1UWBB

Tyr 181 cys hiv-1 rt/8-cl tibo
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE
publication title Crystal structures of 8-Cl and 9-Cl TIBO complexed with wild-type HIV-1 RT and 8-Cl TIBO complexed with the Tyr181Cys HIV-1 RT drug-resistant mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Aspartyl protease
total genus 90
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1uwbB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1uwbB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1uwbB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1uwbB03
1S6QB 3CDWA 4I7FA 4RW4A 2I5JA 2YKNB 1N48A 1C0TB 4NLYA 5KFOA 2IC3A 1C1CA 4DL3A 2ZD1A 3M8QB 4F4YA 3T1AA 4OL8A 4Q0BA 4ZPCA 2XC9A 4H54A 2D3ZA 1S1VA 3N6NA 5F8GA 1RA7A 4RW8A 3PHEA 4F50A 1HPZA 2RKIA 1BQMA 5L1KA 2JEJA 4RNNA 1RT5A 1S1WA 4RW6B 2V0NA 5J2PA 3DMJB 4DG1B 3I5CA 2CJQA 1HMVA 2R2UA 2VG7B 3CIZA 3HHKA 3KJVB 4JUZA 3MFIA 4I2PA 4LSNB 2BQ3A 2IAJA 4NRTA 5DG7A 4QWBA 4MH8A 4PWDA 2ASJA 3VQSA 1S0MA 4NLGA 3FFIB 4RW7B 4TXSA 1RT3A 2FVCA 4R5PB 5I3UA 2GIRA 4IRKA 4HKQA 3IN5A 4O3SA 1FK9B 4I2QA 2FVPA 4LQ9A 4F4WA 3BGRB 5J1EA 2W9BA 4IRCA 3NBPB 4J9RA 5I42A 5T14A 3FDSA 4ECXA 2OPSB 1IKYB 1JLEA 3SI8A 3LP1A 4IRDA 3V4IB 1S1XA 2ATLA 1RA6A 5KFIA 3KMSA 3OL9A 5KG4A 4FS1A 4Q44A 2W9CB 3IGVA 2QV6A 4K50A 3ISNC 3V81A 2JLEA 1SH0A 1JLFB 1FKOA 1TL3A 4G1QA 2VG6B 2WHOA 4ZPBA 3MEDA 3PR4A 4NLVA 3EPIA 2AGOA 1HNVA 4ECVA 2D3UA 4ED7A 4Q45A 3KLHA 3E01B 1K1SA 3C6TB 5L1IA 1CSJA 1KLMB 3H5UA 2OPRA 4FS2A 3DLGA 1NHUA 4QWEA 2FJWA 2E9RX 1IKWA 4EO8A 4NLRA 3DDKA 4H4MB 3KLEA 5KFSA 5HROA 3IS9B 5KFEA 5J2NA 5KG7A 1S1TA 3T19A 4R8UA 3MTKA 2YNHA 3QGGA 1ZTTA 3KLGB 4ECWA 4FBUA 1D0EA 4HYKA 1LWFB 1GX6A 1JLGA 1U09A 4IFVA 5DQGA 1TL1B 4ZP7A 2R8HA 4ZHRB 3QIPA 3G6YA 3CVKA 4XO0A 2YNGB 1VRUB 3Q8PB 1UWBA 4R0EA 4WE1B 1N6QB 4O3QA 2UVWA 1N5YA 2YNIB 1SV5B 4WZMA 2AWZA 2J6UA 1TKTA 4URSA 1EP4A 2C28A 2V9WA 3LP2A 4NLUA 2YKMA 4QWCA 3LANA 3KK3A 4IFYB 4I7FB 4Y34A 4RU9A 4RW4B 2I5JB 3UR0A 4F4XA 4EBCA 1BQNA 4IG3A 5KFWA 1RYSA 1JXLA 2IC3B 3EPGA 5DLFA 1C1CB 1KHWA 2ZD1B 2GIQA 3PR5B 2W7PA 2AGPA 2AQ4A 2ALZA 4Q0BB 4NLTA 3V6DA 3CWJA 4YR3A 1S1VB 1S48A 2VA2A 1JLQA 4RW8B 4K4TA 1HPZB 2RKIB 2BRLA 2ZKUA 3C6UA 4J9OA 3SFUA 2HNDB 2AGQA 1RT5B 1S1WB 1RTJA 3I0SA 2FLPA 5J2PB 1FKPA 4LSLA 2V4RA 3M8PA 4KO0A 1HMVB 1EETA 3BQ0A 4I2PB 3KLFA 2IAJB 2R8JA 2E9ZA 3GILA 4KV8A 3OSPA 4EO6A 5HP1A 4PWDB 5L1JA 3LP0A 1RTDB 1Z4UA 1SH2A 3MR5A 4J9SA 1RT3B 4B3OA 3GV8B 2R2SA 2FJXA 1HNIA 2HWIA 5KT3A 3QYYA 3PVXA 2HWHA 4I2QB 4TYBA 1ZETA 3LALA 2W9BB 3FQKA 4MIAA 5KT2A 1T3NA 3RBDA 2XI3A 5I42B 4Q8EA 3HVAA 5KFPA 1N4LA 1JLEB 3LP1B 3D28A 4RNMA 1S1XB 2BQUA 3NAHA 1TV6B 4O44A 1NHVA 4KHMA 2AU0A 3V81B 4ECQA 4ZVFA 1FKOB 1TL3B 3NL0A 3MEDB 3QO9A 2IJFA 1HNVB 3RB0A 4M94A 5F8LA 3KLIA 3KLHB 2FVRA 5FDLA 2B5JA 3MR2A 3NMAA 3DLEA 2OPRB 2R8IA 2BRKA 3DLGB 3PZPA 5KFVA 2XCPA 1IKWB 3MEEA 5KFQA 4F4ZA 3KLEB 2WRMA 5HROB 4J9QA 2CKWA 5J2NB 1T05A 5C25A 4K4ZA 1NNDA 4R8UB 2YNHB 3BJYA 1DTQA 2RDJA 2C2RA 1TP7A 4YQWA 2IM0A 1JLGB 3GIMA 4IFVB 1D1UA 4RNFA 1RT2A 4NLWA 4KHRA 2IM2A 4RUCA 3JYTA 4IH6A 3KMQA 4ZVEA 1LWCA 1N5YB 1J5OA 4ZPDA 3MR3A 4ED8A 5KFJA 1JLAA 1DLOA 2IMWP 1JIHA 3RAXA 2FLLA 4WZQA 1TKTB 3KK1A 4EYHB 3BR9A 1EP4B 2XGPA 2XGQA 3LP2B 5CYQA 2YKMB 3GIKA 5DGAA 3KK3B 3KHHA 1C0UA 5F8JA 4O4RA 1I6JA 5DQIA 5L9XA 1JX4A 2ILYA 2JC0A 3BQ1A 5F8NA 5D3GA 1BQNB 4IG3B 1RT7A 5F8IA 3BSAA 3CDEA 1S10A 1QAIA 2ASDA 3V6DB 3CDUA 2BE2A 5C42B 4ECRA 1JLQB 3DM2B 4RW9A 1OS5A 3C6UB 4NCGA 2UUWA 2RF2A 4IR1A 3PW0A 1RTJB 4U6PA 3DI6A 4WFZA 2XWYA 1C1BA 3QGHA 2BR0A 1FKPB 4LSLB 3BSCA 2FJVA 3FQLA 3OHBA 3M8PB 4KO0B 3HVWA 5KFZA 3H4BA 1EETB 3CJ5A 1S97A 4NZ0A 1T03A 4KAIA 4KV8B 3QZ8A 3QLHB 3OL8A 5HP1B 3HVTA 1QAJA 4NLPA 3M9OB 1RTHA 1SUQA 3LAMA 4ED2A 4JV1A 3LP0B 4XPEA 5DLGA 4B3OB 2BQRA 1HQUA 5KFKA 5EWEA 2AX1A 1HNIB 3FSIA 1SH3A 2DPJA 4EEYA 3QGIA 3H5XA 1HYSA 2IJNA 4NLQA 2HNZB 4YMEA 3MR6A 3EZUA 4IG0A 4FBTA 3MEGA 3PW5A 2VG5A 1XR5A 3H59A 3T5JA 4RZRA 1REVA 4IR9A 3DOLA 2HMIB 4MK9A 4YP3A 2UVUA 3OSNA 3TAMA 2GC8A 5EDWA 4O44B 3IG1A 2XCAA 1RAJA 5KFYA 4IH7A 4ZMMA 1LW0A 2OPQA 4ED1A 1YVFA 4GC6A 4K4XA 2D7SA 4Q43A 2HNYA 4RUAA 3KLIB 5KFRA 5FDLB 2B5JB 4MKAA 4PQUA 4IDKA 3DLEB 4TLRA 3TVKA 5J2QA 3OL7A 1ZTWA 2J6TA 1JLBA 5HLFA 3MEEB 4DL6A 5KFBA 1BQMB 3ITHA 4QW9A 3I0RA 3RBEA 4YR2A 4J9MA 1T05B 5C25B 3CJ4A 2UVVA 2YNFA 1RT1A 1DTQB 2ILZA 1TVRA 4TY9A 3GQCA 3V6JA 4H4OA 4KSEB 1TQLA 5KFUA 3BSOA 2ZE2A 4KKOA 5F9NA 3KHRA 1S1UA 3DRSA 5C5JA 3JYTB 1RDRA 4O3RA 1LWCB 3Q8SB 4O4GA 2O5DA 2C2DA 3UPFA 1J5OB 4NRUA 2W7OA 1JLAB 1DLOB 3V6HA 4EBEA 5I3UB 3KK1B 1RT4A 1C2PA 4K4WA 4KFBA 3ICLA 5KFLA 3OLBA 3KHGA 3JSMA 3NGDA 3TQ1A 1C0UB 5J1EB 4G3IA 1MMLA 5EUHA 4J9PA 3H2LA 3OLAA 4J9NA 5D3GB 1RT7B 1DTTA 3DLKA 2IM1A 5KFMA 4NLXA 3HKWA 2B43A 4Y2CA 1RT6A 2BE2B 3DRRA 5KFNA 4YR0A 4RW9B 2F8EX 4NCGB 4G1QB 4URQU 4NLSA 2RF2B 3MECA 3GV7B 4J9LA 4K4YA 3DI6B 1C1BB 4ED0A 3MFHA 1VRTA 2DPIA 4NLDA 5F9LA 4ICLA 2WONA 1T03B 4MFBA 5KFXA 4O3OA 5KG3A 2JEGA 5KG6A 5CYMA 3HVTB 5KFDA 3MF5A 1RTHB 1SUQB 3UDLA 5DQHA 1HQEA 3LAKA 5K14A 2FVSA 1S1TB 1GX5A 1S4FA 3PJWA 1SV5A 1HQUB 