1UWBA

Tyr 181 cys hiv-1 rt/8-cl tibo
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE
publication title Crystal structures of 8-Cl and 9-Cl TIBO complexed with wild-type HIV-1 RT and 8-Cl TIBO complexed with the Tyr181Cys HIV-1 RT drug-resistant mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Aspartyl protease
total genus 131
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1uwbA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1uwbA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1uwbA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1uwbA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1uwbA05
4CECA 4RUCA 1JLEA 4CGGA 2XY8A 2YNHB 1FKPB 5KT2A 4K4TA 2IGIA 3SUNA 4ED3A 1X9WA 4QOZB 2R7YA 3MXIA 1KVCA 2G8WA 1NK5A 2LSNA 3HPHA 2VG5A 2E4LA 4C8KA 5KG4A 3P1GA 4M94A 4KE5A 4FJ8A 1S6QA 4ECTA 3AVHA 2IMWP 3TAQA 4EZ9A 2P51A 4PQUA 3S3OA 1IKYA 3PW5A 2AGQA 4O3SA 3DYAB 1C2PA 1A5VA 4HKQA 4EBDA 1UOCA 3VQBA 3M9NB 3AO1A 2BANB 3KK2B 3HP6A 2I5JB 5KG5A 1QSSA 3DOKA 4OKEA 4KO0B 4CGIA 1ZBIA 1S9EB 4M3WA 4EYIB 1ZBHA 1JKHB 4QPXA 4AH9A 4ZHRB 3PX0A 3SFUA 3RB0A 5KT7A 5KFIA 1JX4A 4NLXA 3NGYA 1EP4A 4EBCA 4FXDA 1LWEB 4PUOB 2QKBA 1SV5B 3DRRA 1RT4B 2YV0X 3VA3A 5KFUA 5FDLA 1BGXT 4CGJA 2ASDA 3M9OB 3DOLB 3OLAA 1XHXA 2XHBA 2IM3A 2BR0A 3UPFA 3MAQA 4CJKA 4KV8A 4CK3A 4IDKB 2AX0A 1C1CB 4PWDA 4ED0A 2WOMA 1IKWB 3BQ0A 1XR6A 1QE1A 4ECXA 4ED8A 3M8QB 2E9ZA 2D3ZA 4J9NA 4Q44A 3ULDA 4KKOB 4FJIA 4K4YA 3V81B 4TY9A 4TY8A 5T7BA 1JLCB 3E01B 3RR8A 4KB1A 1UA1A 4ICLA 2Z1GA 4RNOA 5J2MA 5CZ1A 1TL3B 1I3AA 3S9HA 1NK8A 4OLAA 4ECUA 5KGXA 3OSPA 3L2VA 3ZSYA 3C6TA 4O3QA 3ZSQA 1RBVA 5KFXA 4KBIA 4WZMA 3U3GA 4DTOA 1KLNA 2W9CB 2ZD1B 5KG6A 4CHZA 3DRSA 1G15A 5J2NA 4B9UA 2HVIA 4FW1A 4ELUA 3QEPA 2P1JA 5KFHA 2D0AA 1MU2B 1A5WA 3KTQA 2BGGA 2W9BB 4OLBA 4RNNA 4KI6A 4W5NA 1HYZA 3RRGA 1SKWA 1LAVA 3OYFA 4K50A 1SH2A 4FM2A 1EETA 1GOCA 3RMAA 3NF7A 4E7HA 4CF2A 4DU1A 2WONA 4Q5VA 3G86A 4DG1A 5KFNA 2BE2A 3PVXA 5DQHA 5KG0A 4CJQA 3B6OA 3MECA 4PQUB 4HCBA 3AVCA 1IKYB 3MR6A 4DFMA 4CIGA 4KTWA 2HNYA 2XC9A 3DM2A 4DL2A 4HUGA 2KTQA 3GV5B 3H4DA 2WCXA 5F9NA 2HHQA 1J54A 4ZP7A 3U6FA 3H59A 4FM0A 3V6DA 4FJLA 1FKOA 3JSMA 1KVAA 4CJPA 3IG1B 2UVRA 3ITHA 4M95A 4H54A 3QEWA 1BIZA 5KFZA 1YVFA 4IKAA 4CESA 3K58A 3SUQA 2IDOA 1RDAA 2R8KA 5CYMB 3SUOA 3BREA 1EP4B 3AVGA 3DLEB 3KD5E 4IR1A 3IRXB 2FLNA 4O0IA 4NCAA 1N4LA 2QV6A 2HB5A 5SWMA 4F4KA 4Y1DA 3QZ8A 4KV8B 3QLHA 5F8IA 3DRPA 4IRDA 3ALYA 3OYNA 5F8GA 4B9LA 4PWDB 5CYQB 2KZZA 2WOMB 2HNZA 1QE1B 1Q8IA 3SUPA 4FJNA 3QO9A 4NYNA 1KCFA 1QQCA 3Q8PB 4GMJB 2J6SA 3MR2A 4N41A 2V0NA 3N6NA 1KRPA 3ZT0A 4ICLB 1D5AA 5J2MB 2W7PA 1KSPA 2R8JA 4EP5A 1S97A 4I7FA 3KKSA 4ED2A 3C6TB 1TAQA 4JRQA 3PZPA 2YHAA 3MF5A 3AVAA 4ID5B 3CM5A 3DRSB 4CEEA 5HLFA 4K8XA 3TABA 4Z0UA 3TAPA 4MK7A 4KI4A 2C2RA 4M41A 1X9MA 1RT7A 1CZ9A 2ASLA 1Q9YA 4NZ0A 4DS4A 2OPRA 1I39A 3CM6A 3S3MA 5KFTA 4CGFA 4DTRA 3RMBA 1VRTA 2OH2A 1EETB 2IBKA 4LY7A 4I2PB 3VQEA 3SZ2A 3OHBA 1JXEA 1JLGB 3LP0A 3M9MB 4KHQA 3K57A 4E7KA 1BQNA 3QEXA 4DMNA 1JLAA 3MEEB 3AVJA 4DTXA 1VSFA 3MECB 3MR3A 2V9WA 3VQPA 2XY6A 3RMCA 2JGUA 4AHRA 1S1TA 3KHRA 3PO4A 2HNYB 2Y1JA 3DM2B 2W8LA 1KFSA 2R2SA 3CDUA 3EZUA 3Q8QB 3I0SB 4KREA 3DMJA 3T19A 4FCYA 3AO2A 4CFAA 3TR8A 3V6DB 1FKOB 1B92A 4DU4A 2ILYA 3PX4A 3AVNA 4FM1A 3HPGA 3ITHB 1NKEA 1EX4A 5EU7A 2FBTA 1RBRA 3NGDA 4ED6A 4I9LA 4F2SA 1HQUA 2OZSA 3H5XA 4FW2A 1FK9B 4RNMA 3T1AA 1JL2A 4DQSA 3BGRA 4M3XA 3EPGA 5KRSA 4O4RA 2ASJA 2E9RX 4BWMA 4FZZA 4ED1A 1TKTB 1BQMA 4F2RA 2QE5A 3KKRA 3NH1A 4G1QA 4MKAA 4FS2A 1TK0A 2FJVA 4Y2AA 5J1EA 5KFOA 3SYZA 4BE0A 3V1OA 4TYBA 2IJNA 2HNZB 4LQ9A 2EX3A 1S5JA 2EHGA 1KFDA 2RN2A 4N5SA 5EWGA 1YVUA 2OPSA 3I5CA 4FBUA 3ZSZA 1TK5A 2XRIA 1HYSA 3LZJA 4NRTA 4E7JA 5KT6A 4WFZA 1HJRA 3I0RB 4LH4A 2IJFA 3SV3A 3K5LA 4DLGA 2KW4A 2R8HA 4EBEA 4IKFA 1C0UB 3TANA 1Q9XA 2UVUA 2QXFA 4B9NA 3LALA 3ASMA 3LP1A 1NJYA 1WAJA 1RT7B 2OA8A 2VWKA 4RW9A 1VSKA 5KFDA 1NJZA 4WZQA 4HYKA 2DY4A 4CCHA 2R2RA 3G6VA 2OPRB 5CZ2A 4DTMA 3WNEA 3D45A 2D41A 1VRTB 2GIRA 2FVPA 4FJHA 3ZT3A 3LP0B 3OS1A 1GX5A 1DLOA 3N6LA 1BQNB 1VSIA 4KB7A 3MTKA 1RBUA 2R2TA 4J9RA 1WSGA 2O4IA 3C6UB 5KG1A 1QSYA 5C5JA 4Z4IA 3DYAA 2AJQA 5HROB 2FJWA 3DLBA 4E7IA 1C1AA 2GV9A 1S10A 1NNDA 4C8NA 4KO0A 1X9SA 3OYEA 4K4SA 1S9EA 3IS9A 1JKHA 1L3VA 3F73A 1HQUB 4ZHRA 4CJRA 4CFCA 3O3HA 4M45A 1BHLA 4DTUA 3ISNC 3UIQA 4M42A 2IM0A 2HWHA 4PUOA 1SV5A 4DU3A 1RT4A 4NLSA 4PA1A 1Z25A 4N47A 3IAYA 2KQ2A 1UA0A 2GBZA 2IAJA 4CJVA 1KHVA 4CHPA 4G1QB 1C1CA 4DSJA 3NF8A 4NLYA 4J9KA 4CJSA 4JS4A 3CDWA 3KD1E 1DTQA 1JXLA 1CSJA 2OPSB 4URQU 3DLRA 2VA2A 3SQ0A 3CFRA 1U49A 5KFEA 3V81A 1HYSB 1JLCA 1MMLA 1JLBA 1UWBB 1IM4A 1QUVA 4ZPBA 4ZPCA 4JLHA 1S9FA 1QAIA 4XIUA 5KI6A 3LWLA 1TL3A 4XPCA 3PX6A 5I3UA 4ZPAA 1LV5A 4W5TA 1WAFA 3OY9A 4CGHA 4Z4HA 4RW7A 3ZSWA 2JEJA 4JV2A 4RW4A 4E19A 4DQQA 5EWFA 1RT5A 4RW9B 1EKEA 4FLWA 3IGVA 4MFBB 2WTFA 3GIMA 3H4BA 3AVLA 1VRUA 2W9BA 4CE9A 3LANA 3RAQA 4IG0B 1NJXA 3NAIA 4KTQA 1RCHA 3LPUA 1HNVA 4CEBA 2G8UA 3OYCA 4HUEA 3CJ4A 3T3FA 2OZMA 2FBYA 1DLOB 3VQCA 4Z4GA 3QESA 4XO0A 5C25B 2VG6A 3TVKA 4M3YA 1S0NA 2G8FA 