1UWBA

Tyr 181 cys hiv-1 rt/8-cl tibo
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
558
structure length
558
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE
molecule tags Aspartyl protease
source organism Human immunodeficiency virus 1
publication title Crystal structures of 8-Cl and 9-Cl TIBO complexed with wild-type HIV-1 RT and 8-Cl TIBO complexed with the Tyr181Cys HIV-1 RT drug-resistant mutant.
pubmed doi rcsb
total genus 131
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1uwbA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1uwbA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1uwbA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1uwbA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1uwbA05
3LP1A 1HMVA 1S9FA 4ELTA 1HMVB 3HJFA 2FBXA 1N48A 5J2MB 3HVAA 2E6MA 5HBMA 3M8PA 4ZVGA 1L5UA 1T3NA 4B3OA 1S1WB 1NJYA 3PJXA 4FJIA 2D0BA 2PZSA 5EWFA 4NYFA 1NHVA 1D5AA 4Z4GA 1HNIA 2Z1IA 2R8IA 4DG1A 1JLBB 5C42B 2KZZA 5KFRA 1JKHB 3CDWA 5L1JA 4M3RA 3NGZA 1LAVA 3BSCA 2R8GA 2A1SA 2RN2A 3V6DB 4CFCA 3LWMA 3LAMA 2IJNA 4K4TA 3AVCA 3AVAA 3C6TB 1S1VB 2IGIA 3I0RA 3BQ1A 1WSHA 4DLGA 3HHKA 2IM2A 4IFVA 3JSMB 4HTUA 1TV6B 3SQ1A 1NHUA 4M45A 1C1BA 2W7OA 2ASDA 4BDYA 3S3MA 3NH2A 2HHWA 4LH5A 4FBUA 1ZBHA 1C0TA 3S9HA 5FRNA 3VQ5A 3DLGB 4NCBA 1IM4A 1TK5A 3DM2A 2IM3A 4GC7A 2V9WA 1N4LA 2ZKUA 3M8SA 1KVBA 4PA1A 4RZRA 3OYFA 2OYQA 4FLTA 1TVRA 5KFTA 2HNDB 4U6PA 5HRPA 4K4UA 4ZPCA 4KO0B 4Y3CA 4W5OA 4DSEA 1NNDA 1RA6A 2XCPA 4NCGA 4IFYB 1RDDA 4TY9A 3NF8A 2W9CB 4I9LA 2YKMB 4LSNB 4F50A 1S5JA 2R8JA 3SCXA 1HYZA 4DL7A 3TVKA 1VSEA 3SUOA 4B9VA 5F9LA 1S9EB 4J2AA 3FQKA 3TAEA 1IH7A 3K5MA 4PY5A 3V9SA 4TY8B 1S97A 2ZE2B 3GV8B 3NH1A 4NLQA 1U48A 1RT1A 2W9AA 4RW8B 3K57A 2RKIA 4NLXA 2OZMA 1QSLA 2G8FA 4CIGA 3I8DA 1W25A 4C8LA 4WYLA 3H5YA 5CYQA 1CZBA 4DFJA 5D3GB 2VWKA 5D3GA 1KCFA 1JLBA 5C42A 2OPQB 2VG6A 1TP7A 5KFVA 3ULDA 4CFAA 1RA7A 2UUWA 4Q5VA 3NCIA 5KFBA 2EC0A 4ZVHA 4DTOA 2A1RA 3LP0B 5L1LA 2R2TA 1WAFA 1S1UB 3RBEA 1TKXA 1X9SA 1SH3A 1MMLA 1JIHA 4KHUA 1QAIA 4NLGA 1SKSA 2XY7A 3HXMA 1MU2B 3IS9A 4B3OB 3MAQA 1S4FA 4MIAA 4DTJA 2EX3A 4MKAA 1G15A 3RMBA 5KFEA 5KFZA 1JL2A 3DM2B 3HT3A 2D0CA 2HNYA 3PHEA 1RT3A 3DLGA 5KFGA 2G8VA 3DOLB 1RBTA 4K4SA 3DOLA 4FJKA 3ICLA 4IRDA 4HCBA 1JKHA 3H5XA 4J9MA 4M3ZA 3N6MA 4J9QA 1I3AA 4CHPA 1KFSA 3LP2B 1VSLA 1Z4UA 2XO7A 3ZT4A 4DQSA 4IFVB 3LZIA 4IG3B 2XC9A 1HNVB 1VK0A 2QKBA 1WSGA 5KFMA 2E9TA 4K8XA 4RW7A 1NKBA 4LSNA 2B5JB 4CIEA 4J9RA 1HPZB 5KT4A 3SI6A 4M3TA 2HHQA 3TQ1A 1RYSA 1RBRA 4ID5A 4DTNA 4KKOA 3KLVA 4PQUB 3D45A 1T94A 5HP1A 4U7CA 4QAGA 1S0MA 5HP1B 4AHRA 4KI4A 2HNZA 1SH0A 2Q3SA 5DQGA 4DSFA 3I5BA 3RRHA 2I5JA 1YVUA 4Q44A 3T5JA 1NK6A 4NLPA 3RMAA 3ITHB 4JV2A 2AX1A 3SPZA 4ED3A 2BE2B 2PYLA 3ZSYA 3G86A 1RTIB 4KO0A 1S6QA 1L3UA 4O0JA 3OLBA 1UWBA 2BRKA 3V6JA 1TKZA 2F8EX 1S1TA 1RDBA 2RDJA 1S1XA 2C2DA 2HAIA 4G3IA 3V6HA 2J6SA 5FDLA 3AV9A 1BCMA 4DF4A 1S9EA 5DG8A 4FS1A 3NMAA 4ECTA 3Q8PB 1UAXA 3C95A 4DTUA 5KG6A 4H8KA 3QESA 1IKYA 2HHVA 4XIUA 4NRTA 1W9HA 4ID1A 3KLHB 3SV3A 1XR7A 2KFZA 3C94A 4Q8EA 3CM5A 4RW4B 1JLQA 3PX4A 4IG0A 4RU9A 4ED8A 4W5RA 4CF8A 3ZSQA 2B4JA 3O3FA 4DFPA 4Y1CA 3V4IA 4Z4FA 1RTJA 4G1QA 2JEIA 5J1EA 4URSA 2V4RA 4E1NA 1RYRA 4C8MA 5T7BA 4O4GA 5KFUA 3VA3A 1S1UA 4KREA 1B9DA 3MEGB 3IN5A 1TKTB 2DPJA 3IAYA 4KHNA 2VWJA 3V81B 2QK9A 3ASMA 3V9XA 3B6PA 2E9RX 3KHRA 4Y2CA 3JYTA 1GX5A 3MF5A 4NCAA 1RT2B 2JEJA 3M9MB 1NJZA 4DLEA 5KFXA 3IGVA 5HBMB 3HPOA 1L3TA 4LSLA 3K5LA 1U49A 3UIQA 2HNYB 2EHGA 3KLGB 2IC3A 2CKWA 4Z4HA 4KFBB 2Y1JA 2GC8A 4ZPDA 3HVWA 4ZVEA 5F8HA 1Q9XA 3SUPA 4DG1B 3DLKA 4YFUA 1LWFB 3ZSVA 1XR5A 1IKWA 3IG1B 2YNGA 4CK1A 4J9PA 5HROB 3OS0A 1QSSA 1NK7A 3PW2A 1KVCA 2PYJA 4B9NA 3SPYA 3OYCA 3FQLA 3L3UA 4HUFA 3M9OB 4RW7B 3EZUA 4FLUA 3PZPA 3MEDB 4EP4A 1DLOA 4KRFA 1S0OA 4KB0A 2YHAA 1EETB 3RR7A 4ECZA 1TV6A 1VRTA 2F96A 4DL2A 2BDPA 4DSKA 4BACA 2X78A 4RNHA 3PV8A 3IRXA 1JLGA 4CJRA 3KTQA 2VG7B 1IKVA 4PWDA 2ASLA 3LP1B 4ID5B 3NF9A 3OHBA 3VQQA 4NLTA 3AO5A 3HP6A 3H98A 4DFMA 1FK9A 5I42A 2ZE2A 4KB7A 3V9WA 4WFXA 1RT5B 5KTQA 4DQPA 1JXEA 4RW4A 2C2EA 4KB1A 4RW8A 4FLYA 4BE2A 1RTDB 3AVIA 4CF9A 5JS2A 3NL0A 1LWEA 4WZMA 1NKEA 4CJQA 1NOYA 3OYIA 4CJVA 2ATQA 3C6UA 4EP5A 2YNIA 1LW0A 5CYQB 3NF7A 3CDUA 4QPXA 4O4GB 2AWZA 5DG9A 5T14A 2OPQA 2VG6B 1YVFA 4EYHB 3UPFA 1HRHA 3H4BA 3MEGA 1JLEB 4DL5A 1K1QA 3THVA 2G8HA 4I2PB 3GQCA 3RAXA 5SZTA 2AJQA 1MU2A 1ZBUA 2LSNA 4I2QA 2WTFA 1FKPB 3AVLA 4FJ9A 1C6VA 4Q8FA 3DRPA 4QW8A 4IKFA 1XWLA 5E41A 2DTUA 3A2FA 4EBCA 1HQEA 4OPKA 2VA3A 4QW9A 4RW9B 3LZJA 1NK0A 4RNMA 2E4LA 3TI0A 1KLNA 4ICLA 4CGFA 4B9MA 3DRRB 4EZ9A 1IKWB 3OSPA 4RUAA 4YMEA 4Z0UA 3AVJA 4ECYA 3DLKB 2DFHA 2IOCA 1X9WA 1GOBA 4Q0BA 4NCGB 4FLZA 5JXSA 3QLHA 5J2PB 4BE0A 2DPIA 4RG8A 4E3SA 4CGIA 1J9AA 3SQ0A 3PW5A 5C25A 3CJ5A 1TKTA 1FKOB 3SI8A 2XY8A 5KFKA 2KFNA 3QINA 3AVHA 1JXLA 2BQUA 3TR8A 3WNHA 2VG5B 1T03B 3V1RA 1CZ9A 2XCAA 4OGEA 1JLFA 4TY8A 4MQ3A 4M42A 4ECWA 1JLCA 3VQ4A 3QGIA 4DEZA 1SV5B 3EPIA 4OL8A 3M8QA 4YQWA 2W9BA 1RAJA 1QUVA 2HWIA 3DMJA 3QEVA 5KFNA 3G10A 4EYIB 4ZMMA 4E89A 3KLIB 4CEDA 5F8NA 4ELUA 1VSFA 2HNDA 3CIZA 