3T5HA 5C24A 3T5LA 1XR6A 3T5KA 4IKAA 1HYSB 5DG8A 1IKXA 5F8HA 3H5YA 4LQ3A 3QIPB 2R8KA 1JLCA 3CJ2A 4IG0B 4ED6A 3MEGB 2VG5B 4NYZA 1UWBB 4K4VA 3DOKA 3G86A 1REVB 3BREA 3DOLB 4TYAA 1IKVA 5F8MA 1S9GA 3PJXA 4TN2A 3TAMB 4XPCA 3I5BA 4DL5A 2OPPA 2R8GA 3IG1B 4DL2A 5KG0A 3BSNA 4PUOA 1RTIA 1XR7A 4NLOA 2BANA 2HNDA 1LW0B 2OPQB 3KK2A 1QUVA 2AX0A 4K4SA 2WOMA 2B6AA 2WK4A 4RNHA 3RAQA 2HNYB 4QPXA 1LW2A 4PQUB 4ZP8A 4IDKB 5HBMA 5J2QB 3G6VA 4JV2A 4ECSA 3DYAA 2I1RA 1JLBB 5HLFB 1KHVA 4MIBA 1LWEA 3H40A 3ITHB 5KT6A 3KHLA 3SFGA 3I0RB 1RTDA 4ID5A 1JKHA 3I0SB 3FRZA 2YNFB 1RT1B 1MU2A 2V4QA 1TVRB 1TKZA 3N6LA 4H4OB 4TY8A 2RDIA 2ZE2B 1QE1A 4KKOB 3KLFB 2W9AA 1S1UB 3DRSB 3QZ7A 4O3NA 1S6PA 3IRXA 5J2MA 4QW8A 2JC1A 4RNOA 3KNAA 4O4GB 4MK8A 1R0AA 2D41A 4MK7A 1IM4A 5KG5A 1RT4B 2ASLA 4KFBB 1TV6A 4ZVHA 1S9EA 3JSMB 2XI2A 2UVRA 1S49A 1TKXA 3DRPA 3OHAA 4ZPAA 4JV0A 1S6QA 3D5MA 4MKBA 4Y3CA 2J6SA 2YKNA 5EWGA 1DTTB 3DLKB 5KFAA 1C0TA 3Q8RB 2OH2A 2C2EA 3M8QA 4TQSA 1RT6B 4DL4A 4IOBA 4EYIB 3DRRB 2UUTA 1T94A 5KG1A 3MECB 4Y2AA 5KFTA 2VA3A 3BQ2A 3QO9B 3GIJA 3ISND 4RW6A 1S0NA 3NAIA 3DMJA 3RB4A 4DG1A 4ZVGA 3GIIA 1VRTB 1K1QA 2FLNA 2VG7A 4ICLB 2WONB 3KJVA 4MFBB 3NKYA 4LSNA 4QWAA 3Q8QB 1W25A 4DL7A 5CYMB 5DG9A 3KOAA 3PW7A 2WB4A 3V6KA 5KFCA 2W8LA 1HQEB 1HARA 3FFIA 4RW7A 5K14B 4U7CA 3UQSA 3GV5B 4ZP6A 5C24B 3OL6A 4R5PA 5KT7A 4WYLA 3GYNA 3CJ0A 4IH5A 1FK9A 3N6MA 1RT2B 1IKXB 3BGRA 4GC7A 1JLCB 3NBPA 4WYWA 2W8KA 2R2TA 3CO9A 3G6XA 3I5AA 3DOKB 2OPSA 1S0OA 1IKYA 1RYRA 1IKVB 5L1LA 3V4IA 4ECYA 1S9GB 3PW2A 5KT5A 4ZP9A 2OPPB 5C42A 4ECTA 3QIDA 3DM2A 5CYQB 2W9CA 2IBKA 4PUOB 1RTIB 5JUMA 3RB3A 1N56A 1JLFA 2BANB 3KK2B 3H4DA 2VG6A 3H5SA 2WOMB 2B6AB 4O3PA 4DEZA 4WFYA 1LW2B 2WCXA 3CJ3A 3E01A 5KFGA 3C6TA 2JEFA 5HBMB 2QE5A 1KLMA 3DYAB 2R2RA 2HAIA 3M9NB 4KBIA 3QLHA 2C22A 4WXWA 1LWEB 2WTFA 4J9KA 3PW4A 2JEIA 3E51A 5EWFA 4H4MA 4TQRA 4ID5B 1JKHB 5KG2A 3KLVA 3IS9A 4KB7A 5KFHA 5DGBA 1MU2B 5KT4A 5JXSA 3M9MB 1TKZB 4ECZA 2E9TA 3KLGA 4TY8B 4ECUA 4X2BA 1LWFA 4Q8FA 1QE1B 2IM3A 1TL1A 4M95A 4URGA 4ZHRA 2HNZA 4IQXA 1S6PB 3IRXB 5J2MB 3IGNA 4EBDA 1S9FA 2YNGA 1VRUA 1R0AB 2FVQA 4WFXA 1WNEA 4QWDA 4WE1A 1N6QA 4WXOA 3RB6A 2YNIA 2HMIA 4K4UA 3H98A 1S9EB 5KFFA 4ED3A 1TKXB 3DRPB 4KE5A 2EC0A 2IA6A 4IFYA
chains in the Genus database with same CATH superfamily
4I7FA 4ZIWA 5ETQA 1U25A 4HHUA 2R9LA 4NLYA 1C1CA 5IQQA 1K47A 1UTAA 3M4XA 4U8YA 5DS7A 1TMJA 2JEJA 1CJUB 2DTJA 3F73A 2R2UA 1T9VA 3B6BA 3E8OA 4E0DA 4DSFA 2A1BA 3VQSA 5MAOA 1UAWA 5I3UA 3OR2A 2Y0SD 2FLOA 2W9BA 4BS2A 4ECXA 1JLEA 2Y3YA 3LP1A 5B0FA 4K0KF 4DUZJ 4JP8A 5KFIA 4N7TA 1Q7YT 3V81A 1LFPA 1B7FA 3J80U 3MMBA 2KN4A 4QCLA 1HBOA 1HNZJ 4EO8A 5FLXU 2ZJQQ 4C11B 1GT8A 2QTWA 3TVYA 2R8HA 4LFBF 2EKYA 1KVIA 2X1GA 3Q8PB 2MZTA 5B08A 2ZH8A 4TVAB 1N5YA 3GG1A 3IBCB 4F0KA 2EXUA 4JI1F 3MDFA 3CNQP 3T6JA 1KKHA 3JS9A 2ZITA 4Q0BB 1S48A 3VVTA 2ZKUA 3KNGA 3I0SA 1YJ9S 2VODA 3EYZA 4P10A 3SSRA 4LF1A 1VQOS 2E9ZA 3Q8VA 2Z8QA 4WF9Q 3LALA 2MZJA 3BH7B 3GPAA 1B99A 1PCAA 1EARA 1HWIA 1J2VA 4ZVFA 2Z57B 2D9OA 4M94A 3MTJA 1GMWA 5KOXA 3ZXWA 2XMVA 1NSKL 5HROB 4IQMA 3GR1A 1FDNA 1P27B 3CULA 4YY3J 4X4SA 4PG8A 1XNQJ 4DOZA 3CMES 2ZHBA 1WF0A 1KP6A 2GHWA 3CDAA 2AJFE 4DF4A 3Q8YA 1I6JA 4CM0A 2XNQA 1JLQB 3CEDA 1FXRA 4LF7J 2DH9A 4OYWA 3CCZA 3OL8A 2MHNA 3LAMA 4C98A 1SBRA 3D3CJ 1HQUA 3C19A 2BACA 2GNKA 3NGTA 1EZZB 4FBTA 1XR5A 5GMKa 2OMLA 2HBQB 4YP3A 2FHJA 4BCAA 1F5AA 4WKRA 1WC1A 5KFYA 1U2RA 4CLZA 2CNLB 3R5AA 3X3UA 1AT1B 1JLBA 4WPAA 2R7WA 3I0RA 2J5AA 1RKIA 4CQ1A 3CJ4A 2OSQA 5KFUA 2HQFA 4ERDA 4FYXB 4EBEA 1C2PA 4KH1B 3MMAA 1F0XA 2DGOA 1YJWS 3WBZA 4Y6IA 4UTGA 5D3GB 5K8MA 2N3OA 4DV4J 3OTBA 2FY1A 3D6MB 4NLSA 1YRXA 3FGVA 2DHXA 4CO0A 4Q5VA 4ZS6A 3M30B 3NCQA 3VVUA 4DQQA 2POKA 2LA4A 2ZM6J 1RWNB 1FDBA 2HFNA 3Q83A 2ZUAA 4WP9A 3TAMB 3FCWA 3K7RA 1KQGB 2QMWA 1LEOA 3RAQA 3SIPB 1DURA 3A3OB 3Q8UA 2KFNA 2I1RA 1YLXA 3ITHB 2B8PA 3FRZA 3N6LA 4H4OB 1PILA 2DGQA 2LP4A 2K1RA 4YB1P 1HNXJ 3MXHP 2MJUA 3TA2A 3UW1A 3GE9A 1RJJA 2OH2A 1YJUA 1FRKA 3SCKE 3OJSA 4Y2AA 2OLWA 4M63A 1FESA 3CCMS 1J27A 4PR6A 3CJQA 1KOOA 4ZP6A 4LIRA 5GAGU 2X3GA 3FBEA 5E3PA 4XIUA 4IH5A 4DZ6A 4WYWA 1M90T 5JMNA 2DNKA 1XWLA 1T3OA 4QIGA 3MAAB 2OPPB 4KQZA 4HI1A 4C8LA 4EWTA 5F3TA 2OAUA 2FGOA 4TU7A 2JEFA 3C15B 2HZCA 2JEIA 1SKRA 4H4MA 5KG2A 3KLVA 1AW0A 1DZ5A 3CXCR 4DPUA 2ZJPQ 1TL1A 3D0IE 4NA3A 2YNGA 2VV5A 2YNIA 2HMIA 2YH0A 1FJGF 2VFTA 3QJPA 3I55S 2YPZA 2D3ZA 1RA7A 2AW0A 2YWGA 4YHHF 4FYDA 2H1YA 2FHKA 2VG7B 3N9UC 4JUZA 1F2GA 4PWDA 1AZSA 1F9HA 2RT3A 3MCNA 2FJAB 3PO4A 2FY8A 5EX0A 4LF9J 3D66A 1S4EA 1SJ4P 2AYGA 1U6BA 2BKNA 2YQ3A 2JLEA 3EM1A 4H4KC 3C6TB 1M5KC 2NR0A 4N47A 4F02A 4DSJA 1VQPS 3DDKA 5A8KB 4DR5F 5KG7A 3DLBA 3RGIA 3PYFA 4L3NA 1E6VB 5CZXA 2HBYB 4XO0A 3CE8A 2E7VA 2EPIA 5DRKA 2VF3A 1P8GA 4OV6A 1EP4A 4IFYB 9RUBA 1N33J 4V19J 1DQ9A 4IG3A 1X4AA 1X0FA 2DY1A 1OYEA 5D0GA 2CPYA 1P6TA 3M8PA 1FWLA 2RMLA 3PRVA 2HHPA 1CJTA 3OSPA 1RWKB 4J9SA 3MCSA 2J0QD 1NKEA 2CQCA 4CM2A 4DS5A 2CPZA 2QSFA 5I3QA 4FF1A 1GTEA 5K20B 4LFAJ 1VC6A 3MEDB 4P7TA 2GVDA 4G65A 3VV2B 4C8OA 5J1NA 1KQFB 5KFVA 2MKYA 1HBUA 2CRLA 3OT9A 3IO1A 3KJFB 2KZMA 3NNAA 