1JXBA 3GIKA 4MQ3A 2G8HA 4W5RA 5HP1A 4LSNA 3A2FA 4KSEB 4XPEA 2D0BA 3OL7A 2FBVA 3SQ1A 3AA2A 2GIQA 4EEYA 4ZVHA 3OYBA 3TI0A 4H8KA 5KFQA 4ECVA 4FLUA 3NAHA 4OPJA 3IG1A 4OKJA 1T3NA 3PY8A 1RTHA 3I8DA 3H5SA 4Y1CA 3IS9B 1HMVB 4O55A 4KHSA 1BCOA 2XCAA 5CYMA 3ZT2A 3KHLA 3TARA 4EO8A 2WK4A 3HHKA 2HVHA 4CGDA 3PO5A 3DLEA 4U7CA 5JS2A 4UQGA 2QK9A 1T03A 4GW6A 3IRXA 3LP2A 1T7PA 2A1RA 3GYNA 4DQIA 5C24A 3V9UA 2IAJB 2EC0A 1DTTA 3KLHB 2X6SA 4WYLA 4K8ZA 3SFGA 3NCIA 5CYQA 4DSLA 3V9XA 2V4QA 2B4JA 1DTQB 1JLQA 2XI2A 4M3ZA 2ATLA 2HHSA 4FLVA 4KHRA 4R8UA 3NMAA 1NOYA 1B9FA 3VQ5A 1JLBB 1RYSA 4URGA 1XI1A 5I3UB 4ZP9A 3IN5A 4OVLA 5KFGA 1CZBA 4B9TA 1WNSA 3KK3B 3NF6A 1J9AA 2OYQA 1J5OB 2F96A 3RMDA 2HMIB 4RW7B 4ID5A 1NJWA 4RW4B 1RTDA 1RT5B 3O3GA 1VRUB 1K6YA 3KLVA 2YHBA 1S49A 3M8RA 5KFCA 4B3OB 1HNVB 5L9XA 4I2PA 1JLGA 4G3IA 3AVIA 4EZ6A 2ZE2A 1S0MA 4ZP6A 3EYZA 2VG6B 4ECWA 4ZTJA 3MEEA 2PYLA 1NKBA 4MK8A 5HP1B 3OL8A 4LSNB 1D1UA 5C42A 1NHUA 3RB4A 5KFVA 1BL3A 3HPOA 2NUBA 3BR9A 3RR7A 5DK5A 4DSFA 4PY5A 3I0SA 5F8HA 3IGNA 4FJXA 4CFBA 2FVCA 1B9DA 3NBPA 2PYJA 3V4IA 4FJMA 3HO1A 3CFPA 4GVMA 4KHYA 3PJWA 4L8RB 1RTHB 1HPZA 1QS4A 2C2DA 1T8EA 4DL7A 1S48A 4IR9A 4DF4A 2KFNA 2FBXA 1FK9A 4IG3A 1GX6A 1VSMA 3RRHA 1W0HA 1T03B 4NLRA 1JIHA 4FLYA 3LP2B 4NCGB 3VQ7A 1ASVA 5C24B 3ICLA 3DLHA 1L3TA 2B6AB 4DF8A 2JEGA 4M3RA 1TKTA 2Z1IA 1DTTB 1S6PA 2HAIA 3D28A 3NKYA 3RTVA 3HJFA 3NH2A 3SPZA 4QW8A 3O3FA 1XHZA 2D5RA 1JLQB 4F4YA 1QAJA 1NK7A 5KFLA 4R8UB 5KFPA 3K5OA 1SL1A 1S1VA 1CLQA 4BDZA 5KG7A 1RT1B 3BQ2A 1TK8A 3QGGA 1Z26A 3O4QA 4CERA 4J9LA 2R8GA 5EUHA 3I0RA 3K5NA 5J2QA 4R0EA 4TSXA 4ELVA 3NE6A 3HYFA 1JLFA 1C0UA 3DLKA 4RZRA 4CEQA 2BDPA 2BQ3A 4F4ZA 4IQXA 1SH3A 3S3NA 2C2EA 1RTDB 3KK1B 3G6YA 2DFFA 3DI6B 4IFYA 4NLOA 4OGCA 3L3VA 3T5LA 1N56A 3PR5B 3AVMA 3TAGA 1HQEA 3GIJA 3SQ4A 1HRHA 1IG9A 4RNHA 3KOAA 4ELTA 4AILC 1NKCA 2ZE2B 1ZETA 4TN2A 1TGOA 3TAFA 4Q45A 3AO3A 4YP3A 3AO4A 1HARA 4WXWA 5C42B 5KFFA 3C6UA 3CYMA 4IRCA 1U48A 4JS5A 2FVRA 3RB6A 5L1JA 5HROA 4RUAA 5L1LA 1D9FA 2FJXA 4LD0A 3NBPB 4WYWA 3WNFA 4IH6A 4KAIA 4DSIA 3V4IB 2ATQA 1WSHA 3LWMA 3CDEA 4CEAA 3CJ0A 1HPZB 4CHOA 5F9LA 3BSAA 5KG2A 3OYGA 2F8EX 4GC7A 1HNIB 3AA3A 1RA7A 4ED7A 4IG3B 1BIUA 2GC8A 2KFZA 4E3SA 1S6PB 3L2QA 5L1KA 2CJQA 4Z4EA 1NHVA 4Z4FA 3QZ7A 1S0OA 3AVFA 4N76A 2AWZA 3LDSA 4FLTA 3FQLA 4ZMMA 2B5JB 1S1VB 3QIDA 3RWUA 1RDCA 2YNIA 4H4OB 2WB4A 1UWBA 1WSFA 5E41A 1IKXA 5J2QB 2WRMA 3FFIB 1FXXA 1RDDA 2RPIA 3LPTA 4ECSA 3PUFA 3CQ8A 5L1IA 1JLFB 4C8OA 1WNEA 3VQ4A 4EO6A 3DLKB 4Z4CA 3P83D 2DPJA 3HVRA 3HKWA 3HVWA 3ZSXA 5HBMB 3NDKA 4ZP8A 4Y34A 4KRFA 4MFBA 2KZMA 1TL1B 1I6JA 4NYFA 4IFYB 3BSCA 1NK4A 5HRPA 4FS1A 3M8SA 1W9HA 4E0DA 2ZKUA 3SQ2A 3EPIA 3PW2A 4ECZA 1U09A 4IG0A 2C22A 1TKXA 1L3UA 4CJLA 4FJ5A 1U45A 1HQEB 4EP4A 3OYDA 1D8YA 5DG7A 5I42B 4DL4A 5C25A 4ECYA 4F50A 4M3TA 3DDKA 3WNGA 3I5AA 4OKKA 4DQRA 4GC6A 4B9MA 3ZCMA 4IFVA 3UDLA 3PV8A 2BQRA 3UR0A 4C8LA 2YKNB 4KFBA 1S1XA 2RKIB 2DFEA 3VQDA 4FLZA 3BJYA 3VQSA 1REVB 4HTUA 1HMVA 4J2BA 3MEGA 4O5BA 1VSHA 4JV0A 4DSEA 4FZXC 2HNDA 4NLWA 4CJFA 3MEDA 4BDPA 3GIIA 4MIBA 5KRTA 3LAKA 1WLJA 4O44A 1RTIB 1KHWA 4CHQA 3HL8A 2ZQBA 3HK2A 4CF9A 1WSEA 4ID1A 3KLHA 1VSEA 1D9DA 3OYLA 3NAEA 5K14B 1VSLA 2D0CA 1WSIA 5F8MA 3NF9A 1TKDA 1LWFA 4CEDA 3F9KA 1CXUA 3QETA 3VQAA 4IBNA 3NGZA 3OYIA 4NYZA 4OPKA 1NK6A 3O4NA 1RT6A 3TQ1A 4NLPA 5F8NA 4LSLB 3SJJA 4YMEA 2YNIB 4F4XA 3OYMA 5DGBA 2IC3A 3THVA 3KHHA 2W8KA 1IKXB 1U4BA 4FK4A 1GOBA 4E1NA 4BWJA 4K4XA 4HCCA 4N56A 3KK3A 3BDPA 1W25A 5EWEA 3QNNA 1N6QB 1J5OA 4URSA 2HMIA 3FRZA 4R5PA 3MXJA 1X1PA 2X74A 3OL6A 2AGPA 3KLEB 2Y1IA 3Q8SB 3OJSA 2YNFA 3PW4A 4AHUA 3OYKA 2HHTA 4Y2CA 4CJWA 1LW0A 4F4WA 1WSJA 1TKXB 4H4MA 1A5XA 3ISND 2YKMA 2FVQA 4B3OA 3VQ8A 5KT5A 3FQKA 4DL5A 4E7LA 4CF1A 1LAWA 4DWIA 3VQ6A 3JYTB 4LH5A 5KFAA 4WE1A 4TQSA 1IO2A 3G0ZA 3L8BA 3ZT1A 5KGWA 4OJRA 4O3RA 1ZTTA 1RNHA 5J2PA 1SUQA 2P5OA 2R2UA 2AGOA 1RTJA 5HRNA 2DTUA 4ZVFA 2RF2B 3CG7A 3C94A 4MH8A 4IFVB 2JC0A 2HHWA 4FK0A 4JRPA 4KFBB 1S1XB 3MFIA 2AX1A 3V6KA 4O3PA 4RW8B 5DGAA 3UQSA 5F8LA 1L5UA 3L2UA 2O4GA 2IA6A 3MEGB 1YTAA 4K4VA 3OYHA 2HNDB 3H2LA 4QWCA 2R8IA 1KTQA 5KG3A 1QHTA 4CJ5A 3MEDB 3PJXA 4FJGA 2OPQA 4NCGA 4O44B 1IKVB 1VSJA 3VQ9A 4EYHB 1WN7A 1T94A 4J2AA 2B6AA 4QWEA 3QGHA 5DG9A 4DTSA 1C1BB 3KMSA 2WHOA 1K1QA 2AQ4A 3K5MA 4ECRA 2W42A 1LWFB 1N5YB 3NHGA 1ASUA 2UUWA 3CO9A 2E6MA 2Q3SA 3BQ1A 2A1SA 1ZYQA 3GILA 4DSKA 1RT6B 4TQRA 3MXMA 4QW9A 3AA5X 1ZBUA 4ZVGA 4AHTA 1RT1A 4CEZA 4HUFA 2DPIA 2IC3B 3E51A 3CVKA 4IH5A 2XI3A 5D3GA 3TWHA 3PHEA 4KHNA 1NK0A 3EY1A 3EZ5A 3G10A 2HWIA 1TAUA 4Q0BA 4TLRA 4O3OA 1J53A 3TAEA 1RDRA 4CF0A 3ZSRA 3V6JA 3OLBA 1ZBFA 4R5PB 5CY4A 3QEIA 4KHWA 1HYVA 3SNNA 3KK1A 4OGEA 3DI6A 5KTQA 4CFDA 2YNFB 3LAMA 3KLIB 2Z1HA 1LW0B 1Z4UA 2V4RA 1BI4B 3SCXA 4H4MB 3WNHA 4WFXA 5FRNA 4QWBA 3CFOA 1S4FA 2YKMB 3AVBA 4JUZA 2X6NA 3B6PA 2F8TA 2JC1A 3M8PB 2IM2A 4CJ4A 1SH0A 2ETJA 1RAJA 4WE1B 3P5JA 4FYDA 1JLEB 5J2PB 1SUQB 1S1WA 3DLGA 2GUIA 2Z1JA 1BCMA 1LWCA 5JS1A 1RTJB 3VA0A 3KLGA 5KFMA 2HHUA 3H08A 4K4ZA 3AVKA 4ZPDA 2IM1A 1IH7A 2HW3A 3HP9A 2VG5B 4CJUA 1RDBA 2ILZA 1S6QB 2DFHA 1TVRA 3L3UA 2G8VA 4FJ9A 