1UWBB

Tyr 181 cys hiv-1 rt/8-cl tibo
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
427
structure length
427
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE
publication title Crystal structures of 8-Cl and 9-Cl TIBO complexed with wild-type HIV-1 RT and 8-Cl TIBO complexed with the Tyr181Cys HIV-1 RT drug-resistant mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Aspartyl protease
total genus 90
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1uwbB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1uwbB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1uwbB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1uwbB03
2ASDA 4TYAA 4G3IA 5F8NA 5KG7A 1TKXB 2HMIB 1EP4A 3DI6B 4ED2A 3OL7A 2AGPA 2B5JB 3KLEA 4KBIA 2FVQA 3RBDA 3MFHA 1RDRA 2BANB 1RT6B 2VG6B 4ZVEA 3EZUA 3KLGB 5HROA 3RAQA 1JLFB 3LP2B 4QW9A 1K1SA 5HLFA 2OPRB 1VRUA 2WONA 1SH0A 1JLAA 1S1VB 3HKWA 4Y2AA 4IRDA 2W9CB 4TQRA 3KK2B 3H4DA 1S97A 3BQ2A 4RU9A 5KFUA 5DLGA 2XCAA 5KFEA 4QWDA 1S1TB 4KHRA 2W7PA 3BSOA 4ED1A 2IC3B 4O3OA 1IKXB 3GV5B 2HAIA 2VG5A 3ICLA 1YVFA 3V6JA 4I2PA 4IG3A 1IKVB 3KLIA 1RAJA 4TXSA 2XGQA 4I7FB 2OPQA 4Q43A 5J2NB 3DOLA 3LP1A 5KFOA 2WK4A 3QLHA 3QIPA 1S6QA 4KKOA 3PZPA 1LW2B 4YQWA 4EO6A 3V81B 2BQRA 2HNZB 1SV5A 4PUOA 5HBMA 3DMJB 4M94A 1D1UA 4R8UA 4QWAA 2IM3A 1CSJA 1HMVA 2IBKA 2RKIA 4IOBA 1RT5A 2I5JB 2W7OA 4K4UA 4FS2A 3T5HA 3E01B 4J9KA 4NLTA 1RT1B 4WXWA 5F9LA 1TL1B 2UVVA 3KLHB 3M8PB 1NHUA 4MK9A 2E9RX 5FDLA 3H59A 1N48A 3DYAB 3FQLA 1RTDA 4O3QA 4NLUA 1S49A 1S1XA 4ED6A 4NLWA 2YNIB 4O4GA 5EWEA 3RB0A 4NRTA 1HNVB 1S10A 4XO0A 2R2TA 3H98A 2IM0A 4IH6A 2R8HA 1QE1A 4H4OA 5L1LA 4U6PA 1EP4B 4IR1A 1TKTA 1C1CA 1UWBA 3MF5A 3UR0A 4EEYA 3C6TA 3KLEB 2VG7A 3CDWA 4KHMA 4O3SA 2C2EA 3N6LA 4IRCA 3H5XA 5KFPA 3OSNA 2R2UA 3GIJA 4O3NA 5HROB 1HYSA 5L9XA 4YR2A 4ECXA 4NCGA 4MK8A 4U7CA 2OPPA 4IRKA 5HLFB 5C25A 2WONB 2DPJA 3KHGA 3FDSA 4GC6A 4YR0A 1U09A 2ASJA 3MR6A 4IH5A 2FJXA 5C42A 5KFSA 4ZPAA 5L1IA 4RW8A 1JKHA 3UQSA 2VG5B 3KMQA 4I2PB 3DRRA 4IG3B 3PR5B 3KLIB 3GIKA 3NL0A 3CJ2A 3KNAA 1ZTWA 4DEZA 3NKYA 2WCXA 4K4TA 2OPQB 5DQHA 4EBEA 5C5JA 3DOLB 3LP1B 1GX5A 1BQNA 2JC0A 3DDKA 2UUTA 4MIAA 3BSNA 5KT4A 3RBEA 1J5OA 3QLHB 3QIPB 3UDLA 1S6QB 4KKOB 5KFJA 2AWZA 4ECWA 3PHEA 5JUMA 4RNFA 4K4YA 2AX1A 3PJWA 3MR3A 3KLFA 3QZ7A 1SV5B 4H4MA 4PUOB 4X2BA 4J9SA 1SH2A 3NBPA 4R8UB 5KT3A 4OL8A 1TL3A 3CJ5A 3G6XA 1JX4A 3QGHA 4DG1A 1QUVA 3GQCA 1HMVB 2RKIB 3PJXA 2WHOA 4IR9A 3OLBA 5EUHA 3NMAA 5J1EA 5J2MA 5KFXA 3Q8PB 2XGPA 3LP0A 1ZETA 4ZPBA 3ISND 1D0EA 5J2QA 1RTHA 4PWDA 3NGDA 3G6VA 1RTDB 4ZVHA 4DL5A 1REVA 3FSIA 3DRSA 4TY9A 1S1XB 3RAXA 3LAMA 2HNDA 4O4GB 2FVRA 1RA7A 1IKYA 5KFDA 3FFIA 4ICLA 1QE1B 2BRLA 3QYYA 1RT4A 2YNFA 1KHVA 2O5DA 3BSAA 3OL6A 1HQEA 1C1CB 3KJVA 3SFUA 5KFCA 3KLVA 1UWBB 2JC1A 3C6TB 5F8HA 2VG7B 4F50A 2V9WA 4ED0A 5KFRA 3QGIA 4RUCA 5DQIA 4J9PA 1DLOA 3E51A 5T14A 4DL3A 1NNDA 4EO8A 1TQLA 1HYSB 4NCGB 2UUWA 2OPPB 3CVKA 2ZE2A 3H5SA 5C25B 3NAHA 1LW0A 3RB3A 4FBUA 2IJNA 3MECA 2EC0A 4MKBA 4NLVA 3MR5A 4YR3A 1S9FA 2J6UA 2V4QA 4IH7A 1JLCB 4LSNA 5C42B 1ZTTA 4ZP9A 2YNHA 4JV0A 3BGRA 5CYMA 5KG0A 3IRXA 1VRTA 4RW8B 1C1BA 5KG2A 3KK3A 2ILYA 3MEDA 1S9EA 5KFNA 4ZVFA 4WZQA 1DTQA 1LWCA 3CWJA 1S9GA 5C24A 3KHRA 5KFHA 3ITHA 2W8LA 2YNGA 1LWFB 1BQNB 3DLEA 4QW8A 3H5YA 4MIBA 1J5OB 4TYBA 4K4WA 1RT2A 4J9NA 5KG5A 4ZMMA 1HQUA 2W8KA 2JEJA 3G86A 2XCPA 2YKNA 1C0UA 1JLEA 5I3UA 3KLFB 3H5UA 4Q45A 3QZ8A 2WTFA 4HYKA 2RF2A 1RYRA 3HVTA 3NBPB 4RNOA 1TL3B 1QAIA 4IQXA 4DG1B 4WE1A 4NLYA 4TQSA 3DRPA 4NLXA 4F4WA 4RW6A 2OPSA 4WFXA 4ED8A 4KV8A 5J1EB 5J2MB 4ECUA 2HWHA 3G6YA 3LP0B 1QAJA 2FJVA 4K4VA 4PWDB 5J2QB 1RTHB 2XC9A 2R8KA 1IM4A 1REVB 4FS1A 1S1UA 4YMEA 1N56A 3RB4A 1S1WA 2IM2A 2HNDB 5L1KA 4EYHB 3M9OB 2C22A 1IKYB 2HNYA 2JEFA 4ICLB 4Y2CA 1RT4B 3DLGA 5KT2A 2YNFB 3CDEA 5KFYA 1S0NA 3KJVB 4QPXA 1TV6A 1RTIA 3LALA 2R8GA 3CJ4A 4IFVA 3EPIA 1DLOB 3Q8RB 2WOMA 3DOKA 4ECTA 5K14A 5JXSA 2ZE2B 4ECVA 1LW0B 1C0TA 3LAKA 4K50A 3D5MA 5KFLA 4J9QA 5DGAA 4NLOA 4IG0A 1TP7A 3MECB 2FLLA 4ZPDA 3PW5A 1VRUB 4LSNB 1JLAB 5KT6A 2YNHB 4MH8A 3BGRB 5CYMB 3IS9A 3KK1A 4NZ0A 3IRXB 4Q0BA 1VRTB 4RZRA 4PQUA 4DL4A 3KK3B 3PW2A 4IDKA 1S0OA 3MEDB 1NHVA 1S9EB 2HWIA 3HVAA 4WYLA 1DTQB 1LWCB 4RW4A 1N6QA 1S9GB 5C24B 2BRKA 3V6HA 3I0RA 3ITHB 5KFTA 5DGBA 2YNGB 3GV7B 4WFZA 3DLEB 3CDUA 4JUZA 2VA2A 2BE2A 1RT2B 4QWBA 2FLPA 4NLGA 4EBDA 3OSPA 1HQUB 1BQMA 5DG7A 3PVXA 4ED7A 2YKNB 1C0UB 1JLEB 5I3UB 1IKWA 4B3OA 3CJ3A 1MMLA 4ID5A 1Z4UA 4O4RA 4URQU 5L1JA 3FQKA 1TKZA 2RF2B 2BANA 3HVTB 4NLPA 5KG6A 4EBCA 4WE1B 3OL8A 2J6SA 1FK9A 3KLGA 3DRPB 3KHHA 4RW6B 2OPSB 4KFBA 4G1QA 5HBMB 1S0MA 2E9TA 2FLNA 1T05A 5D3GA 5I42A 2ZKUA 3BREA 5F8LA 2JEGA 4FBTA 4JV2A 2B6AA 1RT5B 2GIRA 5KFBA 2W9BA 4Q44A 1S1UB 5KFZA 1T03A 2D41A 1S1WB 5KT7A 5F8MA 3M9NB 2HNYB 5FDLB 3IN5A 4K4XA 5KFVA 1JLBA 3DLGB 2AQ4A 3M9MB 5HP1A 1S4FA 4F4ZA 1TV6B 2JLEA 3DM2A 3TVKA 1RTIB 5J2NA 2CKWA 4H4OB 4IFVB 3C6UA 1TKTB 4NLRA 1FKOA 5EWGA 4RNHA 1JLQA 2WOMB 3DOKB 5KFWA 2F8EX 2IM1A 5KFIA 5K14B 3KHLA 3PW7A 4F4XA 4IFYA 1C0TB 4Y3CA 2YKMA 3HHKA 4MFBA 3UPFA 1HARA 4ZP6A 4IG0B 2J6TA 4DL7A 1TVRA 