5ETVA 3M2VA 5KFJA 1JLAA 2YWEA 2XGPA 3T1YF 4J91A 4M5HA 1X60A 1REGX 4F2SA 2GW8A 5L9XA 4DR7F 2ZDPA 5C42B 3Q2SC 3DM2B 1S77D 3DRYA 3CGIA 2EFGA 1S97A 3ULHA 4ZCMA 2HS0A 2BJ3A 1KFDA 1FHTA 2NSBA 4QBUA 5LSRA 3FJ2A 1F3VA 2HNZB 1R8HA 1QTMA 1REVA 5E5NA 1UJ4A 1WI8A 2L08A 2E66A 1QAYA 2NXNA 3QT7A 2HNYA 1H0HB 1UEKA 1OMSA 3DLEB 3TVKA 2HHTA 2KB2A 2XBPA 3GZ7A 1CC7A 2OD6A 2E1AA 1Q82T 3UWTA 1P9YA 2V8PA 2ZE2A 5C5JA 4HH1A 4O4GA 4AL7A 2W7OA 2DNNA 2W2MP 1JWWA 1IWGA 4ZCIA 5U47A 4L74A 1BD6A 2IM1A 2JFKA 3TZWA 5KFNA 3QRQA 2KH9A 3DI6B 4NL5A 2XMTA 3LO3A 4B3TJ 4MFBA 1KVJA 1NPRA 2BXJA 4LF4F 1YK9A 4ZLNA 3MGJA 1IKXA 3H5YA 2W24A 2F4FA 1JLCA 3EWGA 2WBRA 5LT5A 3BBCA 4NXMJ 2C3MA 4JI5J 3BREA 4OX9F 3PIPQ 4KGZB 3ZC4A 5AXNA 3BKFA 2CNNB 1RTIA 4K4SA 2CVEA 1LW2A 2Z2YB 4PQUB 2YBVA 2P9CA 4JV2A 4ECSA 2MKIA 4LF6F 4HACB 1QDUB 5KT6A 3HD1A 1OPIA 2WW4A 2U2FA 3QAUA 2VDIA 4KKOB 5J2MA 2VB6A 2XI2A 4OI4A 3W5ZA 4ZPAA 2XSJA 1DTTB 3DLKB 3SCJE 4KH0B 3G8TA 3E2EA 2VU5A 3ADAC 2C2EA 1IBMJ 1H74A 3DRRB 1B4SA 4OYBA 4D3HA 5L38A 3BN7A 2FLNA 2DIVA 2KJVA 2MKJA 2B9XA 3FEYB 5IOLA 4JBCA 1GQEA 1QAXA 4OX7A 2B9YA 1RHRB 4ECTA 2C2ZB 3TANA 4PUOB 3RB3A 3DOMB 1YBUA 2WBMA 1Y10A 2LECA 3U02A 2HAIA 4KJIA 3QLHA 1R89A 1JKHB 2KRRA 4NI2B 2KJWA 2B56A 1QE1B 3NGUA 4FPRA 2ZH6A 2GGPA 1S9FA 2CPEA 1TR0A 3BGFA 2MXYA 2JZ5A 1S6QB 1F5CA 3MM7B 2I5JA 2V6AA 3T1AA 5AE1A 3QFHA 2CZVC 2FHOB 4NYOA 1XNRF 4DV7F 5T7LA 4I2PA 4USUA 2KYZA 2MQ8A 4QWBA 2AMCB 5IT0A 2ZBPA 4E98A 2GIRA 5J1EA 1N52B 6AT1B 1VQNS 4ZKAA 2OEMA 5IFMA 1YG0A 2U1AA 3MPWA 1FXLA 3KLHA 5D4PA 3BEGB 3I56S 1F6TA 2MEWA 2L41A 3OV7A 2P5VA 1KD1T 1TELA 2V8GA 5KFEA 3T19A 3M6WA 3DRXA 4LVNP 2HLUA 4DWIA 2E7XA 4ZHRB 1VRUB 2UUBJ 2AWZA 4WIIA 1F3FA 1YBTA 1PC4A 4NLUA 2LQJA 3U1MA 4CP5A 1RYSA 2GIQA 4NLTA 2C3YA 3V6DA 4C48A 4K4TA 1HPZB 2F5GA 1EETA 1AB8A 5ETRA 2D74B 1H2UX 2PGCA 1RLCL 4LR7A 5HVHA 2MZRA 4Z37A 2BW2A 2YKQA 4K59A 1VC0A 3HK2A 4CO3A 5KT2A 3DCAA 2UUCF 4NE9C 1F60B 5IT9Y 5DO2A 2YKPA 4JI8F 1QJHA 3QO9A 2LKZA 5J1PA 1HNVB 3MR2A 2YX4A 3R27A 3DLGB 3BB5A 4PXDA 4R8UB 4JI6F 1NKBA 1XTZA 2W2OP 3EX7B 1D1UA 1RT2A 1VISA 3NGKA 1H38A 4C3LA 1TL7A 1VCTA 3KMQA 2V4JA 1NDKA 1JIHA 4WZQA 3KK1A 2VKRA 1Q1KA 2IHR1 5CYQA 2CQHA 2Q79A 5A8RB 1JX4A 3VGUA 3G82B 1FCAA 1Y3JA 4U6PA 2AYMA 4LSLB 3OW2R 3GSIA 2UU9F 2VFRA 4ED2A 1WF1A 2DGSA 4HL9A 3F44A 2BM0A 3DDNA 2E44A 3H59A 4DHVA 2CIMA 4ILLA 1IBLF 4DN9A 3R97A 2B5JB 2WSEC 3FZBA 2J6TA 5KFBA 4DV1J 4QW9A 4X84A 4KSEB 4A8QA 4YOEA 1LWCB 3M2RA 3R6GB 1TL5A 4WTYA 2W2QP 4I1TA 4X4NA 4QIVA 1UVLA 2MQNA 3VTIA 4PWUA 4LF8J 3B8HA 2J0XA 3J7ZT 4URQU 2LXIA 2MKCA 2WVCA 4ED0A 1HNWF 1CJVB 4P2MA 5H9FJ 2WONA 1OY9A 2Z30B 2J7KA 1SV5A 2MY8A 1XR6A 5DG8A 1VFJA 2WAQD 2OELA 1KBRA 3RRGA 1QSYA 3DOKA 1XEZA 2NCKL 1S9GA 1GXTA 1YIJS 1UEUA 3IG1B 1SKWA 2OTJS 3BSNA 2BJ7A 2XULA 3MPYA 4ETZA 5AE2A 2CG4A 2M88A 2AHOB 1HIYA 2P2CB 4YDXA 1S6PA 3IRXA 3MUMP 2NYHA 1R0AA 5CH7B 1Q8IA 3OXFA 1GH8A 1IUJA 1WOPA 1RT6B 4DL4A 1O51A 1PJ6A 3PKYA 4RW6A 4M5MA 3NKYA 4LSNA 3HHLB 5DG9A 1VQ9S 2ZBCA 4WTOB 5K14B 4RW7A 1ZOTA 5T41A 3K5NA 1TU0B 4GC7A 3NBPA 4EZ9A 3ELHA 2MYFA 1JNRB 5IM0B 2V8DA 2QLWA 2DIUA 2B6AB 3CJ3A 2V94A 1NK0A 2R2RA 4QYZK 1LWEB 1FNXH 1VS3A 2KFZA 3CCSS 1S0VA 4TY8B 4H4KA 2L9WA 4DR6F 3DU5A 3QWPA 1UFWA 4GVBA 1RHJB 3IGNA 3EJMA 3EZOA 1Y7PA 2W4PA 3QATA 1B7YB 1UL3A 1N8RT 1C0TB 3DLLQ 4NZ7A 1S1VA 2OMOA 4OI0A 4RW8A 3FEZA 2Q43A 2DNLA 1FO1A 4C0BA 1VI7A 3UFCX 1QY7A 3RU0A 5D4NA 4NLGA 3AB4B 4DX7A 4IRKA 1FK9B 2ZWOA 1SJQA 2ZHAA 3BM7A 2ZH5A 2VFVA 2MGZA 4N76A 3KMSA 4Q44A 1UVIA 7AT1B 3QRPA 2LDIA 4A8FA 1KLMB 1NHUA 4QWEA 4NLRA 1UW4A 2GVZB 4IFVA 2BBEA 4DN0A 3G6YA 2P9GA 4DQRA 1Y5IB 4O3QA 1Q79A 1WOOA 3W66A 2MQMA 2C28A 3LANA 3KK3A 2AV5A 2CQIA 3ONQA 4UZBA 1SJFA 4YR3A 2BRLA 2RB7A 4OJHA 1KNZA 1ZS6A 2HAFA 2DXDA 3C46A 4B9LA 3MOZA 3MI7X 1U45A 4TYBA 4DV6F 3J81Y 1T3NA 3P3DA 2V2KA 2HHSA 1MW7A 4A8MP 3VZIA 1S1XB 1NHVA 2AU0A 4WK3A 5B0GA 3EGZA 1R6VA 2AP6A 2CPFA 5BR8J 3H7HB 5ETNA 1IKWB 1T05A 2V67A 3PG9A 1AA1B 5HL7Q 3ZZTA 3FSXA 2Q3PA 5D0HA 4JB8B 1DLOA 3RAXA 4EYHB 4GO5X 4QOTA 3LP2B 2MQOA 4DCJB 4B3SJ 3ZNUA 5F8JA 3JQJA 1R3NA 1VQSA 1B0PA 3KWMA 1HD1A 1WUUA 1MLAA 2BE2A 2PT0A 4X4RA 2XWYA 3BPDA 1WSVA 2DNPA 1KONA 2J8SA 3QBCA 1YJRA 4PPDA 2E5LF 3LP0B 1AUSL 5DLGA 1Q95G 5K9FA 3X1LB 4M8LA 1FFSB 4RZRA 3R3TA 3OSNA 4OZNA 2YWHA 2F63A 3FBBA 2OPQA 4DSEA 1FJGJ 5KFRA 3HI9A 4NPOA 1RACB 4N8OA 4CLWA 3OL7A 4AQYJ 1VQ4S 3MEEB 1H6KX 2DHSA 1OY8A 2LQ8A 1OWXA 3RBEA 4KIAA 4YR2A 3V6JA 4UQTA 5A0YA 3C14B 3Q8SB 4LRBA 4I0WA 4KPCA 3V6HA 1CS4B 5I3UB 1HD0A 1QD1A 1NK7A 1V3ZA 5KFMA 4W98A 2IRUA 3ENQA 1OQ3A 2M8DB 4RW9B 5IV3A 1V3RA 2HGNA 1C1BB 3TA0A 3W2WA 1F9EB 3CC7S 3HVTB 2ZC3A 5E3RA 1OY6A 3IP0A 1NHKL 4LQ3A 1PKUA 1Q8KA 1FE0A 6FD1A 2J9DA 2V63A 2W4CA 2LYVA 5E3QA 3DYAA 5KAKA 4MIBA 1WORA 3I0SB 3QWUA 2ADCA 2D9PA 4DR1F 3KNAA 3DHWC 2J9CA 3L95X 4KFBB 4ZVOB 5B7WA 4JV0A 2R7QA 2ZDOA 2VIHA 3RRHA 4DMZA 2Z2ZA 3D6FB 4LREA 4NX9A 3BQ2A 4UQGA 5LJ5Y 4DG1A 4ZVGA 2GFFA 4ICLB 3LTOA 1DHMA 1Z2LA 4ZN3A 4G6VB 3BGOP 3FFIA 4OZLA 2HRUA 1T11A 1G2EA 3IM8A 2W8KA 5LSOA 2R2TA 4I6WA 3Q23A 2PD1A 4JV5F 4G1PA 3PW2A 4EK2A 4Z7CA 2YKOA 1JLFA 4USWA 4C6AA 3D1QA 5B0EA 