1TGOA 4CFDA 4NLVA 1QS4A 4FK4A 1NOZA 5C24A 3BQ2A 4ELVA 3FFIA 3CQ8A 4AHVA 2XHBA 2BANA 1KLMB 1K1SA 3QIDA 1TKZB 2XGPA 3PW7A 3TABA 4FZXC 1EP4B 1R0AB 5L1IA 1VSMA 1LW0B 1RTHB 1UWBB 1ITGA 2RDIA 1LWCB 4QCLA 3LP0A 3MTKA 1NK5A 2G8WA 3CJ0A 3BQ0A 5EUHA 1YTAA 2UVUA 4MFBA 1JLAA 1XR6A 5HRRA 1Z26A 4CF2A 1X9MA 2HHXA 4C8KA 4CE9A 3RB0A 1DTTB 3LALA 1J53A 3EPGA 3CJ2A 4Y1DA 1DTTA 2ILYA 3NAEA 3QZ8A 4AHSA 2UVWA 2D7SA 3KHHA 2FVRA 1KHVA 1SH2A 4NLDA 1OS5A 4E0DA 1K6YA 1HQEB 1RTDA 3WNFA 4DU3A 1TK0A 2R8HA 1WLJA 1XI1A 4B08A 4N5SA 1VSIA 4E7KA 4CHOA 5KG7A 3C6UB 3VQ9A 3VA0A 4WE1A 4CJ4A 1SKWA 1QTMA 2HVIA 3RR8A 3MECB 2FLLA 4DTXA 3DLBA 3DLEA 3V1OA 4I2PA 3OYMA 4OKEA 2ZD1B 3PW0A 4BWJA 1SUQB 3WNGA 4CJUA 3T5HA 3MXJA 4AHTA 1JLEA 3D0PA 3RBDA 4CEFA 4FJMA 2XGQA 4HYKA 3OYAA 4O3RA 4KV8A 5DLGA 4ECSA 3UR0A 3HVTA 4IDKB 3OYKA 2VG5A 1HYSA 4CJSA 2WOMA 3HYFA 5L1KA 4AHUA 2ILZA 3NGDA 2CJQA 1N5YB 4TSXA 3OJUA 1C0UA 1HARA 3ISNC 4Z4EA 2KW4A 5KFWA 1T05B 1C0UB 3VQ8A 3QEPA 4LQ3A 1LV5A 5DG7A 4WFYA 4O0IA 1QE1B 3HPGA 1B9FA 1T8EA 3U3YA 2JGUA 4F8RA 2WB4A 1RTIA 5KFFA 2YV0X 3H2LA 5KFLA 2AQ4A 3RWUA 4DL3A 3V6DA 5DGAA 4ZPAA 3HM9A 3NBPA 3L8BA 3JSMA 1VSHA 4CHQA 4XPCA 4YR2A 2J6TA 1S1XB 3H5SA 1HNVA 3KHGA 3OS2A 5KG0A 3QNNA 4C8OA 5K14B 4X2BA 3NAIA 1TL3B 2GBZA 4JUZA 1T03A 4H54A 2OPPB 3IRXB 4DTSA 3ZSWA 5KG1A 2QV6A 2IM1A 3L2QA 1KTQA 4J9NA 5I3UA 2I5JB 4TLRA 1C0MA 5KI6A 3KK3A 3MR5A 3O3HA 5DLFA 2AGOA 1S10A 4CK3A 5KRTA 3ZSOA 3OSNA 3VQAA 5KFPA 1U45A 1J5OA 1SKRA 4F4YA 3B6OA 1F21A 2YNFB 3LP3A 1C1CA 4I9QA 2HMIA 3IG1A 5CYMA 2Z1HA 5KFHA 3GILA 4EBEA 3SYZA 4NLWA 4O3OA 3G6VA 4CEBA 3TAMA 1EP4A 1R0AA 3KD1E 3GIIA 2AU0A 3ZSRA 3O3GA 4DQRA 1YTUA 3PY8A 3SFGA 4E1MA 2HHTA 1WSFA 3LPUA 3ZT3A 4BDPA 3SV4A 4K50A 3HPHA 2HWHA 2W8KA 2FVPA 4FJ7A 4ECXA 4I2QB 4FS2A 4HKQA 3TAGA 2DFEA 3TAQA 1QSYA 2RF2A 4F4KA 4FJ8A 4CEAA 1ZTTA 3DRSB 5SWMA 3KLEB 2W7PA 5KFOA 2HVHA 5I42B 2WK4A 3VQ6A 4UQGA 3OYJA 4MK7A 2O4IA 1VRUB 3L2UA 4J9OA 4DTMA 4BE1A 3QO9B 4DMNA 2FBYA 4FM1A 3I0SA 2XY6A 5KFIA 4DTRA 3V9ZA 3QEWA 5F8LA 1ZTWA 4RNNA 2DFFA 1NK8A 3OY9A 4CESA 2YNGB 3DLEB 4ICLB 2ITGA 3DI6A 3I5CA 4GW6A 5KG4A 4W5QA 3QLHB 4DTPA 5EU7A 1A5WA 4ED0A 4JV0A 1XC9A 3E51A 1RDRA 1IO2A 4MIBA 2ZD1A 4YR0A 2FVSA 2D3ZA 3C6TA 1HPZA 2IJFA 3DDKA 3UQSA 4WYWA 1RT2A 4B9UA 1C1AA 2V0NA 2GV9A 1VSDA 1TL1B 1ZBLA 4ZP8A 2VG7A 4PWDB 3SUNA 1RT4B 1LW2A 1SV5A 1TL3A 3MFHA 4HCCA 4JRQA 2OPRA 3BGRA 5HLFB 2C28A 1C0TB 1D9DA 3KHLA 3CFOA 1FXXA 3KK3B 1BQMB 4E19A 3TANA 4DFKA 4KPYA 4ED7A 4H4OA 4IH6A 1TKDA 2WCXA 1SL0A 5I3UB 4TYAA 3CM6A 3QIPA 3KLIA 1N6QA 5CZ1A 4URGA 4F2RA 3RAQA 1KVAA 2FJWA 3T3FA 4GVMA 1ASWA 1KRPA 3N6LA 4URQU 1KLMA 3GV5B 4FJNA 4J9LA 3KNAA 4TQSA 5J2QA 3DLRA 3HKWA 4L8RB 1B92A 4DF8A 3OL7A 3L2WA 1RTHA 1RCHA 4BWMA 3KJVB 4PQUA 3KMSA 2HW3A 4KTWA 4N56A 4KAZA 2ASJA 3AVGA 2FVCA 2UVVA 4ZP7A 2GUIA 4W5TA 3OYGA 1S9GB 3SZ2A 2G8IA 2W42A 4KHRA 3TWHA 4R5PB 3CFRA 4LQ9A 2O4GA 4E7JA 4B9LA 4EZ6A 3NAHA 5KG3A 3SNNA 3V6KA 1S49A 4DSJA 2HHSA 3K59A 4M41A 3VN5A 2ATLA 2FC0A 1NJWA 4CGGA 2RKIB 2BQRA 3NF6A 5KT7A 2J6UA 2XI3A 1BISA 5KFJA 2BANB 4IR9A 4FJ5A 1S1TB 3KKRA 4CF1A 4KTZA 2BGGA 4EO6A 3V4IB 3CYMA 2BRLA 4J2BA 3SQ4A 4KHYA 3CO9A 5KFQA 2JLEA 4FW2A 4WE1B 3OHAA 4GMJB 1SUQA 3HVRA 4O3NA 4CERA 2JC0A 4ECRA 3HP9A 3VQEA 4DU4A 2R2UA 3MR6A 4CEEA 5HRNA 4CJ3A 3DRSA 4E7HA 4F4ZA 2GIRA 4O3QA 4CJ5A 4IH5A 1YT3A 4FYDA 4M95A 3UDLA 2E6LA 3KKSA 3SQ2A 3GIJA 4OLAA 3O4QA 1JLCB 4DWIA 4KI6A 1S48A 2D0AA 4G1QB 3ZSZA 3HO1A 4MKBA 4B8CA 4CEOA 4IOBA 1HNIB 3F9KA 5F8MA 1REVB 4CEQA 3V1QA 1J54A 2O5DA 2FVQA 1EXQA 1JL1A 5J2PA 3LANA 4EBDA 1RBVA 5DMRA 4NLRA 4BDZA 3VQBA 3NGIA 3KOAA 1N56A 2IDOA 4ED6A 4OKJA 4M94A 3BSAA 1S1VA 3ZT1A 3RRGA 1HJRA 1D0EA 1VRTB 1WAJA 1TAUA 4ZVFA 5KG2A 3CG7A 1KSPA 2OPPA 3T1AA 3LPTA 3RMDA 3RB4A 5F8GA 3OYDA 4LH4A 1C2PA 4LSLB 5KT6A 3Q8QB 1N5YA 3PO5A 4E7IA 1CXQA 3QZ7A 4H4OB 4DU1A 1A5VA 5FRMA 2IC3B 1D1UA 1GOAA 2FLNA 4CEZA 1BQMA 1LWFA 3G6XA 1TQLA 3ZT0A 1D8YA 4HVJA 2BE2A 2YNFA 4TN2A 3NGYA 4CK2A 1DTQA 3QEIA 4Z4CA 5HROA 4FJLA 4Z4IA 3PR4A 4F3OA 4ZHRB 1U09A 4WXWA 4IRKA 2OZSA 1LWCA 3FRZA 3Q8SB 1WNSA 3KK1A 5DGBA 1TAQA 4CHNA 1BI4A 4RNOA 1DLOB 1RT7A 2JEFA 4QWCA 1IKXB 3PX6A 5K14A 4QWDA 4RW6B 3KJVA 4WZQA 2FJXA 2G8UA 4KV8B 2ETJA 4XO0A 3ZSXA 2FBTA 2YHBA 2KQ2A 4CJWA 4KHSA 2VA2A 2AGQA 1FK9B 4CJEA 1WNEA 1JLQB 4CHZA 2V4QA 4FCYA 4IRCA 2B6AB 3IS9B 3MEEA 3QO9A 4WXOA 3H59A 3QIOA 2R7YA 4MK8A 3V9UA 1T05A 3AO2A 2Y1IA 1S6PB 1S1WA 4Q45A 3GIKA 2P5GA 3CFPA 3DOKB 3D5MA 4QOZB 3K5OA 1QE1A 4NYZA 4HUEA 3I0SB 2B43A 2Z1JA 4K8ZA 1NJXA 3TARA 5KGXA 4J2EA 1HYVA 1X1PA 3K2PA 3AO4A 1RTJB 4HUGA 5KFDA 3ZCMA 4ED2A 1UOCA 2GIQA 1U4BA 3G6YA 4KTQA 3MECA 4K4VA 4DS5A 3T19A 5C25B 3H4DA 3LP2A 3MXMA 3HVTB 1HQUB 4R8UA 1FKPA 3DYAA 3MFIA 4OJRA 5EDWA 3AVKA 4IDKA 2F8SA 2WONA 4JRPA 3PO4A 4B9TA 4PUOA 2P1JA 1ZBIA 5DK5A 3PR5B 4CECA 4FJGA 4MH8A 3M8QB 3AA4A 3QIPB 3LAKA 1JX4A 4EO8A 2IBKA 4CIFA 4H4MB 4CHYA 3CJ3A 3S3NA 2P5OA 3AVFA 1TK8A 1I39A 5KFCA 3MR2A 3QYYA 3QETA 3S3OA 3DI6B 1REVA 3TAFA 4O5BA 5C24B 4AILC 3VQ7A 1BQNA 4KHWA 3CVKA 4DS4A 2YNHA 1D9FA 1BQNB 4KHQA 4FW1A 2YNHB 4IFYA 1S6QB 3PX0A 4FJJA 2I1RA 4DQQA 4RNFA 4O4RA 4ECVA 2AGPA 1L3VA 