3H4BA 1EETA 2D3ZA 4NLDA 3TAMA 1C2PA 4LQ9A 3GYNA 3KK1B 4EYIB 3IS9B 1I6JA 4Q0BB 3T19A 3IGVA 4O44A 4PQUB 2RDJA 4IDKB 3M8PA 2BQ3A 3DYAA 2C28A 4RW4B 4RW9A 1N6QB 4MKAA 2IJFA 3H2LA 5EWFA 4RNNA 3PW4A 3I0RB 3V6DA 1JKHB 1RTJA 3V4IA 3I5CA 3I0SA 4NLSA 3Q8QB 2UVRA 2BE2B 3DRRB 4RUAA 3SI8A 4ZPCA 2UVWA 4I2QA 4NYZA 1BQMB 3OL9A 5KFGA 3KMSA 3QO9A 1S48A 1IKWB 4B3OB 4ID5B 1TKZB 1SUQA 3GILA 3GV8B 3MEEA 4QWEA 1HNIA 5F8GA 3PW0A 5KG4A 4O3RA 1FK9B 2DPIA 1S6PA 4ED3A 4KE5A 4KFBB 4G1QB 4H4MB 2WB4A 1RT3A 4TY8A 2BR0A 3T5LA 2XWYA 1T05B 5D3GB 5I42B 3FRZA 2V4RA 2C2RA 3DLKA 2QE5A 4ECSA 2B6AB 2R2RA 5J2PA 4RW7A 2ASLA 2W9BB 2ALZA 2BQUA 1T03B 2R8JA 1KLMA 4R0EA 3MEGA 4LSLA 1XR6A 1JLBB 3DRSB 1JIHA 3MTKA 5HP1B 3OHBA 2D7SA 3GIIA 3DM2B 5CYQA 3FFIB 3C6UB 5KFMA 2ZD1A 4NLQA 1HQEB 4XPCA 1FKOB 3N6MA 4IKAA 3EPGA 1RYSA 1JLQB 3ISNC 2AX0A 3CO9A 3JSMA 2IAJA 4R5PA 4ZP8A 2R8IA 3IG1A 4IFYB 3VQSA 3GIMA 1FKPA 1HPZA 2YKMB 4MK7A 2D3UA 4MFBB 3M8QA 2IMWP 5F9NA 1JLGA 1TVRB 2AGOA 1EETB 3KOAA 3TAMB 4ZP7A 1N5YA 1R0AA 3HVWA 1DTTA 1RT7A 5KFFA 4O44B 1T94A 4J9MA 2E9ZA 1W25A 2GIQA 5KT5A 4RW9B 4URSA 4KO0A 3Q8SB 4F4YA 5F8JA 1N4LA 4ZHRA 1OS5A 2JEIA 2XI2A 1MU2A 3V6DB 1C1BB 1RTJB 3V4IB 4H54A 3I0SB 4O3PA 1KHWA 1LWEA 4Q8EA 2ATLA 4I2QB 2RDIA 2W9AA 4J9LA 3T5JA 3QO9B 3JYTA 1T3NA 2FVSA 4RNMA 1SUQB 2IA6A 4M95A 3MEEB 1TKXA 2HMIA 3T5KA 1HNIB 3DI6A 5KFKA 4WFYA 5KG1A 1S6PB 2B5JA 1XR5A 4TN2A 4ZVGA 5KFAA 5F8IA 5KG3A 5DLFA 4J9RA 1WNEA 1RT3B 4WZMA 4TY8B 4ECZA 1RT6A 4LQ3A 2VG6A 3DLKB 3QIDA 5DG9A 1JLFA 3LP2A 4RW7B 5J2PB 2FVPA 4KV8B 4URGA 2OPRA 3OLAA 1JLCA 1KLMB 1S1VA 3LANA 3MEGB 3IGNA 4KSEB 4LSLB 1RA6A 2AU0A 2W9CA 4KAIA 3KK2A 4ECQA 2AGQA 2CJQA 1K1QA 1S1TA 4J9OA 2FJWA 3OHAA 2IC3A 3CIZA 1IKXA 4ECYA 5CYQB 4QWCA 1LWFA 1GX6A 3D28A 2ZD1B 1IKVA 4ECRA 4DL2A 3SFGA 4I7FA 4YP3A 3I5BA 4KB7A 4GC7A 2C2DA 3H40A 3JSMB 2IAJB 4R5PB 3BR9A 3IG1B 2XI3A 1FKPB 1HPZB 4DL6A 3BQ1A 3BSCA 4WXOA 2VA3A 2V0NA 3M8QB 1LW2A 1JXLA 1JLGB 4K4SA 4JV1A 3V81A 3V6KA 3N6NA 3T1AA 1N5YB 4Q8FA 2HNZA 2WRMA 3QGGA 3PR4A 1R0AB 3DMJA 1DTTB 1RT7B 4Y34A 3BJYA 3BQ0A 3RB6A 2UVUA 5DG8A 2GC8A 5EDWA 4NRUA 2I5JA 2FVCA 2R2SA 4KO0B 4WYWA 3E01A 4K4ZA 4ZHRB 3I5AA 3MR2A 2QV6A 1MU2B 1RT1A 1TL1A 3KLHA 1SH3A 5KFQA 2I1RA 4HKQA 2ILZA 1XR7A 5DQGA 1LWEB 2OH2A 3MFIA 3NAIA 3TQ1A 2YNIA 3CJ0A 4TLRA 3JYTB 4XPEA 1HNVA 2B43A
chains in the Genus database with same CATH superfamily
2ASDA 4FF3A 2J8AA 4QJVA 1EP4A 1NCLA 4KHPF 1UFLA 1FFGB 1DJ0A 4X4NA 3KJFB 4RWXA 4B3TF 4TQRA 2NXNA 3BQ2A 3FBEA 4P9SA 1QSYA 1MW7A 2MGZB 2MJNA 5KFOA 1KR4A 1S6QA 3V81B 4MYUA 1FX2A 3DMJB 4R8UA 1VQKS 3WHIA 1YZ6A 4IO9Q 4K4UA 1EKRA 4MIWA 4FYDA 4P2FA 3JQKA 4C8OA 4CT8A 2CZVC 3PDNA 3NOGA 4RR5A 4KHMA 3NG8A 3UDEA 1PIEA 4K8RA 5CAAA 2R2UA 3GIJA 5C25A 3JXOA 1DARA 3KFWX 5C42A 1P9YA 1HBOB 3SQGA 3CJ2A 2WCXA 3DOLB 3DDKA 4DN0A 1J5OA 1HBNA 3MOZA 1EHWA 1M5OC 4Q2MA 5E5NA 5JUMA 5HMXA 2IFXA 1KLNA 1R7IA 3HT0A 2Z0GA 2GVDB 3ISZA 2R42A 5EUHA 3Q8PB 3NGDA 2UXCF 4F3QA 2HNDA 4DV2F 2OO4A 3BPDA 2PA3A 2R7QA 4DPTA 2GGPB 2AJ4A 4JI3F 2VG7B 2V9WA 3IR7B 2A2DA 4J9PA 2JFDA 3B4DA 2H65B 5HSPA 2DNOA 3CDAA 2HVDA 4LIWA 2C2MB 1WDTA 3BGLA 3CO0P 5AT1B 5D78A 4X65F 3IC1A 2YNHA 2QLJB 4F2SA 5D4LA 4ED5A 2UUBF 2XCPA 1ZA2B 3MMAA 4ERDA 1U8SA 3AOAA 2BJ9A 5J2MB 4OZ2A 2GNKA 4JI2J 4DR7F 3DNCA 1S1UA 3FK4A 4IO1A 4EYHB 5H9EJ 3C2PA 2VQFF 2BZ2A 2GS8A 3KJVB 3D68A 3LALA 2JFKA 2LVWA 1DLOB 1DQAA 4YS2A 1LW0B 3TZZA 5HJXA 4DUTA 3N0VA 4U67Q 1NK7A 2BX6A 5KT6A 2XSFA 2XHWA 4AQYF 2G9OA 1NHVA 4V19X 4WFZA 2H5IB 4K0KJ 4HLBA 1C0UB 2BANA 4WE1B 4KGXB 4LREA 4OZJA 2NYIA 5F8LA 2E7WA 4F67A 3QWPA 2BKNA 4C8KA 3F0NA 4P7VA 4OHZA 4IFVB 4PQAA 5EWGA 5DDRC 3PYEA 2B8PA 5KFIA 1ROFA 4HDHA 4D3HA 4KH0B 2HQ3A 4MYTA 2ZBQA 4ATNA 2WW8A 3IGVA 4CLKA 1Y5IB 4OI2A 1URRA 4XK8C 2MXYA 2MQMA 3NCRA 3I5CA 4B3SJ 4LF5J 1NJZA 1NSAA 1Q4RA 3UW1A 3PX0A 4NMXA 3EVOA 3AQOA 3GILA 4O23A 4QWEA 5F8GA 3CSKA 5HAOA 1DQ8A 2C2RA 1RHRB 5EGYA 3VHQA 3K5PA 3MEGA 4A46A 4ES1A 4USMA 4OI3A 2VODA 1TUGB 4NE9C 1JLQB 3IWXA 4F25A 1UEVA 3TYTA 2ALYB 2XLIA 4N56A 2MZTA 1PJ7A 3I0SB 4RU2A 1B64A 2R7XA 1H7WA 3X3UA 3TP2A 2FB0A 2ZHBA 5F8IA 3PO5A 4BC7A 5A8WB 4NYPA 4Y28C 5HMZA 2F4FA 2QIFA 2XLKA 4QZVB 3G9CA 1S79A 3HDSA 2W9CA 5E33A 2F65A 5ETVA 2MKCA 2P9EA 3SFGA 1RHKB 2IJRA 3CUNA 2OI2A 1T02A 4WXOA 1RBLA 1NLKL 3W5XA 2CA9A 2RAQA 4ITSA 5BXIA 1R0AB 2XTJP 3LW5C 2PO4A 2FVCA 3KJQB 9RUBA 4DX6A 2E29A 3OTOJ 4BCAA 5DJBA 4JYAJ 3T9NA 1BWEA 1QSSA 1CJUA 4NYOA 2FVQA 3R7NB 4RPFA 4DOZA 2RRBA 4JI5J 1JLFB 4QW9A 1KQFB 2WONA 3MR7A 2B4UA 1X60A 4QYRA 3VTIA 2IC3B 3I4HX 3M30B 1V9OA 1RADB 3BS9A 1C4CA 5L9NA 1Y3JA 1FNXH 2E1RA 5ETRA 4Q43A 4I69A 2ZZTA 4ES3A 3C15B 2WK4A 1NZ8A 1UVNA 4DX7A 5LMNF 4WF9Q 2WSEC 4LMZA 2BQRA 1QDUB 1RBOB 1U48A 3K5MA 1U2RA 1CQNA 4RWWA 2KB2A 1TK5A 1NHUA 2MKJA 3HLUA 1RU2A 1S49A 4OI0A 4KYZA 2ZBIA 2V8DA 3FZ2A 3PFEA 2IIHA 4HVZA 4O3SA 1IQZA 1U4BA 3R7BB 3NWGA 1HYSA 1ZPWX 4OI6A 4OYWA 4YR0A 3K8VA 3CMQA 1VFJA 2QC3A 3PR5B 4QU7A 1AFJA 3Q22A 1FVSA 2M3DA 2JC0A 4MIAA 3SSSA 4FXDA 3QLHB 4CP5A 3LGHA 3PJWA 4PPDA 1JB0C 3D66A 2HEKA 3PJXA 4NA2A 3LP0A 5AXMA 4PWDA 5LL6d 1GFWB 3DRSA 2MY7A 2MLZA 2KO1A 4ZLPA 4CQ1A 5KFCA 4LF6J 