5HI7A 2AKWB 4WXWA 5EWFA 5DGBA 4OHXA 2WVEA 1JJCB 4M95A 2IM3A 2AZ1A 3OUYB 1SQGA 3HSZA 3OQ2A 7FD1A 1NBEB 1SJ3P 1FD2A 4CLSA 4KE5A 2DR8A 3L7OA 2DD8S 2XMJA 5IT9U 2ZD1A 3Q86A 3ET6A 4F50A 2RKIA 4ANDA 3W65A 3K5LA 1XN9A 2ZZNA 3MUTP 2CQ4A 1VK8A 3GMGA 1VBKA 1SL0A 1K73T 1V5IB 3BGUA 2Q6CA 3FDSA 2FB0A 5CAAA 1I94J 3HJFA 2HURA 2XHCA 2KT2A 3PACA 3ISNC 3EPIA 2JOQA 3AFGA 1KQKA 3KJNB 4FBUA 4DDFA 2JVOA 4Y2MA 3GTYX 2GJIA 3EDRB 4B9VA 3R9LA 2XEXA 5L39A 4B9MA 1N6QB 3O6QA 2GCFA 2F9JA 4YFUA 4PG6A 4RU9A 1OJ4A 3M8SA 4E8UA 4J9OA 1D8ZA 4OX9J 3U27A 3GCXP 2QL7B 2UV8G 2AJ1A 2JDJA 4KO0A 2QA1A 3KLFA 2YQ0A 2R8JA 1RAAB 4LBIA 4X4QA 4B17A 3VAJA 5H1SV 4B3OA 4HEA9 4ILMA 2YVSA 1VIOA 3NNCA 5I42B 3R6LB 4RLEA 3NAHA 4UUXA 2B4UA 1Q0NA 1Q86T 3SYZA 3PX4A 4DV0J 5JJBA 2PFFB 5IT4A 2XCPA 4DFKA 1N0VC 4ZPWR 1DTQA 1JLGB 3K58A 4RNFA 9ATCB 4KHRA 1DJ0A 2IM2A 3J7YI 2N3LA 1FI4A 2E1MC 4ED8A 2IMWP 2XGQA 1XK8A 4QIEA 2YKMB 2XY5A 1UZHA 3OJUA 1RT7A 3CW2C 1YHQS 4IR1A 3D0GE 2M70A 5KFZA 4KGKA 4QQBA 1HBMB 3LWMA 3EMTA 4OI1A 1SUQA 3UN5A 1V9OA 3M1VB 2HHHF 2AX1A 1SH3A 3I82A 5IWAF 1X4HA 1HYSA 2L9NA 4IG0A 3RW7A 2CYYA 2HMIB 2DNMA 2GC8A 4TNOA 1HI8A 1LW0A 3RBXA 1VLYA 2ALYB 1M5PC 4FYWB 1RISA 1QSLA 3DGVA 2HHUA 1K8AT 2RSQA 1KEKA 2M4MA 4NRUA 1K44A 2HBZB 4S0MA 4B3MJ 3ICLA 2RAQA 3KHGA 3HSJA 1C0UB 5EUHA 4ZJOA 4J9NA 3OLAA 2OFHX 4RWXA 2ZVSA 4NLXA 5LSLA 4NCGB 3CCRS 4J9LA 4PEOA 3SDEB 2IY5B 4OHZA 3R7SB 2DPIA 3I9V9 3CPWR 5F41A 4HDGA 1R8CA 5DQHA 2O66A 4F8RA 1S4FA 4ZPVR 4A48A 3QT5A 1VBXA 3MPVA 4O23A 2QJ3A 4PXEA 3DLJA 3TP2A 3ZTOA 3OTOJ 3CUNA 4DL2A 5KG0A 4NLOA 3KK2A 3K8WA 1HKAA 3MM8B 3TOQA 1CEZA 2WVFA 4ID5A 1SVDA 1RT1B 3BGLA 2V69A 2HQ3A 2CJ9A 4P71A 5K5MA 5KG5A 2MY7A 2ZC4A 3RR8A 1RWMB 3D5MA 4WFAQ 4BWJA 3M8QA 3CF5Q 2UUCJ 3DXBA 1X9MA 3ZZYA 3L7PA 3ISND 3DMJA 1G4CA 4JI8J 2W8LA 4GVLA 4WKYA 2DXEA 3HHEA 1WKKA 1D9FA 3D3BJ 3Q24A 3N6MA 1Y0HA 4JI6J 4DV3J 2OPSA 2V9KA 3NRBA 3C2PA 1T0TV 2RU3A 2VZ9A 4JI2F 1N56A 4Y65A 2HIYA 4X65J 1FVSA 3D67A 3VR1A 3AXMA 5HMZA 1I3OB 2KXFA 4CIOA 2IJRA 3TRGA 3IS9A 1TKZB 3TUPA 3WZ0A 2E1RA 5A8WB 4EBDA 3DGPB 3PYGA 4WXOA 3J81U 3G6ES 3FCHA 1NAQA 4GKJJ 4B9SA 4RW4A 1RU1A 3MM6A 1N34F 5KFOA 1JMTA 4OL8A 1Y5NB 2OKQA 2M7SA 1B64A 2PSZA 1KWMA 2CNKB 1IBLJ 1AUDA 3DC2A 1Q16B 1I1GA 2ASJA 3ISZA 2BJEA 4HTIA 2GIFA 3W8PA 4UT4A 1MG7A 4ENOA 1H3DA 3I31A 3SBMA 1YITS 1QSSA 1URRA 3IGVA 4DV2F 1FJEB 4IO9Q 3E01B 3AD9C 2C1EB 1YX2A 2FJWA 3E3XA 1NK4A 3HSDA 3KLEA 3H42A 2MDAA 2FPHX 2H3EB 2M3DA 1HNWJ 1RAGB 4WE1B 1R43A 1VLOA 4CYUA 1TKTA 4DJBA 1MROB 3O3LA 4USIA 3P45B 3EPGA 3L09A 2AGPA 4CDIA 2VC0A 3CD6S 3FCVA 4FF3A 1D3WA 4DXLA 2DNHA 2MQQA 3NEKA 1N32F 2H48B 1RT3B 2CQGA 3RBZA 1V5VA 1X4GA 3A8JA 1ZETA 3RBDA 1EJ7L 1R0BG 3OFHA 5KFPA 3G9CA 3VAGA 4TKTA 1VR6A 2VICA 2XSJB 3D0HE 5B0AA 2MZSA 5A6PA 5J2NB 5C25A 1JJ4A 3SQGA 4IO1A 4EZ6A 3JYTA 5CQGA 2FIUA 4USJC 2QC3A 2DKOB 5DGAA 4B3RF 1U8SA 2XY6A 2ZZTA 1BY9A 3CDUA 4C0OC 2KTQA 2DISA 3C6UB 1RWUA 2XQCA 3IBFB 3H4BA 1W26A 2F7VA 4AYBD 3MCOA 3QLHB 1RTHA 1X9SA 2ZZMA 2ZH4A 1R8PA 3EZUA 3MEGA 4DR6J 1HW9A 4FF2A 5GAEU 3DOLA 2VQFF 4ZOSA 5LL6d 1M5OC 2NXCA 3TZXA 2CAJA 2E5JA 2D7SA 2R7UA 5FDLB 2DH7A 4IDKA 3KTQA 4RL1A 4CH0S 4DCPB 3EICA 1BWEA 5B0CA 1HA1A 3R1HA 2VOPA 1TVRA 1TQLA 2JJ4D 2G1HA 2ZOFA 4MKVA 3VQTA 5GAEI 2BE7D 5AJ3F 3KJQB 3NGDA 5J1EB 4OYAA 3AA9A 4C3KA 3H25A 2Y8YA 2DITA 1TZ0A 3WIVA 4USKA 2RF2B 1CVJA 1FTRA 2CJKA 5KG3A 5KG6A 4YEAA 2EK1A 3MMJA 4OX6A 1SC1B 4IKAA 1ZPVA 4LBHA 2F8MA 4YB5A 3TJ8A 5A2QY 4TYAA 2ZH3A 5F8MA 5B0DA 2HNDA 3FNNA 5FD1A 5ITHA 3MHYA 2HVIA 2QA2A 3H40A 2QX0A 4TU8A 2YNFB 2B51A 3OVAA 3MURP 3MZIA 3GLJA 2RHSB 4X4TA 2XLJA 4UUWA 1WACA 2ASLA 2L48A 1TKXA 1JK9B 1WG4A 1FF2A 1LK5A 4F2RA 5ETTA 1UZDA 3MECB 2EKNA 2LVWA 3QO9B 1CJUA 1S0NA 5DETA 3GIIA 1VRTB 4JI3F 1S99A 4L75A 3AXKA 1OYDA 3AH6A 1X4FA 2WB4A 1GK8A 2CWKA 2MQPA 1FWPA 2H4YB 5C24B 2DR9A 5LMNJ 1RT2B 2LLZA 3T9NA 2VFSA 2NXEA 5CYQB 4N56A 4J37A 3H5SA 2WOMB 4O3PA 2WCXA 4A47A 1NRKA 3PIOQ 2FHMA 1ROFA 4GRSA 5LJ3Y 2RRBA 2CXEA 1UPPA 3SXLA 4C11A 3QQCD 5KFHA 3M9MB 2KM8C 3TJ9A 3OBIA 4ZVTB 4GMKA 1RI7A 1WNEA 4WFXA 2EVZA 2RRAA 1E6YB 1S9EB 1U1PA 1HQ2A 4DLGA 1RB0A 3QJJA 1N48A 3QAEA 1RK8A 4Q0BA 3MM5B 1I5OB 4NMLA 4BBYA 3KJVB 2UXCF 4MH8A 1SXLA 1O0PA 3LQVA 1GTHA 2CDRB 2QN6B 2V2ZA 3ILJA 2F9DA 1VIXA 3CCUS 3V4IB 2H65B 3R8YA 3BR8A 3OL9A 3PR4A 4DPOA 1XMOF 1A7GE 1XERA 3QT6A 3TW0A 4B9TA 3NCRA 5HROA 2GMHA 3QGGA 1U09A 2CA9A 1NK5A 3CTRA 2VPWB 1N36F 3CVKA 2F40A 2Z4PA 1SV5B 4WZMA 2DYAA 3I9ZA 3TJAA 1IQZA 3H2UB 3POTB 3CJKB 4AFFA 4DS4A 2VA2A 1JLQA 1S1WB 3K5MA 1HMVB 2HQIA 3ETOA 2MKHA 2IAJB 3NOGA 3BZQA 3HT0A 3W2VB 1RCXB 3H0PA 2LMIA 2FJXA 2HWIA 3CJSA 2VBZA 2BVZA 1LXJA 3C16B 2Y9HA 1ITPA 1M5SA 2DEIA 4C8NA 1NUEA 3EVWA 4J5OA 1MMDA 2R8IA 1M1KT 2CKWA 2UXDF 4OLPA 2XYGB 4OJ3A 3GIMA 4NCBA 3AB2B 2Y1LB 3NLCA 1CPZA 1LQ9A 1RADB 1VC5A 5D3GA 1U2FA 2WVDA 3BO3A 4M5DB 1OS5A 3GJQB 4JV5J 1BC6A 2NPFA 3T41A 3G4SS 2BR0A 1FKPB 4KRWA 2IVMA 1UCNA 2CUYA 2KT5A 4KV8B 3P96A 3G71S 1SC6A 3J81j 2E1PA 3GYGA 3HMJG 1VJQA 2PIIA 4OJGA 4RBVA 4P2XA 4ZVQB 3TAMA 3HLUA 1Y5LB 5ETOA 4DFJA 4AL5A 4TLRA 1BE4A 4DL6A 2EWHA 3ITHA 4UW2A 4TY9A 4H4OA 4OZ1A 1EHWA 