5JUMA 4JS4A 4K4WA 4O55A 4FJHA 1EETA 3OJSA 5F8JA 4J2DA 3EYZA 2XWYA 2P51A 4GC6A 3AVMA 1RT4A 1IKVB 2FLPA 1BHLA 3DMJB 2QKKA 2OPRB 1RNHA 3KLHA 4NRUA 4B8AB 4IR1A 1IKYB 4CGHA 1UA1A 3OYNA 3P5JA 4FBTA 3OL9A 2BR0A 3LDSA 4FZZA 1RT5A 3T5LA 3WNEA 4FZYA 3GYNA 5EWGA 4FK2A 3GIMA 2HMIB 5J2NB 1NK4A 4FLXA 1TVRB 2R2SA 1J5OB 5J2NA 3AVNA 1NKCA 3AO3A 2G8KA 4W5NA 3AVBA 2WRMA 3FSIA 2JC1A 1WN7A 4YNQA 3L2VA 2DY4A 5KT2A 1IG9A 1RILA 2HHUA 4IH7A 3NH0A 5KFAA 3KK1B 4CF0A 1O1WA 4JS5A 4Y34A 4RUCA 4ECUA 2FBVA 4NLOA 3OL6A 2YKNA 1BIUA 2IS3A 1KHWA 1JLAB 3KMQA 1BCOA 4O44A 2RF2B 1UA0A 3P83D 4FJXA 3KLEA 1HYSB 1BL3A 4R5PA 2B6AA 3MEEB 3K5NA 1RDCA 2HB5A 4PUOB 4CJTA 4N76A 5C5JA 3DRPB 3AA2A 1QHTA 2ZQBA 3KLGA 4DL4A 2D5RA 3RB3A 3IGNA 1GOCA 4NZ0A 4J9SA 4DSLA 4CFBA 1CXUA 4HHTA 4QWBA 3O4NA 2KTQA 4K4ZA 1Q8IA 5F8IA 3PW4A 2IMWP 1U47A 1XHZA 3I0RB 1T7PA 1VSKA 4DQIA 5JS1A 3QNOA 1Z25A 4YR3A 3NBPB 1EKEA 4WFZA 3MXIA 3KK2B 4M3YA 4F4WA 4K4XA 4FXDA 4NLYA 3H5UA 3KK2A 4QWAA 1LW2B 2R2RA 2R8KA 4E7LA 3BDPA 1TL1A 3NFAA 4TQRA 2IA6A 3BGRB 5HLFA 4AH9A 1Q9YA 3N6NA 2PY5A 3OLAA 3CJ4A 5DQHA 1RT1B 4KFBA 5CY4A 2OPSA 5KRSA 4JV1A 4OVLA 3F73A 2HNZB 5EWEA 2XI2A 2QE5A 2JEGA 3K58A 4CCHA 3OL8A 4EEYA 3U3GA 4IBNA 3RMCA 1ASVA 3FFIB 2YKMA 1C1CB 4FLWA 3NE6A 1SL2A 4CJFA 4IKAA 2W9CA 4ZHRA 4FLVA 2IM0A 3D28A 4FK0A 3MEDA 3BSOA 4YP3A 1LAWA 5KT3A 4N41A 1ASUA 1L3SA 4MFBB 1IKXA 1CLQA 3E01B 2NUBA 2KZMA 2YKNB 3NKYA 4LD0A 4KKOB 3FDSA 2XRIA 4O44B 5KG5A 1RDAA 5KT5A 3OYBA 3M8PB 3EY1A 3SFUA 4C8NA 3RTVA 4MK9A 4JLHA 1KFDA 3QGGA 5CYMB 4IG0B 1S6PA 3RB6A 4QWEA 1QAJA 4I7FB 3KLFB 4Y2AA 3KIOA 4RW9A 4DL6A 3HK2A 4K4YA 2W8LA 2YNIB 3KLFA 3HSTB 3DLHA 2D3UA 2E9ZA 2C22A 5KGWA 4CJKA 2IAJB 3I5AA 5CZ2A 3ALYA 4ZTFA 3QERA 3Q8RB 3LWLA 1NK9A 4Q0BB 4B9SA 1RBSA 3TAMB 2IAJA 4FM2A 3BJYA 5FROA 3VQSA 4KAIA 2FJVA 4NLUA 4KSEB 4IG3A 4M3UA 3U6FA 3OYHA 4ZPBA 1RT6A 1HQUA 3SUQA 2BQ3A 2B5JA 2ALZA 3H08A 3CDEA 4F2SA 1RT6B 1BGXT 1ZETA 3JYTB 4M3WA 2WOMB 1FKOA 4CGDA 5KFSA 1JLFB 4XPEA 3DYAB 3GV7B 1VRUA 1C1BB 5J2MA 4ZP9A 1WSJA 3ZT2A 1WSIA 2D41A 2UUTA 4F3TA 4TXSA 2OH2A 4NLSA 4O3SA 1EX4A 2X6SA 3TAPA 3DRRA 1SL1A 5L9XA 1BIZA 4OKKA 4AHCA 4OPJA 4H4MA 1CSJA 4ED1A 3L2RA 1RT3B 4LY7A 3G0ZA 3NHGA 3P1GA 5HRSA 1GX6A 5J1EB 1I6JA 1RBUA 1ZYQA 4IQXA 1W0HA 4TYBA 2X74A 3MR3A 3QGHA 4R0EA 3OYEA 1VSJA 1S0NA 4NYNA 3SJJA 3OS1A 2QXFA 4N47A 3KD5E 1Y97A 4CJPA 4ECQA 3M8RA 3AA5X 3BR9A 2F8TA 3M9NB 3OVNA 4R8UB 2RPIA 3L3VA 3PVXA 3HL8A 4RW6A 4O3PA 4Q43A 2WONB 5KFYA 1WSEA 3BREA 1JLGB 2W9BB 2OPSB 4KHMA 4DSIA 3VQCA 3E01A 4F4XA 3H40A 3AA3A 3BSNA 5DQIA 4FVMA 4ZTJA 4OLBA 3ISND 1N6QB 3EZ5A 1QQCA 1DTQB 1LWEB 2WHOA 3PUFA 2OA8A 1A5XA 3ITHA 3DOKA 4M3XA 3AO1A 1ZBFA 3OYLA 3CWJA 4CJLA 5F9NA 4OGCA 4CGJA 2Z1GA 5J2QB 4I7FA 2X6NA 2UVRA 3PJWA 3T5KA 4FM0A 3VQPA 4KBIA 5FDLB 3VQDA 2C2RA 3QEXA 1BI4B 1JXBA 1XHXA 1U04A 4J9KA 1TKXB 4ZP6A 1RT7B 2XY5A 3V81A 3NDKA 1S9GA 2AX0A 4KE5A
chains in the Genus database with same CATH superfamily
3RAMA 5KPTA 2G13A 1EWRA 2CA9A 4CP5A 2FSJA 3MPUB 4K2JA 3C8YA 1S9FA 4ELTA 1I94K 3CE8A 4JKBA 3M8PA 5GMEA 1ATRA 4DHYA 1Q78A 4WK1A 5IV3A 5AZIA 1S1WB 1NJYA 2M5YA 3PJXA 4QPTA 3TA1A 3SCJE 4BRQA 2A6MA 2CQPA 4JKGB 2L41A 5EGYA 4Z4GA 1HNIA 4KH5A 3FSYA 2BJ8A 2KZZA 5M1NA 3CDWA 3NGZA 1LAVA 4UUXA 2R8GA 2XHWA 1T95A 4BREA 5IOLA 4JYAJ 4KJIA 5E33A 4X66J 3SEOA 5AJ3K 2CG4A 3AVAA 2IGIA 9RUBA 3CJQA 1FWKA 3JSMB 5AJ3F 4DKWA 4HTUA 3V5RA 5F0UA 1C1BA 2W7OA 4BDYA 2HHWA 4V19S 5E3AA 1KTVA 2Z2ZA 5L8RC 4LH5A 2QA2A 2ALYB 3GCXP 1QQOA 1XC3A 3HJVA 3S9HA 4O8KA 2XM3A 3CMEN 1N8RT 3B54A 2IA0A 3DM2A 1Z1ZA 3HMJG 4BY9C 3VGMA 4FXVA 1N4LA 2D4WA 2YKAA 1PYTA 4H03B 3OYFA 4DV7J 2Q2RA 4BC7A 1WG4A 2HNDB 5HRPA 5C2FA 5ETSA 4ZPCA 1I94J 4W5OA 2ADBA 1NNDA 1AB8A 4TY9A 2VC0A 1S7IA 3M8YA 3SCXA 3J80U 1QUPA 1HIYA 1HBOB 4QIEA 1VSEA 4DR5K 5F9LA 3T1HF 2KVIA 3GDQA 1VQNN 1IH7A 3K5MA 5BREA 1OYDA 2GELA 3FRYA 1T02A 2FD2A 5IZHA 5BRHA 1S97A 1QM9A 2AP6A 3NH1A 2FJAB 3CTRA 4NA2A 4UTGA 4NLQA 1U48A 1LFPA 4DR3K 4ES1A 2RKIA 4NLXA 1X8DA 2G8FA 1Q5VA 3QJPA 4A47A 4C2MA 3K7RA 3I8DA 5FIIA 4LMZA 3CJ8A 5AFUA 3H5YA 1XQIA 5CYQA 7AT1B 1CZBA 4L3NA 4LF4F 4KHPJ 5HQMA 2O8DB 4H5TA 1X4BA 5D3GA 5CAAA 1KCFA 1JLBA 5C42A 2VG6A 1TP7A 3P4UB 1PAUB 3E9OA 5KFBA 1IJEB 4ZVHA 2VHGA 4DTOA 2AJ0A 1E6YA 2BKNA 2RJZA 5L1LA 3A5MC 3G71N 3J80Y 3WXLA 3W65A 1MMLA 1JIHA 3D2EB 3DXMA 3RJMB 5BPMA 2QMWA 4KHUA 1NGEA 1SKSA 3HXMA 3VV2B 3IS9A 3QFHA 4CZMA 5HOOA 2X3GA 1YKWA 3ZETA 3C19A 5KFEA 1JL2A 3BBBA 3ZTOA 3AOBA 3GFXA 3DM2B 1PSDA 2QWQA 3AXKA 3PHEA 3DLGA 3DOLB 3K8VA 4WPAA 1BQXA 1J5EF 1NH8A 3ICLA 1T9YA 3SCLE 3H5XA 1AXQA 2E66A 3E9LA 2AV5A 4J9QA 4WIIA 3MWPA 4JV5K 1VCTA 4CHPA 2XMJA 3D1QA 1Z4UA 5DS7A 5ETRA 1HNVB 1JNRB 3VOVA 1YDLA 2B5JB 4OHWA 4C3MA 2GCFA 1MLAA 4OYOA 4M3TA 4KGZB 2F8MA 2O8BA 2E1CA 2MZRA 3AFGA 4K42A 2VCPA 1UL3A 3R5JB 1S0MA 4KI4A 2EK1A 2Q3SA 3D4JA 2E2OA 3C16A 1KC8O 1Y0HA 1RDWX 2NXEA 3I5BA 3RMAA 1VLYA 1VI7A 2AX1A 4ED3A 4NYPA 1N34F 3ZSYA 2E5LK 3WX4A 1VJWA 3IMXA 4TNOA 1UWBA 2F8EX 1RDBA 4X64K 1S1XA 2C2DA 2J6SA 5FDLA 1ZM9A 1S9EA 3NMAA 1UAXA 4P71A 3R2CJ 1JB0C 3HD2A 3C7NA 4BC3A 2CGLA 3PIPQ 5D4PA 1ICEB 1XR7A 1Y5NB 2HVDA 3VEZA 3N79A 5AQMA 