4QWAA 5KFSA 2XCPA 1KLMA 2C28A 3VQQA 5JXSA 2G8IA 3QERA 3HVAA 3QGIA 1XC9A 4DS5A 1HNIA 4NLQA 4CJ3A 4CJTA 4CHYA 1XR7A 4FZYA 1C6VA 4YNQA 3DOKB 1Y97A 2OPQB 3OSNA 4TYAA 1JL1A 3OHAA 4HHTA 2FLLA 5DLGA 3ZSOA 3NL0A 4MK9A 3GV8B 5T14A 5DQIA 2RDIA 1CXQA 1O1WA 3NFAA 3AA4A 4E1MA 4IOBA 3DRRB 1UAXA 5FDLB 4MKBA 2FLPA 2B5JA 4X2BA 3VN5A 2J6UA 2JLEA 4BE1A 4H4OA 4FK2A 4ZTFA 4AHSA 4YR3A 4B8AB 3H40A 5D3GB 3TAMA 4J2EA 4CJEA 4W5OA 4RNFA 3OL9A 4HVJA 3FFIA 1K1SA 4K4UA 4Q0BB 4KHUA 4F8RA 2CKWA 2VG7A 1TV6A 1RT2A 5KFRA 2J6TA 4FBTA 4TY8B 4KPYA 1RT3A 3HVTA 3NGIA 3V1QA 2UVWA 2VA3A 5HBMA 1OS5A 1R0AA 3FDSA 5DMRA 3RAXA 4M3UA 1TL1A 4LQ3A 1C0TA 4ECQA 2YNGA 4TXSA 1YT3A 4FVMA 3H5YA 3V1RA 4DLEA 4NRUA 4RW6A 4CIEA 4KHMA 3BSNA 3FSIA 2JEIA 1NK9A 5J2NB 2P5GA 3V6HA 3QNOA 3AO5A 4O4GA 4DQPA 3QIPA 5I42A 4U6PA 1GOAA 3KMQA 3RBDA 2FVSA 2O5DA 1S1WB 3DLGB 3RBEA 3RB3A 1LWCB 5HRSA 2FC0A 4DTPA 3KLGB 1TQLA 3PR4A 4O0JA 2WONB 4KAZA 3OYJA 4DG1B 2BE2B 1NOZA 1TKZA 2YKNA 2VWJA 2RKIA 1TVRB 4Q8EA 1U47A 5KFJA 4CHNA 1KLMB 4J2DA 1REVA 4WXOA 3KNAA 2XY7A 1LW2A 1U04A 4YR2A 2E6LA 3KLFA 2JEFA 3KJVA 3JSMB 3CIZA 1ZBLA 3GQCA 4NCBA 3D0PA 4QCLA 2BRLA 1ASWA 2F8SA 1RTIA 2D3UA 4I2QA 3V9ZA 3QINA 4C8MA 2XO7A 3HT3A 2PZSA 4B9SA 4DTNA 4FLXA 4B9VA 3G6XA 1S9GA 5K14A 3T5JA 3KIOA 2XGQA 5DG8A 3Q8RB 1TP7A 2XGPA 4BACA 1RYRA 2IS3A 5DQGA 1QSLA 3D5MA 3T5HA 2OPPA 4W5QA 4CEOA 3BSOA 3HM9A 4B8CA 1ZTWA 2AU0A 4QWDA 4IRKA 1D0EA 1N48A 4LSLA 4E89A 4KTZA 4F3TA 3QLHB 3DRPB 4FJKA 3TAMB 2B43A 1YTUA 4DEZA 4NLGA 4J9PA 1S1UA 1RBSA 3QO9B 3HSTB 2IOCA 2QKKA 3H5UA 2PY5A 2VG7B 1TV6B 1RT2B 1N6QA 4DFPA 1RT3B 3HVTB 2XWYA 2D7SA 4WFYA 1R0AB 4ZVEA 4I7FB 3KLEA 1RBTA 4I9QA 1C0TB 4YR0A 1T05A 2YNGB 4CIFA 1C0MA 3N6MA 4RW6B 4BE2A 3GV7B 5KFYA 4DL3A 4QAGA 4B08A 5HLFB 1SKRA 4AHCA 2HHVA 4O4GB 1BISA 3QIPB 3I5BA 2G8KA 4Q8FA 3JYTA 3CWJA 4CK1A 2BQUA 3K59A 2BRKA 3LZIA 4CEFA 2YNHA 1FKPA 1ITGA 3QYYA 4DFJA 2E9TA 3CJ2A 5FRMA 1RA6A 5JUMA 3V9WA 2RF2A 4K4WA 3PW7A 2UUTA 4CK2A 4JV1A 1JLAB 1TKZB 4O3NA 4DL6A 4MIAA 3OYAA 1VK0A 2ALZA 4RW8A 4NLDA 1SL2A 4BDYA 1S1TB 1LW2B 3MR5A 4F3OA 3V9SA 3DMJB 1XWLA 3KLFB 3K2PA 2BANA 3KJVB 3KK2A 2I5JA 5DLFA 4FJ7A 1IKVA 4I2QB 4DFKA 4RG8A 1L3SA 3SPYA 4AHVA 1EXQA 5KT4A 5KT3A 3OJUA 1S9GB 1C1BA 3BGRB 1KVBA 3AV9A 3SI6A 5FROA 4DTJA 5HRRA 1LWEA 1N5YA 4RU9A 1RILA 3OS0A 2OPPB 3ZSVA 5F8JA 4FJJA 4OL8A 1XR5A 4J9MA 3DOLA 4J9OA 1BQMB 4KB0A 2UVVA 4IDKA 3T5KA 3KHGA 1VSDA 1SKSA 5J1EB 3QEVA 3HXMA 4Q43A 3ZT4A 4IH7A 3NH0A 1IKWA 1S1UB 5SZTA 1QTMA 3M8QA 3CJ3A 3L2RA 2ITGA 3C95A 4KKOA 3MFHA 3OS2A 2X78A 3L2WA 2HHXA 3U3YA 4Y3CA 3SI8A 2W7OA 2RDJA 3E01A 4YFUA 2I1RA 4J9QA 3CJ5A 3KLIA 1T05B 2XY5A 5KFKA 3PW0A 1BI4A 4YQWA 5KFBA 3LP1B 4NLVA 4J9SA 2W9CA 2ZD1A 3H98A 3OVNA 3SV4A 1F21A 2W9AA 4NLTA 1MU2A 5EDWA 3M8PA 3QIOA 4CF8A 5KFWA 4NLUA 1SL0A 3LP3A
chains in the Genus database with same CATH superfamily
2P8IA 4RUCA 3U9ZA 4CGGA 3OW2R 2XTJP 2HGMA 2YNHB 4DR4F 4A8WA 3L7UA 1WACA 1NMDA 3MXIA 1EX8A 3CJTA 2G0IA 1KVCA 1KBRA 3VGVA 4CYUA 1E4GT 5KG4A 4M94A 3TAQA 4EZ9A 5E3CA 3S3OA 1IKYA 4XEIA 4H03B 1RHUB 4O3SA 3QATA 3R5JB 5GMKa 1C2PA 4B1VA 2ZZMA 3J7AP 4NLBA 1JCGA 1FRJA 3AO1A 5K8NA 2OMOA 3O1WA 2ZC3A 4CGIA 2C3OA 3Q7CA 2JVOA 5HL7Q 1ZBIA 1JKHB 2ZOMA 1EARA 3M30A 4ETZA 4AH9A 3PX0A 2UXCK 2KRRA 2MHEA 5KFIA 1JX4A 5B0GA 1FRLA 2B7BB 4R25A 4NYOA 5BR8J 4PUOB 3GJRB 1PC4A 3DRRA 1TUUA 2O8FB 5FDLA 4C97A 3QRRA 3UPFA 1IWAA 3MAQA 4CJKA 4C3LA 4I1TA 1FVSA 1NB2A 4BRDA 2GWJA 1IKWB 4ED8A 4P75A 1RCOB 4Q44A 4A8SA 5BRDA 1XMQF 3M4XA 3T1HF 1JLCB 3E01B 1HX1A 2NRWA 2YHYA 4H0VB 1I3AA 1EB0A 1O6XA 3C6TA 4KBIA 4WZMA 3U3GA 1KLNA 3W8GA 4JYAK 5KG6A 1G15A 3CJ1A 2P1JA 1MU2B 4USHA 2BGGA 2W9BB 1IBCB 4W5NA 4U8YA 3OYFA 1GAOA 3M6UA 1U2VA 2Z30B 4DU1A 4IOAL 1WC0A 3EVWA 4DUZF 3PVXA 3W5ZA 4UOCA 1EKRA 1V5VA 3KNGA 3B6OA 2KHOA 1VQON 4HACA 1EWQA 3AVCA 5LJ5Y 3MR6A 3EN9A 4ERDA 3DM2A 2CPJA 2EKYA 1SJ4P 4K8RA 5AQWA 3H59A 3JSMA 3MM7A 2ZGYA 1BWEA 3ITHA 3SMSA 2BW7A 3CJRA 5FLXO 5EXWA 1NLKL 3SUQA 1I51B 3RG6A 2PE8A 2BJ1A 2P9EA 3TJ8A 2K7KA 3BB5A 2CG4A 1H2UX 3BREA 4QS7A 2ZH8A 3MI7X 3IRXB 2D0OA 1N5VA 2LXFA 1VOMA 3QLHA 5F8IA 3PNIA 1ZBSA 3ALYA 4Y65A 1N5QA 3A5NC 5CYQB 2KZZA 2WOMB 5KOXA 1QE1B 5D6GA 3MURP 5CZXA 2M3DA 4ANDA 3SUPA 3QO9A 1OVYA 3RSEB 3BH6B 3N0VA 1RWKB 1NU0A 1SIZA 4ATNA 3NGUA 3FJ2A 3TNVA 4CLFA 4X62F 2YI1A 2V0NA 1HHQA 4UUWA 3I55S 5CCLA 2BACA 3E1YA 3HHLA 2W7PA 3CCMN 3VEXA 4EP5A 1S97A 5IZHA 4RTFD 4ED2A 1TAQA 1DEJA 5EN1A 2IVFB 2YHAA 4ID5B 5HLFA 5BN8A 4DX8H 4PKHA 3TAPA 4Z0UA 2C2RA 2F1FA 1UZHA 3G82B 3GDQA 2L3MA 2OPRA 4OZ2A 5M2UA 1G99A 3CM6A 4WU2A 1XQIA 2WBRA 5KFTA 1EQMA 1HBNA 1EETB 4LY7A 4D3HA 2IBOA 1ZAXA 4Y2MA 3K57A 5FD1A 4OMFG 5JLFA 4E7KA 1BQNA 4DMNA 3O1LA 3MECB 5D0HA 3TVZA 4M5DB 4CLWA 1S1TA 1YIJS 1VQ8S 2Y1JA 1VISA 1KFSA 2R2SA 2AP6A 1BWVA 1HBMA 3DMJA 3T19A 4M1KA 3AO2A 2HBQB 3A0IX 2V52B 3PX4A 1GLAG 4BC5A 4J90A 1UEVA 3LH2S 4UW2A 1BMQB 4DUYK 1VQKN 4R79A 1M5HA 5IC6B 4GNIA 4RPFA 5E3AA 4G6VB 2BE7D 4A47A 3OVBA 4Y6IA 1T95A 3HZEA 4BLGA 4RO0A 3DHXA 3DGPB 4BWMA 2ZBPA 1WUAA 4F2RA 1NDLA 8AT1B 1PAUB 1WOQA 3L0QA 3SLCA 4FS2A 2EG2A 1XJWB 4NE9C 4OV6A 5J1EA 1WC5A 5K8MA 