2D69A 4DR2F 1RDRA 1N0UA 1UVNA 1PAUB 3QMQA 5JVGQ 2IDLA 1MMLA 2X3DA 4X66F 4ED4A 1Y4ZB 3RYLA 1RAEB 3AQOA 3ZZ0A 1T03B 2JEGA 3PRBA 3MF5A 2R7VA 1GX5A 2A6MA 1OPZA 3T5LA 4HHJA 2OIHA 1EQMA 4ED6A 1RAOA 3MAAA 3M2UB 2OPPA 2EG2A 3G2XA 2ZH2A 1NMEB 1SL2A 2HZAA 4K5RA 2NSCA 2RQKA 2XZTB 1S79A 4RUBA 3KHLA 2A3JA 3CD5A 4AXIA 2V4QA 1TK8A 4M5KA 4EI2A 2N7YA 1SQEA 2Y1JA 1IM4A 1TV6A 1UJ6A 1S49A 1IXKA 3UNGC 4CLKA 4V19X 1ZM3A 1CLFA 4IOBA 3O2IA 2XS5A 4ES3A 1YZ6A 1U02A 2VG7A 1NSPA 3Q8QB 4MYTA 5H9EK 2YWFA 3OL6A 1T02A 2X1BA 4ZPTR 4CTAB 4P52A 4DUZF 4X4VA 3KUHA 2MLZA 1IKVB 2CQPA 2IBKA 3ZTQA 1Q4RA 4DEZA 4WFYA 2BUNA 5KFGA 3C6TA 4FKYA 2XM3A 2AEFA 1EKRA 2DNOA 2QL9B 5A8KA 2MTLA 1NDPA 4X62J 2HSEB 2LDYA 2XMMA 3CCLS 4NEYA 5ETKA 4IFYA 5DDPC 4U96A 2HFSA 2V0NA 4BLGA 4WK1A 1U4BA 3C66A 3JQMA 2DNQA 2VUGA 1IBKF 3IN5A 2NQPA 4F4WA 4Q2MA 3Q0AA 3FBFA 4WJBA 4IUFA 2DEJA 2BZ2A 2W9CB 5M2RA 5HK4A 4LFCF 3NCPA 3MEDA 4NLVA 2N4DA 4JI4J 2QRRA 3T6BA 3HULA 2EEYA 3KYLA 3O8WA 1XNQF 4ECWA 4BC9A 1EB0A 1C4AA 1VOMA 1LK7A 2HEKA 4I69A 1ACMB 2FZGB 3THTA 4CO2A 1WHYA 3TO8A 3K5PA 2DO4A 4NYPA 4ZVUB 2J6UA 1Y9OA 1YSJA 3M8ZA 2EBGA 1O6XA 3FSYA 5KFWA 3EGNA 5HMXA 1JXVA 4C3MA 5LMUF 2P6SA 3GILA 5L1JA 2VPZB 1Z4UA 2ZBRA 3PTWA 4NWBA 3GV8B 3V4MA 4I2QB 4HLBA 1L3TA 2K3KA 5MLCV 3ZZOA 2X51A 4LUBA 4CLYA 3TUJC 2RQ4A 4MIWA 2PMHA 3RB0A 3MAHA 3NMAA 2BDPA 3DLEA 2OPRB 2CPDA 3ZFVA 3BKTA 3BJYA 4YB7A 4DR4J 2IYGA 4NLWA 4L73A 2C2MB 4RX6A 2FYXA 5AE3A 3UVJA 4JYAF 3I32A 2OD4A 4HH0A 5E3AA 5A2QU 1IWAA 2JC0A 1HWKA 2F4VJ 2ZH1A 2FUG9 2XO7A 2BJ1A 1NB2A 3DI6A 3QGHA 3R1LA 1PGZA 1QAJA 3TI0A 3GIRA 4DX6A 4EEYA 3QGIA 2IJNA 4NLQA 2KZZA 1FXDA 1BXNA 4F67A 2ROPA 4MT1A 2EW9A 4TLQA 2UXBF 3KG1A 3HZGA 3MMCB 4PQUA 4OLOA 4WP8A 4HACA 3HHLD 2I9SA 2ILZA 1HNXF 4FYVB 4KKOA 2LQ9A 2C42A 4L6V3 1MSWD 2YWKA 3EGWB 1FDAA 3CCQS 3NGSA 1KC8T 1DTTA 3DLKA 3HKWA 3UN2A 3EVMA 4C7QA 3DRRA 2HFVA 4N8NA 3S1TA 1TKDA 3M7VA 5ETSA 1O8BA 2I8EA 1NEEA 4IOAQ 4QIFA 3ENAA 1ZAXA 3S01A 3SV3A 2VG5B 3UDEA 3UN3A 4ZLPA 3DN9A 2DRAA 2IDEA 1A6LA 4PUOA 1XR7A 3DOMA 2OI2A 4UOHA 1Q53A 2BYCA 4QR0A 4JI0F 8RUCA 2C3UA 2G0JA 3M8YA 5IZHA 3PRDA 1JKHA 2JLGA 1RWXB 1ZM2A 1RE1B 1QE1A 3KLFB 1S1UB 3DRSB 4QYRA 1FJ7A 2IMOA 1RT4B 2CQ2A 2P6TA 2VQEF 4ZVHA 3GU0A 1S6QA 3MM7A 4KTQA 2IVFB 5AXKA 2AF6A 2UUTA 1TTHB 5CYMB 1M5HA 3DLHA 1NJXA 1HQEB 1UMJA 3UQSA 3O1LA 4CH7A 4LF9F 1PYSB 3PEHA 3A4TA 2KXHA 2PE8A 3OR1B 2B4VA 4QYZJ 2Z2LA 3BN4A 1MMNA 3BS9A 3QIDA 3U7JA 5JUMA 4TU9A 3H4DA 1FEHA 4PG7A 2NYIA 4C4WA 2CDQA 5HBMB 4MTPA 3VAIA 2NXUA 5RUBA 2WTFA 3EVOA 1FRJA 2XMUA 4KB7A 2ZJRQ 5K8PA 4ECUA 4Q8FA 3GSDA 1VMBA 4URGA 4ZHRA 4Q2LA 2RQMA 2JNJA 3JTNA 3M32B 4X64F 1VRUA 3WC2A 4PXCA 1SQFA 1HWLA 1XC9A 5HATA 1N54B 3NMRA 3IR6B 4I6AA 1RCOB 4LJMA 2PC6A 1HPZA 1BQMA 2VQFJ 2V2QA 1UP1A 1K0TA 4CNZA 2YY3A 1RKJA 4M5NA 4NEZA 2J76E 4R5PB 1LFWA 4LQ9A 1RSCA 4LFAF 4HT5A 3IBWA 1IKYB 2GS8A 4UOGA 1D9AA 1BWVA 1HNVA 5AJ3J 2XMWA 1H2TZ 4DUYJ 3DLGA 4K7QA 4OYPA 4P2FA 3ZZPA 2K2PA 4R8UA 2CNOB 2QMXA 4ZJQA 4X4PA 1W2IA 1D8YA 1SL1A 3PJ9A 4DPYA 1KOHA 3FK4A 4LRFA 3JTPA 2ZHOA 5A8RA 3W7BA 3G82A 4EU0A 5HQLA 3CWJA 4A8WA 2C3PA 2AGQA 5J2PB 4LSLA 1S72S 4V1Ak 2AEMA 3MR5A 2CQ0A 4OYXA 2PMZD 4OYZA 2HHXA 5C7PA 3T9ZA 4RNMA 5L8RC 1FKOB 3Q2TC 2GHVC 2B5JA 2HLTA 2FTRA 3TX8A 5KFQA 1HBNB 3LGHA 2WRMA 2VL1A 3TA1A 3ZZZA 3EE3A 4HI2A 1JQGA 4EUVA 4ZVEA 1LWCA 2ZFHA 2ABYA 4ZPDA 4IYQA 3JSBA 3GIKA 1HL6A 3HM9A 3LGNA 2I0XA 3BSAA 1CQMA 1QAIA 3B54A 2ASDA 3TZZA 4F3QA 1WDTA 1WHWA 4B3TF 1S5ZA 4OHVA 1RTJB 1YRUA 1CJVA 3HFVA 2XLIA 4B9NA 3MM9B 4N41A 4U7UD 3QGPA 4NXMF 1NXIA 2KI2A 3MR6A 2EI5A 2VOOA 4GKKJ 2LEAA 2FJEB 3TEGA 3BO4A 4RO0A 4O44B 2RILA 3IG1A 3ETMA 3KLIB 2RS2A 1BQXA 4DSIA 3CJ8A 4XAKA 2KXNB 1NK6A 1Q78A 2ZOGA 1PO6A 1CJKB 4OZ0A 2LCWA 2UXCJ 1ZH5A 4F26A 1RAIB 1LXNA 4USVA 1RT6A 1M1GA 2F8EX 3BV8A 4KY3A 2EK6A 3MFHA 1TK0A 4OMFG 3HHLA 2XSFA 2FVSA 5K14A 2VJVA 4M5JA 1YGYA 3OD2A 3QPIA 5KTQA 2DB1A 1HR0J 4XPCA 4Z7YA 5IM0A 5HSPA 2KKHA 2B6AA 3K57A 3CCJS 5J2QB 2I38A 2KDOA 3MD3A 1UA1A 5HLFB 1LWEA 4X4UA 3CSKA 4PG5A 3IMQJ 4TY8A 2V5HG 3BF4A 1H73A 2BEFA 3RZAA 1T9WA 4QW8A 3TYTA 1VQ7S 3IWXA 2D41A 3TVZA 1HW8A 3GG0A 2QLJB 4PYAA 2J9DE 1ZA2B 2V8HA 5GAHI 2J6SA 5KFAA 1C0TA 3HO1A 2G0IA 3CO0P 5D0RA 3HZEA 5KFTA 3NXZA 3OFFA 3TQEA 3PW7A 3HPOA 1T8EA 4AT1B 3AJ2A 1HARA 2HWTA 5BJRA 2OEKA 1FK9A 3Q89A 4K8RA 2UP1A 3A8EA 2XMKA 2GJ2A 2VKZG 5LOQA 5HVFA 2PI4A 4CI0B 2DO0A 1A9NB 3CCVS 2BANB 2PEBA 3RG6A 4CO1A 4A4JA 1KLMA 2KG0A 1LV5A 3IA0A 4FVMA 1Q5YA 1WG5A 5A76A 5JXSA 4ZCLA 3SZ2A 3GR0A 1SC3B 4ID8A 2UUBF 4DPTA 3M6VA 1IJEB 1VBZA 2GX8A 3LF0A 3AJ1A 4QWDA 3UD4P 3RB6A 2QGFB 4X4OA 2DBBA 4QPTA 3DRPB 4NASA 3AQPA 1IJFB 2F65A 2UV8A 4QJVA 3NOCA 3HX9A 3W61A 3EXCX 1NCLA 3QSYB 3FUYA 3IC1A 5F8GA 5L1KA 3BBFA 3HHKA 2UUAF 3ENWA 4FNIA 5DG7A 1U0HB 3FKBA 3ILLA 3RW6A 1I51B 2G9OA 4QU6A 1KN6A 1AFIA 3KXDA 5CYJA 3CIMA 1S1XA 5CD4H 1K9MT 4OHWA 4CRJA 2WHOA 2VG6B 3VF0B 2AJ2A 1U47A 5E7OB 4Q45A 1K1SA 5D8HB 5L1IA 5ETMA 2C2OB 3K8VA 2DR6A 1WWHA 1IKWA 3BO2A 3R5GA 1LWFB 1GX6A 2VBXA 1SJ1A 2Y1IA 4P72A 3MCMA 4L3KA 2HHQA 3UDVA 4I67A 2NS1B 3LP2A 3JSRA 2V9WA 4XDCA 3GCWP 4EBCA 2IC3B 4ZA1A 5FIIA 1S57A 4DV5F 