1V5IB 4ES3A 1N0UA 3FR0A 3IXQA 4A8XA 4CF8A 3G4SN 2B4JA 3O3FA 4JP8A 4DFPA 4Y1CA 3V4IA 4LUBA 2JEIA 5J1EA 2V4RA 4P74A 1IJJA 4E1NA 1RYRA 3NVKA 4Z2XA 3P96A 4PKGA 2E5JA 2MPUA 3CCRS 2I7NA 2MGZB 1NWKA 4KREA 1B9DA 5EHHA 3MEGB 4UOGA 4MYTA 4KHNA 3F5TA 3FBFA 1RU1A 3L4BC 3M2UA 2MQQA 1UPMB 1FRMA 1U1NA 2PFUA 4USUA 2JDJA 5EOYA 1B0TA 4E98A 3PHTA 2LKZA 3MF5A 2JEJA 1NJZA 2XS7A 1SZ2A 1TL4A 3UIQA 3K0JA 3D7EO 4HDHA 3KLGB 4DCHA 2HGLA 2WBRA 3L7PA 3DOMA 2GC8A 4ZPDA 3HVWA 5F8HA 1RHUB 3PRVA 1LWFB 3IG1B 4CK1A 2B7CB 4J9PA 2YWWA 4PAAA 3ZZZA 3PYEA 2PYJA 3UWTA 1LK5A 3SPYA 3FQLA 4HUFA 4RW7B 4WF9Q 1F5CA 5K8OA 5MAOA 4DR1J 4EP4A 1RBOB 4KRFA 2DNOA 3CC2N 3TJAA 2DNQA 2ZM6F 4GKKK 4IYQA 3TVZA 4BACA 5B8HA 1UVNA 1RAOA 3N01A 5LL6Z 1LWXA 2RD5C 2ADCA 1IKVA 4PWDA 2V7YA 2PAVA 2BA9A 1YG0A 4ANCA 3C7NB 5I42A 4CLUA 4CWBA 5IXUA 2QG9B 2CFXA 3ENWA 4N7TA 2Z56B 2FY1A 5AZIB 1JXEA 1R8HA 4KB1A 3JB9k 1WC3A 5DM6L 4LR9A 2LA6A 5L38A 4ER8A 4B1XB 1NKEA 1HR0J 4WZMA 4CBUA 3OYIA 3U9ZA 5TKYA 4PPDA 1PJ5A 3OXGA 2NZ4A 3C6UA 3EGWB 2QGFB 5CYQB 3IFEA 1F9HA 1LFWA 2AWZA 1HHQA 2VG6B 3UPFA 2CZ9A 3MEGA 1FJEB 2IVNA 3HSZA 1LXNA 3THVA 4GO5X 4I2PB 3CCUS 3R1XA 4JYAK 4IFEA 5T41A 4B9QA 3HHDA 2P9PA 1IVZA 3GP9A 5SZTA 1MU2A 2NRHA 1HI8A 2WTFA 2AJ2A 1FEHA 4Q8FA 2QN6B 4QW8A 1N33K 3N4PA 5LJ5Y 3A2FA 4EBCA 1HQEA 1G99A 1IBKK 2QSWA 4ZLPA 5HANA 5DZ6A 2VA3A 2AEFA 3LOUA 5HVFA 4RW9B 2RQCA 2UUBJ 2E4LA 3EO3A 3TI0A 2FQQB 1IQTA 2Z58B 3I4HX 3OSPA 2MJUA 3J7Z5 2QMXA 1DGKN 3BZKA 3DLKB 4ZOSA 2E7VA 5JXSA 2MKJA 4BE0A 1YJNN 4E3SA 4CGIA 1J9AA 1YZ7A 1U6ZA 4OZ2A 5DDPC 4F36A 2XY8A 4LIRA 4OZ1A 2R7OA 4KGKA 2OJ3A 3QINA 3WNHA 2VG5B 1WEYA 2XCAA 4IUFA 1OH6A 1KD1T 2GWJA 1NDPA 2QSFA 4ID8A 3M8QA 4DV1J 4OV6A 4Y28C 1BG3A 3KLIB 2HHHK 4WCEQ 4ELUA 1VSFA 1NOZA 3EN9A 5C24A 2M52A 2HIYA 5GADU 1YJWS 1WC6A 3EGNA 3CJKB 2NPIA 1KLMB 2NYHA 4JK9A 1TKZB 2G2YA 3PW7A 1VGYA 1R0AB 1NUEA 5L1IA 3MAHA 4MAKA 1UWBB 1HJOA 3H3OB 2WBNA 3WQTA 2QT7A 2HRTA 4HWIA 5EUHA 4PKDB 1URRA 1Q95G 3I56N 1JLAA 2VODA 5HRRA 2CJXB 4CF2A 2XSJB 3D2WA 1GTHA 1OY8A 2I38A 5EX3A 3GB0A 4CE9A 4JD2A 3VETA 2ACYA 2P9GA 4DR6J 3HRGA 1J53A 3NXZA 3MMJA 2QWMA 3HHNB 4WQ4C 5AQYA 2XMUA 3MN9A 2NSBA 4AHSA 2UVWA 3KHHA 3LGMA 1KHVA 3VR1A 3J7AN 1NBWA 3A8EA 1OS5A 2ZJRQ 2XMAA 4DU3A 1TK0A 1WLJA 5L46A 3GBTA 4ENOA 4N5SA 3LPYA 1VSIA 4CLTA 4YB7A 3PSIA 4JKGA 2E2QA 1AW0A 5D77A 4A8SA 4MDAA 2HK3A 1SKWA 1QTMA 2A40A 4DTXA 1Y10A 2MLZA 2NXJA 3OYMA 2MB0B 4OKEA 4QBUA 4B1VA 3MXJA 4CJUA 4AHTA 2EVZA 3WX8A 1G1XA 3D0PA 3RBDA 4FJMA 4L75A 4HYKA 3MMAB 3ZZUA 4O3RA 4KV8A 2GAGC 3NGKA 2VG5A 3PRBA 2WOMA 3LDLA 3VEYA 3W62A 4AHUA 4USIA 1WWHA 3K8WA 3CXCM 1V9OA 1Y11A 2PEHA 1HNXJ 2Q0UA 3KXDA 3I9V9 4OX8A 4LF5J 1AZSA 4KPCA 4WFYA 4O0IA 1QE1B 5CXTA 5A8WA 2ZOMA 1VOMA 2EBGA 2VQEJ 4P7VA 3GG1A 3BP8A 1SCJB 3VGUA 4XAKA 3OVBA 3N9UC 4DL3A 1Y4ZB 5DGAA 4ZPAA 3AARA 3JSMA 1VSHA 1S77D 1ZAXA 4USJC 1GLCG 4CHQA 1S1XB 2NRXA 1CS4A 2MY8A 1X4DA 1PG5B 2YBVA 3H5SA 5KG0A 4DPOA 4CLYA 1N88A 1FE0A 2J7KA 3QT7A 1YJ9N 4YDUA 2GBZA 1CZAN 4QS9A 2OPPB 3D6MB 3CC7S 2W6KA 3CXCR 2HQ3A 1ZH5A 4G1PA 1SJRA 4IOCQ 5I3UA 3R5BA 3O3HA 5D0GA 3MR5A 4X62K 2EBEA 2NLXA 1IBMF 3J7ZT 4A59A 5KFPA 4DV4J 1XMQK 5LXRA 4I9QA 3CMES 2BJ3A 2BEFA 2Z1HA 3MAAB 4W90B 3SYZA 2OELA 4NLWA 2XNQA 1R8CA 3VAFA 3R5GA 4YEAA 1NPRA 4V19X 1V6HA 1EKSA 3GIIA 3S1TA 1EQ0A 2OO4A 2PI4A 3LL3A 1K0TA 3SFGA 1BO5O 3QWUA 1PCAA 3MPWA 1VQLN 4BDPA 4K50A 3JTPA 2IDLA 2ABYA 3R97A 2F65A 3HPHA 1CEZA 4B3RF 4I2QB 4HKQA 3TAGA 2BABA 3VF6A 4FJ8A 3D2EA 4OJ3A 5SWMA 3M1FA 5KFOA 3A8KA 1NZ8A 3VQ6A 4YS2A 2YKQA 3L2UA 1XQSC 2FJBB 3ZTPA 1KOOA 4ILMA 2O66A 5LMNF 2XY6A 4F25A 4ISEA 1SJ3P 4B3MK 2UUBF 1VQSA 5D0RA 5KQDA 4GY2B 1KOHA 3C15A 5GADP 4CESA 3AQOA 2ASMA 4C0BA 5KG4A 2CADA 1RCXB 3QLHB 4NX9A 4DTPA 4HACA 1A5WA 4ED0A 3THTA 1OY6A 2V69A 1UPPA 2D3ZA 2X1GA 2DRBA 1BMQB 3C6TA 3Q7BA 4UZBA 5GAGI 1OO0B 1SIWB 3UQSA 2DGQA 4DV7F 3OTOK 2WUSA 2V0NA 1ZBLA 5D4OA 2A2CA 4PWDB 2QA4G 3SUNA 1RT4B 2C42A 1LW2A 3MFHA 3ENHA 1VS3A 2HHHJ 4MKVA 4BRGA 3KHLA 1RKJA 2DH8A 1F9EB 1QZ5A 3W5ZA 4H4OA 2WCXA 4TYAA 4IOAQ 1WJ9A 3KLIA 1FFGB 1N6QA 3EX7B 1AFIA 1O8BA 1QD1A 2ZKTA 4JNEA 3H1QA 3VALA 5AQTA 3T3FA 3PACA 1ASWA 3N6LA 1KLMA 3R27A 3GV5B 4PXBA 1N33J 1B92A 3L2WA 1RCHA 4KR0B 1DZ5A 4BWMA 1X3MA 3SBGA 2M88A 2Z8QA 4YOWA 1RCOB 2FVCA 3O3LA 2GUIA 1FA0A 1J2VA 3HT0A 1MWKA 1NGGA 5D78A 1UFWA 3CFRA 5KOWA 3V6KA 2HHSA 2GWKA 5G4DA 3K59A 3THXB 2W6LA 4X62F 1SIZA 2V8PA 4LF7J 1FCAA 4PL8A 1QQMA 1K8KB 4NXMF 3OFGA 4JB8B 2CPIA 2BMBA 4U96A 4CI0B 1WKLA 4IR9A 4KTZA 4P10A 3V4IB 3CYMA 3W2WB 4P2SA 3E3XA 4HACB 3J81O 1M5VC 1SUQA 3HVRA 3MMCB 4O3NA 4ECRA 4DX8H 1DY3A 4X4TA 1NMEB 4FO0A 4H5RA 1OKJA 1FO1A 4L3KA 1KN6A 1VBYA 3TSUA 1YT3A 2CNLB 4M95A 3UDLA 1QAYA 2FY8A 1X4HA 2G2ZA 4BRFA 2BW2A 1BC6A 2ROGA 2IHR1 4DWIA 3QNWB 2BW7A 3CJ1A 1KAZA 2J8AA 3HO1A 1YSJA 4B8CA 2DK2A 2HFZA 4EIAA 1WHWA 3F9KA 2GMHA 3M2VA 5A8RB 3E1YA 3CD7A 3V1QA 1J54A 4AXJA 1J5EK 4RLEA 1JL1A 3TPQA 5J2PA 2MKSA 4JI0K 3UDEA 3U1NA 3GJSB 2IDOA 3BSAA 4YOVA 3AD9C 3RRGA 1CBKA 2DH7A 1ZAWA 1WAJA 1D0EA 4DN9A 1M5OC 1OMSA 1HD1A 4ZVFA 3H0PA 5IFMA 3CCRN 5AE3A 4DV5F 5F8GA 4CZEA 3OYDA 4DI6A 5HO4A 4CD1A 5KT6A 3Q8QB 1N5YA 