4YHHF 2XYHB 3UDCA 3PNIA 2HQCA 3MM7A 3K5LA 5KG2A 1N34F 2V63A 3T6BA 2E1PA 5KFHA 4UQTA 1YQHA 1AROP 1BQNB 1YX2A 2ZOGA 1FT8A 1GT8A 4CT9A 2M5YA 4HYKA 2RF2A 3PKYA 4WFXA 4LF7F 4YOEA 3P5BP 1M5PC 1UP1A 2R9LA 3BGFA 5KT2A 2CPZA 2CWXA 2K1RA 3N5BA 1V3RA 4ENOA 4GKJJ 3BDPA 3QMQA 3LAKA 3TUZC 1ZAVA 2QYCA 1TP7A 4FYWB 5HL7Q 4DF4A 5F41A 3QQCD 3SSRA 4LSNB 2KFNA 3BGRB 3KK1A 4PQUA 3O6QA 3DLHA 2VA2A 2BE2A 3JAMY 3BYRA 2L9NA 3PVXA 4C0HA 3UFCX 2OMLA 1YG0A 2KVIA 4LR7A 3NS6A 4G1IA 4ILLA 5KFBA 5RUBA 1FKAF 4Y2MA 2AQ4A 3DM2A 1VBKA 4L6V3 3TW0A 2KRRA 3UCGA 4NEZA 2NZCA 2VKRA 3HF5A 1T7PA 3PW7A 4CTAB 3IXQA 3GWCA 1HARA 2EKYA 2V9KA 1RQ0A 4EYIB 3IS9B 2QMUB 1SQFA 1AXQA 3UD3P 1RTZA 5DO2A 4JI6J 3MM6A 2RQ4A 3VVUA 1U02A 2XMMA 1UEKA 4B02A 1M1HA 4G1QB 2XS5A 2NPIA 3IM9A 2MKYA 2QE5A 2B6AB 4DR5F 1X4HA 2XZTB 2B9EA 2GIFA 1P1TA 1NB2A 2D9PA 1FTCA 2Z2ZA 2DNMA 2ZD1A 2HIYA 2N4DA 8AT1B 5IQ6A 4R5PA 4IFYB 1PYSB 3S8SA 1GMUA 4LFCJ 4NCBA 4ELVA 1N5YA 2CZ9A 2HHHF 2FC8A 4J9MA 2HKEA 3N9UC 3HSJA 4OJ1A 4KO0A 3MAHA 4H54A 2L41A 3Q2TC 1YJUA 3W8GA 4WFYA 1MWYA 2FHMA 1S6PB 1XR5A 5JVGQ 1WHVA 1L3UA 1Q82T 2GO9A 5DG9A 3LP2A 2OPRA 2XS2A 1UVKA 5B09A 2FHJD 2HHSA 2GFFA 1HBMA 3CIZA 5CYQB 1YSJA 2AD9A 2V8VA 2KRBA 2BKOA 4RUHA 4UY85 2C2DA 1R8HA 1LXNA 2CQIA 2QL7B 4OFZA 2XI3A 4USVA 3TARA 1WF0A 2RB7A 3N6NA 3POTA 1AZSB 1PKUA 5KAKA 3VR1A 1B0VA 4N77A 1NPPA 3SDEB 4NLPA 1U45A 4ZVPB 3AAWB 2BANB 4WFNQ 4ZVEA 4K59A 1RAGB 2BUNA 5A6PA 4ELTA 1UPPA 1X4FA 3S6EA 2GJIA 4AUKA 2B9WA 1WD6A 4QWDA 3OUYB 5CQGA 1QM9A 5DDQC 2ACMA 2HWTA 3KLIA 1T9TA 3PRDA 3LP1A 3EDQB 1UZHA 4KKOA 2EW9A 3PZPA 2KFYA 2VBWA 4QWAA 1X9WA 3LGMA 3CJSA 5F9LA 1HL6A 2LXIA 4O3QA 4JI0J 2J8SA 3FC9A 1HNVB 4XO0A 1WTBA 2HVHA 3FZBA 3C6TA 2OEJA 3L9ZA 4QOTA 3ELHA 3B8HA 1NK9A 2DNKA 2ZUGA 1Q95G 3ULHA 2ASJA 3CD0A 2JDJA 2IRYA 1SBRA 3UQSA 1FRXA 2GA7A 2VJUA 4DEZA 5CHCB 1QTNB 3RZAA 3V2UC 3J81j 1X31C 3BSNA 2O67A 2AX1A 3G82B 2DD8S 4ES2A 4OL8A 2HHQA 1PG5B 3HHLA 4KIAA 4OZNA 4USKA 4MJKA 2KI2A 2C1EB 1KHVA 3OL6A 2RQKA 3OQ2A 1N52B 3KLVA 5IT9Y 4KGZB 3QGIA 1JNRB 2X7IA 2DHGA 4V1Ak 2KT2A 1U1NA 2WBRA 3NAHA 3LO3A 4KPCA 1XIQA 5CYMA 3VVTA 2BW2A 5A2QU 2V2VA 3EE3A 4ZPTR 4HTIA 3Q0AA 2HQIA 3W66A 1DHMA 2R7RA 3J7ZT 4HHJA 4QQBA 1JLEA 3QZ8A 4K0KF 3HVTA 3Q89A 3VAIA 4ED8A 1C4AA 1S77D 4Y2IA 1HWJA 1RTHB 5HMYA 1CJKB 4X4TA 3Q23A 3D3BJ 2EFVA 2LEPA 4EMDA 3PIOQ 1U6FA 5IC4B 2R7OA 3DOKA 5K14A 2AIRB 1FDAA 3MMBB 3OR2B 3RRGA 1Z2LA 3G96A 1Y9OA 2EG1A 4LIRA 3PW2A 5B0AA 2J7KA 2M4MA 1S9EB 3K17A 1GNKA 5C24B 1ZA1B 3IM8A 1WOOA 3OTEA 1BQMA 3H2VE 3MUMP 3W61A 5I3UB 5THWA 2CQGA 2ZOMA 3KLGA 2XB2D 5ETQA 5KOXA 2JEGA 4FBTA 1T05A 4DV4J 1NK5A 4UOFA 1IBCB 2ZBRA 5A0YA 5HP1A 3TVKA 1RTIB 1X4DA 1IUJA 1BE4A 4JI1J 2CPDA 2DGQA 3UCZP 2D3ZA 3TAMA 1KD1T 3BN4A 1CJTA 4OV6A 3Q83A 3CCTA 2VBZA 5AXNA 3JB9k 3T41A 1T9YA 3ZZUA 3J7YU 1HNIA 4ZOSA 4U96A 2J9CA 2V67A 3M05A 3HSZA 3R7SB 2VC0A 2Q43A 1FJGJ 1WSRA 4OLPA 4P75A 4ETZA 2CNNB 3U1MA 3O3LA 3ZTPA 4XDCA 3CCVS 1E6VB 3DRSB 3D6MB 3HM9A 2Y1LB 1KS2A 1GEHA 3VAKA 4PWUA 4ZCIA 1NDLA 4C98A 3NGRA 2PMHA 3M8QA 4PABA 1TMMA 2VDHA 2HHPA 4YB1P 4CH0S 2C3OA 4FKYA 3CXCR 4Z37A 3EDRB 2JEIA 4DQPA 3V6DB 4P10A 5GMDA 1WWHA 3OTOF 2IA0A 3DU5A 1T3NA 1SUQB 4JYAF 3T5KA 4LRFA 3MAQA 4J9RA 2R4FA 3FEXB 4JI5F 1JQGA 3FJ2A 3UI3A 2FJBB 2CG8A 2I9SA 3AQPA 2LQ8A 4L76A 1NKBA 2ZJPQ 3JSMB 4E2FB 1VQMS 1FKPB 4JV1A 1JXEA 4QR1A 3CE8A 3LOUA 5EDWA 4NRUA 3W5YA 1MROA 1NK0A 1RT1A 4HKQA 5DQGA 2CPYA 4TLRA 3JYTB 4I64A 4TYAA 4G3IA 5KG7A 1SXLA 4ZIWA 2MTLA 1RT6B 1WUUA 5HROA 4YY3J 4O0NA 1S97A 4ED1A 4KGKA 3BSOA 1JNZB 3OT9A 3ICLA 1TMJA 1PCAA 3VQTA 3M6WA 2GQ2A 5D0RA 4BHQA 4WIQA 3KJNB 3GPAA 2EXUA 4F3OA 5T41A 1AB8A 3I87A 5C7PA 1HBUB 2KDOA 1UFWA 3PEJA 1GMVA 4PWWA 2J0WA 1WOSA 1HI8A 2JOQA 4LF6F 1RKJA 1U8WA 2OPPA 4IRKA 2FC9A 2M9KA 2P9GA 3BN7A 3CCJS 4M5KA 2LP4A 1NPRA 4HI1A 3DRRA 1KVIA 1SL1A 4K4YA 3KLFA 2X1BA 1QAXA 3R1HA 1JX4A 3GQCA 1HMVB 2RKIB 3NMAA 3ZZRA 3BF4A 1IVZA 4CDIA 1NJXA 3FSIA 4TY9A 1S1XB 1OSCA 1W2BR 3GSIA 2KT5A 5T7LA 2DHAA 3AXKA 2DO4A 1REGX 1KNZA 5E3CA 2U2FA 2ZE2A 1IR1A 1A9NB 4WKRA 4GKJF 1UZDA 2RVJA 4DR1J 3IRXA 1S6OA 4CYUB 1LWCA 2LU2A 1HBMB 3K2YA 3H2UB 3ITHA 3SCLE 3U1NA 2FJEB 1HA1A 1KDNA 2DHXA 3T6JA 2YKNA 2W2QP 2WTFA 2AJFE 4CO1A 2BE7D 1RBAA 1E6YA 4YB7A 1UEUA 3H25A 2YKOA 2A2CA 3RB4A 4WJBA 3K89A 2C22A 4C3LA 3PYGA 4Y2CA 4U7UD 2V5HG 4M5DA 4AYBD 3OFFA 2MSTA 2P6SA 2VBYA 3ENWA 1OJ4A 2CNLB 1GMWA 5JXSA 4BLGA 3WC0A 1YJ9S 2XZWA 1Y3KA 5A8RA 3TX0A 4QBUA 4RW4A 1N6QA 2Y9HA 2BABA 4JUZA 4EBDA 2RMLA 1VR6A 4ED7A 4B3OA 4ID5A 1FFSB 5M2UA 5DETA 1H38A 2RU9A 2G4BA 2WVEA 4C2MA 5KT7A 2DNNA 1JLBA 1X8DA 2KHDA 2BMBA 2DXDA 4NLRA 2Q79A 4ZLJA 5SUHA 1C0TB 3D0IE 4IG0B 6AT1B 2MKHA 1TU0B 2Y0BB 4L74A 4CNYA 2AEJA 4TU8A 3DLJA 3G8SA 1TKZB 5BYSA 4LBPA 4NASA 5H9FJ 3RAMA 3G6ES 4ECSA 2Q1LA 1SJFA 3WIUA 3NS5A 2R8JA 1KLMA 4LSLA 2DRBA 1HHQA 3OHBA 1TL5A 1H6KX 2IRXA 1NKCA 2YBVA 2DGTA 2IAJA 4OZLA 2ATCB 3VQSA 4MK7A 1D9AA 2XMAA 3L7PA 2W2PP 3KOAA 4WIIA 3WIVA 1DTTA 1RT7A 2CPIA 2GIQA 4DV0J 1OS5A 3OR1B 2CQCA 3AHPA 3HPOA 3QO9B 4CLYA 1FERA 2JL9A 5KG1A 3UR3C 2JSXA 3CJKB 1FHTA 4TY8B 2FJDB 4LQ3A 2DNHA 1EIYB 1CS4B 2V50A 2ZVSA 2ZUAA 1HQ2A 1JLCA 