3TNVA 2GA7A 4UY85 2E1CA 4G1IA 3WDOA 2HNDB 4J90A 1RT5B 4KGXB 1TK5A 2V4RA 3J7Z5 5IC6B 2VASA 4PABA 3EXYA 1ZYQA 1WKLA 3AD7C 3THVA 2IBOA 4ALZA 3LP0A 3HT3A 1FNMA 1FA0A 3T1HF 1X5TA 1VGYA 2IIHA 2HWHA 2XI3A 1R27B 2XYHB 4UY8T 4N5SA 4QZVB 4OI6A 2WVBA 3LA0A 1TL3B 2VFUA 1Q7LB 4K0KJ 4DV1F 5BYRA 3MEEA 2YNHB 1PBUA 2JVRA 3C14A 4FN5A 3CMQA 1H7WA 4LFBJ 1U6ZA 3RAMA 1CS4A 1NPKA 1RP5A 4A8KA 4ZDNA 4LF8F 1KDNA 2CJYB 1ZBTA 1BQNB 4JI1J 1KQSR 2DGWA 4RW9A 4AUKA 4DQSA 1C1BA 2NUHA 2QEXS 2VH7A 5HP1B 3HVTA 5THWA 4XPEA 2AJ0A 4NXNF 5I3PA 2W1BA 1HNIB 4LR9A 2B7CB 3B4DA 4DL0C 2CPXA 2XO6A 1FKAF 3FVYA 2H9ZA 4P75A 1D9DA 4F04B 3SSSA 5IQ6A 4FYYB 3LPEA 3GFHA 1S7HA 1YJTA 1T95A 2YQ1A 5F9NA 5G0RB 4O3RA 1J5OB 2GHPA 4KFBA 1NLKL 2A2CA 1VQYA 3H2LA 1IBKJ 1R0CB 3W62A 2B9EA 2B43A 1O5JA 1T9XA 2ZBIA 2BABA 2DGTA 3SCLE 3P5TL 3HXMA 1X4DA 4LFCJ 2HRYA 4ICLA 1RQ0A 3I6PA 2FGCA 3HVRA 4U8VA 3LAKA 3H20A 3RTVA 2R8KA 3M8WA 5LM7E 3ZZRA 3L7UA 1SB6A 2I2YA 2EG1A 4AD6A 3G96A 2WK4A 1YKWA 5L9NA 1R31A 2W2PP 4LSZB 3K5OA 5E33A 3T3FA 4FZVA 2GAHC 2P8IA 1XQIA 1FRMA 3QZ7A 2JC1A 3HP6A 5LMUJ 1RHKB 2PI5A 3OUYA 3PFOA 3CT9A 4MK7A 3LH2S 1RWOB 3UD5A 4I64A 2HIQA 3JSMB 2QO3A 3UCZP 3OTEA 2YTCA 5KG1A 5M2UA 1RBAA 1HHSA 4XDDA 1NSQA 1ZA1B 2RU9A 3R7NB 4PPZA 2Y1RI 5CA5A 3GV5B 4LRCA 5KT7A 4DI6A 4WWSA 1D09B 3CO9A 4RKUC 2DJWA 2I6WA 2G13A 1FDDA 4JYAJ 5AT1B 2IRXA 2HK2A 2H51B 3DXSX 3G8QA 1XMQF 4DPWA 2IA0A 3HFZB 1MU2B 1BHNA 3GONA 4X2BA 2HPUA 2EFQA 3D7SB 1N6QA 4HR2A 1R8BA 3ZO7A 1XMBA 2HK3A 2IPOB 4ES1A 2YKNB 4OX8A 2O1PA 3W5XA 5E3CA 3K17A 3F41A 2NPIA 2E5IA 1CBKA 2LA6A 3I5CA 2UXBJ 1RHUB 2Z0GA 2ROGA 4JOUA 2MZ1A 5HMYA 1S0MA 2M0GB 4ZN1A 2V50A 4O3SA 1U1OA 3DDIA 4K2JA 3BGRB 5I42A 5T14A 5G4DA 4F0HA 3AJDA 4RU2A 2ATLA 4FS1A 5BR8F 4G1QA 8AT1B 5DZ6A 2R42A 4USHA 1CSJA 3H5UA 2NZCA 2YWWA 4RBTA 1RTZA 3KLGB 1U6FA 1JLGA 4ZP7A 1TUWA 5CCMA 4B3SF 1H7XA 2B7BB 3PFEA 3ZNJ1 2H5IB 2YKMA 4M5GA 3ILOA 1FERA 4I7FB 1H72C 3AOBA 1C1CB 3PR5B 2VONA 4ZVPB 3D68A 3K0JA 1WC3A 2MZQA 4YHHJ 4CT8A 1HBMA 1EX8A 1X8DA 1DY3A 4AE5A 1B70B 2BJ8A 3M1VA 4JI0J 5GAGI 3OR2B 2W9BB 4ED5A 1N4LA 3VGVA 1JLEB 2GV1A 3LP1B 1T7PA 4DF8A 2VPXB 1TV6B 4P6QA 1N5SA 3V81B 4AQYF 2Y8WA 2VQEJ 5KOWA 1U1QA 3MMBB 1WSRA 2BRKA 2DGUA 1HBOB 2F1FA 4QR2A 4C0HA 4NZ6A 1NNDA 3N28A 2WSCC 4OZ2A 3R5DA 4DR5J 4RUCA 1NDLA 1N5YB 3AODA 3A12A 3BDPA 5M2PA 1Y11A 3KHHA 1C0UA 1T9UA 4YB6A 4OIXA 2L9DA 3JAMY 1EIYB 4BDPA 4NCGA 3KUEA 3SDEA 1A0OB 1NK8A 4JV1A 2J9EA 1FRHA 1HI1A 4ELTA 3MOJB 1HWUA 1NDCA 2EFVA 1B3TA 2WZ1A 3MPDA 4LT6A 4X64J 4J7CA 1GXUA 3N0VA 4UZCA 2XG8A 2E7WA 3MM8A 1ZTWA 3G87A 5BXIA 5D4OA 1RT1A 4I6YA 3O44A 1WTBA 2MSTA 3W64A 5IS2A 1TUGB 2R4FA 4J9PA 5L46A 3T1YJ 3R7BB 1NJZA 2JWNA 3UCUP 5DJBA 4Y2CA 4DR7J 3TEHB 4O0NA 4IOCQ 1GMUA 4NLDA 1NU4A 1WHVA 2QL5B 4MAKA 1HQUB 4FVCA 4B9UA 2D1CA 1YWXA 4OFZA 3S6EA 1FX2A 1VQ8S 4K4VA 3PJXA 4DL5A 3WX8A 2B0GA 1SKSA 3SMZA 2D3O1 1JLBB 2EFOA 3I0RB 1RTDA 2OGUA 3KKFA 2M8HA 1TKZA 3VAFA 2DHAA 4DR3F 3TZYA 5A8WA 3DGPA 2YPYA 1CULA 4F3MA 1X4BA 1TMMA 3MMAB 3OHAA 4MKBA 1NZAA 2R7SA 5EWGA 5D4LA 4TQSA 1MN7A 4EYIB 3VAHA 1L3KA 3GIJA 4QWAA 4DL7A 4CZCA 3LGMA 3MAQA 2E5GA 4KGMA 1VQLS 4WYLA 3GYNA 1I94F 4LF4J 1JXEA 3S7RA 3UVJB 2CG8A 1NB7A 4ECYA 2GO8A 1FNOA 5D6GA 1VRQC 2DR7A 1Q8BA 1NPPA 1KR4A 2E5HA 2EBEA 4FF4A 1YDLA 3E01A 3VWSA 2ZBQA 5KT4A 4LF6J 4NMXA 2PEHA 2K1RB 2R7XA 3J7YU 2FZCB 2FVQA 4WE1A 3QT8A 2N7CA 3C8YA 1BUXA 4K4UA 3JSYA 1MROA 3B82A 1RXOB 3GFZA 4DL3A 5F0WA 4H54A 3FRYA 3PM9A 2Z56B 2RD5C 3DFEA 3VALA 4XTTA 1YQHA 2DT9A 1RT3A 1F1BB 4KYZA 4WIQA 1FVQA 2GQQA 2Y0BB 5EX3A 4P74A 4IRDA 4CO5A 4ZJLA 1F2HA 2GJFA 3N4WA 5KG4A 2G1DA 4DV0F 3W60A 2QZ8A 2W4DA 2VC1A 3VAMA 4L72B 4H4MB 5J2NA 3RRKA 1ZTTA 4EFAC 1TL1B 2OTLS 2YNGB 2UVWA 4F3OA 2YNIB 1VYAA 4Y2KA 2AJQA 2RIJA 1SIWB 4Y34A 4ZIVA 3N01A 1FRIA 3D2WA 3NWRA 3C6UA 2MHEA 3SCIE 3GP9A 3AOCA 2G2YA 3IFEA 1XNRJ 4PWDB 1AZSB 4DV7J 1SH2A 2YX1A 2BKPA 3W9HA 2R2SA 2JH3A 2VD3A 1PYTA 2BJDA 4YUDA 4DU8A 2R7OA 1RLDA 2C3OA 4LIWA 2BQUA 2KM8B 3A8KA 5AXLA 5ADZA 4ECQA 2PO4A 3KFWX 5FDLA 1WG1A 5CXTA 4AL6A 3GB0A 5HN0A 1PYOB 2A6OA 1PJ7A 4PRFA 3MD1A 4C9DA 1IM6A 4B3MF 4LF5F 2HVDA 2FC9A 4HVZA 1EP4B 1U1KA 1KRPA 1QVFR 3IRWP 1HWJA 2AIRB 5F8NA 4IG3B 1RBLA 1N88A 3JQKA 3MR7A 4ECRA 4ZK7M 2UUWA 2FC8A 1X5PA 2RF2A 4CNYA 2Q6BA 3M8PB 2J0WA 1WC4A 1CJTB 1Q81T 2PA3A 1GFWB 2BQRA 5EWEA 5HO4A 3OTOF 1OQ6A 1UPMB 4R0JA 4A46A 3R2DJ 3GWCA 2UVUA 1Z2ZA 5EDWA 1EQ0A 4IH7A 4ZMMA 2B3TB 2GVDB 1ULRA 4RUAA 1TFWA 4MKAA 4QU7A 2NZ4A 1BQMB 1HBUB 1ZPWX 2HVZA 4J9MA 2YNFA 4OJ1A 2QT7A 1PIEA 1JJ2R 3KHRA 3BBBA 3U1NA 1UVJA 3KG0A 3M2VB 2UUAJ 2V68A 4Z2XA 1JLAB 4K4WA 5LXRA 5KFLA 3W9IA 4G3IA 2PDAA 4OV1A 3MEKA 1QVGR 4YR0A 3PKMA 3P4UB 3KDOA 4EGLA 3UE2A 3MECA 1N5QA 1VRTA 3V5RA 5KFXA 3J7AN 2P9EA 4QR1A 2QSWA 1C4CA 3UDLA 3HKZD 1DQAA 2UU9J 5C24A 3BDEA 4PXBA 4PWWA 4DV3F 2HQCA 5CABA 2CPIA 5E41A 1REVB 1H98A 2XS7A 1ZM4A 4X65F 2WOMA 4RNHA 2HNYB 2DNZA 5B0BA 3G6VA 1KHVA 2CJXB 3VGTA 2DNYA 2R3VA 1PBAA 2HQGA 4DV5J 2ASYA 2ZE2B 2DHHA 2QYCA 1V6HA 4O4GB 4GKJF 1E6YA 4FXDA 1S9EA 1L3UA 3T1HJ 2NXJA 2KRBA 3Q8RB 5H9EJ 3MM5A 3W1YC 3JTOA 3NS5A 3KJVA 4MFBB 2PN6A 1S7IA 2HHWA 1NH8A 4OYMA 