4L74A 2QL7B 2FJEB 2R42A 3QZ7A 3TNVA 4DU1A 2UU9F 2IC3B 4ZN3A 1GOAA 4CEZA 2WFBA 4JI1K 1LWFA 3U8XA 3LGNA 5FD1A 1Q7LB 3NGYA 1DTQA 3QSIA 1HA1A 4FJLA 2V4JB 2CPFA 4WXWA 2AF6A 3D7SB 3CC4S 2NCKL 1RI7A 1WG5A 4F67A 3UKRB 1WNSA 1TAQA 3D0HE 4K43A 1DLOB 3GTYX 4DR3F 2JEFA 1IKXB 1NPPA 5K14A 1Q79A 2K8GA 3KJVA 4KV8B 4F02A 5H9FK 2BZ2A 1Q0NA 2YHBA 2KQ2A 4H0OA 4U67Q 4CJWA 3CC2S 3QFUA 1WNEA 2KI2A 3MX2A 2HHHF 1JLQB 3MEEA 4WXOA 5GVQA 3O9RA 2WVCA 3BM7A 3GIKA 2P5GA 3H90A 3L4IA 3CFPA 4QOZB 3K5OA 1QE1A 5AE2A 4K8ZA 3S7RA 1X1PA 1GXLA 2J8SA 4HUGA 3C15B 3UD5A 2RIJA 4RUHA 4ZJQA 3EGVA 2IVOA 4KTQA 1VQ6N 4DS5A 4B3TJ 2OGUA 3T19A 4LF7F 3MXMA 3HVTB 4ILHA 4R8UA 2E1AA 2W2PP 3BYRA 2NRVA 3T1YJ 3MFIA 3DLLQ 5EDWA 3B4DA 4RKUC 4K0KJ 2LEAA 2D9OA 4DMZA 3WHIA 3PO4A 4B9TA 2X1AA 3HBTA 2FJDB 3IO1A 3PR5B 4CECA 2HF3A 4KH0B 3UN3A 4DJBA 2YY3A 3M8QB 3AA4A 3ID8A 1OPZA 3LAKA 4EO8A 2AYEA 3RG6A 2IBKA 4CHYA 2XB2D 1BA0A 4OJHA 1VQ7S 3AVFA 3QYYA 4GMKA 1REVA 2DXFA 2F5GA 4M5DB 5C24B 4KHWA 3VQ7A 3ZXWA 2XS5A 2HBJA 3PIPL 2H1YA 2DGXA 4AE5A 4YB6A 4ISGA 1D9FA 3A8YA 4OZ5A 4KHQA 4FW1A 2HQIA 4FJJA 1K47A 2I1RA 2XEXA 4LFBF 4ECVA 2W41A 4DU8A 1E3MA 2NYIA 3GMGA 4WFNQ 4LBIA 1F60B 1F1BB 1EETA 3ZNUA 3OJSA 4J2DA 3MMVA 2PD1A 3KDNA 4UUWA 5IT9U 3AVMA 1KP6A 2Y1LB 1UVJA 1XNQK 1MWMA 2OPRB 1HWLA 4NRUA 1S7HA 4B8AB 1DURA 2H3EB 1BE4A 4IR1A 1IKYB 4ILLA 2BR0A 3LDSA 2J9CA 4FZZA 2QA1A 4USMA 3BS9A 4CNZA 1HUXA 2M8HA 4FK2A 2HMIB 4I6AA 1TVRB 1L3KA 2MZSA 4BVPA 1NKCA 3D2FA 3BH7B 2WRMA 3EKSA 1WC4A 4OYMA 3CULA 2VDHA 2R7VA 2ROEA 4FF1A 5C0YA 1HHTP 3GJTB 2W24A 1RILA 1U2VA 3KK1B 4CF0A 1O1WA 4RUCA 1WDTA 4NLOA 2XSJA 3CGIA 2YKNA 4P2FA 2IS3A 4O44A 2RF2B 1UA0A 3P83D 3CD0A 4NYOA 3PEHA 3MMAA 3KLEA 2DGOA 3THWA 5C2GA 4OPHA 2MSTA 2W2NP 1F2GA 1YJTA 3K5NA 3I56S 5C5JA 3MCNA 3DRPB 4JHDB 3NOCA 5AZJB 1P6TA 2Z30B 3MN6A 3IGNA 2QWOA 2C3UA 3J7YU 3CC4N 2CIMA 4Q2MA 3RGIA 4NZ0A 4KGVB 4GV9A 4J9SA 4J5OA 4DSLA 3RW6A 4CFBA 3SSQA 4P73A 2CQIA 3M6XA 3UCUP 4K4ZA 3PW4A 3I0RB 2M7SA 4EI2A 1VSKA 3QNOA 1VQ4S 1RADB 2ASPA 1Q1KA 1TL5A 1EQYA 4WFZA 3MXIA 4K4XA 1PIEA 1VQ9S 4QWAA 2R2RA 2XLJA 5JMNA 3PKMA 1TL1A 4TQRA 3BGRB 1XNRF 4WU2A 4D3GA 2NUHA 3OLAA 1RAAB 4AD6A 5DQHA 4KFBA 3C16B 4BVOA 4JV1A 2DTJA 2VFUA 5HATA 2JEGA 3K58A 4OZJA 3N28A 3Q23A 3D0IE 2AD9A 4IBNA 3MOZA 1UWAA 3RMCA 1ASVA 4NEZA 4YB1P 2Z57B 4DV6F 3A5LC 1U2FA 2RSQA 1RQ0A 4U7UK 2LQ8A 3MEDA 2RAQA 3OR1A 3FUYA 4X64F 1V4SA 4YP3A 3N4QA 1M5HA 1GLEG 4OIXA 2FSNA 3CCMN 5HMZA 5CZVA 3ZO7A 4N41A 1LOTB 5F2RA 1ASUA 1IKXA 3E01B 4IWVA 3GCWP 4KKOB 1RWNB 1N34K 1RDAA 2CUYA 3M8PB 2ZBRA 1VQ7N 2FSKA 2YWKA 5B0BA 3N5BA 3RTVA 2OTLN 2PEBA 1KFDA 3FZBA 4J9VA 4W98A 2HBMA 1EKRA 2CQDA 3RB6A 5ELZA 4I7FB 3KLFB 5DDQC 4Y2AA 4P6QA 2YNIB 1HBNB 2XBPA 3QERA 1NK9A 4Q0BB 4B9SA 1O0PA 3BJYA 3KG4A 1Q82O 4KAIA 4OX6A 4IG3A 5FPNA 5J1PA 4JN4A 5AQQA 4ZPBA 1HQUA 2DT9A 3IM9A 4TLQA 3H08A 3CDEA 2OD4A 4F2SA 1V3ZA 1WKJA 1FKOA 1FDBA 4FNHA 3HHEA 1JLFB 5KFSA 4X66K 4JI1J 2JVOA 3J81Y 2DPNA 1MWQA 1YJ9S 2UUAK 4TXSA 2OH2A 4NLSA 3TJ8A 1EX4A 3TAPA 3DRRA 1Y9OA 2LDYA 4ED1A 4LFAK 4LY7A 3LPEA 3CPWR 5HRSA 1GX6A 1RBUA 3TOQA 4AL7A 3MR3A 4DR5J 2PMHA 1CPZA 4CH1A 2HURA 4LF8J 2IIHA 1S0NA 3ILLA 1M90T 1SBRA 4MO5A 2L3MA 1Y97A 4E8UA 4UOCA 2F8TA 2GVDB 5AQSA 2ZH2A 2PGCA 2NRRA 5KFYA 4LF4K 2Z0GA 1JLGB 1HX1A 2QWPA 2CQBA 3WXIA 4KHMA 2YJEA 3VQCA 4F4XA 3PEJA 2H5JB 3X3UA 4YY3F 3BSNA 4UOFA 4FVMA 3Q22A 2F4FA 4EK2A 2ZWHA 4OLBA 3ISND 1N6QB 3VZHA 2ZM6J 5E2QA 2V50A 3KWGA 3PUFA 3MMBB 2W7AA 2HMPA 3P45B 4FXWA 1WHVA 3AGKA 3MPVA 3CWJA 4DV2K 4PWWA 4WKRA 3M6GA 2BTFA 4MO4A 4JI0J 2V52B 4LR7A 3ENBA 3VQPA 1HL6A 2MQNA 3K0SA 2DNPA 2EFVA 3PDNA 2LEBA 1XHXA 3D1HA 3VVUA 4ZP6A 1G2EA 2IVYA 5M1PA 2XY5A 2EFOA 3BO3A 4OFZA 2MXYA 3GSDA 2RH3A 3CUNA 1GLJO 5EY4A 2UUCF 1T0TV 1F3FA 2ZJRL 2KYZA 2FBXA 1DJ0A 3HVAA 5HBMA 5LJVA 4ZVGA 1V4TA 2RE1A 5DJBA 1T44A 2GJFA 2Y3YA 2QLBB 3IWLA 5EWFA 2E88A 1ZXOA 4AQYF 5B0AA 4F0HA 4L6V3 2CPJA 5GAHI 2R8IA 3K89A 4DG1A 3W5XA 2XG8A 4G9ZA 2KKHA 4CZKA 4M3RA 3FZLA 4LF5K 4I6WA 3BSCA 5A8RA 1TUVA 5DDRC 1VDHA 1YI2S 3V6DB 3D66A 1HI1A 3LWMA 3LAMA 3AVCA 3KJNB 4KH4A 1TMMA 1KVJA 4GRSA 2GUPA 1S1VB 3I0RA 1IN0A 3PIOQ 2NRWA 2ZDOA 3KG0A 3HHKA 2IM2A 4IFVA 4NA3A 2RHQB 3J81j 3D6TB 1NHUA 3M2UB 4M45A 1YITS 4CZLA 1YF5L 5HMYA 1N32J 2YHYA 1C0TA 2RMLA 4XH5A 4JI6K 5LJWA 3JXOA 1WDDA 3MD1A 3FFKB 3W60A 4AFFA 1RGIA 1EARA 1LEOA 4PA1A 2EEYA 1Q7YO 4BRDA 1GLFO 1I94F 1TVRA 4JI4F 2QFIA 5KFTA 2C2NA 4U6PA 4K4UA 2FHJA 4Y3CA 1YTYA 1T3OA 4NCGA 3CF5Q 4IFYB 1XMOF 1UZDA 3NS7B 3NF8A 2ERRA 3M6UA 3CHWA 1B7FA 1HYZA 5LM7E 1BA1A 2WW8A 1G3OA 3SUOA 1VQ5N 2IDEA 1S9EB 1T6CA 4J2AA 3TAEA 4PY5A 1IR1A 4JD2B 4TY8B 1K9MT 3BR8A 2MYFA 2HLUA 2GNKA 3K57A 1RBAA 2OZMA 2N7YA 2K7JA 4WQ4A 4CIGA 2QI2A 2HBYB 1TL7A 5M1FA 4WYLA 2OFHX 3W66A 5GMKa 4RWTA 1WOOA 1M5PC 4M63C 2VWKA 3UKRA 3ENQA 3POTA 4PHTX 4FWRA 2VQFF 2OPQB 5KFVA 4DV1K 3ULDA 3ISZA 4CFAA 2CQ0A 2EC0A 2F4VK 2AZ3A 2HPUA 3UFCX 2N7CA 1HHSA 3LP0B 1MWZA 1NLVA 5IT9Y 3UN5A 1TKXA 1IQZA 1SH3A 4X4PA 4PG7A 1PBAA 3CCVS 1MU2B 1PJ6A 4B3OB 3GE9A 1S4FA 5IM0A 2HBZB 2VFVA 1Q4RA 4MKAA 4MLHA 2MQMA 3WIVA 1G15A 3ILJA 4ZVTB 5KFZA 5AQVA 1ATNA 4LJMA 2Q43A 1NDCA 3A4TA 4DCOB 