1T9TA 2RE1A 3J80O 2FPHX 2ZJPL 4IO9Q 4M63C 4UQTA 4OKJA 2Q97A 1SQFA 5G4DA 1EQYA 2A6MA 2GVZB 3SQGB 1HNZF 2ZJRQ 1RDWX 4ZIWA 2PMWA 4KI4A 4JKDA 2ZBRA 2V9WA 2KN4A 3MAHA 1W0HA 4TQSA 1OSDA 5ETRA 2PI5A 3V6DB 2Q1NA 2HS0A 1TAQA 4FLZA 1J5OB 5BR9A 4WP9A 5IC6B 1I3AA 4EI2A 3CC7N 1CJTA 1P9QC 4OQJA 5M1QA 4B3OB 4JI5F 3GU0A 4TY8A 2YHYA 4HTUA 2R7TA 3JB9k 2K2PA 3IMXA 1HWUA 1RCHA 2DY1A 3I8DA 4M41A 1A6LA 4QWAA 2ZH5A 4N56A 3DRYA 3LOUA 4EYIB 1RP5A 2ROPA 3M1VB 4B1UB 2W4PA 4DG1B 4FK2A 3HULA 1T6DA 2D0OA 2RS8A 4DV3F 4MKVA 3NBPA 2GBZA 4OI0A 1RDDA 2YQ1A 1WI6A 4ZVSB 3THXA 2VPZB 4OYPA 3CM6A 2YWFA 2XY7A 1UW4A 3MR6A 1MLAA 1NH7A 3PO5A 4DV2K 4F0MA 4CO0A 3GE1A 2RD5C 5GIPA 4BG8A 4K4VA 2E9TA 1M5OC 2D9OA 4E89A 5ITHA 2GGPB 4YB1P 2YJFA 4BRPA 1VBXA 1TMMA 4DTUA 1ZYQA 2HNYA 1DT9A 3VF0B 2VA3A 4DZ6A 4M3YA 3GSDA 4TKTA 4PABA 2LP4A 1I94F 1QSYA 4JS5A 2R4FA 2DCLA 2AEMA 1SB6A 2YVSA 4KHMA 3OY9A 3TX8A 5EOYA 3AVHA 4I6WA 3S3OA 4M94A 2VKZG 1ASWA 4HUGA 2O8EA 2XB2D 3CMAN 3GB0A 2CZVC 4NASA 3HFKA 2AYEA 2UVRA 4YDXA 4M7XA 5BXIA 4TN2A 2RPIA 4A8XA 4QS9A 2ZJQQ 3AXKA 2YWKA 1UVMA 4KHWA 4MDBA 3F9MA 2F4FA 3KFWX 2MQMA 3RMBA 4BRDA 1M5KC 2V8PA 1K73T 3GCXP 2GAGC 2JEIA 2Z1GA 3IRXA 2DRAA 1GMWA 4Y3CA 1UA0A 2GGPA 2D0PA 5B7WA 3R6MA 3DU6A 2LDYA 4PWDB 2IRYA 3T69A 4NLCA 4KH0B 1SCJB 2CQDA 4JI3J 4QS8A 3OTCA 1RAAB 4GVBA 2UUTA 4B9SA 2FSNA 3SQ4A 4PKGA 4KBOA 3O3GA 1BY9A 3JTPA 3JTOA 3R97A 1TUYA 1RI7A 4O0JA 2FY8A 3GFHA 3WX8A 5GAEI 1WHWA 4WU3A 4W5NA 1SUQA 4DSKA 4E19A 3VQCA 4QOTA 5KFRA 3FRZA 1MWMA 2EFNA 5KT6A 4NLGA 4CLKA 2W2QP 4DV3K 3DLKA 1N5QA 2GJFA 3ETOA 2XO7A 4OZJA 4QU7A 3KK1B 5HMZA 3QT6A 4Q0BB 1LWCA 1F0XA 2VQFK 4DR6F 2B6AB 3OW2R 2UXBK 1RYRA 3AAPA 5AQIA 3MECB 2YHXA 4DV0K 1N33J 4NRTA 4O3RA 4YP3A 1M5HA 1A7GE 2DNQA 3M2RA 1OS5A 2VGNA 2ZDPA 1X31C 2ZUGA 3N6NA 1LFPA 2E2NA 1EARA 3C66A 4ZVQB 5EGYA 2W9BB 2QZ8A 1WSVA 3IC1A 1SJ4P 1T9UA 1RDRA 4AE5A 1R3NA 