3NG8A 5FJ4A 1J5EF 1IKXB 1JLCB 2CQ3A 4JI7F 3I5AA 4DQIA 3V4IA 1LKZA 1IR2A 1RTIB 4B02A 1LW2B 1NZ8A 4Y0FA 1HLWA 3PW4A 3D6HB 1G7CB 2LEPA 1RAFB 4ECZA 3CC4S 2E9TA 4M1KA 3NWGA 5J2MB 1NM2A 1W2BR 4DQPA 1PC5A 4HTJA 1RGVA 3MUVP 3H98A 2BV3A 2MKSA 3POTA 2IA6A 3CJKA 3CDWA 4NXNJ 4OZJA 2XC9A 1YBAA 1N5TA 1S1WA 1HMVA 2IAJA 3GFYA 4USTA 3W2VA 2FVCA 5HANA 2DCUB 1WI6A 4F0MA 3WHIA 2XY7A 3W63A 4WCEQ 1FX4A 3FMWA 4OZ5A 3C16A 3VGSA 3JAMU 4FDFA 4DCOB 2HGLA 2EFNA 2FDNA 3IXQA 3R5JB 1S1TA 5K8NA 1BMQB 4U95A 2Z58B 2ZVIA 1YTYA 3QIPA 1GMVA 2GGPB 1GAOA 1UWBA 4R0EA 5F3ZA 2APOA 3NY0A 5K8OA 4FXVA 4C8YA 1WC6A 2I5JB 1S6OA 2CJBA 3UR0A 1SIZA 1JXLA 3ZZUA 5DLFA 4KHPF 4M5DA 1SJRA 5A6WA 3HJVA 2K7KA 2RRNA 3SFUA 4F36A 2A2DA 3R5BA 1VQ6S 3GJRB 1G1XA 1FKPA 5T7LB 4ER8A 1X31C 5DM7Q 2XS2A 3BQ0A 4I2PB 3MPUB 4KV8A 1ZAWA 1DRZA 1U1LA 1NH7A 3WQPA 5KT3A 3FQKA 2AT1B 4LBPA 4XK8C 1WF2A 3ZTSA 3GJTB 5IV4A 2QLXA 3H2VE 5DDOC 1YZ7A 3NGRA 3HFKA 4A8OA 2W01A 3KLHB 2FVRA 3UO0A 2LEBA 2G4BA 2V8VA 1WTFA 2DGVA 2DCLA 3TAQA 1NJWA 4U7UK 4CLLA 2CADA 3HCXA 4ZLLA 4P2SA 1Z1ZA 4O4RA 2HW3A 3TUIC 4RWWA 3GYXB 1UEVA 2KYXA 2BMBA 3V6DB 3IWNC 2KO1A 1NKCA 3A3NB 4WFZA 3CJTA 2C2KB 3OHBA 2FJVA 2FJBB 3HVWA 2YX7A 1EETB 1T03A 4DX8H 1CQNA 4NLPA 1GEHA 3HDSA 1AFJA 3A3PB 1XMQJ 2DNGA 3KDNA 3I4PA 3AY0A 2LXUA 3PW5A 1DBDA 4DV6J 2QG9B 1P9QC 2BJ9A 3M2UA 2ZUGA 2HFUA 2KVQE 1RAJA 1U2CA 4GC6A 4K4XA 3K89A 5D78A 4RR5A 3PEJA 4CLUA 2GQCA 3AD8C 1UVMA 4ES2A 4Y2IA 4PG4A 1TL7B 2MQLA 2V4JB 1UJ5A 2C2DA 2CPHA 3KK1B 4Y00A 2M52A 2B4PA 2PFDA 1F5BA 2R7RA 2AYEA 4A8XA 2BX6A 2XHWA 4YN3B 4KC5A 4DSLA 3A8IA 7FDRA 2HFZA 1WDDA 3CD0A 5F9LA 5EN1A 3H90A 1TFYA 5LMNF 2OSRA 2RHQB 2E5LJ 2KT3A 3BYPA 3CDBA 2CZ9A 2CQ1A 4CTAA 4C2MA 2Z2MA 4PCQA 1RZMA 1IKVA 4C8MA 1UVKA 3OPKA 4L76A 2AX0A 1DQ8A 4RPFA 2F3JA 2MLYA 3ZTPA 4P9SA 1KSPA 3LUYA 4PKDB 2K3IA 5CD4A 3M05A 4UOCA 1AROP 3M2RB 4J9UE 1RHQB 4M5LA 1UA0A 3OTDA 1L5UA 5D0EA 2XZWA 2OJ3A 2FD2A 2FZKB 3BPSP 4HHHA 2PA8D 4DPXA 2RUGA 3CCTA 4PQAA 5D15A 3TUZC 2RUSA 2O3DA 5DDRC 2VA3A 1SKUB 5DZ7A 3NAIA 2WONB 3SSQA 2M5YA 3FZ2A 2HRTA 2H4WB 3BYRA 1KFSA 4MYUA 1VHIA 4I4BA 1YRTA 3N79A 3DOKB 1S0OA 1S9GB 4N77A 2W9CA 3S8SA 4Y28C 4DZDA 4DFMA 2QE5A 3UDCA 2VPYB 3PX6A 2V34A 4DBQA 3SV4A 2KVIA 1X9WA 2WB1D 1JJHA 1KS2A 1S6PB 3IRXB 5GMDA 1K0VA 1XIQA 1R0AB 1HFEL 5IC4B 1U24A 4MKYA 1SI9A 4DR1J 4DLEA 2QA4G 2EC0A 1IR0A 3AHPA 4K5SA 3PV8A 2MLXA 3M6XA 3PDNA 1WEZA 3WC0A 3NS6A 1T9TA 2ZH9A 2HS3A 1KTVA 2GZOA 4RW6B 2CJQA 2JHEA 4LRAA 2BQ3A 4LSNB 3P8BB 2DXFA 1YJVA 2ACMA 2HGMA 3NS7B 4RW7B 5HQ8A 4HKQA 3HHNB 2KFYA 4PYDA 4I2QA 2KU7A 5SUHA 3NBPB 3ENVA 3HD2A 2ZNZA 1ICEB 4WFNQ 3SI8A 4LR8A 3WX4A 1KLNA 1SH0A 3P49B 5KFKA 1UKUA 2X1AA 2NLWA 1FWKA 2ZNYA 4ED7A 4LF2A 2OPRA 4J9VA 2BA9A 2HFOA 3W5YA 1WJ9A 3M30A 5EGYA 3MTKA 3K2YA 2X7IA 3ILIA 3FMBA 4GVBB 5HAOA 4CLFA 1Q5VA 2J0SD 4A8YA 1PAEX 2K8GA 3OXGA 3TARA 5BYQA 3RUBL 2YKAA 2W7PA 2ALZA 1S1VB 4QIWD 1S12A 4RW8B 1SC4B 2HG4A 5CHCB 3N5BA 4C8KA 4W90B 5CZVA 4BC7A 4HT7A 3US5A 1B0VA 4MMOA 2BW7A 3DHXA 3HVAA 5CCLA 2GQ2A 4DR3J 2MGZB 4C8ZA 1IVZA 4BWMA 4LRDA 4UF4A 2IJFA 3MMCA 5F8LA 3NNHA 2BKOA 2GO9A 2UZAA 2ZWPA 5HVGA 4J9QA 3OTCA 2VBWA 1UW9A 2RDJA 1TP7A 1RU2A 4IFVB 4OI3A 2ADBA 1HHQA 4IH6A 3CCES 1PSDA 1VHFA 1FRLA 2ZKTA 2FLLA 2GAGC 3BR9A 1NK9A 3KK3B 1EAYC 2QLBB 5DQIA 1GXLA 4OYOA 2ILYA 3BQ1A 1Y00A 5ETLA 4DU7A 4P7VA 1NSAA 2XZDB 4HDHA 1S10A 3PHTA 3C15A 2OFGX 1X0PA 3FC9A 1L3SA 3PW0A 4WBFA 1ZAVA 4ELUA 4KAIA 1V3SA 5B09A 2E29A 3HF5A 2HYIB 3VAKA 5IXUA 2VG5A 4U9RA 1LOUA 3HHLC 3PNIA 1U1MA 4ZLJA 2VBYA 4M5IA 1NJIT 1S59A 2R7TA 4OZ3A 2IVYA 3G8SA 1T05B 2UVVA 4WU3A 3GQCA 4U67Q 1S1UA 3DRSA 3BKUA 3CB4A 3UPFA 5HMWA 4ILRA 1DLOB 1MWQA 1RT4A 1RABB 4I68A 4B08A 1HNZF 2BE2B 1R8AA 1URNA 4G1QB 3GV7B 1E6VA 1OSCA 1SCJB 2EC2A 1ZZFA 3PYEA 5CYMA 4K2XA 3P6YC 1HQEA 3T5HA 3T5KA 1OO0B 1ZM9A 5H9FK 2HHHJ 1EKSA 5IWAJ 3G86A 3OR1A 3UR3C 2OHDA 1QUVA 2OPQB 4RJVA 2OEJA 2F8HA 4DUTA 4QPXA 4ZP8A 5HBMA 4R25A 1WOSA 4X62F 5GMEA 3SFGA 1M0SA 2QA4S 5A0YB 2RDIA 1UWAA 4RNOA 3M32A 2IFXA 1TUVA 4GO7X 1MWYA 3B78A 4RUHA 2GMLA 4Y3CA 4RBUA 1VK3A 1WELA 1P1LA 1M1HA 5DDQC 2HBRB 1QTNB 1T94A 4YY3F 2MPUA 2RQCA 1QLNA 5F0UA 3W2WB 1RWVB 2RH3A 1W25A 1P1TA 4WP3A 4U7CA 2HKEA 4R5PA 3NP5A 5C2CA 2N4CA 1U0SA 1WEYA 1IKYA 1YJ7A 1RYRA 4LF7F 3KG4A 5C42A 4LF5J 4JI4F 3DM2A 2DH8A 3FEXB 2VJUA 1VQKS 1H2VZ 1AXQA 3TWZA 3EZ5A 1Q8LA 4ANCA 3DYAB 1Y3KA 3A13A 3E51A 3M6UA 1RWWB 1WHXA 3QSIA 2A10A 2CJAA 3RR7A 2HNZA 3PCOB 5I4MA 1FE4A 2X1FA 4D3GA 1YJNS 5GADU 3TR5A 2H54B 2M9KA 4ZPCA 3D54A 3PHEA 2JRSA 3H8YA 5J2PA 4DG1B 2COLA 3CIZA 3MFIA 3VCDA 4NRTA 1VQ5S 3FFIB 4A8SA 3PX0A 4TXSA 2AEJA 2DRDA 1HI0P 1FTCA 2FVPA 2C2NA 3LPYA 4IRCA 5JVHQ 5GADI 4DV4F 2H5EA 2FQQB 3AOAA 1VBYA 3GJSB 3D4JA 2QV6A 4K50A 2QLFB 1JLFB 1FKOA 5DM6Q 2AGOA 4ECVA 2D3UA 4NA2A 4JI2J 4FS2A 2CWXA 2E9RX 1MNEA 4DR4F 1HBNA 5HJYA 4F4KA 4HYKA 2ZM6F 2KHCA 5DQGA 3RJMB 1ELOA 8ATCB 1FJCA 3ZTRA 4OHYA 2RS8A 3D6TB 2WSFC 3WIUA 2F4VF 3D9BA 2CFXA 2ZD1B 3MWBA 1U26A 3ET6B 2RKIB 1N34J 1RTJA 2XMAA 3V2UC 1VJWA 2AD9A 1LWXA 1RTDB 3LW5C 3MM9A 3OVBA 3QJLA 3PVXA 3QYYA 4MIAA 3HSGA 2WW8A 1FFGB 4Q8EA 2XB2D 4NOHA 3D28A 4WFBQ 1CULB 