2ZZMA 2AU0A 2EWHA 2NUUG 1L3TA 2LXFA 2YPYA 2OTLS 4H4KA 3BR9A 3PRBA 3BQ1A 3ET6B 2WRMA 3GR1A 1XTZA 2AJ1A 4CZCA 2FUG9 1MU2B 4A4JA 1LWEB 1FESA 2KM8C 2DYAA 4C11B 4NL5A 1S59A 4JI0F 1TKXB 3KUHA 2VG6B 3KLGB 1MNEA 4XTTA 3U1LA 1PBUA 4DPUA 3PYDA 2HAIA 3V6JA 1DZ5A 3BBFA 5A0YB 3W63A 1IBKF 3M32B 1SIZA 3NWRA 1NM2A 3MHYA 5HBMA 4LF8F 2BJEA 3B78A 1TL1B 3KUGA 3H59A 4O4GA 3MDFA 5EWEA 2DKOB 2C2OB 2MQNA 4AFFA 3OFEA 3UE2A 1UCNA 1M1KT 5L9XA 3MXHP 2DPJA 4CO5A 2XMUA 5HI7A 2XULA 1UA0A 2MLXA 3OFGA 2FJXA 4LF9J 1YJTA 2B8QA 2MZJA 3A4TA 4A8WA 2HFUA 1B7FA 3QIPB 3NNAA 4A8SA 4DLEA 2M70A 1BLUA 1MWZA 2MB0B 4OHYA 1TL3A 1XNRJ 4DG1A 3TOQA 1CULA 1IN0A 3J80Y 1R31A 2CQDA 3OTDA 4QIFA 2FVRA 3FFIA 4ICLA 2OIHA 4WCEQ 2BOAA 1UWBB 5T14A 3GSDA 2CQ3A 4NCGB 2UUWA 3GCWP 1BQXA 2FQQB 2EC0A 3QSIA 5KG0A 3KK3A 2H4YB 1PJ6A 1M5VC 3DLEA 2N3OA 4PG7A 1KEKA 4QIWD 4A48A 1PAUB 1NUEA 3PG9A 4HACA 4NLXA 4KV8A 2ZDPA 3GMGA 4DV4F 5L1KA 2JEFA 4YFUA 4GO5X 1RT4B 5KFYA 1Q1KA 2VFVA 2DNYA 2HS0A 3VAMA 5EX0A 4JI1F 5DGAA 1MN7A 4NLOA 3CULA 1Y00A 2HRTA 4OX7A 1H3DA 5KFTA 3GV7B 2LEBA 3CDUA 3HK2A 3MM8B 2CNKB 2Q6BA 2P5VA 1Z4UA 5L1JA 3FQKA 3IA0A 2PE8A 1U0HB 2WW4A 2W25A 2R7SA 3CCZA 3QATA 3B4MA 3RBZA 2R7VA 1VQ5S 1U1QA 4YN3B 4EK2A 4Q44A 5KFZA 1FJGF 5F8MA 1M5KC 2HNYB 1PJ5A 4EWTA 1BUXA 1SKRA 3BV8A 1WI8A 5J2NA 4UUWA 1FKOA 5IWAJ 3K7RA 1TL7B 1WJ9A 3V5RA 3FSYA 5K5MA 3I4PA 1RCXB 3THTA 1X4CA 1VQ7S 2H9ZA 1XC9A 3M8RA 4CLLA 2AEMA 4IDKB 1PC4A 1WC3A 1YDLA 3C16B 3DRRB 1ELOA 3OL9A 3J7A1 3MEEA 1FEHA 2BJ3A 1VGYA 1FK9B 4KE5A 1PILA 5HMWA 5J2PA 1VQNS 2BQUA 3C3LA 3PCOB 2X51A 2ZH4A 1ZM9A 2MZSA 1UTAA 3MTKA 2AYGA 1F9FA 2DBBA 3VALA 1H72C 4UZCA 1F60B 3ISNC 2R8IA 2OSQA 2IMWP 1N5VA 3P96A 5IT4A 1TVRB 4ZP7A 1BD6A 3AH6A 2E9ZA 2RH3A 3H8YA 3HD1A 2RIJA 2JLGA 3OV7A 2H54B 2XI2A 1RTJB 3V4IB 1GTEA 2QA2A 4DV6J 1N5TA 2A10A 4USHA 2YH0A 1EZZB 2YH1A 2WBMA 3MMCA 3DLKB 5IS2A 3G8TA 2CQBA 1E6YB 1N0VC 2E5GA 3D0GE 4OYIA 4PKDB 2Z4PA 3KK2A 1XNQJ 1B7YB 1ZM4A 3A3PB 3OTBA 3OHAA 1YBUA 3D28A 1IKVA 3BZQA 2AJQA 2W4DA 2LCWA 3CC4S 1X5OA 1JXLA 1JLGB 1R89A 2DR5A 5HJYA 2HNZA 4M5MA 3GLJA 4Y6IA 4QR2A 5A8RB 1SI9A 3E01A 1K73T 2ILZA 1JJCB 2QFJA 3H90A 1R43A 5F8NA 4EFAC 2IMOA 2D69A 5D4NA 3TUPA 1SB6A 1CJVB 5HLFA 1VRUA 1XBWA 3B82A 1GK8A 2NS1B 5KFUA 3US5A 2DCUB 2B0GA 4OZ1A 2XGQA 2O01C 1VMBA 4U7UK 2WVCA 2ZHOA 4C48A 2E1AA 1Y5NB 2HQDA 1SV5A 4PUOA 4HR2A 1TK8A 3QT8A 1T9UA 3SCKE 2D9OA 4IOBA 2I5JB 2Q6CA 3GB0A 1VQ8S 2ZH7A 1JXVA 2EK6A 4H4OA 4IR1A 1F3FA 1VLOA 3IBFB 3MM5A 4DX8H 5LOQA 2M52A 1YWXA 2ZC4A 3HKZD 2HBYB 3HZEA 2F8HA 3HCXA 1U6BA 2LXUA 3ILIA 3HFKA 4CI0B 2VG5B 2H5EA 3IMQJ 4DL0C 4DR1F 3UVJB 2H5JB 3HX9A 3UDLA 5IM0B 4NCAA 4USUA 3NCQA 3QZ7A 2KG0A 3NBPA 3SIPB 4P2SA 3CCUS 1D8ZA 3J81U 3R9LA 2HFNA 2XGPA 5J2QA 2ZITA 1L3SA 4ANCA 1TK0A 1RWOB 1IKYA 5KFDA 1BY9A 3MAAB 2YNFA 1Q53A 2RHSB 4C3MA 2ZH6A 3TX8A 5K9FA 4N47A 2FIUA 3RB3A 3MECA 4MAKA 4YR3A 3KTQA 1JLCB 2UXBF 2AYBA 1Y7PA 4WKYA 5KFNA 3CGIA 4WZQA 4YB5A 2YNGA 5BR8J 3DC2A 3H5YA 2ERRA 1RT2A 4ZMMA 2LA4A 2JEJA 4CO4A 4TU7A 3BDEA 1QAIA 3M8WA 5J1EB 4FS1A 2K2PA 2KHCA 2DGOA 2ZNYA 1HWKA 4ZCLA 3SEOA 3A3OB 3O1LA 3M8YA 1T9XA 5HVGA 1KTQA 3GJSB 2QX0A 1P6TA 4AXIA 1RUSA 3JS9A 4ZPDA 3OFHA 2IRUA 4Q0BA 4DL4A 2HRYA 3MEDB 3ETOA 1S9GB 3V6HA 3I0RA 5HVFA 4QWBA 2HSEB 1T9VA 3BPSP 2BXJA 3UD4P 2FZCB 2JLFA 4JI4J 1FO1A 3S7RA 5HBMB 2HQGA 4DSEA 2QEXS 4DR4J 1T03A 1S1WB 4USWA 2HFOA 5KFVA 3B6BA 1TV6B 4YDXA 2VL1A 3C6UA 5K8OA 2EFQA 4OYAA 2E5LJ 5KFWA 1L5UA 2F8EX 2GQCA 4F4XA 1BXNA 2YKMA 4MFBA 3QT7A 2LDIA 3JQMA 2MSSA 3IO1A 3GYNA 3TEHB 3HXMA 2VFSA 1FRKA 4NLSA 3SI8A 2FD2A 1UJ6A 2HS4A 2P8IA 3DFEA 1RT3A 4LUBA 2I2YA 4P6QA 1WKJA 4F4AA 2DEJA 3FFIB 1VHFA 5G4DA 1RYSA 4JI7J 2GV1A 3DOMA 1HPZA 1EETB 1O0PA 4FYXB 4O44B 1NSQA 1YTYA 5DZ6A 3NXZA 2C2NA 2ACYA 4CM0A 3AJ2A 4Q8EA 2APOA 4LR9A 1NK8A 1Z1ZA 2HRUA 2ZH1A 4M95A 4DV5F 1F2HA 4GMKA 2CJKA 3MI7X 4OYOA 2OUGA 4KV8B 3OLAA 2NSCA 3W9HA 2ROGA 1GX6A 4L73A 1D9DA 4KB7A 4FNIA 2LKZA 4GVBB 1KVJA 2OGUA 2V0NA 2IBOA 1FRJA 4CH7A 3GIRA 3JTOA 1KQSR 3ENVA 2R7UA 4F3MA 4DQQA 3CJ0A 2HLUA 4XPEA 4DU7A 2HHUA 3O44A 2CPJA 3KLEA 2DB1A 2K7JA 2A0FB 3RAQA 1G7CB 3IWNC 4ZCKA 4BWJA 1S1VB 4C8YA 1NDPA 5DLGA 5H1SV 3CC7S 2BBEA 5D0HA 1YVFA 4TXSA 5E41A 2OPQA 5J2NB 4LF9F 3U02A 2QFIA 2A6MA 2VPZB 4EO6A 1SIWB 5IFMA 3K59A 3GYXB 4UZBA 2W7OA 3HHDA 4J9KA 1XNRF 2PC6A 4OZ5A 5FDLA 4Y2KA 4NLWA 2JWNA 5CCMA 4IH6A 1DRZA 4U6PA 4AE5A 1C1CA 1AUSL 4NX9A 1NBEB 1FDBA 5KFPA 5D4PA 2ABYA 4WP3A 4HI2A 4ZVTB 4DCOB 3OXGA 1QJHA 3E8OA 1FDDA 1D9FA 5LMUJ 4K4TA 4ZKAA 5DQHA 2UU9J 2FGCA 5F3ZA 1RWNB 3CMES 4DXLA 5L46A 1HD1A 4H4MA 4YB6A 3IBWA 4ZPVR 3G6XA 2MY8A 3LQVA 3LPEA 1D0EA 4HH0A 2ROPA 7FD1A 3MUTP 2HHVA 2UUCF 1RISA 2OHDA 1CVJA 3TO8A 4M8LA 2Y0SD 1F5BA 2D3OR 2J76E 2VOPA 3MR5A 3EUNA 1VRTA 4RW8B 4FZVA 3TWZA 3MUVP 4B9SA 4F4KA 2E66A 2ZWPA 1RB0A 4TNOA 3DGPB 5B0CA 1DBDA 1NSPA 4Q45A 2AMCB 1RYRA 2CAJA 2N7CA 2J0QD 1YGYA 2XSJA 2OPSA 3CD6S 1IM4A 2F63A 2W4PA 2DR7A 2MKKA 3DLGA 2JX2A 3GFZA 3CJ4A 5K8MA 3QT5A 5IWAF 3W9JA 2HAFA 1KSPA 2FLLA 2HZAA 1VRUB 3MD3A 3UO0A 2MQPA 4NA3A 1LNQA 1RWXB 4I0WA 3F56A 2NREA 1HQUB 3RU0A 4FF2A 1RWKB 3LH2S 2KJVA 2DGWA 2J6SA 1EB0A 1XMOJ 5I42A 