2BJDA 2AEJA 3NF9A 3ZT4A 4OJRA 3LPUA 3Q86A 4RWWA 2QV6A 1X4EA 3LDPA 2H5IB 1RADB 4IQXA 3B4MA 5J2NB 3CVKA 3NDKA 1PGZA 2EK6A 1X9WA 4CZEA 4DX8H 3J7Z5 2QA4G 5LMNF 4AILC 1ZTWA 1XMOJ 3NNHA 1ITGA 2RIJA 4NYFA 5ETSA 4ZPTR 1DY3A 5IQQA 2FBVA 2ZFHA 2Y3YA 4OJGA 1M1GA 4CJVA 1GNKA 2B4JA 4FJ7A 3AAQA 4QBUA 3OTOF 3OLBA 5ETOA 1VQMS 2HRTA 4O8UA 2EFPA 1FI4A 2HFZA 2HFVA 4P2SA 4NOHA 2J0SD 4ZJLA 2GWKA 3IP0A 2NSCA 4ECSA 3I56S 3M8QB 3J7YP 4F3OA 4CJLA 2ZQBA 2NXCA 1J27A 1REGX 3G6XA 2AEFA 3T3FA 4CH0S 3JS6A 4LRAA 4U7BA 1B3TA 3TJAA 3QQCD 3T9NA 3BZCA 3LDNA 3TEGA 3VA0A 2BEFA 2A2CA 3FGVA 2VV5A 4J90A 3CCMN 4JRPA 3PACA 4CRJA 2EC2A 3S6EA 3EE9A 3KUGA 3LO3A 3B6OA 3CFRA 3THWB 2V0NA 4CLFA 3A5MC 2GELA 3CPWR 2RVJA 4DQ8A 1U0SA 4L3NA 4KAZA 1WOPA 2GNKA 2ZNYA 4DU8A 1EQ0A 2B9WA 3HI9A 1XNQF 3CCLS 4DZDA 3ZX0A 5F0WA 1NK9A 4CFBA 4JI8K 2QWRA 3PW2A 1CJUB 2IVYA 4C2MA 4DS5A 4M3UA 3VERA 4CFDA 1VGYA 2R7SA 1EETA 4LSLA 3HSGA 4J2DA 2ZH8A 2Z1HA 3G2XA 4HTIA 3Q8YA 2W6KA 1WUUA 2G8HA 4GKKF 1OY9A 3A2FA 3HX9A 3LW5C 5KFNA 4BRQA 4CEBA 2A18A 4A62A 1NMDA 1W9HA 2XMUA 3G4SN 2ZC4A 1U49A 5AQNA 4ANCA 2H65B 2G8UA 2ZZTA 3CD0A 3VZIA 2CQ2A 2MTLA 5IXUA 3CJCA 2XMTA 4WQ4C 1SJQA 5EX3A 4OX8A 2RE2A 3UIQA 3AA3A 3OYLA 2JEGA 3H42A 2Z2MA 3HHKA 4X62J 1J5EF 3MI7X 5DGAA 3VGKA 2KT5A 1XI1A 2QWNA 2W42A 5EY4A 2YX6A 2V2ZA 1LFWA 3IR7B 3ISND 3A3OB 5KPTA 3EN9A 2BOAA 4HDGA 5CD4H 5A8KA 3BSAA 4C6AA 3D4JA 2HHHK 1JXLA 2GMHA 4MQ3A 3MM9A 3KK7A 3C16A 2MQNA 5A6PA 5EUHA 4N77A 4XAKA 4JV2A 1NDPA 4DV7K 1NXIA 3VQ9A 1I39A 4PYAA 2QW9A 2NXNA 3IDHA 4FVCA 2RQMA 5B0DA 3HM8A 5HL7L 1D8YA 4CI0B 3ZZTA 1YJ7A 4CCHA 5HN0A 1I6JA 5CR4A 2HVEA 3DDKA 2VG6B 4I67A 2XSJB 2XLIA 2DKOB 2EG1A 1PYOB 5EWEA 5BRHA 2MEWA 3N5BA 3P8BB 2QLFB 1NM2A 1IBKF 1QAIA 3DLRA 2GX8A 2WSFC 3CPWM 4AHRA 1RA7A 3CULA 3VQEA 4H4MB 4CHNA 1K44A 4M5NA 1NGCA 1VR6A 3S9HA 4I2PB 4K59A 2XS2A 3O9TA 2Z4PA 2Y0SD 2QK9A 3V6DA 4F4YA 