3VGTA 3V1OA 4PPDA 1K47A 2H9ZA 1T44A 5LSLA 1S5JA 4IUFA 1JCFA 3ZSZA 3OHRA 2YPYA 1X7VA 1HYSA 2VB6A 4WFZA 3I0RB 4LH4A 2IJFA 3SV3A 5A8RA 4P6QA 4IKFA 4H5VA 2HHHJ 4DUYJ 2UVUA 3ASMA 1MW7A 1RK8A 4LF5K 3BH7B 3ZZ0A 1CJKB 1CZAN 4RUHA 2J0WA 4CCHA 2E1YA 2OELA 3UDCA 2UUAJ 3OFFA 2DCLA 2D41A 1VRTB 4KR0B 2J8SA 1V6HA 2YBVA 3ZT3A 3PLAA 1SC1B 3ZO7A 4JAXA 2EG1A 4ISFA 5DM7L 3RJMB 2QMXA 1Q16B 2A2CA 1DLOA 3FEYB 3N6LA 3UKRB 3AA8A 3T7ZA 1W2BM 1RBUA 4YORA 2NZ4A 3MWPA 1R8AA 5G0RB 1MSWD 3EE8A 3NCPA 4ZVSB 3DYAA 1FRIA 1NGAA 2HRTA 3AT1B 1XNRK 1R59O 4E7IA 4C11A 1C4AA 2GQCA 2GV9A 1ZC6A 3MCOA 1NNDA 4C8NA 4KO0A 1X9SA 2JFKA 5BXIA 1F5CA 4L74A 3BZQA 2CQ3A 3F73A 3VGMA 4CFCA 2NXJA 4M45A 3WXKA 4X4OA 2WVFA 1U1OA 4LF5J 4HTIA 4XH1A 3AY0A 2FY8A 4U7BA 3UIQA 4M42A 1FJ7A 4A4JA 2HWHA 1F9FA 2BJ3A 2PEBA 1SV5A 4N47A 2OP5A 1UA0A 3CCQN 2GBZA 2D3OR 3CMAS 3CPWM 2XYGB 4CZGA 1NDKA 3PHTA 3M32B 3O4WA 1TUWA 1RAHB 2ZH2A 3EKUA 4CJSA 4IOCL 3WXJA 4ILLA 2XMAA 4UZBA 4JI4K 2OPSB 1Q8KA 4DV2K 3SQ0A 4I0WA 3CFRA 3V81A 1UW9A 2F5GA 1YJUA 3EVOA 1UWBB 1NAQA 3K17A 1QAIA 1T11A 3LWLA 4S0MA 2ZDOA 4XPCA 1FVQA 4W5TA 3H20A 3TTFA 2HLTA 1SQFA 5A8WA 4DR6K 3OXGA 4L3QA 3LW5C 4RW7A 1BE4A 1SS6A 5AE2A 3GIMA 3H4BA 3POTB 3J81U 1Y3KA 4JI3F 1HNZK 1RKJA 3H1VX 4BG9A 3DDIA 1KQGB 3LDQA 2ZITA 2LA4A 1HNVA 4K5SA 3OYCA 5CR4A 2Q31A 1GLDG 2OZMA 2J7WA 2VG6A 4RL1A 4M3YA 3QPIA 1JXBA 3ZNUA 3A2FA 4KSEB 1U6ZA 3Q23A 4DV2J 2CPZA 3OL7A 4M5LA 2FBVA 2ZH5A 3AA2A 2A1BA 4KH5A 2KI2A 2GIQA 4Z94A 1HUXA 4EEYA 3BZCA 4OX7A 2QWRA 4H8KA 4P74A 2QO3A 1FRHA 3FBCA 5KFQA 1LFWA 2A2DA 5E0OA 2JFDA 2H3EB 2DK2A 3W3DA 3IG1A 4OIXA 5AQPA 5C15A 3R5DA 3EGWB 3I8DA 4Y1CA 3IS9B 1LOTB 2RNEA 2OKQA 2D74B 4KHSA 3UVJB 4YOUA 3ZT2A 3KDOA 1HBUB 4EO8A 6FD1A 1UL3A 3AXMA 3DLEA 1TUGB 4UQGA 4FPBA 2QK9A 2O8BA 3J7A1 1T03A 3LP2A 5C24A 3BBFA 2MJNA 4FWNA 2YHXA 3QRQA 2JX2A 2N4DA 2IAJB 2C1EB 3ZZOA 5B0FA 5EVZA 3CCVN 4WYLA 4K8ZA 1R43A 2QFJA 3NCIA 4F25A 2B4JA 1DTQB 3K8VA 2HWTA 2XI2A 5ETPA 5HO4A 4KHRA 4A2BA 1E6YB 4G1IA 4GVBB 2VC1A 1WHWA 1RP5A 3FK4A 2E5JA 3CIPA 3LM9A 3IN5A 1WC4A 1CZBA 3KK3B 3K0SA 3RMDA 2F96A 2HMIB 3UE2A 3SSSA 4CP5A 4RW4B 2CVEA 4J8FA 1S59A 2W6KA 1VQNS 2F9WA 4BC2A 1VRUB 1MWZA 3DN9A 1WB9A 2YHBA 4WFAQ 2FTRA 3QFUA 5L9XA 1DZ5A 1JLGA 4G3IA 2QLJB 2ZHAA 2BKPA 4KC5A 3A3NB 5KFVA 3HPOA 3BGFA 4TNOA 3CERA 5DK5A 4ER8A 1B9DA 3VF6A 1NRKA 1OY8A 6FDRA 2HQGA 2AJFE 4KHYA 2DY9A 3PJWA 1Q5VA 3OTEA 3A1YG 3C2PA 4J5OA 1T9TA 4ZPTR 2GVDB 3KG0A 1QS4A 4FKXA 2DT9A 4A59A 1NNEA 1U24A 1YJTA 3PSIA 4BR5A 2LECA 3EGNA 2KFNA 5AQGA 1JJHA 3FBBA 1U2RA 1AZSA 4DPTA 2GJ2A 2KKHA 3H90A 4FXVA 2N4CA 1ASVA 4FPIA 1K8AT 2ZF5O 1DTTB 1N34K 3ZTSA 3HOSA 3G8SA 2QMWA 3HM8A 3IMXA 3D28A 1QD1A 3RTVA 1HR0K 3AY9A 3O3FA 2VQEK 5I4MA 1FXRA 3DXSX 1QAJA 4CM0A 1IM6A 3EDRB 1CLQA 4BDZA 1RT1B 3BQ2A 1TK8A 3O4QA 4UY85 3VOVA 3CC2N 2WVDA 2W41A 5DDRC 3K5NA 5J2QA 4R0EA 4BRNA 2HIQA 4JKGA 1MWMA 1JLFA 3P3DA 2QEXS 3DLKA 4RZRA 3VVTA 3QB0A 2BDPA 3AB4B 3L4BC 4IQXA 2HG4A 4ILGB 3VEZA 3S3NA 1MN9A 4LF9J 2M70A 4CD3A 1RTDB 2B7CB 3NS5A 3P6YC 2DFFA 1XMBA 3DI6B 1AUDA 2UV8A 4IFYA 1WOOA 2CQGA 2MZTA 1ATSA 3H1QA 5CHIA 4IO9Q 1N34J 4FYYB 5D0EA 1HQEA 4K2XA 3SQ4A 1IG9A 4A46A 5DRKA 2MKKA 3PXGa 5F0WA 3CCSS 1YHQN 2LCWA 3AO3A 3ZX3A 1PYOB 3Q8YA 5C42B 3D3BJ 2ZBQA 1HI8A 4RLEA 1NGCA 1U48A 2R7TA 5HROA 4C7QA 4LD0A 3HSGA 3NBPB 4Q2LA 1TMJA 3MX2A 4DSIA 2A5XA 3THYA 2X1FA 1N8RT 4H0XB 5F9LA 1IXKA 1S72N 1PBAA 3BSAA 2GX9A 2X3GA 1HNIB 2CQIA 2MHNA 1BIUA 4WTYA 2DHXA 2HFNA 2K7JA 2W2OP 4OX9K 2V8PA 2X1BA 2UXCF 3AOBA 1VDHA 5IM0A 1RI7A 3MDQA 3VMFB 1FDNA 1UEUA 5H9FJ 2CH6A 5L1KA 3D4JA 4Z4EA 3SBMA 4CTAB 1S12A 3ZETA 3LDSA 4H0TB 3AQPA 5AT1B 2AEMA 4CRJA 2BA9A 4P9SA 3QIDA 1EHWA 1ZA1B 4YB1P 1RDCA 1ROFA 4JKHA 1TL7B 2WB4A 1WSFA 4RBTA 3LPTA 3PUFA 1WNEA 1FDDA 3HVRA 2WBNA 5KPRA 1HKBA 3L7PA 4Y34A 2DXFA 4MFBA 5GADU 2V6AA 1T9UA 1I6JA 4NYFA 3BSCA 3M8SA 1W9HA 3CD0A 3TR5A 3EPIA 3PW2A 1QVFM 1U09A 4JYAF 1FESA 3GSDA 2Q6BA 3T9ZA 4CT8A 4W92B 1U6BA 1KP6A 3OYDA 2NZTA 1HD0A 2KXHA 2ZWOA 5A8KA 4QR1A 1F2GA 5AXNA 3MM5B 5DG7A 3JS9A 4DL4A 4ECYA 4HHUA 4K5RA 3DDKA 5BPLA 4M3TA 3WNGA 4ZN3A 2P9KB 3I5AA 2XG8A 2YPZA 4DQRA 2O01C 3DKDA 2LLZA 4B9MA 3CW2C 4ZVPB 3ZCMA 1UZDA 1QQOA 4JK9A 2SXLA 2VFUA 4IFVA 2BQRA 4C8LA 4KFBA 4OI0A 1S1XA 3VQDA 1NSPA 3GP9A 4DMZA 1UJ4A 1N0VC 2M88A 3CF5Q 5F3ZA 4JV0A 2GEMA 3MEDA 4I6AA 2JWNA 4MIBA 1OH8A 1WLJA 4O44A 4X4TA 5AQMA 3OR1A 3HL8A 1RLCL 3HK2A 3FBFA 1N36K 3R1LA 1HWKA 4M7YA 1VSLA 5F8MA 1CC8A 3P31A 4QU6A 4CEDA 2VV5A 2CQDA 4NYZA 4OPKA 2P5VA 4PZVA 3TQ1A 4NLPA 4WCEL 3OW2M 3I9V9 3DJCA 2YCHA 3THVA 2LQJA 4A8MP 2GJFA 4BWJA 4X4PA 3AAWB 3BDPA 1W25A 4GKJK 2QTWA 3P5TL 1N6QB 3OTBA 1ZS6A 5AQIA 2HS4A 1AXQA 2YH0A 3IAM9 1PAEX 2HMPA 2DGWA 4PHTX 3HHLC 3MCMA 2Y1IA 4JBCA 3G96A 3AXKA 5GMEA 4OPAA 1RHKB 1B0VA 2QIFA 2GZOA 1WSJA 5C2GA 1OO0B 1ICEB 1N36J 2CFXA 2YQ1A 5JVGL 2CXEA 2FJAB 4LF6J 4DI6A 3NGRA 2XBPA 4DWIA 4JN4A 1YZ7A 4WE1A 4WKRA 2QG9B 3ZT1A 2XS7A 4UY8O 2QA4G 3O44A 1T6CA 5B09A 4CBWA 4JI6K 4JI7K 2MY7A 2HOEA 1IBMK 2DNYA 4HR2A 1BU6O 1N33J 4O3PA 4RW8B 2OEJA 3DLLL 4WKYA 5F3TA 5AQJA 1PSDA 1YJ9S 1YTAA 4K4VA 3H0PA 2IDLA 3FMWA 3C14A 1QHTA 4CJ5A 