4JBCA 1QY7A 1KKHA 1FTRA 3U7JA 4K4XA 4UOCA 3D67A 4JV5J 2CKWA 5GMEA 4H4OB 2GVZA 4DZ6A 4OLOA 1KOHA 1YJRA 4RNHA 2WOMB 2Y1IA 3HHKA 3F44A 2J7WA 4W90B 2J6TA 2MHEA 1C2PA 4HHHA 2DR8A 1I6JA 3T19A 4F7VA 3QJJA 2MQ8A 4ZDNA 4RW9A 3NP5A 3K58A 2V68A 4K2JA 1MG7A 4CNZA 1IKWB 2OP5A 4DV6F 1UJ4A 4C8LA 2J9DA 5KG4A 4ED3A 4KFBB 2VASA 2WB4A 5D3GB 1SC1B 2CJYB 1VRQC 2B4VA 2V4JB 4NEYA 4DQRA 1XNQF 3AOCA 4X4OA 3D6FB 3EPGA 2BJ7A 1S12A 1Q79A 3M1VB 4ZP8A 3C19A 2D3UA 4RL1A 4DX5A 2ZH8A 4AT1B 1WG5A 3LWLA 3I9V9 4ED4A 5F8JA 2KM8B 3W2VB 4PYAA 4UOGA 3I56S 1KHWA 3MEKA 4Q2LA 4I2QB 2UUAJ 2W9AA 3T5JA 2NXCA 2V2KA 2IA6A 4PZVA 3DI6A 1MMDA 4TN2A 1GH8A 5DLFA 4DFPA 4C8NA 2N82B 1RA6A 5CZVA 5BJRA 4ECQA 1S1TA 4J9OA 3EX7B 1JJ4A 1IKXA 2QG9B 2QSWA 4YP3A 3M6UA 2XLJA 5D8HB 5H9FK 1VK3A 3ETMA 4WYWA 1YHQS 2CPFA 1HKAA 3KLHA 1XR7A 2U1AA 2PD1A 4DBQA 2HMIB 2W01A 2B5JB 3TJ9A 1SKWA 3RBDA 2DNZA 1PBAA 2P9CA 2FYXA 2B7BB 3PRVA 2OKQA 1Q5VA 3H4DA 2XCAA 2H1YA 4ID8A 4M5GA 2EK1A 4I7FB 2KKHA 5DZ7A 5D0EA 2YWGA 1RAHB 3VZHA 1CSJA 4RJVA 3BH6B 1IR2A 3FMWA 1RWPB 2QZ8A 2EFGA 1N48A 2CRLA 1OMSA 2YNIB 1WC0A 1NKEA 1QE1A 2QMWA 3O2IA 3UR0A 3N6LA 3NCPA 4Z7YA 3H5XA 2YKQA 4NI2A 4ECXA 4U7CA 2ZH5A 3DXSX 3CMAS 3BBBA 2YX1A 2E5IA 5L1IA 3RJMB 4I2PB 4IG3B 5HQLA 1HHSA 2CQHA 5C2CA 5BR8F 2XMKA 1SPBP 1CQMA 2HFZA 2RQMA 2F8MA 1WC6A 4DJBA 4OYBA 3V4MA 3G6VA 1RTDB 1REVA 2OJ3A 1CPZA 4KRWA 1I3OB 4TKTA 4LF2A 1HQEA 3RYLA 2QMXA 2JC1A 3SV3A 1G6BA 2YPZA 1U49A 4P52A 2M8DB 3JTNA 1UW9A 2IVYA 2ADBA 4FBUA 1AW0A 2H48B 1UAWA 1RP5A 1WHXA 2NCKL 2KH9A 2CJ9A 2XO7A 3CWJA 3KHRA 2VC1A 4QW8A 3M2UB 1RXOB 1TAUA 3RBXA 1VQOS 4QYZJ 3KG1A 2D74B 4XDDA 2W24A 2E1CA 4UTGA 3M2RB 4JI4F 2FJVA 2XYGB 4EI2A 3DHWC 4K7QA 4DR4F 2FJAB 3NY0A 1M0SA 4OMFG 2XM3A 2MKIA 4ZS6A 3SXLA 4KHPJ 2E5LF 3T9ZA 5C2GA 4B3TJ 5IOLA 2HQFA 2H51B 4ZCMA 5G0RB 2MZRA 3HVAA 1DTQB 1A0OB 5J1NA 4CLSA 2W2OP 1R6VA 1O51A 5KG6A 3TNVA 3OL8A 5B0BA 3DRPB 3C14A 4RW6B 3W5ZA 1CEZA 7AT1B 3EZ5A 2XWXA 2PIIA 2LU1A 5ETPA 3HHLC 5FDLB 1U25A 3JSYA 4A8KA 1DQ9A 1X0FA 4I56A 2NZ4A 1Y4ZB 4PXDA 1XWLA 3DYAA 3H2LA 3D3CJ 3Q8QB 4XIUA 2XMVA 1HD0A 4DLGA 4WTYA 1TELA 2CVEA 4OZ3A 1QTMA 5A8KA 4O3RA 1IWAA 4H4MB 2Z30B 3JTPA 4RW7A 2PMWA 4Z7CA 2W9BB 2FZKB 2UXCJ 4OZ0A 2JHEA 3JSBA 4FDFA 1VC5A 3KG4A 3MM9B 3N6MA 4P71A 2HURA 2KJWA 4DCPB 4OX8A 1RLDA 3FCHA 5F9NA 4UY8T 1HLWA 4HEA9 2AGOA 5HN0A 1FDNA 3KKFA 3EICA 3OVAA 2A1BA 3VCDA 4B9NA 1XMBA 1W25A 4CM2A 4URSA 4ZHRA 1FWLA 2PEBA 2MHNA 4DR3J 3FBBA 3DGVA 2ZWOA 2GX8A 3CJQA 4WZMA 2A18A 4ECZA 1FXRA 3GTYX 2LYVA 2BOPA 4URGA 2J9DE 2KFZA 2JJ4D 2AGQA 2DIUA 4LVOP 2VQFJ 1LWFA 3GFHA 1RK8A 1S57A 3I5BA 2MGZA 3IG1B 5DS7A 3ZZ0A 2G0IA 3W2WA 2W7AA 3V81A 3DMJA 1HWIA 2AW0A 1QVGR 1RHJB 1XK8A 2R2SA 1UMJA 3PACA 2E5HA 1VBYA 2AYMA 2OH2A 2ZEJA 4A47A 4F02A 2UP1A 3DRXA 1MSWD 2B43A 1NMEB 2MQOA 3M6VA 5ETSA 3R1LA 4KBIA 2ZH3A 2CVIA 3I31A 3EZUA 2GZOA 1CG2A 1RWWB 3PYFA 4IOCQ 2KYXA 1HBOA 5IT0A 3JAMU 1VQ4S 4X4UA 1TR0A 1NDKA 3DOLA 3PV8A 3G2XA 4X62F 3A3NB 2UU9F 5F0UA 1LW2B 2KZZA 4I68A 2FLOA 1RABB 2GVDA 5M2PA 4OX9J 5CXTA 2V2ZA 3FMBA 3ZC4A 3HI9A 1HI1A 2C2ZB 3AD8C 2EFOA 3KXDA 2IM0A 1F5AA 1WELA 3R2DJ 2EVZA 2G2ZA 1N5QA 1LOUA 1EP4B 2GJFA 1PYTA 3NGSA 2GGPA 4NZ7A 2VG7A 1VDHA 4TU9A 1YBTA 4O3NA 3TRGA 4MK8A 3D4JA 1NB7A 1U24A 4GC6A 2CQ1A 4IH5A 4I6YA 1JKHA 1MN9A 3VF0B 4W92B 3EWGA 2WAQD 2FZGB 1B4SA 2FY1A 1S6QB 2CJXB 2EG2A 3AB2B 3A8EA 2M2BA 5B0EA 4R8UB 3K5OA 1QUVA 3ILLA 3MPUB 4ZVQB 5J2MA 5KFXA 1ZETA 3ISND 1TKDA 4HHUA 4U9RA 4P74A 3ZZOA 5B0GA 2HGMA 4DS5A 2CJAA 4RX6A 3KJVA 2KZMA 1DLOA 5FLXY 2VH7A 1DFDA 4CLWA 5E3PA 5DM7Q 5C25B 1LW0A 4DPWA 2KN4A 4OJGA 2KXNB 4IH7A 5C42B 4RO0A 3CCSS 4LVNP 3SQGB 4ZVFA 3HJFA 4C97A 1J5OB 1VCTA 1HBNB 1LFWA 1C0UA 1UA1A 2MQQA 2XO6A 4IQXA 4WE1A 4HL9A 3OBIA 3J7AN 4PYDA 1SCJB 2COLA 2XC9A 1ZM3A 1FWPA 4GKKJ 2HNDB 2NPFA 2RD5C 4JV5F 1SC4B 4IFVA 4GVLA 1FF2A 5I4MA 1K0VA 1ZZFA 2QA4G 1N5SA 3NOCA 2YNHB 2EEYA 3M8SA 1EKSA 4N7TA 2HWIA 4WYLA 2BRKA 3PJ9A 2BM1A 3BBCA 3DKDA 4O4RA 3SMZA 5ETMA 3MMAB 3UCUP 4OQJA 1IQTA 3GE9A 2E9TA 1YZ7A 1R27B 4ANEA 1S1UB 4EUVA 1OQ6A 2F3JA 2YY3A 4DSJA 3ILJA 4DPOA 3EXYA 3CEDA 4QR0A 3UN3A 2FGOA 3M8ZA 4L3NA 1JLQA 2RS8A 3R5GA 3MPDA 2OFHX 3HZGA 1Q86T 3H4BA 3EM1A 1FE0A 4Q5VA 2L08A 4UW2A 4OI1A 1U1LA 2YXLA 2ZOFA 3IRWP 5ETKA 4C8ZA 2HVZA 5GAGU 3I0SA 3NLCA 3SZ2A 4NYZA 1WHYA 3LF0A 1S48A 2CUYA 2ZVIA 2UUAF 2WVBA 2DPIA 1S6UA 2GO8A 5A8WA 2DY1A 3TVZA 1Q0NA 4DQSA 2PA8D 2GCFA 4AXJA 3VAFA 2DHHA 2Y8WA 3A1YG 3ILOA 1FJ7A 3NNCA 2OTJS 2WSFC 1HHTP 1RAOA 2Z57B 4QIGA 1OQ3A 1X4AA 1OO0B 1KONA 1HQEB 1Z2ZA 2CPEA 3K8WA 1YITS 4BWMA 3OVSA 2YWEA 4JI8J 4I1TA 1KP6A 1NPKA 5J1PA 2AZ3A 1R0AA 1J5EJ 3ZZPA 2BV3A 2GAGC 3EVMA 1UVJA 2CG4A 2FVSA 1RACB 4V19J 4MTPA 1YKWA 4M1KA 2IYGA 3BEGB 1VIXA 1SL2A 2K3KA 2MYFA 3QSYB 1JLFA 3THVA 2BA9A 4X4RA 3MEGB 4KSEB 3FKBA 1WOPA 4F0MA 2DR9A 4XAKA 2IC3A 3M30A 2VIHA 1PGZA 3H40A 2FDNA 3C15A 2FTRA 4DL6A 1WSVA 2N3LA 1F9HA 3PR4A 1UVMA 4PXEA 4Y34A 2KG1A 3BQ0A 2UVUA 1VQPS 5IC6B 3RGIA 4F0HA 4K4ZA 4JI2F 1LEOA 3NAIA 1B0PA 3MCSA 2GHPA 4KH1B 1LXJA 3OJSA 3K5NA 4LT6A 2QN6B 2VFTA 4USTA 4KC5A 2DJWA 3KDNA 2W9CB 1IBLJ 3IAM9 4UOHA 3GV5B 5IXUA 2OSRA 4ZVUB 5FD1A 2FHJA 