1JK9B 2F7VA 1OPZA 2UXBF 2ZM6F 1LWEB 2NXUA 4KGVB 1RISA 4DUYK 2JJ4D 2OZMA 1V3ZA 1ZM3A 3N0VA 5HP1A 2HMIB 1WORA 3G6ES 3L95X 3ICLA 5K8PA 4WU2A 4JI3K 1JLQA 3TP2A 1G99A 3ATVA 3DGPB 5DMRA 1M5VC 3ADAC 4UW2A 5E3PA 4ZJOA 4IQMA 4CLYA 4LQ9A 3ZT2A 3H1VX 2R8JA 1TYQB 1UWBB 4FO0A 3H59A 4CZIA 1KQFB 2JHEA 2CWXA 3BQ1A 3W1YC 3RSEB 3IGNA 3WC0A 3CJ3A 4DR5J 2VICA 3G25A 3TA2A 1S49A 5AQUA 1L3TA 5E3AA 4QWBA 1N34J 4ZPDA 1Z26A 1VQNS 3RMCA 1KD1T 2IRXA 2IMOA 4DXLA 2EKYA 1PBUA 4DS4A 2QYCA 5D4LA 1M5SA 4ZIVA 3SPZA 2AKWB 1V9OA 3CCJN 2O5DA 1GMVA 3LP0B 4BRFA 3W3SA 3GE9A 5MLCV 1JQGA 3K5LA 3S3MA 1OYEA 1WOQA 2VC1A 3NGKA 1S1WB 5A8WB 4JN4A 1YTYA 2XWXA 4JBCA 5CYMB 4LF6F 4JUZA 3TAQA 1HLWA 1BDGA 3ZSXA 4NEYA 2A6OA 4YOYA 2CQGA 5LSOA 3P96A 1QLNA 1YXQA 4LRFA 2CQBA 3HZEA 3A4TA 4ALZA 4FPIA 1VQON 4KQZA 5AFUH 2BJ8A 1FWLA 1KWMA 1S10A 3CJKB 1U1NA 4YMEA 3EO3A 3KHHA 5BRDA 2KXHA 2YV0X 3HSTB 2IM2A 3SPYA 3KLFB 1RTHB 1FKPB 1ZBLA 2W6LA 2E2PA 2OPPA 2DHHA 2Q3SA 1U02A 1RHMB 4E1JA 3ZSWA 3ITHA 1J9AA 4QR0A 2GW8A 3AHPA 1U45A 3VF4A 1YIJN 4K42A 4TXSA 1ESVA 2HRYA 2K7JA 4LREA 3G8SA 2CG8A 3TVKA 1MW7A 3F56A 4DR3F 1FVQA 4CZFA 3IRWP 3T1HJ 3WC2A 2AJ0A 4TNOA 4CFCA 3DI6B 3ZFVA 4YOUA 2YKAA 4USUA 4J9SA 5HK4A 3D0IE 4I68A 4DBQA 1UJ4A 5F8LA 5F3ZA 1V5VA 4E7KA 2Z58B 3N4WA 4UY85 5AQOA 5C5JA 3F5TA 4NE9C 1K8KB 4CJUA 3GTYX 3FCWA 3GV5B 3R5JB 2XHBA 3QFUA 5C2GA 3OVNA 1AW0A 4B8AB 3PTWA 2YKPA 4EFAC 3IXQA 2OPQB 2CPZA 4X2BA 4M3XA 4FWRA 1VHFA 4CZLA 2RQ4A 2GHVC 4Z4IA 4LF8K 5HMYA 2RQKA 4IO1A 3GIJA 1B70B 2J9CA 3AQPA 1SQGA 4N8OA 2V51B 1OYDA 8AT1B 4FF1A 1K47A 4EBDA 1CJVA 3GJSB 1S6QA 4XH4A 2KT3A 3OYGA 4DEZA 3HMJG 1VQ6S 4C8LA 1S6QB 3LA0A 3CPEA 1GLLO 1K1SA 3OYMA 1ULRA 5FPEA 1NMEB 2UUBK 1SKWA 2R7YA 4F4ZA 1WSIA 2IVFB 2X1BA 3U27A 1YJUA 1BHLA 2FC9A 2KYZA 4G6VB 5JMNA 2VF3A 3QNWB 4X4SA 4IG0A 3LF0A 4FZVA 1XQIA 3AVAA 2FJBB 2BQ3A 5I9EB 3Q8QB 4FNHA 3UNGC 1NGEA 2JL9A 