1UWJA

The complex of mutant v599e b-raf and bay439006.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
276
structure length
264
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATEKSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
publication title Mechanism of Activation of the Raf-Erk Signaling Pathway by Oncogenic Mutations of B-Raf
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 66
structure length 264
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1uwjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1uwjA01
4LRMA 5B2KA 3GU8A 4MD8E 3C1XA 4FIEA 4RA5A 1XJDA 4WT6A 4UMRA 4I4EA 4BDGA 3WF8A 3HRCA 1F0QA 1JPAA 2PVLA 4YTHA 3QQHA 3MWUA 5DEYA 4C59A 5DRDA 3Q4ZA 4DTBA 1PXMA 3C0GA 3FHIA 2VAGA 1G5SA 1U4DA 2GFSA 4B6LA 3HV6A 1SNXA 3GXLA 2WB8A 3DNEA 4XBRA 5IUIA 4PTGA 3MIAA 3SXSA 3SXFA 3VHKA 2GHLA 2IVSA 2HZ4A 4TYIA 2XKFA 2C6MA 3SKCA 4DCEA 3CGFA 4TYJA 4D4RA 5CI6A 4BRXA 2G1TA 3VQUA 4R1VA 3NUSA 3UDBA 5JFXA 4N0SA 5AIRA 3ZC6A 1M2PA 4M69B 4GV1A 5E90A 5K4IA 2BAQA 3E88A 4FSNA 4YJNA 3NZ0A 3EKKA 2G9XA 1K9AA 4L3JA 4USDA 4K18A 3F5XA 4FEQA 4LG4A 5F20A 3NLBA 3PPKA 4IM3A 4AE9A 2GHGA 4W9WA 3MTFA 4WRSA 2H6DA 5EHLA 4E4MA 5FTGA 4FC0A 3TTJA 2OXXA 3IONA 4KIKB 2PMIA 3AD5A 3QZIA 4IDTA 4GIIA 5HTBA 3R9RA 5EYCA 3QU0A 1PKDA 2OF4A 4FZDB 5KMJA 3MA6A 1ZMUA 4NTTA 2VZ6A 2HW6A 3OY1A 4NWMA 5A3XA 3POZA 4FOCA 3OT8A 4LRKA 2XJ0A 5HIBA 3D5UA 3QLGA 4FTLA 2WMAA 3LM5A 2IW6A 4IZAA 4JQ7A 4OBPA 3W8LA 4ZSAA 4E8AA 2YLEA 2NO3A 4G6OA 2JFMA 4KNBA 3TUDA 4B7TA 3AD6A 4C37A 1U54A 4M0YA 3FSFA 4BZDA 3CTQA 3C5IA 4O82A 2IWIA 4WG3A 4CYJA 4C38A 3OUNB 2Y4IC 4Y85A 5HD7A 4G3EA 4FTUA 3UBDA 5IA3A 4PDOA 3KULB 5LXMA 2ITNA 3GFWA 2WTVA 4D1SA 4HVDA 5J9YA 4MAOA 3VF9A 4EQCA 3DPKA 1OIUA 5HIDA 4FZFB 3QCSA 1O6KA 4AA0A 3VJOA 1IAJA 1XHAA 3BGQA 4FEWA 2F57A 4IWOA 