3PJXA 4DUYF 4BRHA 3K8WA 3MAAB 4NCGA 4J2AA 4TKTA 4QWEA 3QGHA 5DG9A 1OH5A 2P6SA 1QQMA 2WHOA 2QA4S 2O8CB 2NR0A 5A6WA 3TRGA 3NHGA 2FJDB 2A1SA 3PDNA 1ZYQA 4TQRA 2VBXA 4JI6J 4JI7J 4MKYA 4IOXA 4MYTA 1PYTA 2KT2A 1IBMJ 1HWJA 5CD4H 2G1HA 3PHEA 3IO1A 2RUGA 1NK0A 3EY1A 4DR7K 4HT7A 1FJGK 4ZPWR 3CE8A 3TAEA 1YIJN 2HQFA 3THWA 1VQ8N 2XLKA 1ZBFA 3OLBA 5C12A 1K8AO 1A7GE 2X7IA 1HYVA 3J7YU 2CQ0A 2AEJA 3KK1A 4OGEA 1RWVB 4ZJQA 2FC8A 2I7PA 4AXIA 3LAMA 1RLDA 5D4PA 2Z1HA 2WUSA 4DCJB 1YJNS 3CMES 4H4MB 2QLBB 4QWBA 3CFOA 3N5BA 4L72B 5JVHL 1LNQA 2FSKA 1SH0A 1NDCA 5AQNA 1YLXA 4FYDA 4OJHA 3MPWA 1JLEB 2MZ1A 1VRQC 4OQJA 1S1WA 3CO0P 2GUPA 4YDDB 4AE5A 3HFZB 1RTJB 3KLGA 3CB4A 3X3UA 3CJSA 3MD1A 1URNA 2DH9A 1AW0A 1PIEA 2IM1A 3Q86A 1IH7A 2VG5B 1ZXOA 5HANA 2Y0SD 4OYIA 2DBBA 1AFJA 1MMDA 2C28A 3TVYA 1XNRF 1UVMA 5E3RA 2Q1NA 4NLQA 1RWPB 1RQ0A 2Y8WA 4DZ6A 2HFVA 3IBWA 1S76D 4YNQA 3DOKB 1Y97A 3Q89A 4K25A 3V2UC 2CG8A 2GW8A 3C46A 4ANCA 5T14A 4TU8A 2BW2A 2RDIA 5M1FA 3B82A 4IOBA 3SCJE 1DQAA 1TELA 1N8RO 4FYVB 3QT6A 2QA1A 4X2BA 2DJWA 3VN5A 4NASA 4HTLA 4BE1A 4P2FA 3NOCA 1X4HA 5HMYA 4YR3A 2EFNA 1NGHA 5D3GB 3O9UA 2W25A 4FKYA 4KGMA 1YI2S 4W5OA 3OL9A 1A0OB 4UZCA 4JI4F 2V2QA 4DV2F 2YHWA 2I7NA 2BX6A 1CJTA 3OR2B 4KHUA 3MPDA 4F8RA 2CKWA 1TV6A 5KFRA 2PFDA 4KPYA 1YSJA 4HVZA 3BYPA 1XNQK 3DXMA 2YVSA 5F0UA 2HQ3A 3RAXA 3HI9A 4EHUA 1RDWX 3FSXA 4DR6F 4HHJA 1HI0P 1U0HA 1YT3A 2QW9A 4NRUA 5AJ3J 2VHGA 4RW6A 3UO0A 1B3TA 3BSNA 3FSIA 3KG1A 3QNOA 2FXUA 4O4GA 2GELA 2V7YA 1JWWA 1HNZF 2VOOA 3KMQA 2BUPA 3H46O 3RBDA 1QTNB 4XDCA 3CMAN 3H45C 1HNWJ 4C1NK 1YKWA 3BF3A 4O0JA 4A8XA 2ADBA 1FKAF 1NOZA 1R8CA 3FZ2A 3IC1A 1TVRB 1FJEB 4PCQA 2XLJA 4J2DA 1REVA 3S41A 2VFRA 3BO3A 3M2RB 4V19S 4YOEA 2JLFA 2WBMA 3ZXWA 2DNLA 2JEFA 1EO1A 3G9CA 3CIZA 3GQCA 3ZEUB 1XERA 1ASWA 1IBLK 3TO8A 3S6EA 3D6TB 5LL6d 2VICA 1NGGA 3G6XA 3KIOA 3R8YA 5DG8A 5H1SV 2JZ5A 3P4UB 4BACA 3E9PA 1WOSA 2GVZB 3P5BP 3BF1A 2VQFK 4LSZB 3G8TA 3HM9A 3PYGA 2AU0A 4QWDA 1D0EA 4LSLA 4USTA 1YUWA 4F3TA 4PXBA 3DRPB 4FYWB 4FJKA 4FF1A 4DEZA 3CQYA 1YBTA 4X66K 1RBSA 1BDGA 3OUYA 2IOCA 2AJ2A 2E1PA 4ED5A 1RT2B 3HVTB 2XWYA 2CQBA 2D7SA 4FOIA 1R0AB 1CG2A 1VQ9S 4DPXA 2WVCA 3KLEA 3B4DA 2FZKB 2G2YA 1C0TB 5IFMA 4G9ZA 3KFWX 1APSA 3N6MA 5HN0A 3FZLA 3C15B 3GV7B 3U9DA 4DL3A 1RHRB 3LGHA 4J37A 4Q8FA 1X4AA 4YB7A 3CWJA 5B08A 1YQHA 2RQCA 4CQ1A 2NRZA 4K2JA 5LXYA 3KZBA 3J81O 1M5PC 2WTUA 4IQMA 2E9TA 3CJ2A 2GTDA 3TW0A 1NGJA 2OFHX 2RF2A 3PW7A 4CK2A 1CS4B 2IDEA 4X66J 4MIAA 2MLZA 3W5YA 3IWNC 4NLDA 4C6AA 4CZHA 1K8KA 1LW2B 4F3OA 3VGUA 1MROB 4U67Q 3KLFB 3K2PA 1NJIT 4DUTA 4FJ7A 2KU7A 4WFNL 4A5BA 4I2QB 3F2KA 4RG8A 2ABYA 4AHVA 1VQNN 2NZCA 3SIPB 4ZVQB 2ZWPA 1O5JA 1OY9A 1B0PA 2CNKB 3W2VB 4ZOSA 3AV9A 3SI6A 4L76A 1HWUA 1LWEA 1N5YA 1JK9B 2VOPA 1NGFA 1RILA 2OPPB 4B3RK 2FUG9 5F8JA 1N34F 2VDIA 4FJJA 3R9LA 1CJUA 3DOLA 2MQLA 3F0NA 3NCRA 1HR0F 2VQEF 3BS9A 3HXMA 1LK5A 3AQOA 3NH0A 5SZTA 2BKNA 4ES1A 3L2RA 4OJ1A 2X78A 4ZCIA 1Q86T 4Y3CA 2W7OA 5AZIA 4YS2A 4J9QA 3SDEB 3FUYA 3NOGA 3KLIA 3I6PA 3MOZA 3D2FB 4YQWA 4NLVA 2W9CA 2ZD1A 2LEBA 3DOMB 1F21A 2W9AA 4NLTA 3M8PA 3VAHA 2OGUA 3LP3A 3CHWA 4NXNJ 2VF3A 2OLWA 1R8PA 3IFRA 1X60A 4V19J 1FKPB 1ILYA 1K0VA 1X9WA 2MGZB 1Y64A 1SJ1A 2R7YA 3O9SA 2WFBA 2LSNA 3HPHA 3U1LA 3P1GA 4KE5A 3A8JA 2NREA 4ECTA 4QBUA 2IMWP 4ZJOA 5H1SQ 4PQUA 3PW5A 2NCKL 3DC2A 1GXUA 2ROEA 4HKQA 1IQZA 2CJXB 3M9NB 3GIRA 4YEAA 2BANB 3IKMA 5T7LB 1VQLS 2I5JB 2QEXN 1QSSA 2XNQA 3TA0A 4OKEA 2OTJS 1IG8A 1S9EB 3OTOK 2JH3A 1ZBHA 3O08A 1LWXA 4QPXA 1QZ6A 4ZHRB 3SFUA 3RB0A 2CPDA 4Z7YA 3VEYA 1G4CA 1SJQA 3NGYA 1EP4A 5DJBA 3C16B 4FXDA 4OX9F 4C0OC 2EFQA 4ZK7M 2YV0X 3S7RA 2HGLA 2ASDA 2YKOA 3BR8A 4FWKA 4YB5A 3M9OB 3OLAA 1FTRA 2IM3A 1I5OB 4KV8A 4IDKB 1NPRA 1A9NB 3CCSN 1C1CB 4PWDA 4ED0A 4GVLA 1M90T 3NEKA 4WBFA 3EEQA 2E9ZA 5DS7A 3CCLS 4J9NA 3ULDA 1QY7A 3NGKA 2R7WA 5T7BA 4TY8A 3RR8A 4LJMA 1UA1A 4ILMA 2P2CB 4ICLA 4WK1A 2V34A 1TL3B 3GLJA 4OLAA 3HSZA 1T9WA 4O3QA 5KFXA 1B7FA 3M8ZA 4DTOA 1RBLA 2N3OA 5J2NA 4FW1A 1X3MA 3QEPA 4LFBJ 5CE3A 5IT0A 1UJ5A 2VH7A 2XB2D 2X1AA 1R0BG 2X1GA 1OPIA 3LL3A 4FM2A 2BM0A 3N5FA 3E8OA 2D0PA 3RMAA 3NF7A 4WJBA 4CF2A 4E7HA 5AQFA 3CCEN 3D67A 3G86A 4DG1A 4CYUB 2BE2A 1YJRA 1Z6RA 2CJ9A 2BEFA 2PFUA 4HCBA 1IKYB 4BRPA 1NSQA 4DFMA 3L3CA 4KTWA 2IA0A 2HNYA 1RUSA 1J54A 4ZP7A 3M2UA 5EX0A 3U6FA 1EWRA 4FM0A 3V6DA 1WSRA 4FJLA 4KGZB 1XBWA 4Y2IA 2OSRA 3QEWA 2E7XA 1YVFA 4NEYA 4A2AA 4CLUA 1ZAWA 2RHSB 3K58A 3LDLA 3M6GA 2GGPA 1F9EB 4OFZA 2OHDA 3HZGA 4JKFA 3ZYYX 4ILRA 2ZJRL 3SUOA 3AVGA 1NH8A 4IR1A 2FLNA 3EGZA 4NCAA 1N4LA 1NUEA 3KJNB 2E2OA 1N36F 5SWMA 4F4KA 2RJZA 4Y1DA 2HFUA 1EQYA 3O8MA 4P10A 2BVZA 2HKEA 3ATVA 2HNZA 3W8PA 4FJNA 2GMJA 4WK3A 1WKJA 3Q8PB 3KJFB 2WW4A 5HVHA 3N6NA 1U8SA 2K1RA 1Q1KA 1AROP 1KSPA 2AJ4A 4I7FA 2MLXA 1KC8T 3WXIA 2G2ZA 4GKJF 3C6TB 4C2MA 3WC0A 2GQ2A 4JRQA 3MN7A 3M05A 2MEWA 3MF5A 3AVAA 1UW4A 4X65F 4MK7A 4M41A 2YWGA 3LPEA 2KYZA 3JXOA 2C2KB 3BO4A 4DS4A 3CCJS 3DXKA 3S3MA 3NGSA 1WTBA 3HHNB 4CGFA 3RMBA 1U2VB 4I2PB 3OHBA 3JAMU 1JXEA 3LP0A 1BC6A 1RCXB 4DV1K 2PC6A 4K7QA 1PO6A 4EGLA 4DTXA 1GEHA 4OZ5A 4JI6F 3MR3A 4HACB 4JI7F 4C3MA 1RABB 2NLXA 