3HFZB 2QC3A 4K7QA 2H9ZA 2HLTA 2JFDA 2HNYA 1PO6A 4A8FA 1RT3A 5KFGA 5JLHA 4K4SA 3DOLA 1WD6A 4HCBA 3PLAA 4CLPA 3QMLA 3IR7B 5CR4A 2B9XA 1M0SA 4PRFA 2VFTA 2F40A 3ZT4A 2XC9A 1WKKA 1VK0A 2P9KB 1U1LA 1WSGA 3BUZB 4KQZA 2XULA 5KFMA 2HS3A 4BRKA 1NKBA 4LSNA 4CIEA 3W5YA 1HPZB 2UV8A 1A0OB 3FKBA 2WBMA 1D3WA 3TQ1A 1CJVA 1GLAG 1RBRA 3QT5A 1VQ6S 1VQMS 4DTNA 4KKOA 3KLVA 1N5TA 5HP1A 4QAGA 1NGHA 1W2BM 2HNZA 1SH0A 3ZZ0A 2I6WA 5D4NA 1QVFM 3RRHA 1YI2N 2HFNA 2I5JA 1NK6A 4OX7A 3T5JA 3AT1B 2EK6A 3ITHB 1U6BA 4IXCA 1HNZK 3SPZA 2IRUA 4BR5A 3WDOA 1FJGJ 1KNZA 3JAMY 2BE2B 4OI4A 2RB7A 1KWMA 1L3UA 1DRZA 3OLBA 1IBLF 2P9SB 3M4XA 3V6JA 4NXNJ 1CULA 1O13A 2YWFA 4NI2B 1TKZA 3KFWX 4QYRA 1S1TA 3DGPB 4DV4F 1S6UA 2YX6A 5IS2A 2ZZNA 1VR6A 4EUVA 2YCHA 3OTEA 4NASA 3P39A 1NM2A 2UXBF 3C95A 1OIAA 1LQ9A 4KYZA 5KG6A 4H8KA 1NGBA 1IKYA 1S99A 1W26A 2WVDA 4XIUA 2ZITA 3BY5A 3CJ9A 1PGZA 3KLHB 2ZJQQ 3SV3A 1WG1A 2KFZA 2BOAA 4Q8EA 1TTHB 2DHXA 1H1VA 2ZGYA 1U2RA 4X65F 3G9CA 6FDRA 1ILYA 2CNKB 3OUYA 4FWMA 2XSFA 1R89A 5K9FA 4C8MA 3HHLA 1H0HB 2KYXA 2ZOGA 1JCEA 4X4QA 1WTFA 4DN0A 2QTWA 3VA3A 1S1UA 3SCKE 1YHQS 3IAYA 1ESVA 2IRXA 3HF5A 4BRLA 2EG1A 3B6PA 2CJBA 3CJRA 1HR0K 1RT2B 2VICA 4DLEA 5KFXA 4WFAQ 3MUVP 3HPOA 1XK8A 3K5LA 3QT6A 1ELOA 3OQ2A 1VAZA 3SQGB 2GQCA 4KFBB 3SUPA 4B3RJ 3DOMB 3MMBA 2GMJA 3OFHA 3I87A 4ZN1A 1TU0B 3ZSVA 4U67L 2YNGA 4LF5F 5HROB 2JRSA 4BRCA 3OS0A 4TU7A 3PW2A 1FXRA 4B9NA 4AQYK 3P49B 1GMUA 4DR6F 5D4LA 3O44A 3M9OB 1DT9A 3EZUA 4ZJOA 1UFKA 2DITA 4XK8C 1BXNA 1S0OA 4KB0A 2QIFA 2YHAA 4D3HA 3RR7A 4ECZA 5AQZA 1TV6A 3OR2B 2F96A 1F2HA 2QL9B 4DL2A 4DSKA 4M5IA 4RNHA 1HNXK 2LCWA 3PV8A 1E6VB 4CH0S 3KTQA 2VG7B 1X5SA 3MM7B 3OHBA 5C12A 3HP6A 2U1AA 4KB7A 2RILA 1RT5B 4DQPA 1HLWA 2D1CA 4DR7K 4FLYA 1RB0A 3AVIA 5JS2A 3NL0A 3CCSN 1S22A 2ZUAA 1NOYA 1FRLA 1XMQJ 3J7ZO 3CDUA 2ZWPA 1HPMA 2G1DA 2OANA 1KR4A 5T14A 5GIOA 2KT2A 2OPQA 4EYHB 1R3NA 1VQMN 4K59A 3VAJA 1OPIA 4GKKJ 5E3RA 4DL5A 2B56A 2G8HA 1N32K 1RWOB 2ZBPA 5BRDA 4ANEA 4ZLJA 4Y2KA 4R25A 3RAXA 1E4GT 1K9MO 2LSNA 1VQ4N 4I2QA 3ZZTA 3FGUA 1FEEA 3AVLA 4NXNF 3CCMS 4IKFA 1XWLA 5CD4H 2NZCA 3S41A 3KDOA 2PFFB 4B1UB 3AA8A 1FRXA 2H4WB 2OIHA 5DZ7A 2UXCK 4ICLA 4B9MA 3DRRB 1B64A 4RUAA 4YMEA 2IVMA 4IOXA 4NPOA 2D0PA 4HTJA 4LC9B 2DFHA 4NCGB 3QLHA 4PYDA 3DLLL 3TTFA 4RG8A 5M1KA 1DAXA 3K9JA 3SQ0A 3PW5A 5C25A 3K2YA 1WF1A 1TKTA 1TYQA 4HDGA 1FKOB 5KFKA 1RWVB 2J0XA 3TR8A 5L9NA 4X66F 3V1RA 1NB7A 3IR5B 3FMWA 4TY8A 4M42A 5BPLA 1EB0A 1F6TA 4YQWA 1IJFB 2AHOB 2FB0A 2HWIA 3B78A 3G10A 2J9DA 1BUPA 2HVEA 2HNDA 5E5NA 3CIZA 4OX9F 1TGOA 3F9MA 4NLVA 4FK4A 4CLSA 2PDAA 3BQ2A 4DV5J 3EZOA 2OTLS 3FCVA 4ELVA 4AHVA 2XHBA 1RAEB 3QIDA 1BLUA 3MM9A 2CJAA 1LW0B 3VGLA 2LQ5A 3GFZA 1ITGA 3FLCO 2RDIA 1LWCB 4QCLA 3LP0A 2OEMA 2VPZB 3PFEA 4MFBA 3F44A 5F41A 3RYLA 3AB4B 3AQPA 1QY7A 3SAHA 3DWLA 4Y1DA 4DUZK 2ILYA 4O5FA 3NAEA 2HQFA 4A61A 2D7SA 3VTIA 3SDEB 1U02A 1HNWF 3B6BA 4NLDA 4E0DA 3W9IA 4AF1A 3WNFA 4L76A 2APOA 1XI1A 4E7KA 2LXFA 3BEXA 5KG7A 2HBRB 3VQ9A 3VA0A 1WOPA 4RU2A 4BR7A 4JI4J 3DLEA 5J1NA 3V1OA 4BRNA 1SUQB 3WNGA 3VHQA 3T5HA 1JLEA 3OYAA 2DO0A 2E5LJ 4DL0C 2CWKA 2HG4A 3SMSA 2XMKA 5B09A 3NNCA 1N5QA 3PM9A 2VV5A 4BC5A 3TQEA 2NSCA 1NSAA 4NWBA 1MN7A 5L1KA 3CCSS 3IBCB 1NXIA 3NGDA 3EWGA 3OJUA 1C0UA 4Z4EA 5FPDA 4J7CA 2D3O1 2KW4A 2QYCA 2YX1A 3QEPA 1DQ8A 2QM1A 1U1KA 2UZAA 1T8EA 4RL1A 4QYZK 1JWWA 4BGAA 3MD3A 2YV0X 3H2LA 1S76D 2HZAA 4FYWB 3NBPA 4OYXA 3ELHA 3M30A 4XPCA 2J6TA 1YLXA 2E29A 2F4VF 3FEYB 3W3SA 3DAWA 4C8OA 1GFWB 2VQFK 3NAIA 8AT1B 1TL3B 2OCEA 1RP5A 2BJ1A 4JUZA 3CB4A 1I51B 1W7WA 2YWGA 2E2NA 2FHMA 5MLCQ 2EPIA 4DTSA 1H74A 1KS2A 2QV6A 4OQJA 4GKJF 4J9NA 4TLRA 2OLWA 1C0MA 5KI6A 5DLFA 2AGOA 1QTNB 4M1KA 5KRTA 3OSNA 1GMWA 1K8KA 3T1YK 3B6OA 2UXDK 1ZA1B 5AQNA 2FGOA 3DXSX 4BG9A 3LP3A 2RHKA 5KFHA 4EBEA 4BHQA 3QSYB 1K8AO 4BS2A 3G6VA 4CEBA 1HBMA 4CLLA 1NHKL 4LSZB 4OI3A 2HZCA 3OXLA 2AU0A 4LF4J 3ZSRA 4DQRA 3PY8A 4IDHA 4E1MA 1WSFA 4YORA 3TEGA 1IM6A 2MLXA 2HWHA 2GGPA 1Y00A 4FS2A 2M0GB 2SXLA 1UKUA 1QSYA 4CEAA 1ZTTA 4XTTA 3DRSB 3G87A 2WK4A 4CZJA 3OYJA 3ENAA 4MK7A 2Q66A 4NO7A 1VRUB 5HK4A 4DTMA 4LFBK 3I0SA 1FRIA 2V6AA 2BE7D 2E5GA 5KFIA 1B3TA 3V9ZA 4WQ5C 3QEWA 2P9EA 5F8LA 3VVTA 2P9UB 4RNNA 2PA3A 1M5SA 1NK8A 3MCAB 4CQ1A 2YNGB 4ICLB 2JLGA 3I5CA 1Q81T 4EFAC 2Q1LA 2HRYA 3AJ2A 4JV0A 1UEVA 1XC9A 3QWPA 4MIBA 2ZD1A 1NCLA 4YR0A 2FVSA 3I96A 4JAXA 3CPWM 1OJ4A 1M90O 1U6FA 4B9UA 3ZTRA 1NGJA 4RO0A 1TL1B 1AROP 4ZP8A 1R8PA 2VG7A 3ETOA 5F3TA 1VQLS 1U1QA 1SV5A 4JRQA 2C28A 1D9DA 1GXUA 1VK8A 3GYGA 4FYXB 3DHWC 2B9YA 4IH6A 5BN8A 2KU7A 1DBDA 3QDKA 3VMFB 1RHKB 3CM6A 4DR4J 2OTJS 4URGA 1YJUA 3RAQA 4DR4F 2LDIA 3O9QA 1KVAA 2MKKA 2FJWA 1IBLJ 1TUWA 3VGSA 2ZZMA 2AMCB 1D09B 9ATCB 3OR1B 1Q18A 3C14B 2GHVC 3HKWA 1NEEA 3OL7A 1Q16B 3KJVB 3KMSA 2HW3A 4KTWA 4KAZA 2BKPA 5ETQA 3C0BA 2E1YA 4W5TA 4ZP7A 2N3OA 1S9GB 4DV2J 4CRJA 4A46A 1FD8A 4R5PB 1YBAA 3ETMA 4DPUA 2KG0A 2O4GA 4QS7A 3LDNA 3GPAA 3NAHA 3SNNA 4DSJA 1S49A 1NJIT 2ATLA 3VN5A 3D68A 2FC0A 5LY3A 3J7YI 2ZBQA 3CCVN 3LTOA 4B3TK 1ZS6A 4A5BA 2G0IA 2DNHA 3ENVA 2BANB 2VBYA 1S1TB 1Q8LA 2QJ3A 2BGGA 2BRLA 4MT1A 4J2BA 3G8QA 3SQ4A 4KHYA 1HQ2A 4IO8A 