3V5LA 2UW4A 2QG5A 1P4OA 4KD1A 4N57A 3F3TA 2XNMA 4XV1A 3IDBA 4FODA 3I5ZA 3UVRA 2HIWA 5HG8A 4F7NA 3E93A 5CSPA 3FLSA 5HZNA 4NJDA 3HKOA 1SM2A 5JT2A 3OY3A 3C13A 4TW9A 3FXWA 3TT0A 5I4NA 4U45A 1OPJA 3MI9A 3E7OA 2X39A 4PMTA 2X81A 4MXAA 4WBOA 4PP7A 4O7VA 4QTDA 1CMKE 4BBEA 2VTJA 3VHEA 2R5TA 3QWKA 4FTIA 5HGIA 2C5YA 3RBWA 3RMFA 4APPA 4XV3A 2QOQA 1VJYA 3F7WA 3GU4A 1TQIA 3OD6X 2QNJA 3G15A 5FM2A 3DKOA 2J0IA 1OL5A 5HORA 1CSNA 2HAKA 4JIKA 3D5WA 1ZMVA 3HDMA 4V01A 1Z57A 5EKOA 1OB3A 4ZTHA 4U7ZA 5K3YA 3RM6A 3CQEA 4EWHA 4XUFA 4PY1A 4RWLA 2YZAA 3FKNA 2VTTA 3I0QA 5GJFA 5HESA 3ZSGA 4F64A 3A4PA 2UW6A 5DYJA 4IVCA 4CZUA 3N9XA 4BCFA 3RAIA 1DAYA 2XNEA 2ETMA 1H0VA 3UC3A 4R3RA 4AGCA 1KV2A 1OL1A 4X2JA 3PY1A 3PY0A 3Q4CA 4OT5A 4M69A 5CEIA 4GVAA 4KKHA 4O0SA 1WBOA 3UTOA 1UNGA 3QL8A 3W55A 2FA2A 4RWJA 3LQ5A 4Z7GA 2EWAA 2BAKA 1Q8WA 3D2IA 2JITA 2B55A 5FBOA 4LQMA 4OTRA 2WTCA 2QOBA 1XBBA 4F1TA 4EK4A 3ACKA 4GFGA 1ZZ2A 5J1VA 2PUNA 1QL6A 3LQ8A 4KIKA 3DT1A 1PXIA 1W0XC 4L45A 3PPZA 4ANOA 5M55A 2JLDA 3UVQA 5HX8A 4AG8A 2VNWA 2QCSA 4X7QA 3PP0A 1OKYA 2R64A 2PE0A 2GCDA 3PXYA 2UZDA 2P33A 3GOPA 4M8TA 2NP8A 4EHGA 3HMIA 3FI2A 1OL6A 2WTDA 3ZEWA 2PZPA 2ITPA 4EOKA 4M12A 4ZOGA 3UG2A 4FIFA 2QHMA 3C4ZA 2WMQA 3U51A 3FZOA 2B9HA 2X9EA 3O8TA 5GHVA 5LMAA 1H1QA 4F0IA 3G51A 1PMVA 2R2PA 3KMWA 5KKRC 3Q6UA 2ITXA 5E8YA 4IZ5A 5J7BA 3NSZA 2VO0A 4ASXA 4DEEA 1LPUA 2C6TA 4EUUA 5A6NA 4G31A 1UKIA 2ZDUA 4RJ7A 4GT3A 3KULA 4ACHA 4BC6A 2CKOA 3QQJA 4F4PA 4GKIA 3RWQA 1LEZA 3M1SA 3RPSA 3QRJA 4BDIA 1JKLA 2OKRA 4FG7A 3DK6A 2VWBA 3QCQA 5HO7A 1WBVA 2QODA 3EQDA 4GJ3A 3EFKA 5HO8A 1MUOA 2WMVA 3NDMA 4RGJA 2VX1A 4MXCA 1Q62A 1JLUE 4Q9SA 4WNMA 5HICA 4EK5A 2FSOX 5HG9A 5JMSA 2PL0A 2RFEA 3ACJA 4JRNA 3TJCA 3ZO4A 5LMKA 3DBEA 4QP2A 4O96A 4OW8A 5E1EA 3TZ8A 3ORZA 3IW8A 3NW7A 3BCEA 2VWUA 3LCTA 4FKGA 3UNKA 2DYLA 