2JGUA 2HRUA 1SC6A 3DM2B 3WDOA 2W8LA 3EZUA 3Q8QB 1IBMF 3I0SB 4KREA 3VV2B 1KOHA 1R6VA 2MKJA 2B9WA 5CA5A 4C8ZA 1B92A 4DU4A 2DNNA 2Q1LA 3AVNA 4FM1A 3ITHB 1D09B 1MNEA 4MMOA 1NKEA 1EX4A 1MN7A 2DO0A 3GCXP 5EU7A 1RBRA 2PI5A 4ED6A 3MPYA 4I9LA 1HQUA 4FW2A 4OI3A 1U2FA 4PYAA 4RNMA 3T1AA 4DQSA 3BGRA 1U6FA 2HURA 3EPGA 1E6VA 2FGCA 1VQ5S 2XHCA 3NCQA 1MWQA 4CLKA 3QRPA 4ED1A 1TKTB 1FFWB 1GMVA 3D0HE 4MKAA 2VKRA 4DV1J 3MGJA 1RZMA 4KHPJ 4Y2AA 4DHYA 4LQ9A 1NJIO 1R3NA 5K8OA 4N5SA 4ISGA 1M1KO 2XRIA 3GTYX 4EI2A 3LZJA 4NRTA 5KT6A 4C9DA 2J8AA 3CGIA 4DR7F 5GAEI 2VC0A 1FJGF 1BO5O 3K5LA 2KW4A 2JWKA 1C0UB 4LR7A 2V2KA 3GR0A 1YJ9N 3JTPA 2AIRB 3LP1A 3HULA 3N01A 2NXEA 5ADXH 5LT5A 1WBDA 2OA8A 2PEHA 3Q2TC 1CPZA 1VSKA 5KFDA 1NJZA 2MDAA 2YWEA 3PRBA 2AEFA 2DY4A 2YX7A 3TZWA 5BYSA 1R8HA 2H4YB 4F0KA 2R2RA 2OPRB 2HBYB 5CZ2A 4DTMA 3CMQA 1X4CA 4CH0S 2GIRA 1GXLA 3LDNA 3F44A 1FFSB 2QA4N 1Q86O 2K2PA 3GFZA 1BWFO 1XTZA 1SB6A 3B78A 4FF4A 1BQNB 2VDHA 1KNZA 2C2OB 2R2TA 4J9RA 1WSGA 2HFZA 3C6UB 5KG1A 3ZZUA 2CPHA 2O66A 3E9LA 5BR9A 4Z4IA 1GMWA 2AJQA 4I64A 3FR0A 1HBMB 1FF2A 1FTCA 4TU7A 1UJ6A 2Y3YA 1BQXA 1C1AA 3R7NB 3CCMS 2IY5B 2V69A 4K4SA 3O8WA 1YF5L 1JKHA 4X4SA 4IEEA 4CJRA 1FEEA 1SJ3P 3LUYA 2GQQA 3UI3A 2VCPA 3W0LA 2OCEA 3JQJA 4DTUA 2KL8A 9RUBA 2QWNA 1YJNN 3CMEN 3AB2B 1Q7LB 4PUOA 4DU3A 2GS8A 2NPIA 2O8FA 5L46A 3IAYA 4USKA 3UDEA 2EBGA 2KN4A 1JJCB 4OHVA 4CHPA 2V51B 1Y3JA 2LQBA 1W2BR 4DSJA 2KLAA 2RHKA 4NLYA 3C65A 2FHMA 3KD1E 1JXLA 2FSJA 1VIXA 5C7PA 1HYSB 1JLCA 4I6WA 1MMLA 1JLBA 1IM4A 4CNZA 4M5IA 4ZPBA 4JLHA 4XIUA 5KI6A 3GL1A 5I3UA 2KB2A 5A8RB 1IR1A 1QJHA 3OY9A 4LREA 4CGHA 5GADP 2FJBB 2VFSA 4RWTA 1XNQF 3HHDA 2IRXA 4WCEQ 1KD1O 3O1BA 1EKEA 3IGVA 1Q8LA 1YXQA 2WTFA 3VENA 4O5FA 1J5EK 3AVLA 2W9BA 3N9UC 1OIAA 2E44A 3KJQB 4FF3A 4LVNP 4KTQA 4ALZA 4CEBA 3CPWR 3CJ4A 2ZBIA 4UQTA 1DLOB 3QESA 3GPAA 3TVKA 2ZWHA 2W2NP 3VAIA 3LQVA 1S0NA 3GIKA 4BBYA 4LSNA 3Q24A 3GONA 1KVIA 4KH6A 4CM2A 1NSAA 1O51A 2YJEA 4UTGA 3UFCX 2X3DA 5HMXA 4A48A 4C11B 1JNRB 2WW8A 3UCUP 1RTHA 1WEXA 3H5SA 2PA3A 4ED4A 3KKFA 3TARA 1AB8A 4AL5A 1J5EJ 1FDAA 3PO5A 3SCKE 2W1BA 5JS2A 1IBLF 1YJWS 4NLCA 3IRXA 1WSVA 2ZC4A 4PKDB 3V9UA 1HKGA 4I69A 3DLLQ 2KDOA 2IRUA 5HSPA 3QWPA 2RB7A 3GJTB 3SFGA 4BRMA 2D9OA 3QSYB 5CYQA 3AJ2A 1WDDA 2VQFF 3V9XA 2V4QA 3EGVA 2VPWB 1JLQA 2ATLA 4FLVA 2BKOA 4R8UA 4JI1K 1RAGB 1VMBA 2NUUG 3R27A 3MZIA 5M1OA 4IO8A 4J7CA 4X66F 4URGA 1RU1A 4ZCKA 1VQPS 1D3WA 2AF6A 4ZP9A 2KH9A 5BJRA 1U26A 1WNSA 5A8WB 1J9AA 2OYQA 5EX3A 4RW7B 4ID5A 2G13A 2O1PA 1GLFO 1BY9A 1X9JA 2UXDJ 3O3GA 2R7SA 3GG0A 4LRBA 4F7VA 2RDDA 2MLYA 5H9EJ 1HNVB 3MUVP 1WC3A 3IA0A 4LMZA 2VONA 2ZE2A 1S0MA 3OQ2A 2BM1A 4PG7A 3HT0A 2VG6B 4ECWA 1B0TA 3CIMA 2W4DA 3D6MB 1NKBA 2FDNA 4MK8A 3OL8A 1DFDA 3MUMP 4M5DA 5E33A 1IWGA 2NPFA 3RR7A 3LM2A 4TU9A 4FNHA 4CBUA 2E5LJ 3MWBA 3BN4A 7AT1B 5JVHQ 5KQ8A 3HO1A 4GVMA 2Z2YB 2ZBRA 1HPZA 2C2DA 1M5SA 4DL7A 3CCTA 1I94J 2A6MA 1VQ9N 4P71A 3ENWA 2ZM6J 3G6ES 1NBWA 1ZOTA 3G71S 1CVJA 2O8BB 1T03B 3EXYA 3LP2B 4DR3J 1BA0A 5C24B 3ICLA 3DLHA 4NO7A 1VCTA 2Z1IA 1GLLO 2YY3A 2VKZG 5J1PA 2DXDA 3FCHA 4K0KK 4B9QA 2Q66A 3I32A 4C3KA 4B3RF 2D5RA 3LTOA 1D8ZA 4F4YA 1EJ7L 1DBDA 5KFLA 2B8PA 1SL1A 2P9IB 1S57A 3ULEB 5KG7A 4QYZJ 5LMUK 5HJYA 4DX5A 3I0RA 3RW7A 1FWLA 3J7YP 1H2TZ 3HYFA 4IO9L 2P9PA 3D54A 3DU5A 3VAMA 1FE0A 2XO6A 3HSJA 5BYRA 4LF4J 5ETOA 2PD1A 3D6HB 4M5KA 4YN3B 4I6MB 3HKZD 3SQGB 4BR2A 1CJKA 3EXCX 3TP2A 4DN9A 4QR2A 1PC5A 3WEEA 4OGCA 3L3VA 3T5LA 2W2MP 2IMOA 3PR5B 3TAGA 4L73A 2Q43A 4AILC 1NKCA 2B0GA 3CCVS 4TN2A 1TGOA 4A61A 2QM1A 2QWLA 3EO3A 1Y9OA 5KFFA 1P90A 4IRCA 4JS5A 5LMUJ 5L1JA 4M7XA 4RUAA 4LF1A 1P9QC 3WNFA 3JAMY 2MQPA 2UZAA 3LWMA 1EAYC 2NXUA 3CJ0A 4CBXA 3LDPA 2RU9A 4NMXA 4CHOA 2DGTA 4HHHA 4CWBA 3BBCA 1UTAA 2FF3B 2E7VA 4QS9A 4XK8C 4LFAJ 3ZZYA 4GC7A 3CJAA 2XNRA 2I8EA 1AZSB 3D1QA 3D2EB 1T3OA 5D0RA 3OTOF 5AQHA 3D0IE 1KONA 2Z58B 4OZ1A 3L2QA 2PT0A 3H25A 1WWHA 2CJQA 3M32A 3F5TA 3QZ7A 3N79A 3EE3A 2AWZA 1UCNA 2KG1A 4FLTA 4RR5A 5DM6Q 2K3IA 1GLEG 2YNIA 4H4OB 2NSBA 3R5CA 5ETKA 1KAZA 1UWBA 1FNXH 5E41A 1B99A 5J2QB 2WRMA 4DXLA 2RPIA 5L1IA 1JLFB 3AFGA 4C8OA 3DLKB 5CAAA 3VGKA 2EXUA 4Z4CA 1HQ2A 3P83D 2DPJA 2ZNZA 3HVWA 3JB9k 3ZSXA 3ZNJ1 5HBMB 4LFCK 5EOYA 3V4MA 2LU2A 1VQLN 1TL1B 2HF3A 3POTA 4IFYB 1NK4A 2OTJN 5HRPA 2ZKUA 3OT9A 4ZLPA 4ECZA 4MYUA 2C22A 1TKXA 5A2QU 1L3UA 4CJLA 2LYVA 5L38A 2DTJA 4M5MA 2CRLA 2DO4A 4ES3A 1U45A 2HHPA 1HQEB 4EP4A 3KWMA 3IRWP 2UU9J 4USMA 4OHXA 1IJFB 5I42B 2XHWA 2W4CA 3QJPA 1RE1B 4PL8A 1WBBA 4OKKA 4OYMA 1R89A 4GC6A 2EK1A 1VBKA 2VJVA 3CF5L 3J7AN 2C42A 3A8KA 3NS6A 4ANEA 2A18A 3HJVA 3VZIA 1H98A 4H5RA 3JTNA 3CULA 3PV8A 3UDLA 5ELZA 3THYB 3UR0A 4HI1A 3CCLN 5I9EB 1F3FA 2LXUA 4Y2KA 3VQSA 2BABA 4QYRA 3IMQJ 2BV3A 4C4WA 1VSHA 3R97A 4DSEA 1QHAA 3N4QA 1RB0A 2NRVA 4JKDA 4JHDB 1V4TA 4CJFA 1QVFR 1SJRA 1MDUB 4JI5F 4P73A 4JB8B 3W63A 5IWAK 1RTIB 3VF4A 1X5SA 2ZQBA 4CF9A 2HSTA 3QQCD 3VALA 3TYTA 1KQSM 3BBBA 4YOTA 1WSIA 4O23A 3SAHA 1F1BB 3ZETB 2BJEA 4N7TA 3QETA 4DPUA 3IR7B 3NGZA 3SAFA 1RT6A 1N5TA 3BGLA 4FDFA 5F2RA 1E6YA 4YOWA 3JSRA 4IJAA 2YWKA 5DGBA 1IBKK 3GR1A 5M1PA 3PSFA 2DR9A 1NHKL 