2MB0B 2QL9B 5IS2A 1XIQA 1E4GT 3EDQB 3EGWB 1A5WA 1GMUA 2GIQA 3IA0A 1FEEA 1B64A 1D5AA 4UY8O 3PX4A 3MXIA 4UUWA 2YHWA 2Y1RI 3QNNA 1NGFA 3HYFA 1HI0P 4WZQA 4QW9A 5AQYA 3A1YG 2PMZD 2XCAA 4BRGA 3LDLA 3E1YA 3BJYA 1NZAA 1R89A 4KGKA 1RCXB 5JVGQ 5KOWA 3QT8A 3UPFA 4MJKA 3UQSA 2VQEJ 5BREA 2B4UA 1X4BA 1JLAB 2RU9A 4PPZA 2N3OA 2BE2B 6AT1B 3PIPQ 1AFIA 4H5TA 2YH0A 3ENOA 3CEDA 1VQ8S 3LP2B 1W2BR 4J5OA 3BO2A 2XULA 2GTDA 4DV7J 1RWOB 3D45A 1UKUA 3TO8A 4CQ1A 4FS2A 4NXMK 1S97A 3K9KA 3A8YA 3OYEA 1RLDA 3UD3P 1T3VA 1S9GA 1NKCA 3FFIA 4PR6A 4U7UK 4WCEQ 3US5A 1JCFA 1WHXA 4GVBB 2LLZA 1FRIA 2DT9A 1KBRA 5J2QB 4CH7A 1C1BB 1IO2A 2VB6A 2XHCA 3CM5A 2J6TA 2FIUA 1JXBA 1WDTA 1D09B 2VFRA 2PDAA 3DYAB 2H9ZA 1HWKA 3CDUA 4BGBA 2O8DB 4G9ZA 1JLEB 1IKYA 1RTHA 4NXMF 3GJQB 2IAJB 5AQXA 3EXCX 3J7YU 1F5BA 4DL4A 3ULHA 3U1LA 1NPRA 3UKRB 3DRPB 1NM1A 3C65A 2F4VJ 3IBCB 1S99A 1J6ZA 3DC2A 2UXCF 2HGNA 4NLSA 2UUBF 1KHVA 3M8PA 3RW6A 3K8WA 4ILRA 3VQ5A 3MXJA 4RUHA 1ZBUA 3CQYA 1VC0A 4B3TJ 1LXJA 1X4CA 3C16B 3ASMA 2GWJA 3FQLA 3OV7A 3RJMB 3C6AA 3CWJA 4BRIA 3CCVN 4BVOA 2I9SA 3A5OC 4LF4J 5B0EA 1IR1A 1TL5A 5GAHU 2E1RA 1C4CA 5KFBA 3V9XA 2AA4A 3QFHA 3P3DA 5E3CA 1FTCA 2CQ1A 2IBKA 3DOLA 2OHDA 4PKDB 1WBBA 4O3SA 2P9SB 2V8HA 1KNZA 1NK4A 1UWBA 1HKCA 3I55N 3ZXWA 1NJIO 4DV7F 1RT6B 4OI4A 3OUYA 4O4GA 3A3NB 1HJOA 4LR8A 2ZITA 3I9ZA 1CBKA 3IAYA 5AQGA 2K3IA 3VQPA 4PKHA 3MN9A 3EKSA 2B0GA 2RRBA 1WSHA 2ZGYA 2N7YA 3D0GE 3KWMA 3VEWA 1LW2B 1TAUA 2JOQA 4CYUA 1C4AA 2X74A 2BBEA 3L7OA 4WFAQ 3AJDA 4Z4GA 4MAKA 1HQEB 4OI6A 3CJQA 5M2RA 3BZKA 1YG0A 2HGLA 1HBUA 1NLVA 5AQMA 5DDPC 3H08A 1ZTTA 4YHHF 4LC9B 1OIAA 3WQPA 1NGHA 1HBMB 1Q8BA 4B3RK 3K58A 3MPWA 1NMNA 1C1BA 1FA0A 1GEHA 2BA9A 4LFBK 4R79A 1GOCA 2WBMA 1IBMJ 4OO1J 1RAJA 1D9FA 2VDHA 2IM0A 2XYHB 5K14B 3WXMB 1YUWA 3HHLD 4GKKK 5CE3A 2KZMA 2HQCA 4DL0C 4ICLB 1JLQB 2P9LA 2OELA 1U4BA 4FXWA 1OY8A 2QT7A 1S3XA 4IEEA 