4C97A 2YXLA 4O44A 4KHMA 4OYIA 3VHQA 2BOPA 3KLIA 5SZTA 4DV2J 2CZ4A 2QFIA 3PZPA 1U48A 4K4ZA 2J8AA 2C2RA 4YQWA 2QMUB 1CJKA 3AA8A 4ATNA 2ATCB 1FT8A 4NA1A 2NUUG 3DKDA 5AXMA 3AT1B 1APSA 1J5EJ 3CCWA 2HQDA 3CDEA 3OFGA 3PYDA 4JI7J 2JLFA 2ROEA 3J80Y 3JXOA 4NI2A 4KO0B 5FLXY 3CJ5A 3IR7B 3SEOA 5ETPA 3QZ8A 1X7VA 4FKXA 5GVQA 2IYIA 4B3OB 1ZZNA 3FSIA 2BOAA 2DPJA 3H5XA 1N32J 3QFWA 4E2FB 2JFDA 3TX0A 4MK9A 1M5VC 3IM9A 2LQBA 1VQMS 5J2QA 4F25A 3I4HX 5HLFA 1R6YA 2VDHA 1DTQB 3BSOA 1IBCB 2W2NP 2O5DA 2DY9A 2DVIA 4DSKA 3D1OA 2RDDA 3TQ1A 3W3SA 2A18A 1B0TA 4ZVSB 1AYEA 1RT7B 5C2GA 4B3RJ 2HHVA 1QUPA 1U7LA 2N82B 4KGVB 2RE1A 1GNKA 4K4YA 3D1HA 2AJ4A 1RAHB 1UETA 3L3CA 3CMAS 4Q7AA 2DHGA 5KFDA 1SUQB 1NJYA 1N33F 4BHQA 1HYSB 3HHDA 5F8HA 1UFLA 4IG0B 2K06A 3EDQB 1WD6A 2XNRA 1U1RA 4TN2A 1FFWB 2MJNA 5BYSA 2BANA 1LW0B 2MMYA 2RVJA 2VHGA 1IR1A 2MSSA 3N5FA 3IAM9 2EFPA 4KHPJ 2AZ3A 1S6UA 2G2OA 1CG2A 4O3NA 3EGVA 2HZVA 3FBCA 2UVRA 3DRPA 3LWLA 1JNZB 5E0OA 3K59A 4OQJA 2ERRA 1X4EA 1DARA 1K1QA 4DFPA 3UNYA 5KFCA 1U0HA 4LMZA 1UFKA 3PXGa 1TAUA 1WEXA 2A0FB 2AYBA 2SXLA 5L1LA 2NREA 1U8WA 3PO5A 3KK2B 2VG6A 4DUYF 4I56A 4FPIA 2ZOMA 3M9NB 2C22A 3F0NA 1OIAA 4KPYA 2J7UA 4TQRA 4ID5B 4FNHA 1IQTA 4LVOP 1LWFA 4CCHA 2OO4A 1DAXA 1XBWA 2HVHA 1N5VA 2KHDA 2IC3A 2ACYA 3M8QB 4F4YA 3N6NA 3CC2S 4RNNA 1RT5A 4FP9A 3DMJB 2B4OA 1R7IA 1MWZA 4JI3J 2FJDB 4O0IA 3OXLA 4PZVA 4PAAA 4EMDA 3L9ZA 1TAQA 4J9RA 2OPSB 2QYGA 3UD3P 4ANEA 1RA6A 2G2ZA 4ZPBA 5HJXA 1TL3A 2JL9A 2JX2A 3QNWB 3P5BP 5E2QA 1RHMB 1VDHA 5KFSA 3IS9B 2YNHA 2W7AA 1TL4A 1D0EA 4JI5F 4ITSA 2MB0B 2OP5A 3DU6A 4URSA 1U1NA 1L3VA 4QWCA 2IRYA 2B8QA 1T9YA 4RW4B 4F4XA 3MM6B 1BQNA 3A1YG 1KHWA 1KVKA 2AQ4A 1GMWD 3KUGA 1YI2S 1PG5B 2FLPA 1CC8A 2CVIA 2RNEA 4EO6A 5HP1A 2O01C 2H5JB 3DNCA 1HNIA 4ELVA 4GKKF 2V2VA 4P73A 1IBMF 1FRXA 5LXYA 5HQMA 3QRRA 3LOUA 3CD7A 3NL0A 2DNRA 1F9FA 1MN9A 2XTJP 1XMOJ 2O67A 4F4ZA 3KLEB 3R5CA 1G6BA 6FDRA 2IM0A 2W25A 4CWBA 5G0RA 3BH6B 2HS4A 1J5OA 3MR3A 1N36J 4CYUB 1TKTB 2FHJD 2Q1LA 4F4AA 4OI2A 5GAHU 1DFDA 2LXFA 5F8IA 4NCAA 2OUGA 4YS2A 1X5OA 2KG1A 3BSCA 3FQLA 4NZ0A 3M9OB 4CT9A 3I87A 1S76D 2LU2A 1HR0F 4YMEA 1RUSA 1X5SA 4WU2A 1U49A 2K7JA 1WC5A 3T5JA 3TAPA 4IR9A 2M2BA 5D77A 4ZVRB 2XCAA 1BGXT 2D3OR 4AXJA 4ED1A 1XJWB 1YVFA 4CO4A 4Q43A 2J7WA 1QM9A 2QFJA 2PMWA 5C25B 3SQGB 3THPA 2QIFA 3JYTB 3JB9k 2UXDJ 1X4CA 2LFVA 2JSXA 2ZH7A 2HVEA 3IWLA 3OLBA 3JSMA 2L3MA 3I96A 1LNQA 1FEEA 3OVSA 2LQ5A 4FXWA 1WC0A 3VZHA 2GVZA 2B9WA 4O3OA 3M8RA 1RTHB 2LU1A 3IAS9 1S1TB 3PJWA 1RBOB 3SQOP 2MKKA 1RWPB 3QIPB 2CQBA 3CJ2A 3MEGB 4NYZA 1UWBB 4KT0C 3AAWB 3DOLB 3I5BA 3R2CJ 2R8GA 4USMA 1G3OA 1OSDA 4IDKB 2XYPB 3W8GA 2ZEJA 4ZCKA 1IN0A 1MU2A 1PJ5A 1TVRB 3OFEA 4CLPA 2W9AA 4MK8A 3J7A1 1NO8A 4MJKA 3O5TB 3Q22A 1KTQA 4DR2J 2DR5A 4CH1A 2DK2A 2YKNA 4ZITA 2Q66A 1SPBP 2BE9B 3CJRA 3PY8A 4DX5A 4X66J 2DRBA 3L4BC 3RB4A 1BLUA 2RJZA 1W7WA 3KOAA 3B4MA 3F56A 3V6KA 4W4MA 1WKJA 4YDDB 3CJ0A 3UI3A 4CLTA 3BGRA 2XWXA 3G6XA 3U1LA 2GMJA 3C3LA 5KT5A 4ZP9A 2BM1A 2YH1A 2DGXA 2XLKA 1FD8A 1HHTP 4KBIA 2CPJA 4J9KA 4W92B 4UOFA 3KLGA 4KR0B 2KL8A 2G0CA 4IQXA 3UCGA 3IR5B 4ETXA 4F7VA 3EUNA 5EHHA 2CQDA 1JB0C 3W9JA 5KFFA 4ED3A 1TKXB 3GFXA
chains in the Genus database with same CATH topology
3CDWA 3IR6B 4I7FA 2XMJA 1U25A 4I6AA 2R9LA 4NLYA 1C1CA 2ZD1A 4OZJA 4LJMA 2XC9A 5IQQA 1YBAA 2PC6A 3M4XA 4F50A 1HPZA 2RKIA 1BQMA 5DS7A 2JEJA 1N5TA 1S1WA 2DTJA 1UP1A 3F73A 1K0TA 4CNZA 3K5LA 1HMVA 2R2UA 2IAJA 1XN9A 3E8OA 4E0DA 2ZZNA 3MUTP 2YY3A 1RKJA 2CQ4A 2A1BA 1VK8A 3GFYA 3VQSA 4DSFA 5MAOA 2J76E 1UAWA 3W2VA 2FVCA 3GMGA 4R5PB 2DCUB 1SL0A 5I3UA 1K73T 1LFWA 1WI6A 3OR2A 4LQ9A 2Y0SD 2FLOA 2W9BA 4BS2A 4LFAF 3BGUA 3FDSA 2Q6CA 2FB0A 4HT5A 3IBWA 4ECXA 2XY7A 1IKYB 1JLEA 4WCEQ 3LP1A 3HJFA 5B0FA 4K0KF 3FMWA 4OZ5A 5KFIA 2KT2A 1Q7YT 3PACA 3ISNC 3V81A 1D9AA 1LFPA 3EPIA 2JOQA 1HNVA 1B7FA 2XMWA 3MMBA 1H2TZ 2KN4A 1KQKA 2HGLA 3DLGA 4QCLA 1HBOA 2EFNA 4EO8A 2FDNA 3IXQA 3ZZPA 2ZJQQ 4C11B 1S1TA 2K2PA 4R8UA 4FBUA 4DDFA 5K8NA 2JVOA 4Y2MA 1GT8A 2QMXA 3TVYA 2GJIA 2R8HA 4LFBF 4B9VA 1YTYA 2XEXA 3QIPA 4X4PA 2EKYA 2GGPB 1GAOA 5L39A 1W2IA 1D8YA 2X1GA 1SL1A 3Q8PB 1KVIA 1UWBA 2MZTA 1N6QB 4R0EA 5B08A 5F3ZA 2ZH8A 1N5YA 4B9MA 2APOA 3O6QA 3GG1A 2GCFA 1KOHA 5K8OA 4JI1F 3JTPA 3MDFA 2F9JA 4FXVA 4YFUA 4C8YA 2ZHOA 5A8RA 3T6JA 4PG6A 4RU9A 2I5JB 1S6OA 2CJBA 3W7BA 3UR0A 1SIZA 1JXLA 3M8SA 3ZZUA 5DLFA 2ZITA 4EU0A 4KHPF 4Q0BB 3CWJA 4A8WA 4M5DA 1SJRA 1S48A 5A6WA 4E8UA 2K7KA 2RRNA 2ZKUA 2C3PA 4J9OA 3SFUA 1D8ZA 2A2DA 3KNGA 3R5BA 3U27A 3I0SA 2AGQA 1YJ9S 2UV8G 1VQ6S 2VODA 5J2PB 3EYZA 1G1XA 1FKPA 4LSLA 2AJ1A 2JDJA 1S72S 4KO0A 5T7LB 2XS2A 2QA1A 5DM7Q 3SSRA 3BQ0A 4I2PB 3KLFA 1VQOS 2R8JA 2E9ZA 4KV8A 4X4QA 1ZAWA 3MR5A 2Z8QA 4B17A 3VAJA 5H1SV 4B3OA 4WF9Q 2CQ0A 2PMZD 1DRZA 1U1LA 1NH7A 4HEA9 4ILMA 5KT3A 2YVSA 1VIOA 3NNCA 3LALA 2MZJA 3FQKA 5I42B 4XK8C 1WF2A 2HHXA 4RLEA 3T9ZA 1HWIA 4RNMA 2QLXA 3NAHA 1J2VA 4UUXA 2B4UA 3H2VE 4ZVFA 1FKOB 5L8RC 5DDOC 1Q86T 3Q2TC 2GHVC 2D9OA 3SYZA 3PX4A 4M94A 3HFKA 4A8OA 3KLHB 2FVRA 3MTJA 2B5JA 5JJBA 2HLTA 2PFFB 5KOXA 2FTRA 5IT4A 2LEBA 2XCPA 3TX8A 5KFQA 2XMVA 1HBNB 2G4BA 2WRMA 5HROB