5L38A 3QLHA 2BJ1A 4DUYJ 2Z8QA 2OLWA 2ZFHA 4B3MJ 2IM3A 3JQJA 2EPIA 1RT5A 1LQ9A 3I32A 3QJPA 3DYAB 4B3RJ 1U26A 1N36J 1CJUB 2GMLA 2CYYA 2RE1A 2QL9B 2V8HA 3OSNA 1U1KA 4A8FA 2WONB 4HT5A 1Y10A 3Q8VA 2G1HA 1XEZA 3GIKA 1ZTWA 2F9JA 4B3SF 3QAEA 4LF5F 1BQNA 4B9VA 4ECWA 2E44A 1TAQA 2V69A 4H4KC 4OI4A 2VB6A 3CJ5A 3QGPA 3I82A 3OLBA 2KXFA 2LQ5A 3I6PA 2ZHAA 4I67A 2WSCC 4BC9A 2CXEA 4AL7A 1NJYA 4QIEA 3ZTQA 3CIMA 3FEZA 2L48A 2HW3A 4RUCA 2HHXA 2DXFA 4DL3A 1SKSA 2CPXA 1HYSB 1FVQA 4UF4A 4LSNA 4ZP9A 3BGRA 1N54B 3MWBA 3TA0A 1LWFB 4J9NA 4ZJLA 3X1LB 1F5CA 3UNGC 3W65A 4NLYA 3W2WB 1FE4A 3RG6A 3LP0B 2HZVA 4K4VA 4PWDB 1D8YA 5LXYA 2E5JA 1FD8A 1RCOB 4QPXA 2YVSA 5HATA 4N5SA 4N76A 1T3OA 1PO6A 2JVOA 4CTAA 3RTVA 2OAUA 1BHNA 1H0HB 1A7GE 3MM7B 4MH8A 3IS9A 4NZ0A 1TFWA 4RZRA 1ZM2A 1RWMB 3PIPQ 3W64A 4X4PA 3BM7A 5DG7A 3CJ3A 3DCAA 2ZZNA 1HNXJ 2AYEA 5GAGI 2RF2B 1N32J 1RJJA 2EFPA 4G1QA 1X4GA 1S0MA 3AD7C 1H2VZ 2B6AA 2Z56B 1QUPA 3P3DA 2XS7A 3CNQP 4B9LA 4WU3A 2K1RB 2B4OA 5B7WA 4IFYA 2R7TA 2UXDJ 3KK1B 4ZIVA 4PQUB 3NNHA 3Q2SC 3DHXA 4M63A 1JKHB 3L7OA 2BE2B 3T1HJ 2ZKTA 4J9UE 3QAUA 4DR3F 2X1AA 3PXGa 1S6PA 2PFFB 3TAPA 4DS4A 3L09A 1KFDA 1XR6A 2F7VA 1K0TA 1JIHA 4TVAB 1VI7A 3GIIA 3DM2B 5CYQA 1GAOA 2QJ3A 5KFMA 3EXCX 2XNRA 2RRAA 3D7SB 2QRRA 1YJ7A 1DURA 1KQGB 5DDOC 2ZC3A 3BYPA 4DV1J 4NZ6A 1A6LA 3NGUA 1T94A 1AZSA 3MM6B 2VPYB 4WBFA 3SDEA 1K8AT 4LFAJ 3CD5A 5KG3A 2J9EA 4YUDA 2HBZB 4CLFA 2CJQA 3OUYA 2H4WB 4ECYA 1NZAA 2YTCA 2DNGA 4CLPA 2ZD1B 1H2TZ 7FDRA 2PN6A 4R5PB 2RDDA 2VA3A 4PPZA 4C8MA 1M90T 2DRDA 2G2OA 5E7OB 1N5YB 3RRKA 2BYCA 3GYGA 4KO0B 3E3XA 5KFQA 1KFSA 1AYEA 4OX9F 2IDLA 1ZAXA 3TR5A 1HNVA 1Q16B 1QVFR 1P1LA 3MGJA 4FPRA 1RZMA 2MZQA 4WK3A 5B0FA 5CZXA 1YLXA 4WFBQ 1OYEA 3LP2B 3VAHA 3FCWA 2OPRB 1SH0A 5HQMA 4DMZA 1FA0A 3TA1A 3F41A 4E0DA 2M0GB 1RAJA 3HFZB 1FD2A 2OD4A 3IFEA 1FI4A 1WC5A 4LRAA 1SL0A 1ZBTA 8ATCB 3GG0A 1YRUA 2VPWB 3G82A 3W8PA 3G71S 3POTB 3I55S 1U0SA 2B9XA 4NLTA 2UVVA 4N41A 1ULRA 4FYVB 5FIIA 3N01A 1MLAA 4KY3A 1S0NA 3D6HB 4KGMA 4QCLA 4EZ6A 1F1BB 1RSCA 2HG4A 4L3KA 3D6TB 3KHGA 4N8OA 2DHSA 2LFVA 4P73A 2DT9A 4RKUC 3KLIB 4KT0C 4JI6F 3NKYA 3OW2R 3LP1B 1X7VA 1OY9A 3DLLQ 4KKOB 2AWZA 4F8RA 1OY6A 5JJBA 3FUYA 2M7SA 2ZJRQ 4LSZB 5GVQA 2QSFA 1S0VA 4X4QA 4IR9A 4IOAQ 1RTHA 1VBZA 1ZPVA 1CJKA 2BRLA 4GKKF 1FCAA 3C6TB 5KFRA 3QBCA 2LLZA 1VQ9S 4EO8A 1TQLA 3TUJC 1TFYA 4J7CA 1ITPA 4LFCF 3MMBA 1SVDA 4MKBA 3OR2A 2V4QA 1WG1A 3VV2B 5HQ8A 5JVHQ 4FXWA 1S9EA 2ASYA 1T11A 5C24A 1L3VA 2QYGA 3HP6A 4K4WA 1YRTA 1TUWA 4DUZJ 2J5AA 3ZTRA 4C3KA 5I3UA 3BB5A 1WG4A 2AHOB 2F4VJ 2XQCA 3QJLA 3TEGA 2GW8A 2HWHA 1QAJA 3HHLB 3IR6B 2EFNA 1N56A 2PFDA 2IM2A 3M9OB 2QLXA 3BKFA 3VAGA 4F0KA 4NWBA 3EYZA 1RTIA 2R8GA 4FYYB 4X84A 4ECTA 1ICEB 2R3VA 3R5AA 3AY0A 4DPYA 4J9QA 3PW5A 5CYJA 3SV4A 5CYMB 1KTVA 4DQIA 1XMQJ 5LSLA 2FPHX 4B9MA 3CC2S 2KXHA 2FLPA 4NLGA 1U7LA 1JLEB 2QGFB 3W7BA 2DEIA 3IWLA 2VJVA 3HVTB 2AEFA 4OX6A 2VF3A 4NXNJ 4JOUA 3A12A 1HNZJ 1R3NA 2ZKUA 1RT5B 4CWBA 1OWXA 2DGUA 1O6XA 3MTJA 1E6VA 5I3PA 4X64J 2HHTA 1R8BA 2RU3A 3GG1A 1RU1A 3DOKB 2XMWA 4OYXA 5K14B 4QYZK 2HVEA 5ETLA 2B56A 5L39A 4ILRA 4JI8F 1L3KA 3BKTA 3T3FA 3TJAA 3VGTA 2C28A 4MKAA 2QA1A 3GJQB 1J5EF 3V6DA 2UVRA 2KYZA 4AL6A 2VZ9A 1BQMB 2ZH9A 1T95A 1SUQA 4ELUA 4WWSA 4GO7X 3W62A 3NGTA 3EGWB 1T05B 4F26A 4OIXA 5IV3A 1U47A 1Q8LA 3WX8A 5HP1B 2D7SA 4KGVB 1JJHA 1X5SA 3JSMA 1M5SA 5MAOA 1FKPA 3N4WA 4CH1A 3PHTA 3H0PA 3IAS9 1YI2S 3TAMB 3J80U 4M5HA 5KFFA 1CJTB 1NAQA 3CCMS 4P2MA 3JYTA 4RNMA 2K7KA 1HNIB 3R6LB 3TANA 1RT6A 2YX4A 6FDRA 2FVPA 3H7HB 3UN5A 3U27A 3PM9A 3FVYA 1I94J 3N28A 1OPZA 1IBLF 2V2QA 1B0TA 3BSCA 1NHKL 3M8QB 4FS2A 3T5HA 2CQ4A 4DUYF 2GC8A 3P45B 4B3MF 1FNMA 2K8GA 4B9UA 3A8IA 3PFOA 4B3RF 1HBUA 3G4SS 5IZHA 3BH7B 2EC2A 2AGPA 3NS7B 1N36F 2DGVA 2BDPA 4FKXA 4OV1A 1WC4A 5I3QA 1S4EA 1RLCL 1QSLA 3RRHA 4RU9A 5KFEA 4KHRA 4FXVA 2HGLA 3THPA 1Q5YA 4CCHA 4F04B 1ZAWA 2DCLA 1Y5LB 3KUEA 2YX7A 2WVFA 3HHLD 1NO8A 5ITHA 4Z2XA 3R5BA 1HMVA 1BC6A 2RKIA 1NDCA 1MROB 1P8GA 1RT1B 4WXWA 2Y3YA 4EGLA 1AT1B 3SBMA 2VFRA 4F36A 1S1XA 1CLFA 2UV8G 3RB0A 2Q66A 2R8HA 1QAYA 3MF5A 2VD3A 5HROB 4WFAQ 3AJ1A 3WX4A 3HHNB 2EBGA 1VLYA 4DPXA 5KFSA 2UZAA 1VC0A 1G1XA 3D1QA 5E0OA 4CYUA 3KNAA 2G1DA 4DV7J 2Y1JA 3QRQA 2V34A 3MR3A 2V94A 3MPWA 4J9SA 1W7WA 4DSKA 4W4MA 2K3IA 1HWUA 2GHVC 4DL5A 3SCJE 2YKPA 1RAEB 4DR2J 3HFVA 4A8MP 3P4UB 5F8HA 4F50A 3QPIA 4KJIA 5DQIA 2MQLA 2OPPB 1VC6A 3C8YA 5AE3A 5HO4A 3SCIE 2IJNA 2NLWA 1Y0HA 1PAEX 2HGNA 2CNOB 1PYOB 2YWKA 5MLCV 3FEYB 3R8YA 4NMLA 1LKZA 5KG5A 3OPKA 3G86A 3H5UA 2XEXA 3KLFB 4RNOA 1HNXF 4TQSA 1S7HA 1N32F 2L9WA 3NGKA 4I6AA 5E3QA 1VQYA 1X9SA 1SQEA 2JH3A 5T7LB 3G8QA 2ZE2B 2RT3A 4E98A 1GXTA 1C0TA 3D5MA 3TUIC 4IG0A 4A8QA 4P72A 4DV3J 2UXDF 3IRXB 2RHQB 4J5OA 1TTHB 1LWCB 1VJWA 3HD2A 3ITHB 2W2MP 1IBKJ 5BYQA 2YKNB 3T1HF 1I5OB 1F2GA 1TKZA 3TI0A 1R8PA 4LF8J 3KHHA 1RAAB 4ER8A 4HDGA 3BREA 4YY3F 2IY5B 3D0HE 3CJ8A 2DITA 1ZH5A 4M5DB 1S4FA 2JLEA 1U2CA 4L72B 2V6AA 3UDVA 2ZBPA 1BMQB 4ZP6A 2DH7A 4ZVSB 4DL7A 4NLDA 4S0MA 2RDJA 4DV1F 2DNQA 2E7VA 3M8PA 4RW4B 1N6QB 2D1CA 2DGSA 2QA4S 3AODA 3OR1A 4CO3A 3OXFA 2PT0A 2A6OA 1FRHA 3QO9A 4B3OB 4ID5B 