4FEVA 2BROA 5D11A 4FX3A 3IW7A 2QLUA 1ZOEA 4CT1A 3MW1A 3KXHA 4D0WA 4KSQA 4OTWA 2RSVA 2XUUA 5IA1A 4EH9A 3OUKA 3OVVA 3PZEA 4X3FB 5HCYA 2X6DA 2QHNA 5KMKA 3ET7A 4O7SA 3DQWA 3UC4A 3EJ1A 2VTSA 5ACKA 3WZUA 4F6SA 3RPRA 4O6LA 5KNJA 3LM0A 4I5HA 3MGYA 2PMNX 2YDIA 4CMOA 2RG5A 3VS3A 1YOLA 2R7BA 4RC2A 3GBZA 3VUGA 4K2RA 4MXXA 4OTGA 3TV4A 3G2FA 4BHNA 4L68A 5FP6A 1DAWA 4XYFA 3RVGA 2UV2A 2RGPA 2XK7A 5ETCA 2E9PA 5FTOA 2ITWA 4KA3A 3RK9A 5CXHA 1GOLA 1VR2A 4JJRA 3IW6A 4BKJA 1NVSA 3PVBA 4YURA 2QLQA 3V6SA 3ZRKA 4CFNA 3AT3A 5I9XA 2BRMA 5IMXA 3EN4A 5CNNA 4FIJA 3FEGA 4FTOA 5HNBA 4O86A 3L9MA 5B2MA 2ERKA 2QR8A 2XK3A 1X8BA 3I60A 5CU2A 1NXKA 5DN3A 3DXQA 2JDTA 2HOGA 1H1RA 3DY7A 3QUEA 5IH5A 3S1HA 1WBWA 2YCSA 3BLHA 4BCHA 3E8EA 1Q61A 3IECA 3KN5A 2X8DA 5GJDA 4WD5A 4YC8A 5KBRA 4DLIA 3I1AA 4F65A 3PG3A 1FINA 3VUHA 1YXUA 3TDWA 2NRUA 2Q0BA 3MVLA 1RW8A 4C4HA 4LV8A 2P55A 1UU9A 3HUBA 4HZSA 4C61A 3A99A 3GC0A 3QA0A 5KX8A 1ZYJA 3R1NA 2PWLA 4ZTLA 2PVYA 3ZEPA 2PUPA 2W9ZB 2ZAZA 4FKLA 3QF9A 4KINA 2GTMA 2EXEA 1OPLA 3FZPA 1OL7A 5FDXA 3JUHA 5DR6A 3W2SA 2B9JA 4AW0A 4G16A 2R3KA 3A8WA 2YIXA 2CCHA 5HLWA 3DB6A 2VTLA 3PJ2A 4LV5A 4U5JA 5C8MA 4AAAA 3PPJA 2C6IA 4U41A 5ACBC 3H0YA 1WVXA 3EQHA 4EBWA 3T9TA 4DINA 3B8QA 2O3PA 2W1CA 5C01A 3UJGA 4EH4A 4I0SA 5JGDA 3ZUVA 2PMLX 3GQIA 5HE2A 3R7VA 4PWNA 4FICA 4FSYA 3WF9A 1E9HA 4LMUA 4BTJA 4AN2A 2ZOQA 2YABA 2JIIA 4G3DA 1HCKA 4DH1A 2HWOA 3O96A 2WO6A 3QQGA 3FSKA 4L42A 4TWPA 5E91A 3R9NA 1B39A 2YN8A 3WYYA 2A4LA 3HMPA 3FI8A 1JSUA 4YSJA 4CQEA 3NUYA 4Q5HA 1H08A 2ITZA 2ZM1A 3GU5A 4G9CA 4YJTA 4MNEB 2OF2A 1YWVA 3BLQA 1PXKA 4FG9A 3PXKA 5FM3A 4K8AA 3RAKA 4D58A 5AUTA 3U9NA 3MESA 3A7JA 3FZ1A 4WNOA 3W2PA 4AGWA 3SAYA 4IB1A 4DYMA 4Z16A 4RZWA 3O50A 4FBXA 4DTKA 3BRBA 3RP9A 4JRVA 4XX9A 2XVDA 4X3FA 3PP1A 4FI1A 1PXJA 1SMHA 3QHRA 3R00A 3PWYA 1XQZA 2H34A 