5KFQA 1MG7A 2PT0A 5JVHQ 4GMJB 1KVIA 4CERA 4JI1F 5IWAF 3GJRB 5A76A 4BR0A 2KLAA 1NG9A 4CEEA 4CJ3A 3ILIA 2XMVA 4ZITA 2CDQA 4CJ5A 3ATVA 1JJHA 3EZWA 1VQOS 3CCWA 3GIJA 3O4QA 1XERA 2QEXN 1GH8A 3ZSZA 1SC3B 3OBWA 3BF1A 4CEOA 2A18A 2IBOA 3BGFA 1HNIB 5F8MA 1JQGA 1REVB 3KYLA 2QWLA 1H2UX 2OUGA 2Q31A 1RBVA 2XMTA 3KOAA 3JQJA 4OKJA 4M94A 4P52A 3DXBA 4MMOA 5A0YA 4KH1B 1HJRA 4BC2A 1VRTB 4K8RA 1TAUA 4TU8A 1VK3A 5KG2A 3JAMO 2Z2YB 5HQ8A 3RMDA 1KQSM 5F1XA 5F0XA 3M32A 4H0VB 1C2PA 2DHAA 4ZK7M 2C2ZB 4A8WA 1NSQA 3PO5A 4E7IA 2B4UA 1APSA 2I8EA 3PSFA 1X5PA 1A5VA 5FRMA 2FLNA 4FWKA 5IWAK 2VOPA 2EFNA 1W2IA 3T7ZA 4LR8A 2VKZG 1D8YA 4HVJA 2YNFA 4V1Ak 3CJKA 1LNQA 4DOZA 2IVPA 4H5WA 2JLFA 4DV0K 4HLBA 4ZHRB 1U09A 4RX6A 3NCQA 3TTDA 2WW4A 1K44A 2QL5B 3Q8SB 2H5IB 3KK1A 1G7CB 5DGBA 2AYBA 3MURP 4ALZA 1SC1B 4QWCA 2HGMA 3PX6A 2G9OA 3CJ7A 3I6PA 4QWDA 4WZQA 2G8UA 3VAHA 3TSPA 2P9LA 1WBBA 2FBTA 2GGPB 1KD1O 4Y2MA 2FTRA 3RRKA 3HCXA 4KHSA 4CJEA 3A13A 3JSBA 2QLXA 4I69A 5B0EA 1XIQA 2GQQA 2V4QA 4FCYA 2B6AB 1KBRA 1ZBTA 1ZPVA 5K20B 1NMNA 3MK6A 2R7YA 2ZWOA 5CYJA 2JSXA 5MLCV 2HOEA 1ZZNA 1ITPA 1GXTA 4CZFA 3CERA 3D5MA 1FRJA 4DZDA 1MSWD 4HUEA 3I0SB 1WOQA 1NJXA 4PG5A 5KGXA 1HYVA 4YOXA 5K8PA 1RTJB 4OYZA 3S6EA 3KG1A 1PYOB 2QLJB 4LF6K 1VQ8S 1UOCA 1U4BA 3MECA 5M2UA 2DBBA 2Q79A 2HQGA 2CDRB 2WVBA 5I3QA 1MNEA 1K0VA 1KDNA 3HM8A 1IUJA 2GJIA 5BPNA 1HQUB 2OSRA 4E1JA 1FJGF 2UU9J 1DFDA 2LQ9A 4P7TA 5H9FJ 4JRPA 2DNYA 3R7SB 2ASYA 2HKEA 2RQMA 2A6AA 4FJGA 1VBZA 4MH8A 3ZETB 2HFVA 1GLBG 3QIPB 2DGWA 1VC6A 1FWLA 4Z94A 4B3SK 1K8AT 5KFCA 5ETNA 3S3OA 3DI6B 3AY0A 4LFAJ 4PCQA 2COLA 3PYDA 2UUBK 2YNHA 3W2VB 2FC8A 3THPA 4DCJB 1EJ7L 2D69A 4K0KK 2OEKA 4LFBJ 2GVZA 4RNFA 1S59A 3TUIC 1SQKA 4I56A 4A8OA 4K4WA 4O55A 4FJHA 2DB1A 2V5HG 2DGTA 3EYZA 2XWYA 3MX5A 3DNCA 2XTJP 2FLPA 1REGX 5AQHA 1XN9A 3ZYYX 3O9TA 4BC4A 1DQ9A 2GJ2A 1UA1A 3P5JA 4RBVA 2AYMA 1GQEA 2LQBA 3JSYA 2DCUB 2VIHA 5EWGA 3GIMA 5J2NB 2GHWA 2V34A 2R2SA 2DR7A 3LM9A 1R8BA 1J5OB 4USKA 2G8KA 2M8DB 3AVBA 1J27A 2JC1A 3RU0A 1A6LA 4YNQA 5DO2A 2UXDF 3R7NB 1IG9A 3T1YF 1KKHA 4JI2J 3T69A 2VGNA 4ECUA 2I2YA 5E84A 3D9BA 1BIUA 1JLAB 3K5PA 1H6KX 4H0YB 1HYSB 1XMOJ 3UN2A 1RWPB 3W8PA 1JK9B 5LJ3Y 4LF2A 3QAUA 3AA2A 2C2KB 4GV3A 2DISA 4ZVOB 1W2BR 2ITMA 3MWTA 3QRRA 1GOCA 3BEGB 3H3NO 1U1MA 1RHRB 1CXUA 1FJGK 4CTAB 2KTQA 3W2VA 3AB2B 1Q8IA 5F8IA 2H54B 3UDCA 1T7PA 4BRMA 2XMWA 4LRDA 5JS1A 2KKZA 1ZM2A 4I6YA 3NBPB 3QFPA 4DZ6A 1R43A 3H20A 1H38A 3TUZC 4LF6F 4FXDA 4NLYA 4X62J 2V2ZA 1LW2B 1U26A 2R8KA 3PXGa 1Q9YA 3D6HB 2UXCJ 3M32B 5CY4A 4DV3F 2OPSA 3HTVA 3V4MA 3F41A 4QQBA 5RUBA 4IJAA 4WTYA 5EWEA 2XI2A 1FHTA 1WHYA 3SMZA 5D6GA 2BJ9A 2RHSB 4EEYA 2VL1A 1FWPA 2B7BB 2KJWA 2W01A 4OZ0A 4UW2A 3FFIB 2YKMA 4WBFA 4FLWA 4ZHRA 3WC0A 3N0VA 1YBUA 4KRWA 5GAGU 4JKEA 4X4RA 3CJCA 4YHHK 2VKRA 5E26A 2VJVA 4RWWA 1QLNA 4U8VA 4DUYF 4AQYJ 1F3VA 2WSEC 3W3DA 2XRIA 1VISA 2J5AA 4X4UA 3OYBA 3WXKA 4J91A 4CBWA 3SFUA 2FF6A 5ADXH 1VQ9N 3M2RB 5BN9A 1FJCA 3VAGA 3W0LA 3BBFA 4JLHA 2M2BA 2UUAJ 2UU9K 1WELA 1X0FA 2Z2LA 4IG0B 1HBMB 4ED5A 4ZPTR 4DL6A 4A5AA 3KLFA 2D3UA 4LT6A 2IAJB 4AM7A 3Q8RB 2CWXA 3LWLA 2A41A 3C65A 5D0HA 2W4DA 2FZGB 3VQSA 3C3LA 2CH6A 4NLUA 4KSEB 4JI2F 4M3UA 3U6FA 1FX4A 2B5JA 2ZEJA 5LT5A 3O6WA 1ZETA 2GEMA 2WOMB 3GV7B 1VRUA 1C1BB 1SQGA 1ZZFA 4ZP9A 1WSJA 3ZT2A 4YOEA 3LF0A 2HZVA 4WFAL 5FLXO 3H7HB 2D41A 2UUTA 3H2VE 1SQFA 3L6QA 5BYQA 3IBWA 4O3SA 3QQCD 2X6SA 2PMWA 1SL1A 4OKKA 4H4MA 2JHEA 3L2RA 1RT3B 4P2XA 4ZLLA 1ZYQA 1I6JA 2CH5A 2LFVA 3BYPA 3OYEA 1NU4A 2HS0A 4N8NA 1YQHA 3M3ZA 3MCOA 3O5BA 1F5AA 2KHDA 2VZ9A 5ADZA 1CS4B 1Z05A 3RBXA 2KXNB 3FBBA 3BR9A 4CYUB 2GVZB 3M9NB 3OVNA 2RPIA 2LMIA 1N33F 1R0BG 2OKQA 4FYVB 2QTDA 3HL8A 3Q83A 4K25A 4O3PA 2WONB 4TU9A 1WSEA 3BREA 3B4MA 2W9BB 4DSIA 4F4AA 3H40A 1SPBP 4OYIA 2C2MB 3ULEB 3FSXA 5DQIA 1TFYA 3EZ5A 1WF0A 2O1PA 1DTQB 3ITHA 1N52B 2YI1A 1CVJA 1ZBFA 4FWNA 2Y0BB 4A62A 4CJLA 4OGCA 4CGJA 2Z1GA 2FIUA 3LH2S 2X6NA 2K7KA 3DXKB 2DRAA 5BXIA 1MA9B 2BX6A 3T5KA 1YWXA 3H6EA 2KFYA 2C2RA 2AP1A 3QEXA 1VYAA 1HLUA 1NM1A 1U04A 4J9KA 1TKXB 4LF1A 2ZF5O 4Z37A 3A5OC 3DGVA 4GNIA 1S9GA 4J9UE 1CJKB 1S6OA 1I3OB 1NGIA 1FTRA 1HMVA 3W9JA 5T7LB 3DXMB 3P8BB 1ATSA 2XO6A 2DXEA 1KXPA 4GKKF 4DR1F 1L5UA 1T3NA 2CQGA 2JNJA 2VQEK 1RAIB 3EKUA 3HKZD 2DNZA 4FJIA 4KY3A 4QIVA 5FJ4A 2AIRB 5G0RB 4C9DA 4XH1A 1D5AA 4Y00A 2P2CB 2M3DA 1JLBB 5C42B 2ZH8A 2O67A 3E66A 5L1JA 4BCAA 2E5HA 2ZJPL 4WYBA 4IQMA 3OTOF 4DV7K 3AOCA 2A1SA 4B3SF 3QGPA 3TW0A 4K4TA 2OTJN 2KRBA 3C6TB 2RVJA 4IO9Q 4YOTA 4U95A 3BQ1A 1WSHA 2JWNA 2YHWA 2GA7A 3EGZA 3SQ1A 2CZVC 5LMUJ 3S3MA 3NH2A 2MTLA 2VD3A 3Q2TC 3O8MA 2Z4PA 1UVMA 1HD0A 3ZLJA 3W64A 3G2XA 3HX9A 1LKZA 3DLGB 3SSSA 1UW9A 1IM4A 2IM3A 2V9WA 3LO3A 1TFWA 2WTUA 4WKYA 4RZRA 4LRFA 2OYQA 3HZ6A 2MJNA 2KB2A 4M5DA 5HL7Q 5HJXA 2RUSA 1IWAA 2CGJA 4DSEA 2OAUA 2QEXS 1LXJA 1RA6A 2XCPA 2HSEB 4NOHA 5B08A 2W9CB 3DDIA 2YKMB 4WP8A 1N5SA 4WJBA 1S5JA 2R8JA 3GE1A 2MKIA 4DL7A 3TVKA 3CQXA 3HZGA 2O8BB 4OLPA 3FQKA 4ISFA 1U0HB 1KQFB 1FNOA 4DUYJ 4RUBA 2YHXA 3V9SA 2B9EA 1BY9A 2ZE2B 1F0XA 2R4FA 4BQZA 4OZ3A 1RT1A 2KO1A 1YITN 3QAEA 4ZVQB 1B7YB 4OJ1A 2E2PA 2WSCC 4M5JA 2WAQD 1VQON 