3GV8B 1G2EA 5EN1A 2IYIA 2B9YA 3CJKA 1RGVA 1V3ZA 4TY8A 4LFAF 3T5LA 3D54A 3FCVA 5AXLA 1CS4A 2ALZA 2JNJA 2JVRA 1JLBB 9ATCB 4RLEA 2XMTA 2AX0A 3I9ZA 1XERA 2OEKA 4CIOA 4CO0A 3ET6A 3RUBL 2MLYA 1JJ2R 2N4CA 2P2CB 3HVWA 2N7YA 4RBUA 5EHHA 3Q8SB 4MKYA 1MU2A 1LWEA 5A2QY 3GCXP 2ATLA 4ZN1A 4C11A 3BGUA 3WQPA 1R0CB 2DXEA 1TKXA 5AE2A 2RQCA 4X66J 4ZVGA 1BGXT 1YK9A 3HJVA 2VG6A 3KG0A 3QIDA 4WK1A 1KLMB 3A13A 4LSLB 3MD1A 2B3TB 1K1QA 4QWCA 3Q24A 2RUSA 4M5IA 4DL2A 2IAJB 5LXRA 3L7UA 3M32A 3ZTSA 4K4SA 1S7IA 1DTTB 1RT7B 1ZZNA 1IBMJ 1F6TA 4UQGA 3MR2A 2NYHA 1TL1A 1UVLA 1UW4A 3OXLA 5LJ3Y 2NUHA 2O66A 2XY7A 1URNA 2ADCA 1IJFB 2M8HA 4IYQA 2FHKA 4IRDA 2PI5A 1CC7A 3QT6A 2C2KB 4ZPWR 3QIPA 1ACMB 1VQLS 1LK5A 4YQWA 4C6AA 4M94A 2LQJA 1QD1A 1RKIA 1EAYC 3FQLA 2LECA 3L95X 2HVIA 4ED6A 1FX4A 3GJRB 4ZVRB 3H98A 2X1FA 4ZA1A 2L3MA 1SJRA 1EX8A 3DXBA 1UWBA 3WZ0A 1WF1A 4YR2A 4NCGA 3I96A 2CFXA 3CCQS 4PXCA 2YQ3A 4PCQA 3UD5A 1KC8T 4MT1A 2GJ2A 3MR6A 3RW7A 1QLNA 5DDPC 4FF4A 4BS2A 2ZDOA 1YJNS 4I6WA 3L3CA 2O3DA 5GADU 4G6VB 1AUDA 2C3PA 2MJUA 4X2BA 4DUZF 1SH2A 5KT3A 2A3JA 2HBQB 3IP0A 5GAHU 1JMTA 2F4VF 1OIAA 1KN6A 3RAXA 4O4GB 1RA7A 1GMWD 1RT4A 3MZIA 1R8AA 3RR7A 3O8WA 3CVKA 4CLTA 4PG6A 5DM6Q 1DAXA 3VWSA 4JV0A 4YEAA 1S99A 3MPYA 1N33J 1HIYA 3TZYA 4DV0F 1XMQF 3MM8A 2W8KA 4Y65A 2RS2A 3PEHA 3MOJB 2HYIB 1U0HA 4EZ9A 3HSDA 1TL3B 4DG1B 1WTFA 4KQZA 1V3SA 5K20B 3BR8A 1CULB 4Q7AA 4ECUA 4NXNF 4AL5A 2LQBA 4X4SA 1HNZF 4YMEA 1YIJS 2HNYA 4ICLB 3BGOP 4L75A 2G0JA 3HT3A 4X64F 3GFXA 2VQEJ 2MDAA 2NSBA 3EPIA 1TL7A 2I38A 4M5JA 1LV5A 2HIQA 3KK3B 4ETXA 4IDKA 3J7Z5 1UKUA 3D9BA 3KDOA 5DGBA 3DLEB 3C16A 5JMNA 1NSKL 3OSPA 1GXLA 1U2FA 4FVCA 1VS3A 4HACB 2XYPB 1FK9A 2C3MA 2NXUA 2FLNA 4JV2A 2SXLA 2Y1RI 1NU4A 3M9NB 4DSLA 4LBIA 3ZZYA 2FHOB 3KHLA 4A8YA 2KTQA 2QLBB 2CQ2A 2C42A 4FPIA 3DRYA 1D09B 1TVRA 3AD9C 5ETNA 2Z2YB 1GQEA 1T9WA 2G2YA 1YBAA 2BQ3A 3DU6A 2CDRB 1X5PA 2YWHA 1RTJA 3V4IA 3M7VA 2PDAA 4M5NA 2DVIA 3KMSA 3R5JB 1APSA 5CCLA 1RHQB 4KR0B 3FSXA 5KTQA 1ZS6A 3DLKA 2QTWA 5AE1A 1U6ZA 2MEWA 2AJ0A 5D15A 5ETTA 1SJ4P 1I94F 1SQGA 2P6TA 1VIOA 1FKOB 3CO9A 4ILMA 3A8KA 1VHIA 4LRCA 5ETOA 4ZVOB 1JLGA 1G4CA 2GHWA 2D3O1 4LRDA 2UXBJ 1X9MA 3M2VA 3DN9A 2IPOB 2GQQA 4X4VA 2RDIA 5GAEU 4Y0FA 4OHWA 3MEEB 1JK9B 4WU2A 4OHVA 2F40A 2RJZA 2YWFA 5J2PB 1CJVA 4B17A 3EGZA 2DK2A 3J7YI 1H73A 1S72S 2FJWA 2QT7A 3TVYA 3LTOA 3S1TA 1FJCA 1HW8A 4G65A 2DH9A 3V6KA 3T1AA 2XG8A 3FBCA 3QGGA 5AJ3J 3Q8YA 2PEHA 2I5JA 2UV8A 1NJWA 2ROEA 4FP9A 3DDNA 5LT5A 4BBYA 2XZDB 4CLUA 3LGNA 2B51A 4TYBA 4NA1A 5H9EK 4ED2A 3OL7A 3P6YC 3DDIA 3QRPA 5K8NA 2PI4A 3MMCB 2QL5B 2QO3A 1K1SA 4TLQA 1JLAA 1YJVA 3HKWA 5SZTA 3W1YC 3KK2B 1MMNA 4P7TA 1UFKA 2VG5A 1UJ5A 2NXEA 2ZM6J 1IKVB 2Y8YA 2LEAA 3UVJA 3LWMA 5IM0A 4DV7F 3ADAC 4J90A 2HNZB 4DI6A 3BKUA 2F9DA 5GADI 3GR0A 4C4WA 3E01B 3M8PB 2CQPA 4MK9A 4ZITA 2E9RX 4NPOA 5GAHI 4FVMA 2R2TA 3W60A 2VPXB 4U8YA 3MAAA 1TKTA 4PG5A 4DR2F 4EEYA 2PMZD 4J91A 2C2EA 2L9DA 4IRCA 1WI6A 1W26A 5D0GA 5HLFB 3FDSA 2HLTA 2DNLA 1I51B 1TZ0A 4ZPAA 3TZWA 1Q78A 3KMQA 1B99A 1U1MA 1VYAA 1EJ7L 5KFJA 3PHEA 3GZ7A 5CH7B 1K44A 2IVFB 1SV5B 4PUOB 3QGHA 4FNHA 2LMIA 2HS3A 4OYPA 5J1EA 4PEOA 1F3VA 4ZPBA 3AXMA 2OMOA 1NK6A 4ZVHA 3F73A 4EU0A 2O1PA 2RUGA 3QYYA 1XJWB 3BSAA 3QWUA 4DV5J 3MM5B 1S5ZA 2J0SD 4ED0A 3E51A 1KOOA 3MMJA 3M6XA 1AA1B 4M5LA 2CJBA 4NLVA 2J6UA 4DFKA 1NH8A 2RILA 1C1BA 1OPIA 2H3EB 2KT3A 4DV3F 4QU6A 2ILYA 3MEDA 3ENQA 5LSRA 1S9GA 1NK4A 2W8LA 2CZ4A 2ZNZA 1CBKA 4ZK7M 3NBPB 2ZH2A 2BVZA 2VICA 3G6YA 5J2QB 2X3DA 1VQ6S 1UPMB 1S1WA 1H98A 1SC3B 1IKYB 1W2IA 2YNFB 2CIMA 3CDEA 3GJTB 4ANDA 2AKWB 1TV6A 1F9EB 2W1BA 1FWKA 4FF1A 2DGXA 1VISA 1V5VA 3OD2A 1WDDA 4AD6A 3DLBA 1V5IB 2VUGA 4DCJB 5LSOA 2GMJA 3MECB 2E1MC 2IVMA 5CABA 1T0TV 2W4CA 5IQQA 1S0OA 2VFUA 4OYMA 5E2QA 1ZYQA 2YNGB 4C9DA 1RT2B 1FFWB 3TZXA 2F5GA 4LRBA 3M4XA 1WF2A 4EBCA 4USIA 4NXMJ 1IWGA 1X0PA 2G13A 3D1HA 3ZXWA 3QNWB 1AFIA 2XHCA 1LK7A 3CDBA 4LR8A 1O8BA 1MWQA 1EETA 3NRBA 4LQ9A 3NMRA 2DISA 3VGSA 3CW2C 4Q0BB 4O44A 2GMHA 4RNNA 3I0RB 1HR0J 3BO4A 1Q8BA 3P5TL 2DR6A 5CD4H 5F3TA 3SSQA 1WORA 4DR6J 4PRFA 1HNWJ 5GAEI 3H20A 2BR0A 4X66F 2R2RA 4WTOB 1T03B 4USJC 4R0EA 1TUVA 3CD7A 1GTHA 5D77A 2UUCJ 3AFGA 3C6UB 1VBXA 4XPCA 4IKAA 4GVBA 4C0OC 3GIMA 2YKMB 4MFBB 5HANA 3OTCA 5LJ5Y 3D1OA 4DZDA 2YQ1A 1WC1A 2QLWA 1IBMF 4OJ3A 2HFVA 4J9LA 4I4BA 3GP9A 3VZIA 3JSRA 1WNEA 1RT3B 2HBRB 1X4BA 4O0IA 3MCNA 1S1VA 4KAIA 2IHR1 3R27A 1P9QC 4IQMA 3AJDA 1IM6A 3DOMB 1HPZB 1WKKA 1X4EA 1N88A 1B3TA 2JRSA 3T1YJ 1KBRA 1Q8KA 2NQPA 2KVQE 2V8PA 1M1GA 3CT9A 2Z2LA 4DF8A 3WDOA 3CB4A 2J7UA 2I1RA 2VDIA 3ZFVA 1HFEL 4NOHA 3LA0A 1FJEB 2DY9A 1B70B 1BWVA 1EQ0A 4Y2AA 4LFBJ 4O3OA 4E8UA 2MMYA 4PR6A 3QRRA 2MZ1A 3FRYA 1OSDA 3CCES 1HI0P 1RHUB 4G1PA 2IBKA 5IV4A 2I8EA 1Y11A 3MURP 3C46A 4LF4J 1FRMA 4NLUA 5B08A 1YRXA 1S10A 4DDFA 5L1LA 3D2WA 3KLEB 3CDWA 3FGVA 2AP6A 1XN9A 5HK4A 1N8RT 1Q7YT 1H7XA 1ZOTA 3R5CA 1FEEA 1U09A 1NXIA 4QPTA 1RE1B 3SYZA 1TL4A 4ZLNA 4RW8A 5F0WA 2BACA 4J37A 5D6GA 3O5TB 2OPQB 4EBEA 5E3RA 5C5JA 1N33F 2UUTA 2QLFB 4WPAA 4DU8A 2BM0A 5EX3A 3DGPA 2DNPA 3EZOA 5A6WA 4RBVA 2K06A 4J9VA 3M2VB 5BYRA 3L4BC 3CPWR 1CC8A 3WBZA 