3ZU7A 4E1ZA 4XLIA 4N6ZA 4NCTC 3WZEA 5GZAA 4ENYA 5EK7A 2HXLA 5CSXA 3C4CA 2B9IA 4ZSEA 5IUGA 3QUPA 4CG9A 5I9VA 4BI0A 4I24A 5H2UA 5EQPA 3B8RA 5E8XA 1UKHA 4TYGA 3SA0A 4ORKA 4CFVA 5F9EA 3K5UA 4G6LA 3MY1A 4TYHB 1M7QA 2WXVA 1JSTA 1NY3A 4L00A 4DBXA 1YXTA 3Q9YA 3ZSHA 2DWBA 3KMUA 4EL9A 2YCRA 3Q32A 4FVQA 4J53A 2E2BA 4FYOA 3O23A 1H07A 4QOXA 4JS8A 3VUDA 3SG9A 3F5UA 3HUCA 2BMCA 5EQYA 5K0XA 3AG9A 3QZHA 4JQ8A 3GI3A 3HRFA 3W2OA 2WIHA 3ORLA 3COHA 4XJ0A 4OTDA 2CDZA 4QTCA 1KV1A 1TKIA 2PU8A 4ALWA 4D2SA 4AU8A 4C35A 4E93A 2CNUA 4C4GA 2PVJA 3FMKA 2R3NA 4OR5A 4YMJA 5H3QA 2W0JA 3MH0A 3BHHA 3A7GA 3HL7A 3UOKA 4GK2A 3ORXA 4H3QA 3KKVA 2JBPA 4KIOA 3C0HA 4IACA 3UQGA 5IDPA 5LJJA 1T45A 4RFMA 4AA5A 3CD8A 3DFAA 3PVWA 3BPRA 3LAUA 1WBNA 2DUVA 3PA3A 3R8VA 4NW5A 3BEGA 4GW8A 2YIYA 3W1FA 2B9FA 2ONLC 4NM0A 2CJMA 3EZRA 3QTSA 3G5DA 4XRLA 4TZRA 4HJOA 4KWPA 4BDJA 5HI2A 3RGFA 4MNFA 5CY3A 2YFXA 5HCXA 4AZWA 5L2IA 3FL5A 2WTIA 5IA0A 2IPXA 4EZ7A 3HMNA 5AAGA 3FMHA 4HOKA 4AA4A 4XG7A 5L6WL 2WEVA 4NIFB 3OTVA 4Y95A 3BBWA 5FEDA 3ZBXA 2HZIA 1OIYA 2PVKA 4AN9A 3GVUA 3QD2B 4CXAA 2UZUE 2W1HA 3EQGA 3N4VA 3PRIA 4PPAA 3OZ6A 3UNJA 3PA4A 4EZ3A 3VS7A 5BYZA 5L8KA 4H36A 1JWHA 2IO6A 3NCGA 4QTBA 4XLVA 5AP0A 2HY81 1PXNA 5IQHA 2OIQA 4AZSA 3L8VA 3VS4A 3UMWA 3PY3A 5C8NA 4R7HA 3PLSA 1ZRZA 4O0WA 4MNEA 4PMMA 2XNBA 4YPSA 2UW0A 4ZSLA 4BWXA 2ZV2A 1BKXA 5BMSA 3W33A 4DH7A 2BZKB 3LXNA 3R8LA 3IDCA 2IZUA 4RWKA 4MBIA 5BUIA 2C6EA 5T68A 4OTPA 4KSPA 2CKEA 3I79A 5AP6A 2C4GA 1J1BA 4O1OA 1YHSA 3D14A 5LWMA 3IS5A 4XOYA 3RK7A 4JBQA 3NIEA 3NPCA 3U4UA 3TEIA 4Q5EA 3FKLA 3UE4A 3DQXA 3FY2A 3BU6A 3Q9XA 3ALOA 3UIXA 2OGVA 4DEGA 4DN5A 3WF7A 2YAKA 1Q3DA 4R78A 3G90X 2I0YA 5TT7A 1I09A 3OBGA 5EOLA 2UW9A 3LXPA 2OJIA 3DAKA 3UIUA 5EW3A 4TYHA 4ZJIA 4GEOA 4ZZNA 2X7GA 4ZZMA 3EKNA 5CT7A 3QALE 1KE5A 4M13A 3OCGA 2WFYA 3R73A 