1SBRA 2GJIA 3CFPA 4CBWA 5M1OA 4QIWD 4LRDA 2B9EA 4LRCA 4Y34A 2MQQA 4Z4HA 1RXOB 3VEZA 1WHYA 4WZMA 3MWBA 4B3MJ 4FYYB 1HW8A 3UDVA 1HR0K 3BKUA 4F4AA 2G2OA 3AVIA 5HRPA 3UKRA 3ZZOA 3HF5A 3IWLA 2J5AA 5KFDA 2D4WA 1R27B 2AD9A 3SQ1A 3V5RA 1OPIA 3AVCA 4GV9A 1IWAA 4CESA 2QSWA 4CLSA 2C2RA 2BTFA 4X4UA 4M42A 4FYVB 2BGGA 4UOHA 3DU5A 4KTZA 2XGPA 2SXLA 4DCPB 5F8JA 3D3CJ 4BRCA 4DR7J 4A8YA 1DGKN 4HVJA 2QA2A 4LFBF 2HYIB 1EHWA 2J7KA 3MK6A 1S7IA 3HSZA 4CO5A 2KVQE 3QLHB 4OPKA 2OMOA 3HRGA 2DGQA 4K5RA 3UCZP 3GR0A 3AB2B 1T05A 3AARA 4NXNJ 1RGVA 3TZXA 4CLLA 1HFEL 1IJJA 1GLCG 1PBAA 1RLCL 5D78A 1QSSA 1DHMA 3EY1A 3OTOJ 1RK8A 1HD0A 3C6UB 3BH7B 1UVIA 2C3MA 2JSXA 1JNRB 2DNGA 1CQMA 1F60B 1C1CB 3BBCA 2HVZA 4CEEA 4H4OA 2HIYA 3HOTA 3OSNA 1N5SA 3MAAB 3PM9A 2R7QA 2OIHA 1JB0C 2E66A 3MMJA 2B5JB 3DM2B 3EWGA 3O3HA 1EKSA 3SQOP 2GIRA 3P4IA 3DRSA 4C48A 1VRTB 2Q66A 2CRLA 3WHIA 3WXKA 2XYPB 1T7PA 3IMQJ 3BB5A 2Z2LA 1H0HB 5KFIA 2D3UA 3LGMA 2H51B 3DNCA 1U04A 4K5SA 1JCEA 3LP3A 2RNEA 3MDFA 3WIUA 2ZOMA 3RBZA 2FD2A 1I3OB 5K5MA 2E88A 1I1GA 2P9UB 4YHHK 3TVYA 2F8TA 4K4TA 1KVBA 2CG4A 5AXNA 4OHWA 4V19X 4CVNE 4LSZB 4JI1K 1LWFA 1NK5A 2F9TA 2KJWA 1WHVA 1EIYB 3M1FA 1P8ZA 3NMAA 1HRHA 4JHDB 2I7NA 1XBWA 4KHQA 3VQ4A 4ZVEA 2GIFA 4FJLA 3BPSP 3HVAA 3MD3A 4UUXA 3RBXA 5BR8J 3LPEA 2QTWA 1WN7A 2XNRA 4Q2LA 5HO4A 1M0SA 4I7FB 2PGCA 4RUBA 2FLPA 3T5KA 1N36J 4U6PA 2D41A 2CQ0A 2AWZA 2UXDJ 5HL7Q 2DR9A 2VQEF 1YVUA 4LQ3A 4JYAF 2YY3A 5HRSA 2D3ZA 3A5NC 2QFJA 3MM7B 2EXUA 4M1KA 1GOBA 4I2QA 2E1MC 2WC9A 2C22A 4P74A 5E0OA 2M70A 1GMWD 1QTNB 1X4GA 4K4YA 4ILMA 2HBMA 3DAWA 4MLEA 4NLTA 5DETA 1S0OA 3BGLA 2AJ1A 4ECWA 3QEIA 4IOCL 4DPYA 4DSJA 1YRXA 3VHQA 5ADZA 1WC0A 3THPA 2W2MP 2ATQA 3SSSA 5KFQA 4IOCQ 4DCHA 5C42A 4FWPA 2UXCK 3D2EA 2AP6A 2CPHA 3S01A 1TUWA 2VPWB 4OLAA 5F8GA 4AQYK 4ZPVR 3OBYA 2PAVA 3B82A 1ZBTA 1RT2B 2LMIA 4FW1A 1SJ3P 5HATA 5ADXH 3L8BA 3L2VA 2HNZA 