4KPYA 3LAMA 2RRNA 5CA5A 1NJIT 2X3GA 1C1CB 1YJWS 3IR5B 4JI7F 4CRJA 1NNDA 2VQEF 3H5SA 3R97A 3AT1B 4R0JA 1SJ1A 1IJEB 1M5HA 1UETA 2I0XA 1RHMB 2DNRA 2VONA 4MIBA 1HQUA 3EJMA 5HVHA 3ZO7A 3Q8UA 4WP9A 3CJRA 2WB1D 2AZ1A 2WZ1A 4LJMA 2R8KA 4DV2J 1FRLA 3P8BB 3EMTA 3HSGA 4PG8A 2Q3PA 3H42A 4JI3J 1NRKA 3A8JA 2BEFA 3Q8RB 3R6GB 2WOMA 4FN5A 4ECVA 5K8PA 4K50A 4X65J 4IUFA 1LFPA 1JLAB 3R5DA 5E3AA 1VRTB 1EARA 2HK2A 2LDYA 2UUBJ 3E2EA 4ZN3A 2PSZA 5KFGA 1IKWA 1MMLA 1RI7A 2XSJB 2OPSB 4KFBA 4DR7J 2POKA 2BKPA 5D3GA 2CQ0A 2GIRA 4Y00A 2V4JA 3DLGB 3M9MB 4B08A 2DH8A 4F4ZA 4A8OA 2BE9B 1TKTB 4ALZA 4N8NA 2VHGA 3MPVA 3M1VA 4D3GA 4OJHA 4AQYJ 4HH1A 2IJFA 3PW4A 3BO2A 3W2VA 1RWVB 4YDDB 4RUAA 4I2QA 4WP8A 2EBEA 3Q86A 4OHXA 2LA6A 5L8RC 3SQOP 3PW0A 4MKVA 1SJQA 1VOMA 3B54A 5I42B 2V4RA 3TJ8A 4W98A 2ASLA 3J81Y 1VJQA 3UNYA 1EQMA 4LF1A 2B4PA 1WKLA 5KOWA 2IDEA 2HHWA 2HK3A 2YQ0A 2GVZB 1IR0A 5LMUF 3QFWA 3PX4A 4P2XA 1SC6A 4GRSA 1U1OA 2R7WA 3HO1A 1RAIB 3ZNJ1 2X1GA 3IBCB 4RW9B 4K2XA 5AJ3F 1N4LA 1C1BB 3EVWA 1U1RA 1D3WA 5DRKA 1R6YA 3KWMA 5FLXU 2HMIA 1K9MT 2PGCA 5KFKA 2B5JA 3PX6A 2BJDA 3UWTA 4BDPA 1X5TA 1OYDA 3MCOA 4ZJOA 4DN9A 3IGNA 4B9TA 2GAHC 3CCRS 1OY8A 1IXKA 2AJ2A 4ECRA 3ZTOA 4I7FA 3ONQA 4GC7A 4CLZA 2ZM6F 1PSDA 2E7XA 4HTJA 6FD1A 2KU7A 3BO3A 2LQ9A 4Q8FA 3OVBA 3MCMA 3BJYA 5FJ4A 3RB6A 1SKUB 2FY8A 4ZJQA 3EGVA 2QV6A 2KL8A 2VV5A 2RSQA 2BJ8A 3AOBA 2YNIA 2F1FA 2YWWA 2JZ5A 5B0DA 3DI6B 3ZZZA 3MFHA 2V8GA 1RDRA 1XQIA 3OJUA 1I1GA 4QIVA 2XMJA 5D4OA 3LUYA 5LM7E 2W7PA 1S1TB 4DHVA 3W3SA 2AT1B 1IKXB 1FNOA 4MMOA 3KYLA 4I2PA 4IG3A 4DWIA 2OEMA 3LPYA 3P49B 3RW6A 4K5RA 1F0XA 3TA2A 1FXLA 2DTJA 2CPHA 1VK8A 1H74A 1O5JA 1D1UA 3HHEA 1JWWA 4C0BA 1XMOF 2WVDA 3FNNA 3KLHB 3FBFA 1J27A 1RTDA 1R8CA 3PO4A 4NRTA 2DRAA 1WEXA 3R3TA 3N5FA 3NEKA 1Q7LB 4DFMA 2J0XA 4C7QA 1KRPA 2HZCA 1R0BG 3NL0A 1GX5A 5GMKa 3RBEA 5KT4A 3M2UA 5LMNJ 3W9IA 4RNFA 4UT4A 2VOOA 3AB4B 2NXJA 1H2UX 5A76A 2CDQA 2VBXA 2WHOA 3M2RA 5AXKA 1VQSA 4K5SA 2C3UA 4PG4A 2DIVA 1UVIA 2MPUA 2CWKA 1HW9A 3N79A 1KQKA 1QE1B 1Q8IA 2O5DA 3QFHA 4DSIA 3SFUA 1KWMA 1WEZA 4NI2B 3K0JA 2ZJQQ 4JB8B 1S9FA 1G3OA 1ZTTA 3R2CJ 5G0RA 3AA8A 2EI5A 1DTQA 3UN2A 2VKZG 4JP8A 4PXBA 2OFGX 2B7CB 2C3YA 1NEEA 3DRPA 3KNGA 4DSFA 1S76D 3CF5Q 4RW6A 4RBTA 4F4WA 2Z2MA 4NXMF 1REVB 2VU5A 4KTQA 5M2RA 1N0UA 3CTRA 4YHHJ 1SJ3P 4U8VA 1K47A 1WACA 4F2RA 5KFLA 4OYZA 3CCLS 1N34J 5ADZA 3GONA 5IT9U 2DO0A 2G0CA 4X62J 4DFJA 1HR0F 3PY8A 2HFSA 3ZZTA 3VGVA 1RAFB 4URQU 4LF7J 2OELA 2AF6A 4DR6F 2XNQA 1HNWF 2CADA 3AA9A 2W9BA 2D41A 4CO2A 1J2VA 2OD6A 3IN5A 4A8XA 3CCWA 2I6WA 3HULA 2EKNA 2XBPA 3EGNA 3MM9A 3RR8A 1RWUA 2IM1A 3ENAA 4Y3CA 4R25A 3UPFA 4RUBA 2NR0A 1KVKA 3GFYA 5U47A 5EWFA 1GXUA 1FRIA 3HMJG 2UVWA 4ZPCA 1WHWA 4UUXA 1FXDA 2MKSA 2AV5A 3C14B 1NH7A 2XWYA 3FRZA 3WC2A 1UL3A 3TAQA 2RNEA 3K57A 3S01A 1Q81T 1PC5A 3HVRA 4NLQA 2ZBCA 3IG1A 3CJTA 3VGUA 1UWAA 1U1PA 3T1YF 5KT5A 3G87A 1HWLA 4F4YA 4LBHA 4O3PA 1V6HA 3C66A 4U95A 5A8KB 2Z58B 5KFAA 3PKMA 4DR5J 2XY6A 4RW7B 3LANA 1T8EA 4LFBF 4HT7A 5CD4A 2W2NP 4ZLLA 2M88A 2XY5A 2BW7A 2YKAA 2HPUA 4PAAA 3TQEA 8RUCA 3PTWA 1LWXA 3ZNUA 1LW2A 3VAJA 2HHHJ 1DY3A 5DG8A 4ZHRB 3I5AA 3GU0A 1P27B 3MFIA 1WEYA 4LF4F 3TQ1A 1SH3A
chains in the Genus database with same CATH topology
4NL5A 2MQOA 2ASDA 4FF3A 2J8AA 4JI0F 1TKXB 3M6VA 4QJVA 2XY7A 1EP4A 3R1LA 4KBIA 2ZH3A 2CVIA 4KHPF 1URNA 1UFLA 3I31A 2ADCA 1IJFB 2VG6B 1DJ0A 3EZUA 3KLGB 4X4NA 1MNEA 3U1LA 1CG2A 2M8HA 4RWXA 4B3TF 4IYQA 2FHKA 4IRDA 2PI5A 4TQRA 1CC7A 3BQ2A 4IOCQ 2KYXA 1HBOA 2HAIA 5IT0A 3V6JA 1DZ5A 5A0YB 1QSYA 1VQ4S 4X4UA 1TR0A 1MW7A 2MGZB 3DOLA 1IBKF 2MJNA 3PV8A 3M32B 5KFOA 4ZPWR 1KR4A 4X62F 3QIPA 2UU9F 1S6QA 1VQLS 1SIZA 5F0UA 1LW2B 1LK5A 4YQWA 2KZZA 3V81B 4MYUA 3MHYA 5HBMA 4LF8F 3DMJB 4M94A 2BJEA 2LQJA 4I68A 4R8UA 1VQKS 2FLOA 4IO9Q 4K4UA 5M2PA 1RKIA 3B78A 1TL1B 4MIWA 5CXTA 3H59A 3FMBA 3FQLA 2LECA 3L95X 3ZC4A 4FYDA 3HI9A 1HI1A 2HVIA 4ED6A 4O4GA 3MDFA 5EWEA 4C8OA 2EFOA 3H98A 2IM0A 2X1FA 1F5AA 1WELA 4ZA1A 2L3MA 1SJRA 2EVZA 1N5QA 1LOUA 1EP4B 3DXBA 4CT8A 2MQNA 1UWBA 2GGPA 3WZ0A 2CZVC 4NZ7A 3PDNA 4AFFA 2VG7A 4KHMA 3OFEA 4TU9A 3UE2A 3NG8A 1WF1A 2R2UA 1M1KT 3GIJA 4O3NA 5L9XA 4YR2A 3TRGA 4NCGA 3I96A 4MK8A 3MXHP 2CFXA 3CCQS 5C25A 2DPJA 4CO5A 4PXCA 2YQ3A 1NB7A 1U24A 4GC6A 1DARA 2CQ1A 2XMUA 4PCQA 5HI7A 1KC8T 2GJ2A 4IH5A 2XULA 3MR6A 1UA0A 3RW7A 3KFWX 3OFGA 1QLNA 2FJXA 5DDPC 5C42A 4FF4A 4I6YA 1HBOB 4BS2A 1JKHA 3VF0B 2ZDOA 1YJNS 4W92B 4I6WA 3SQGA 3CJ2A 1YJTA 3L3CA 2WCXA 2MZJA 2WAQD 2O3DA 3DOLB 3DDKA 4A8WA 5GADU 4DN0A 1J5OA 1B7FA 3QIPB 2FY1A 1HBNA 3MOZA 1S6QB 4G6VB 1M5OC 4Q2MA 5E5NA 1AUDA 2C3PA 5JUMA 3NNAA 2EG2A 4A8SA 4DLEA 3AB2B 5HMXA 2MJUA 3A8EA 2M2BA 4X2BA 4DUZF 5B0EA 2M70A 1BLUA 1MWZA 1SH2A 2MB0B 4R8UB 2IFXA 5KT3A 3K5OA 1TL3A 1R7IA 1KLNA 2A3JA 4DG1A 1QUVA 2Z0GA 3TOQA 3ISZA 5GAHU 1IN0A 5EUHA 3J80Y 5J2MA 5KFXA 1JMTA 3Q8PB 1ZETA 2F4VF 1OIAA 3ISND 3NGDA 1TKDA 2UXCF 1R31A 2CQDA 4F3QA 3OTDA 4QIFA 4U9RA 1KN6A 3RAXA 2HNDA 4O4GB 5B0GA 2FVRA 3ZZOA 1RA7A 2HGMA 4DV2F 3FFIA 4ICLA 2OO4A 4WCEQ 2OIHA 1RT4A 2PA3A 2R7QA 4DS5A 2CJAA 4RX6A 3KJVA 1R8AA 3MZIA 1UWBB 2GGPB 2AJ4A 4JI3F 2VG7B 2KZMA 3RR7A