2OWBA 2F2CB 4ANMA 3MPAA 3EYGA 4PMSA 4EQUA 2OXDA 1ZYSA 2ZVAA 4EH6A 2XM9A 2CN5A 2CSNA 3GB2A 3H3CA 5CYIA 5FXSA 3VUIA 3QKLA 4CFXA 4UYAA 4GFOA 3Q53A 3FC2A 4IZ7A 5BMMA 5A9UA 3ATTA 5E1SA 3TZMA 4BDEA 4WRGA 5AA9A 5BVDA 3OEZA 4TTHB 5B7VA 4L67A 3GCUA 2JD5A 2W1DA 2B1PA 4XP0A 3NIZA 3FYKX 3H4JA 4J95A 4ZSGA 4DA5A 2CGUA 4IX3A 5CVFA 4D2WA 5AP3A 3ZHPC 1Q97A 5DI1A 2VWZA 4LRJA 4EBVA 4UY9A 1O6YA 4N70A 4FSWA 1WAKA 2W4OA 3L8XA 3PIYA 5BVNA 1Y8YA 2X9FA 2YLFA 3VBYA 3GCSA 5EDRA 3QX4A 2C3IB 4A7CA 5M44A 4G9RA 5BUEA 2CGWA 2F4JA 2VTRA 4CCBA 4UMQA 4NJ3A 4E5BA 2F9GA 4FTAA 3RPYA 5AM7A 2CMWA 4BKYA 4S2ZA 4ASDA 1QPEA 5LVLA 4E4LA 5J9ZA 5IUHA 2UW7A 3R0TA 1GZOA 3TM0A 4I92A 1WVWA 4F9AA 1FGKA 1FQ1B 4MF1A 4QT1A 2WELA 1ATPE 3HZTA 1YI3A 5AUZA 3UIMA 4DFXE 1H26A 4IEBA 4EHEA 1S9IA 4XH6A 3UIBA 4NIFA 3R1QA 3SX9A 1TVOA 4OTHA 2HZ0A 1XWSA 4A9UA 4DEBA 2W5HA 4BYIA 2C3JA 1HOWA 4LOOA 4C3PA 4EKKA 2ZB1A 4F08A 5K5XA 4M66A 3A7FA 1M2QA 5C03A 4CMUA 4USFA 4YBJA 4CFFA 3TL8A 3VS0A 4QQJA 1Y57A 3LLTA 1APME 3QFVA 5DH3A 3A2CA 4O2PA 4AACA 5C27A 1YWNA 4HW7A 1FVRA 2R3PA 5CVGA 2QOIA 3G33A 4J96A 4JT3A 4QD6A 5ANDA 3F82A 4APCA 2YDJA 4BTMA 2GS2A 3M11A 3PSDA 3SRVB 1MQ4A 3VBTA 1RDQE 4FTTA 4O0TA 4KS7A 3Q60A 3S2PA 4C34A 2OZAB 3QRIA 4HNIA 4UN0C 3KRRA 3QAME 5KHXA 2YWVA 3LFFA 2XKCA 1R39A 3EN5A 3NNXA 4QQCA 4O6EA 2B52A 3VAPA 2XB7A 5CU6A 2G01A 4LGDA 4Z55A 2RKUA 3A4OX 1JVPP 2C1BA 3CJFA 3OCTA 3TWJA 5M4FA 2IJMA 4CLIA 5M53A 2YM5A 3BYSA 5L2WA 3WF5A 3UQFA 2RG6A 3T9IA 4ARKA 2H96A 1UWJA 3BYMA 5DFPA 5DGZA 3ZMMA 3ZFMA 2JBOA 5J79A 3HAVA 4FEUA 4O81A 4ZLYA 3BELA 5CEKA 5AUYA 2Z8CA 1W8CA 3ORPA 3QYZA 1E1XA 4KABA 4NM5A 1ZLTA 2XCHA 3ZC5A 4AW2A 1PHKA 2EXCX 5IISA 3OF0A 2I0VA 2Y0AA 2C0TA 2VX0A 4DEAA 4FV9A 2Y6MA 1BX6A 1UNLA 2C68A 1G8SA 2QOHA 3U55A 2IVTA 4GSBA 4YZDA 4EKLA 4I5MA 1FPUA 2ZV7A 5CF4A 3JR1A 5DT0A 4BCIA 