1W25A 3SAFA 2LP4A 4GKJK 3OD2A 4JKCA 1UAWA 4Y6IA 4BGBA 2LXUA 4DFJA 1CJTA 1YVNA 2CNOB 3NP5A 2BVZA 1YXQA 2P9CA 4C1NI 3ENOA 4EMDA 3R1LA 4A8QA 4KGMA 4I64A 1X7VA 1R0CB 4CT9A 2ZVSA 3ZTSA 4J90A 2R2TA 4ZLNA 3RBEA 5LOQA 3R5DA 1X9SA 2V67A 5SUHA 2Q6CA 3WC2A 4HHUA 3O1LA 4X4NA 4H5NA 1QAIA 2XY7A 2JX2A 1BOTO 1RABB 2MDAA 4JHDA 1VQ5S 4BRHA 2F7VA 4DTJA 2EX3A 3OA9A 3UI3A 2O8EB 3A0IX 3RMBA 1KAYA 2VB6A 3HT3A 2D0CA 2P8IA 3H2UB 4U7UD 1RBTA 3LUYA 4O23A 4FJKA 2VDIA 3AAWB 4ZDNA 4X65J 4IRDA 4CZIA 1JKHA 1AUSL 4M3ZA 3N6MA 3CCZA 1I3AA 2AZ1A 2G2OA 2GHPA 2XO7A 4A48A 3O9UA 1BHNA 1SJQA 1FD2A 3I33A 2DXDA 2QKBA 3A1YG 3L3CA 4K8XA 4RW7A 2Y8WA 3SI6A 1XMBA 2FHOB 3CEDA 2HHQA 3WUHA 1ACMB 2DHSA 3WXJA 4PQUB 3OBIA 1P1LA 4U7CA 1SKUB 3Q0AA 5HP1B 4AHRA 3OFEA 5DQGA 4DSFA 3AJ1A 1QVGR 4HHHA 4OZLA 4QIGA 4Q44A 4NLPA 1Q5YA 1NGAA 1T3VA 4DV1F 4TKTA 2NREA 4ZPWR 3G86A 1FRKA 1RTIB 1CJTB 1PC5A 4KO0A 4OI0A 2Z2MA 3ILOA 4B3MJ 4O0JA 4ZCKA 2BRKA 4FF3A 4YHHF 4I67A 4MKYA 2RDJA 5M1OA 1C0FA 2KXFA 3AV9A 1GT8A 4ECTA 5H9EJ 3CW2C 5ITHA 3TEHB 2PI5A 4DTUA 5AQRA 1GMWD 2HFSA 3OT9A 1CJKA 3QESA 3Q24A 2FPHX 2HHVA 2E5IA 4QR0A 2QZ8A 4YN3B 3ZFVA 4NRTA 1W9HA 3T1HK 3AAQA 5K8NA 3C94A 2LEPA 1KONA 1FKAF 4M5KA 1FNXH 4RU9A 4ED8A 4W5RA 4Z4FA 2GO8A 4HR2A 3JS9A 1HW8A 2ROPA 4JI4K 4DPYA 3TZZA 1SXLA 5KFUA 1VLOA 4CH7A 3A12A 4CZCA 3IN5A 3QJJA 1TKTB 1TYQB 1SB6A 1R6YA 2D3OR 1VIOA 3V81B 2MKCA 1FVQA 3DHXA 2P9IB 2E9RX 3MN5A 1VJQA 1Y5IB 2PIIA 3CCTA 4Y2CA 1GX5A 1WSRA 1SVDA 1RISA 3M9MB 1X4GA 2UXCF 2AEMA 5K5MA 4LSLA 2QA4N 2EHGA 3HSCA 3W63A 3QT8A 3VEWA 3JTOA 3IM8A 3OTDA 4WWSA 3GOIA 5B0DA 4GO7X 1Q9XA 2CQ2A 4IEEA 3ADAC 3DLKA 2KHOA 4BBYA 4YFUA 1XR5A 2E20A 1MN9A 3NS6A 1QSSA 3H45C 1KVCA 2VFSA 2JFKA 5I3PA 3G6ES 3OYCA 5CHIA 2DR8A 4LVOP 2J0SD 1EETB 4FYYB 3SXLA 5B7WA 2BDPA 4OMFG 3IRXA 1JLGA 1T9TA 3FEXB 4BROA 2ASLA 1YHQN 2YPYA 4CDIA 3TZXA 4ID5B 3NF9A 5T7LA 1PKUA 2E1PA 3VQQA 4NLTA 3IWXA 3AO5A 3HOSA 3H98A 4DFMA 3VF0B 1FK9A 2ZE2A 2EG2A 4ZCLA 3V9WA 2ZH7A 4PG6A 4K41A 2C2EA 4L3QA 3R9LA 3HZEA 4P75A 5CABA 5IQQA 4CF9A 1LWEA 3MM5A 2ZC3A 1BWEA 3CCEN 2ATQA 1ZBSA 4EP5A 4ZA1A 5LMUK 3NF7A 2OD6A 2X3DA 1Q81O 1FFWB 4QPXA 1RTZA 4H5VA 2ZM6K 1R27B 1P9QC 1U8WA 1RU2A 2ZH6A 5BRFA 3H4BA 1JLEB 1K1QA 5GAHU 3U1MA 4YY3K 4X4OA 3MGJA 2VU5A 4FKYA 5CH7B 2AJQA 2RS8A 2DO4A 3QATA 4FJ9A 2NPFA 1C6VA 1Z2ZA 3DRPA 3IWNC 5HQLA 1UFLA 4B3SJ 4AUKA 4CM0A 1PBUA 4OPKA 4EFHA 2VBXA 4QW9A 2HBLA 2CJKA 1NK0A 2JH3A 4RNMA 1V3SA 1WORA 3SAGA 4H0TB 4OJGA 1KLNA 2OEJA 3GSIA 4EZ9A 4CGFA 2EW9A 4FNIA 1QZ6A 4Z0UA 4G65A 4ECYA 2IOCA 4Q0BA 4LFAF 1G4CA 4PKIA 3AD8C 1E6YB 2DPIA 4LFCJ 4BQLA 1H3DA 2CJ9A 2ZH4A 3KUGA 2UV8G 3H1VX 3SI8A 2ZNYA 2QO3A 3EM1A 2HYIB 5C10A 3NRBA 2FF3B 2AA4A 1JXLA 2BQUA 3AVHA 3IA0A 1A7GE 2E7WA 4OGEA 1JLFA 5D0EA 4MQ3A 1JLCA 3QGIA 1SV5B 4OL8A 2W9BA 4I4BA 1RAJA 1OVQA 4DX5A 5K8MA 5EN1A 3QEVA 1OQ6A 1RHMB 4EYIB 4ZMMA 4CEDA 3EICA 3UE5A 4CFDA 4HTIA 5E3QA 1QS4A 3VWSA 3PYFA 1FDAA 4GVBB 3CJTA 2H65B 4JKAA 2XLIA 3CQ8A 2HAFA 1X4AA 3CF5L 3OPKA 1K1SA 2RQKA 3EE9A 4FZXC 3TABA 5AQKA 4HVZA 2EKNA 3W2WA 1VSMA 3NLCA 4M7YA 2CGKA 3NGUA 2VONA 5CHCB 3C14A 3MTKA 3NY0A 2G8WA 2DR6A 2PO4A 3CJ0A 3BQ0A 1YTAA 2QA4S 2L9DA 2QRRA 1Z26A 2CYYA 1OH5A 4Q2LA 2BUNA 4C8KA 3UO0A 2A10A 1DTTB 3LALA 2I0XA 2J7UA 3AY9A 1HNZF 1VBXA 1HKAA 5IC4B 4C3KA 4FF4A 2FVRA 3TA0A 1K6YA 1HQEB 1RTDA 4QU7A 4DV6K 3KHYA 2P9NA 3MEKA 4LRBA 3NG8A 4CHOA 1CQNA 5U47A 1HBNA 3R8EA 1WHXA 2HVIA 2KM8B 3TJ9A 3MECB 4HH0A 2JZ5A 3SJHA 1P9YA 3C2PA 4OX9K 3ZNJ1 4I2PA 5FLXY 4HL9A 2ZD1B 1XTZA 1P27B 2WZ1A 3GONA 5CQGA 2F9DA 4KHPK 3KUEA 3CDAA 4ECSA 2YVSA 4Y2IA 3UR0A 3S8SA 1XNRK 5E3PA 3G8TA 3OYKA 2POKA 2G4BA 3THWB 4PWUA 4IO9L 4CJSA 1YK9A 3BN7A 3CMAS 2ILZA 1N5YB 4TSXA 3NGTA 5KFWA 3GG4A 1C0UB 1PC4A 2YJFA 2ATCB 5DG7A 3CQYA 4RWXA 3HPGA 2GMLA 2X7IA 3E2EA 1B9FA 1NPKA 2RT3A 3U3YA 4DV6J 4F8RA 1RTIA 4DCPB 5KFFA 1UP1A 2DNLA 1WSVA 3TSQA 2OMOA 4C97A 3RWUA 4P2MA 3V6DA 3F0NA 3HM9A 1FRHA 4OI1A 4M5GA 2XYHB 3L8BA 4RBTA 3KK7A 4ERDA 4YR2A 3Q86A 5AQOA 3QNNA 4C98A 3R3TA 4R79A 5K14B 2CRLA 1BWVA 3FZMA 3CPEA 1T03A 4H54A 3IRXB 2DHHA 4B3TF 2Q6BA 2XYPB 4S0MA 3GR1A 1D4XA 2I5JB 2AJ1A 3KK3A 3DRXA 4CK3A 2LU1A 4FP9A 3M1VA 2HIQA 1E4FT 3VQAA 1U45A 1RDUA 1J5OA 1SKRA 4F4YA 3UB5A 4QIFA 1F21A 2YNFB 5HI7A 1C1CA 3IG1A 4ETXA 3R6GB 3HSDA 5THWA 2CVEA 4C8ZA 4O3OA 1GTEA 4IOCL 5DM7L 1FE4A 3TAMA 1EP4A 3KD1E 3O3GA 4J8FA 1URNA 4C7QA 2HHTA 2KN4A 4UT4A 1Q86O 3LPUA 2V7ZA 3ZT3A 4CIOA 3G82A 5FPMA 2B0GA 2FVPA 3TAQA 1N0VC 1H2VZ 5LSRA 4JI7J 2QYGA 1UMJA 3QB0A 2HVHA 1HNXF 1ZA2B 5I42B 2CAJA 2R7RA 3D67A 4TVAB 1QVFR 4NL5A 4UQGA 4AYBD 2CPYA 4J9OA 1HWKA 4DMNA 2MKHA 1VIXA 4FM1A 2O8EA 3TUJC 4DTRA 1GAOA 2GV1A 1ZTWA 3OY9A 2DNGA 2KT5A 3HHLC 2NXNA 2BV3A 2J0QD 4GW6A 4W5QA 3BN4A 2OHDA 4KC5A 1JJ4A 4FOIA 4OV1A 2ZH1A 1RDRA 1IO2A 4OX9J 1X31C 3OBYA 4WYWA 1RT2A 1NLKL 5IWAJ 6AT1B 4MJKA 4R0JA 5CZXA 1OH8A 2OPRA 3M7VA 5HLFB 1DARA 1AZSB 4KBOA 2B4VA 3CFOA 3AH6A 1FXXA 3KK3B 3OTCA 4LF6J 3CIPA 4LF7K 3TANA 4DFKA 3M1VB 2HF4A 5I3UB 1VHXA 3QIPA 3SIPB 1VC5A 3GZ7A 5AQXA 1VQKN 2PSZA 3J8AA 1H72C 4GVMA 3CO0P 4J9LA 3KNAA 4TQSA 1NU0A 5J2QA 2H5EA 2ZH5A 4L8RB 3BPDA 1U2VB 3BGLA 4OYBA 3M6VA 4C48A