2QIFA 5EXWA 3DM2A 2YKQA 3GIKA 1RSCA 3U9ZA 2E7XA 1UJ6A 1TTHB 1YTAA 1I94K 1PAUB 1NK0A 2UYTA 3AA2A 1TV6B 2O1PA 3AO4A 3BGOP 3JQJA 2HG4A 3HPOA 1VK3A 3TUZC 1VQ9S 1FEHA 2HLTA 3CJ5A 3V1OA 2YXLA 3WNGA 1R6YA 1ZPVA 2C1EB 3O1BA 2EI5A 3EZOA 2AT1B 4XTTA 3D54A 1B4SA 4ZOSA 2UVVA 5IT4A 2NRXA 1RWPB 5IM0A 1KSPA 5IV4A 3MUMP 3G8QA 3I9V9 5F9NA 4L3QA 3BYPA 2VH7A 3OQ2A 4DHYA 2DNYA 4HKQA 2RF2B 2R8HA 4EHTA 3DLLQ 4BR0A 1TKTB 3AAWB 4YDUC 5HSPA 3QYYA 5L1IA 4J8FA 2OCEA 2ZHAA 1T3OA 3QDKA 2BQRA 2A1SA 4E8UA 3GIIA 5KGXA 4QW8A 4QWDA 4JI0J 3QRPA 4DMZA 4DR1K 1NDCA 2MZRA 3BKTA 3BY5A 5CYQB 2BYCA 1DQ8A 1ZXOA 1CJTB 4FJNA 2K06A 3CCUN 1D1UA 3SBTA 4O4RA 5A2QO 3I0SA 2KI2A 2F4VK 2D3O1 5K14A 5ETPA 1VSJA 5B0AA 3E51A 1CLQA 2NS1B 3GL1A 4GMJB 1WSJA 4W5OA 4U7UD 2CPYA 4DTNA 3GBTA 2GVDB 4CF0A 4LFCF 1WOOA 1JJCB 3BP8A 1NH8A 3DCAA 2E5LK 1UP1A 3T1YF 2F8SA 1TYQA 4HHTA 3P5BP 1TKXB 4U7CA 3LANA 1WBDA 5KT4A 1UEVA 4LJMA 4B9MA 4KH4A 1HBNA 4EK2A 1SJ1A 3SMSA 3R5GA 1D4XA 3OXGA 4USWA 2DPIA 2FYXA 2IC3B 3SUOA 4IG3A 1VQ7S 2KYXA 4JRQA 4TY8B 4HUFA 1EX4A 5AR0A 4C8ZA 1BQMA 3H5XA 1JL1A 1XMBA 1Z6RA 4DSLA 1F3FA 4USMA 2LQ5A 2NNWA 1Y3JA 3HT0A 4RWTA 1QQOA 3MM5A 7FD1A 1WD6A 4UY8T 5D4OA 4ECRA 4CIFA 3KLIA 1HHTP 4H4KC 2UU9F 2H5EA 4JB8B 4CO3A 1C6VA 4K4UA 3HKWA 1UVJA 2Q2RA 1O8BA 1JLEA 4BLGA 4DG1A 1W2IA 4LFBJ 2PMHA 3CO0P 4GV3A 3LUYA 3NOCA 2FJVA 3GV8B 4LR7A 1AZSA 3MN5A 2ZH6A 2P9NB 2OPSB 3DLEB 3R7NB 3LP1A 1FHTA 3K9JA 2E7WA 3U4LA 3HD2A 3TTDA 1IKWB 4LF9J 3VZHA 4P75A 3QEXA 3KTQA 2WAQD 4X4VA 3TQ1A 2DRDA 2PFDA 1Z2ZA 2NCKL 4C4WA 2WHOA 1E4FT 2PYJA 3VPZA 5M1FA 1WJ9A 3M5RA 2YCHA 3IM9A 5L8RC 2YNIB 3ZT1A 4B9LA 2OPRA 2M9KA 3VOVA 3ENWA 4KO0B 1O5JA 3OTDA 1RE1B 2IA6A 3BUZB 2DNPA 4DR6J 2ROEA 2MKIA 1Q81O 4DPUA 5ETTA 4UQGA 4EP5A 4DV5J 1PSDA 3GV7B 3W2VB 2R2TA 3OFEA 1RHRB 3GFXA 3ZETA 4WTOB 1WC4A 3M8WA 1NHKL 2HS4A 4H0YB 4CJ5A 1NOYA 4FXVA 1N34K 4Q45A 4K7QA 3MUVP 