1GOBA 4QQBA 2BBEA 4K4XA 2MZJA 3KK3A 2CAJA 1QVGM 1WELA 3QNNA 4URSA 1SQGA 4IDHA 2HMIA 3A8EA 4R5PA 1S72S 3MWTA 1YJ7A 2MTLA 2XMJA 5AXLA 2AGPA 2UXBJ 2YNFA 3C7NA 3OYKA 3J80O 2H5IB 2LDYA 5IWAJ 3WT0A 4LF7K 1OYEA 3ISND 5C2DA 5D78A 5KT5A 1IV0A 3O5TB 4E7LA 1TR0A 3JYTB 3AAPA 5AQQA 4DU7A 5BR8K 1NH7A 5J2PA 1SUQA 2HFSA 2I0XA 2R2UA 4PYDA 2AGOA 2IIRA 4DV0J 1X0FA 5JMNA 2VODA 4ZVFA 4DV1F 2DTUA 1IBKJ 3TOQA 4DPWA 3CEDA 3C94A 4IFVB 2JC0A 2DNGA 1Z1ZA 5TKWA 1ZPWX 2ZGZA 4KFBB 1S1XB 2J7UA 2GVDA 5F8LA 1L5UA 3SK3A 2O4GA 2O3DA 5IXUA 3PYEA 3THXB 1K44A 3OYHA 3H2LA 4OYZA 2R8IA 4NB4A 1X4GA 3MEDB 4BRQA 2FGOA 4FJGA 2HS0A 2OPQA 3CC4S 4O44B 2HS3A 4LF7J 2M9KA 3OR1B 1YDLA 3HHLD 3W2WA 1T94A 3ILJA 2CQ1A 2DB1A 1C1BB 2BJDA 2EFVA 2AQ4A 4ECRA 2W42A 3CCJN 3SMZA 2E6MA 3BQ1A 5CCMA 2Q3PA 2XZWA 2E1MC 4BR0A 1ZBUA 2M52A 2YX1A 4ZVGA 3OD2A 1RT1A 3RVCA 5GVQA 1WG5A 3MUTP 2FB0A 3ETOA 2ASYA 2B8QA 1E4FT 3EZ5A 3G10A 4Q0BA 3ULHA 1KS2A 3MCNA 3AARA 4HDGA 3NNCA 1RDRA 1MLAA 3QWUA 3CD7A 4CF0A 3ZSRA 5CY4A 4LUBA 4C1NI 2U1AA 4DV4K 1S7HA 3SNNA 2IVPA 5AFUA 3DI6A 1S6UA 4ES2A 3BPSP 2W24A 1Z4UA 2V7ZA 3TUZC 1BI4B 3SCXA 3WNHA 4KYZA 4ID8A 4IO1A 2F8TA 2IM2A 4CJ4A 3K89A 1VQ5N 1RAJA 4WE1B 4YY3K 2BJ8A 2H1YA 3PFEA 3DLGA 2Z1JA 4X84A 1BCMA 1LWCA 3VA0A 3M6WA 2HHUA 3H08A 5GAGI 3W65A 3A3PB 1MMNA 2HW3A 3HP9A 4CJUA 2EWHA 3JAMO 1S6QB 2J9EA 3KVGA 2OEMA 2NYIA 4FNIA 1G6BA 4QWAA 2GFFA 4AD6A 3QFHA 4A62A 3QERA 1HW9A 3GCWP 5ETTA 3HVAA 4GMKA 4DV4J 5LM7E 2MZQA 1HNIA 5M2RA 4CJ3A 4CJTA 3P8BB 3W9IA 3VERA 4FZYA 2QYCA 5AQYA 1LOUA 1VQSA 1FD8A 4OZLA 4DHVA 5LXRA 1NGDA 1X3NA 2KRBA 1JL1A 3ID6A 1U25A 4DB3A 5DLGA 3ZSOA 3NL0A 3S1TA 1HD1A 3QT5A 3NFAA 4CTAA 2HLUA 4YY3J 4H5TA 4E1MA 4F04B 1UAXA 4MKBA 4AQYK 3I56S 4JI2J 3W5XA 4FWPA 4FPRA 3HZ6A 5LMNK 3NLCA 1NM1A 2AA4A 4NWBA 4FYXB 4P7TA 5KAKA 4J2EA 4DBQA 2LEPA 4K4UA 1K1SA 2ZJRQ 4CZJA 2GX8A 1YAGA 2W01A 2K3KA 2DHSA 2J9DA 1FX4A 4ZLNA 1XIQA 2B9EA 2OTLS 2V68A 1SC4B 1RT3A 3O6QA 2BXJA 2UVWA 2VA3A 4CDIA 1OS5A 2IJRA 1TYQA 3FDSA 3PRDA 3RZAA 3D66A 4M3UA 4DV3J 2E1AA 4LQ3A 3F9MA 3OFGA 4DOZA 3GG1A 2MQNA 1U1NA 2JEIA 1NK9A 2MKIA 2FPHX 2P5GA 2Q6CA 2CQCA 1J5EF 2E88A 3MM5A 4EK2A 4U6PA 2DR6A 3R6MA 1EQ0A 2P9KA 4AQYJ 1S1WB 1U1QA 4LF8J 4Z7CA 4WQ4A 2FC0A 3KLGB 5LMNJ 3ATUA 1PKUA 1T9YA 2CJAA 2B3TB 2WONB 4MKVA 3HMJG 4FWSA 4IJNA 3BGOP 5AQZA 2CQHA 5FLXU 4Q8EA 2DD8S 3KNAA 5IS2A 3M2VB 2PAVA 4X4NA 3JQMA 2RH3A 1FE4A 4OV1A 4JI0J 1K73O 1VHIA 4NCBA 2HHHK 1SI9A 2BRLA 2FHJA 2ZVSA 3H2UB 3KYLA 2FC9A 3QINA 4C8MA 2PZSA 4B9SA 4DR4J 4FLXA 4B9VA 2DNMA 1Q79A 3T5JA 5BPNA 3A3OB 3ZTQA 2R7UA 1VAZA 3VR1A 5DQGA 1QSLA 1CJVA 3D5MA 3M3ZA 2UUAK 1FNMA 2YWHA 1FT8A 4CI0B 4E89A 1OWXA 5TKYA 1YTUA 1QDUB 4DX6A 5ETLA 4NLGA 2YWWA 4J9PA 2KM8B 1CJTB 2FJEB 4JI1F 3FCVA 3TJ9A 1TV6B 1N6QA 2XSJA 3WHIA 2NQPA 3HFVA 2PDAA 3OPKA 4ZVEA 3CSKA 4I9QA 1PGZA 4YR0A 1U0HB 4CIFA 5ETQA 2ZHBA 4RW6B 4BE2A 4WF9Q 4B08A 4O4GB 3I5BA 4OHZA 3UD4P 2A40A 3UKUA 2MKYA 2OSQA 1YJWN 1TMMA 3L09A 4IXCA 2AP1A 3G8QA 3LZIA 4F26A 4V1Ak 2GNKA 3I33A 1ITGA 3QYYA 4U67L 2DRBA 1GXTA 2HQIA 4DFJA 3NY0A 5A2QY 1FFGB 1RA6A 5JUMA 3V9WA 1XMQJ 3T1HJ 5CXTA 1VQ6S 2KJWA 4YOVA 1JLAB 4DL6A 4NMLA 3R9PA 5GAHI 4CIOA 2ALZA 4RW8A 5DDQC 3K2YA 1M1GA 4BDYA 3R8EA 3OBIA 2IVYA 4I68A 1VQPN 2EFPA 1XWLA 3SSRA 3DRXA 1VGYA 3FGVA 2DGOA 3KK2A 3PACA 2Z8QA 5DLFA 3MAAA 4LBPA 2OO4A 4AT1B 2QL7B 4V19X 5A0YB 2CQ4A 1L3SA 4KH0B 5ETRA 5DZ7A 4ZVRB 5KT4A 2CIMA 5KT3A 1KQKA 2BE9B 1KVBA 4JD2B 3EDQB 4ZLLA 5FROA 2AYMA 1Q82T 4DCOB 2L41A 1XR5A 1BQMB 4K0KF 2Y1RI 3R6LB 2JDJA 4CVNE 3RGIA 4A8OA 3KHGA 3CJ7A 2POKA 1SC3B 1K0TA 4Q43A 3ZT4A 4F9OA 4IH7A 4BVPA 3TUJC 1B7YB 3M8QA 3CJ3A 3OUYB 3G2XA 3LOUA 3C95A 2F4VK 5LMUF 1YK9A 4KKOA 2RUSA 4RKUC 2VBZA 3U3YA 1G2EA 3SI8A 2RDJA 4YFUA 3AD9C 1NMEB 4A8YA 4AM6A 2H5EA 2QXLA 2IVNA 5IT9U 4YDXA 3MMCB 1CQMA 3MMAB 4JOUA 5KFKA 5CHCB 4ZVOB 3H8YA 1VS3A 2HBRB 3G6EN 3G71N 5KFWA 4NLUA 1SL0A 3TZXA 5AQRA 1JLEA 1HNXK 2XY8A 2HBJA 1VR6A 2EFGA 3CJCA 2V8GA 5KT2A 2IGIA 3SUNA 3ELHA 4QOZB 4X62J 3VAJA 2G8WA 1JXVA 1NK5A 2VG5A 4C8KA 2E4LA 4FJ8A 3CQXA 3AVHA 4AXJA 4CJ7A 2P51A 3A5LC 3N28A 2F4VJ 3QBCA 3SSQA 4OYWA 3MM6B 1V3RA 4EBDA 1UOCA 1NO8A 3VQBA 3HP6A 4HLBA 3NRBA 5KG5A 4CI6A 3DOKA 3EVMA 4BCAA 5ETVA 2CJKA 2VPZB 5HQLA 2C2NA 3A13A 2QX0A 3H7HB 4PG8A 4KBOA 1RBAA 4LR8A 4EBCA 1W2IA 1LWEB 1JMTA 1RT4B 1HNXJ 5KFUA 4EIAA 3TPQA 1ITPA 2P9LA 1CJUB 3DOLB 1XEZA 3GYGA 1H3DA 3PEHA 4DDFA 4CT9A 4WP8A 2FQQB 3FKBA 4M8LA 4FPAA 2DNHA 1XR6A 1R8BA 4ECXA 1J27A 4NA1A 4OI2A 4K4YA 4TY9A 1RGIA 3MMVA 2Z1GA 4DR1K 4RNOA 5J2MA 1F60B 1WI6A 5CZ1A 1ATRA 1NK8A 4ECUA 5KGXA 1T9VA 1GMUA 3VHQA 1CLFA 4P2SA 1X5OA 1HPMA 1S99A 4PWUA 2ZD1B 2W9CB 4LFCF 5D0GA 3DRSA 2HVIA 4ELUA 2DRDA 3U7JA 3MN6A 3PYFA 5KFHA 4E98A 5B8HA 3W62A 3KTQA 2DVIA 4OLBA 1DT9A 3RRGA 1SKWA 1G3OA 4FP9A 3IXQA 3FZFA 1LAVA 4K50A 1SH2A 5E5NA 1QZ5A 2XZTB 3CD6N 4AM7A 5KFNA 5AR0A 3HHEA 4PQUB 4CIGA 4KQZA 4PWWA 5HOOA 5D8HB 4WQ5A 7FDRA 2CGJA 3MHYA 1N0UA 2EPIA 2XC9A 4DL2A 2DXEA 3LO3A 4DR1J 1BD6A 2FF6A 4AFFA 1FKOA 1KVAA 3GB0A 2UVRA 2I2YA 3WIVA 4L6V3 4H54A 3ZEUA 3A5MC 5KFZA 4ENOA 2YXLA 2HVDA 4CESA 2C3MA 4LF9K 5CYMB 4MDAA 1UKUA 1EP4B 1GQEA 