4UZBA 2HHSA 3KUEA 4E1MA 3QSIA 2N4DA 1A9NB 3LZIA 5G0RA 4FWNA 2QGFB 3KIOA 4CDIA 1VRUB 4B3TK 3TSUA 3VN5A 1S9EB 5KFYA 1RU2A 1FO1A 1UTAA 2OEJA 2KKZA 1YF5L 1HNWF 4ZCMA 1MSWD 3NWGA 3ZEUA 2EHGA 5HQLA 3UDLA 4X84A 3HVTA 5AQWA 2FZKB 2E1ZA 5I3UA 4KKOB 2IM1A 4JAXA 9ATCB 1YHQN 3N5FA 1TKZB 2EWHA 4MFBB 2M7SA 3DXBA 2FGOA 2IDOA 2P9KB 2V69A 2QKKA 1JJ2R 1O6XA 3BH6B 4V1Ak 4B1XB 1EWQA 4KPCA 4C3MA 2OTLS 3K17A 3FMBA 1AXQA 3VF6A 2KT2A 4ED0A 4J9OA 2O8BB 2W40A 4ZVPB 4OJ1A 1MN9A 3WX4A 2VHGA 2DNLA 4JI6K 3DLGB 1S7HA 3FZ2A 4RU2A 1WF0A 3J81U 2GQQA 2KDOA 3I82A 4DV1F 2VOPA 2CVEA 2HB5A 3A0IX 2EEYA 4CBUA 4DTOA 1CJVB 3NNCA 2LECA 2QN6B 3CQXA 4AHCA 2DNKA 5ETNA 1RA6A 3EVMA 2J0WA 2CJ9A 2VFVA 2GEMA 3Q8VA 4NLRA 4DWIA 3CXCM 2VOOA 2L3MA 3QJJA 3RUBL 1VQ5N 2MJNA 2OA8A 2ZWHA 5CA5A 2R42A 3RR8A 3EJMA 3VQ7A 4KJIA 3X3UA 1K0VA 2FLOA 5HJXA 2PFFB 1ZA2B 4O8KA 1RTZA 3O8MA 3E2EA 5DGBA 4CYUB 4KPYA 3JAMY 4C1NK 3H7HB 3P6YC 2XRIA 3AVNA 3I56N 2E9RX 3L3VA 5IQ6A 3TUIC 4OMFG 1HNIA 2C2KB 2QKBA 1DTTB 4HVZA 2OMLA 1ZM4A 4OJHA 1NJZA 3FEXB 3DRRA 4H5NA 2EC0A 3VQTA 3C7NA 5D0HA 2WCXA 2RHQB 1JNZB 4E98A 2AF6A 4AM6A 4J91A 1LCUA 1NBWA 5FPMA 1VFJA 1KC8T 3PNIA 2HFNA 3CMAS 1B92A 3KK3A 2XMMA 1AUSL 4F04B 1N0VC 4CK3A 2R8IA 5KG5A 2Y8YA 4S0MA 2HF4A 2OEKA 1QD1A 4WF9L 1SAZA 4YNQA 1E6YA 5SZTA 4F2SA 1XR5A 3KHGA 2HURA 5CZVA 3J8AA 5KFEA 2VZ9A 5AZJA 4EMDA 5D4PA 1CZAN 1CQNA 4EIAA 3M8PB 1VQLS 5CQGA 4AT1B 2FVRA 3UVJB 1Y0HA 4DPTA 4OJ3A 2YKMB 1FXRA 2I5JB 4N47A 4ZLLA 1IKWA 3N01A 3MM8B 4NLBA 1T11A 3JS9A 4GKJF 1UJ5A 4DPXA 5I3QA 2C2NA 4JI4F 2YNHA 2WZ1A 1VAZA 2LU1A 4KE5A 5E5NA 4BROA 4M5MA 1QUPA 3QJLA 3D0PA 2AU0A 1V5IB 2XM3A 2MY8A 3R3TA 5T7LB 2KRRA 1OQ6A 4KRWA 5FJ4A 3VALA 2DNOA 2OGUA 3HKZD 1EXQA 4CGIA 3A13A 1XK8A 2PEHA 2BE9B 4M3RA 4C8YA 4MH8A 2ZBPA 4IR9A 4ZN3A 5A8WA 4ID8A 1X5PA 4JD2B 3FC9A 3SSQA 1HL6A 3C14A 3PRVA 5LMUF 4FP9A 1K1QA 3OJSA 5KFHA 2HZCA 3MEDA 