3KD5E 1M5VC 3MCPA 5IWAF 3TX0A 2QWQA 4O0IA 3UCZP 2FIUA 3Q22A 3VEVA 4DR5K 2DGVA 5B0AA 1JJ2M 2DYAA 1IJEB 4KV8B 3DRPA 4IRDA 1SBRA 3OYNA 4B9LA 4PWDB 5DETA 1X4FA 2B51A 1Q8IA 3GYXB 2KXNB 4NYNA 3NWRA 1QQCA 2R3VA 4BGAA 4GMJB 2PMWA 2J6SA 2O8EB 2BZ2A 4C48A 5HQMA 4GY2B 1IBKF 4EWTA 3MR2A 4N41A 1PG5B 1KRPA 1Y00A 1FXDA 4ICLB 1BA1A 1D5AA 3RUBL 1RWOB 2ZH1A 1O8BA 2JJ4D 3M8WA 3L7OA 3PZPA 2DH8A 2J5AA 1OQ6A 3QJJA 2VGMA 2ZZNA 3TUPA 4K8XA 3TABA 3OV7A 3UW1A 2Y1LB 4L3NA 1RT7A 1X9MA 1T6DA 1KXPA 3DLJA 2L9WA 1HWLA 2WVEA 3C66A 1CZ9A 3THPA 3WUHA 2ASLA 1RWUA 1Q9YA 4LF7F 1IQTA 4QIVA 4NZ0A 1I39A 1SAZA 2ZBCA 4DR5J 2Z0GA 2HBMA 3MM8A 1KQFB 2OH2A 4PXDA 3VQEA 3AHPA 3GFXA 2XQCA 4KHQA 2OD4A 4BHQA 2ASOA 3K0JA 5H9FK 1W7AA 2M8DB 2RE1A 4WP3A 3TSQA 5BR8F 4MLEA 1FWKA 1CS4A 3CDBA 3MEEB 3AVJA 1VSFA 3FGUA 2DISA 2XY6A 2IRYA 1OSCA 3RMCA 1JB0C 4AHRA 4KH4A 2IPOB 2HNYB 4OX8A 4FCYA 1AYEA 4KPCA 4CFAA 3V6DB 1X4BA 5LY3A 2DNOA 1BG3A 1WG1A 2QFIA 4JI3J 2B4UA 2KT3A 5FLXY 4LRCA 1UVNA 3ET6A 3EUNA 2ZVIA 3NGDA 2GGPB 3BP8A 2OZSA 2ZOFA 3H5XA 4B1WB 1M0SA 1FK9B 2PSZA 2OANA 2AHOB 4XAKA 1WDTA 4HDHA 4G1PA 4M3XA 1KOOA 4O4RA 4LRAA 2ASJA 2ZH6A 2E9RX 4P2XA 4FZZA 4K43A 1N5SA 1C0FA 2QE5A 2UUBK 3BDEA 4G1QA 2ATCB 4PPZA 3CCES 3I8BA 3K9JA 1KTVA 5KFOA 2CVIA 3QBWA 4TYBA 4BR9A 2HNZB 4NXMK 1O0PA 2ALYB 2FLOA 1KFDA 1UEKA 2RN2A 1OH6A 4WTOB 3I5CA 4FBUA 2JL9A 1TK5A 3CCRS 1WORA 2V4JB 2Q0RA 3W7BA 2J9DE 1H73A 5AQKA 4B1YB 1P8GA 1HJRA 4B3SK 2ZJQL 1A6LA 3SDEA 3OBWA 4P72A 3ENAA 4LC9B 4X64K 1Q9XA 2MYFA 2QXFA 1Q82O 4DV4F 1NJYA 1KN6A 5GAHP 2QL5B 3DOMA 1H6KX 1HBOA 2VWKA 4RW9A 3WIUA 4WZQA 1Q18A 3CC4N 3G6VA 3WNEA 3D45A 3DXKB 3EMTA 4CLLA 4GV9A 2FVPA 2NRXA 4FJHA 4W90B 2UUBJ 3LP0B 2MGZA 4QZVB 4EMDA 1GX5A 3H2VE 5K20B 2O8DB 2KT5A 1HIYA 4YY3F 1VSIA 2MMYA 4NXMJ 2EI5A 2A0FB 2O4IA 5JMVA 1LXNA 3VPZA 2FJWA 1RBOB 4HI2A 9ATCB 4FWLA 4PKGA 3DLBA 4KRWA 4EUVA 2P9SB 4B3SJ 4LT6A 2ZHOA 2DR5A 1H72C 4X64J 5AQVA 5GMDA 3OYEA 2VU5A 2E66A 3BV8A 1S9EA 4O8UA 2WSEC 3G87A 3KUGA 4A8KA 1HQUB 1EIYB 4ZHRA 2OAUA 2DR7A 2C3PA 2KVQE 4PQAA 4XTTA 3ISNC 1TL5A 3M1VB 2IM0A 1DRZA 3NNAA 1WHXA 1URRA 4NLSA 4PA1A 3J81j 3FNNA 2CH5A 1F5AA 3D1OA 3HDSA 2G2OA 4CJVA 1KHVA 2F9DA 4LF6K 3W64A 1C1CA 1QUPA 4AQYF 5THWA 4JS4A 3FEZA 3CDWA 3VETA 1CSJA 4DL0C 3ADAC 1W26A 5LMNF 3TWZA 3DLRA 4ILHA 4DZDA 5LJ3Y 2KVIA 4MAKA 2B4PA 2RILA 4ZPCA 5KPTA 1YJVA 4WWSA 3UE5A 2AD9A 1ZM4A 5DO2A 1TL3A 3CETA 3PX6A 1LV5A 2NNWA 2J0QD 1N33K 1WAFA 2YQ3A 4Z4HA 4O0NA 3PIOQ 3US5A 3ZSWA 1PJ7A 4JV2A 5AQLA 4E19A 2ZKTA 1RT5A 5EWFA 4FLWA 2J0XA 2HSEB 4CE9A 2GAGC 4IG0B 5IT9Y 4PG5A 3CCWA 2XWXA 5IC4B 3GMGA 2L9NA 2EKNA 4OYXA 3R7SB 3CXCM 3VQCA 4XO0A 3JS6A 5C25B 1TL4A 5AQTA 1RDUA 4A57A 3I56N 4DU8A 2R9LA 1VBZA 4MQ3A 1EZZB 4W5RA 5HP1A 4EU0A 2D0BA 3SQ1A 4WQ4C 1NCLA 3EM1A 3FEXB 3RBXA 3OYBA 1VQYA 4KGKA 1QM9A 1AFIA 1FD2A 5IOLA 3DRYA 4FLUA 5J1NA 1UWAA 2CPEA 2V67A 3U02A 4OKJA 3PY8A 2OTLN 3VAGA 1HMVB 2PGCA 1BCOA 4B02A 2XCAA 1P1LA 4ZCLA 1YITS 4OZ3A 2WK4A 3HHKA 4CGDA 2HHHF 4FXWA 4GW6A 5HVGA 1CBKA 2DNKA 1T7PA 3PKMA 2A1RA 5G4DA 4DQIA 3CJKA 5JJBA 3B6BA 2EC0A 3KLHB 2ROGA 2AMCB 2X6SA 2DNQA 1P9YA 3OVSA 1SCJB 3EZOA 2UUAF 1WEYA 2E7WA 2KXFA 1V4SA 2HHSA 2A3JA 4NEZA 3NMAA 1NOYA 5C0YA 1B9FA 1JLBB 4ZDNA 1ESVA 2PBDA 1XI1A 1OSDA 5I3UB 5KFGA 5FJ4A 3FZHA 1X4DA 1KAYA 1Z2ZA 1J5OB 2CPXA 2XMTA 1DAXA 3MM9B 2UXCJ 5BRFA 2P9NB 1X5TA 4YHHK 3CNQP 3UN3A 2BMBA 1K6YA 2A41A 5HJXA 3DFEA 4W98A 3KLVA 3MN9A 5BN9A 1O13A 1S49A 4BC7A 1CQNA 3M8RA 5KFCA 2HRYA 4B3OB 1Y10A 2AT1B 3HSCA 2D1CA 4LF5F 4I2PA 2HVZA 4FO0A 4EZ6A 1RAOA 4ZP6A 4YDUA 2EWSA 5DZ6A 4LSNB 1D1UA 1NHUA 4WYBA 1ZAVA 2NUBA 3BR9A 3IBFB 3W3SA 4PY5A 3I0SA 5F8HA 3IGNA 3U27A 4K59A 4PL7A 3ENOA 3V4IA 3VAFA 4BQLA 3KUEA 2J0SD 1RTHB 4JYAJ 1T8EA 1S48A 4IR9A 5E26A 4DF4A 2FBXA 4YHHJ 2KYXA 4IG3A 1GX6A 4BC3A 3GG4A 4BREA 1FHTA 2A42A 1VSMA 3HTVA 1W0HA 4NLRA 1JIHA 4ETXA 2A6OA 4FLYA 3IFEA 1BUPA 3FZMA 5AJ3K 3B8AX 4KJIA 2LMIA 2B6AB 4DF8A 1TKTA 2E5HA 1S6PA 1X31C 3NKYA 4NI2A 5GAEU 4MJKA 3HJFA 3NH2A 1P27B 3VGLA 4QW8A 2BJ7A 4CW7B 1XHZA 1ZZFA 4CZKA 4W4MA 5CZVA 1S79A 1JLQB 2KKZA 4R8UB 3ILLA 3K5OA 4U96A 1S1VA 1HNWK 4ISEA 2CWKA 1Z26A 3BEGB 5K8PA 4U7UK 1VQ6N 2R8GA 4FWRA 5EUHA 3W9HA 3NGTA 1JJ4A 4ZPVR 4TSXA 4ELVA 3P49B 2F4VF 2G4BA 1C0UA 2E2QA 5MAOA 4X4RA 3D6RA 2P9UA 1NLVA 2Q2RA 2VFTA 2C2EA 3AH6A 2QGFB 4NLOA 2ITMA 3KUHA 1XQSC 3BGUA 1N56A 1H0HB 3GU0A 2RSQA 2C2ZB 3AVMA 3GIJA 3NXZA 1HRHA 4RNHA 3KOAA 4YOXA 4NZ6A 2ZE2B 4GO5X 3HI0A 3IUCA 4Q45A 1HNXF 3H3NO 2KJVA 2NYHA 4YP3A 1HARA 3AO4A 2ZJPQ 3PIPQ 1VIOA 5I3QA 4MLHA 1NGBA 3C6UA 3N4WA 4RU2A 3CYMA 2NXNA 2RE2A 2VWBA 3T6BA 3RB6A 2GO8A 1D9FA 5L1LA 2L08A 2FJXA 2GHWA 4IH6A 4KAIA 2DNZA 2ZH3A 3CDEA 2JSXA 4CEAA 2KFYA 2Z57B 1HPZB 3M6XA 4ZVUB 5KG2A 1NBEB 3WX4A 3O2IA 3OYGA 1VC6A 3AA3A 1RA7A 2ZFHA 4CLPA 4FVUA 8ATCB 3L9ZA 5DM6L 1PILA 1Y4ZB 3WBZA 3QAUA 4E3SA 1SVDA 1CULA 5ADZA 2JWLA 1TFYA 1HLWA 3G25A 4X4VA 4Z4FA 3AVFA 4N76A 3SXLA 3FQLA 3C6AA 1V9OA 2Z56B 4ZMMA 2CNOB 2B5JB 1XN9A 3MPUB 1IKXA 2YH1A 2M7SA 2ERRA 2MQMA 4BROA 3FFIB 5M1KA 4ECSA 3CQ8A 2U2FA 2P9PB 1RXOB 3VQ4A 4EO6A 1RWXB 4LF2A 1HFEL 2UYTA 3SBGA 2AYEA 1RISA 3HKWA 4DR1F