5GAHI 4U96A 4B3RF 2B51A 3N9UC 1U24A 3CJRA 1R8BA 1VSFA 1HBNB 4QIEA 4WFYA 2R8KA 4JI3F 4LFCK 4AD6A 1GH8A 4J9LA 3OYDA 4F26A 4JV5F 3SK3A 5IC4B 2NRWA 1CEZA 3HHEA 1G2EA 1TKTA 4RW8B 1QTMA 1L3UA 3OVBA 5MAOA 2YX7A 4ZVTB 3KK3B 3LWLA 5AQKA 4BHQA 1XHZA 1UAWA 2LKZA 4WFXA 4H54A 4DUZK 1S76D 2YKMA 4JI7F 4DQPA 1U8SA 3KKFA 2VYPA 1SC4B 2ZH1A 1ZH5A 1JXEA 2BZ2A 1KFSA 5HVHA 1X9JA 2JC1A 2BJ1A 5C42B 3ZSYA 2Z0GA 1QVGM 3PYEA 2YQ3A 5FIIA 1S1XB 1WC5A 5KFSA 3CW2C 1NUEA 2HQIA 1U8WA 2DEJA 4EAHD 2B8PA 1RTIA 1VRQC 4IFYA 2PA8D 3V6HA 4F3MA 5ADXA 5H9EK 4OYIA 5BYQA 2JLFA 2FLNA 2HHHJ 2QMXA 2PI4A 2A10A 3DYAA 2YBVA 1Y5IB 3SMPA 4M5HA 5LOQA 2LQBA 3SDEA 4C0HA 2BOPA 1UMJA 4LR9A 3DXMA 1SPBP 1YRTA 5EWFA 4DHVA 1K0TA 3ATUA 4NYNA 5KG4A 4JKCA 3AT1B 4H4MA 3AVFA 2CXEA 2LQ9A 1H38A 2V2KA 1R6VA 4AHVA 2JWLA 2FLLA 2QFIA 3FFKB 1X0PA 3CIMA 4DV0F 5BPMA 1JLBA 2XTJP 3DHWC 4JI4K 1RWNB 1XNQK 2POKA 1P9YA 1UETA 2BANB 1JIHA 2AMCB 3D0HE 1K9MT 3PKMA 4NXNF 2O8BA 4B3OA 1RACB 1VQNN 1C0GA 2YNFB 3M6UA 1Z25A 3DXSX 3TAMA 4CK1A 2AJ4A 1S77D 4ZTFA 3I0RA 1QZ6A 2D1CA 4R8UA 2WSCC 5KG0A 4WQ4A 3V81B 2Z8QA 4I0WA 3FBEA 4M5GA 3UCUP 4QWCA 4DUYJ 2GA7A 3V4MA 4ZLPA 4GY2B 2LXUA 3UKUA 2XMKA 3VEOA 3MEEA 2N3LA 5I3PA 2A41A 3FMWA 5BYSA 3C8YA 3OJUA 2W8KA 1DRZA 3QEVA 1U1PA 1WAFA 1UWAA 1RBTA 3EZUA 4NB4A 3J81O 2ZD1B 2VUGA 4ZVOB 3NGDA 1ZBHA 4M5DA 1HR0F 1S79A 3BO4A 1ZAVA 3HHLA 4NPOA 1U6FA 4IYQA 2F9DA 1GTEA 3EZ5A 3TAEA 1S57A 4C3KA 2W9CA 5E3QA 2MQOA 2R9LA 4C9DA 1K8KA 2F8HA 3VAFA 4LF1A 1FWPA 3MR2A 2DR6A 4I56A 4A57A 3W8PA 4DV5F 3H46O 3GMGA 3CHWA 3R5DA 4PXDA 4JI5K 5GADI 1U48A 4CEDA 4DN9A 1TL1A 4ZHRA 4I2QB 2VG7B 2ZM6J 1D0EA 4FJGA 1U1MA 3W9HA 5CYMA 2E5GA 3PJXA 4RX6A 3SAHA 5IWAK 3IO1A 2OJ3A 3T1YJ 2HRUA 1NU0A 4FWMA 1CS4B 4RJVA 1CPZA 2CH6A 3ID6A 4GRSA 2KG0A 3CDBA 4I4BA 1RTDA 3M6VA 1VMBA 3OD2A 3AO3A 3AXMA 1Z1ZA 3R1HA 5DZ7A 2GX9A 4DUZF 5TKWA 4CTAA 4FJHA 1TL7A 3AVJA