4CSVA 5AFVA 4IC7A 4MQ2A 4FV7A 4JDIA 4PUZA 4TPTA 3R8ZA 3SW7A 3R1YA 4O0XA 5D9HA 3G6GA 4QQ5A 3OW4A 4FV4A 2C1AA 4RFYA 4RT7A 5B0XA 3VBVA 3F7ZA 2WOUA 3EH9A 1GIIA 2X1NA 5IMEA 3QKMA 3FY0A 4IWQA 4FG8A 1GZKA 2JEDA 3CC6A 2YA9A 5IQIA 4ZMEA 4W4VA 5IEVA 1GJOA 2J90A 1GY3A 3BQRA 4YJPA 3QD3A 5FD2A 2XZSA 2ZJWA 2PY3A 1IG1A 3DXNA 3GUBA 4EEVA 4QP1A 2WEIA 4RSSA 5IH4A 4C2WA 4F9WA 4IWDA 3U6IA 4QPMA 3P1AA 3Q2MA 4W8DA 4MVFA 4QO9A 4M7IA 3KQ7A 3C0IA 5JZNA 2OK1A 3ORIA 4YHTA 4G3CA 5CT0A 2A19B 3OXTA 3P5KA 1PRYA 4Y73A 1FGIA 4FTQA 5AUXA 3D0EA 5IU2A 4EOQA 1QPDA 2YJRA 4XEYA 5DIAA 4FTJA 4KB8A 5D12A 4FE2A 5BYLA 4EC8A 4P5ZA 5JGAA 3RHKA 2YDKA 3DBFA 5L8LA 3D7TB 4Y8DA 1RE8A 5AA8A 1PMEA 2QU6A 2JFLA 2ZMDA 5EW8A 2UUEA 3VJNA 2OW3A 3E7VA 3AGMA 3KFAA 5HG7A 4OGRA 4CKRA 1JKTA 2YCFA 4J7BA 4HPUE 4HGTA 2Y8OA 4PDPA 1YXXA 5CF6A 5J8IA 2X7FA 2HZNA 2V7OA 2F7EE 3FC1X 4IE9A 2GS7A 4IBMA 1Q41A 2QO2A 3PXRA 5BUJA 2OJGA 3OWKA 2FSTX 3RHXA 2FSMX 3IOPA 5CTPA 5CQWA 1YXVA 4AOJA 5HX6A 3BX5A 5HLNA 5BVFA 4RVKA 3AC8A 4GKHA 4RJ5A 1YRPA 2IZRA 5KMMA 4HVHA 3QLFA 3QZFA 3D15A 4BDFA 5A4QA 4FZAB 2P3GX 4B4LA 5KMIA 3GCPA 4WSYA 5AJQA 3F3VA 5LVNA 2BKZA 2EVAA 4DHFA 3QTXA 3TUBA 4ZY5A 4NT4A 4YLKA 3HMMA 4I0TA 4IFGA 3RPOA 5KBQA 1YVJA 2C30A 3HYHA 4CFMA 4GU9A 5BNJA 2XJ2A 5EQEA 1AD5A 3SRVA 3VBQA 3HA6A 4DITA 3KA0A 3PE2A 3AC2A 4IM2A 2QR7A 4RLKA 1YXSA 3RAHA 2XJ1A 4XG9A 2OZAA 2R3GA 4RIYA 3H30A 4JR7A 3W16A 4CYIA 5FGKA 5F1ZA 4K0YA 1CDKA 3CBLA 1KWPA 3C4EA 4HVIA 1PYEA 4KRCA 4FT3A 4BB4A 2BFYA 5KHWA 2P4IA 3GFEA 5DBXA 4A07A 2AYPA 3MA3A 1OMWA 4BCKA 3MPMA 3CQUA 3SDJA 4Y83A 2Y9QA 2J5FA 3QXOA 4FA2A 4FTNA 3TACA 4CTBA 3F69A 4E5AX 5C1QB 4JX7A 5FXQA 4JG8A 3EHAA 3C5UA 4EQMA 3VIDA 3O17A 2CHLA 4KKGA 1QCFA 2WMWA 2QOCA 3QQFA 4OTIA 3E3BX 1V0BA 2R3LA 3R9DA 4R77A 3UO6A 2OJJA 3HAMA 4D1ZA 4QMNA 2VTNA 2I0HA 4BGGA 5IZFA 4FGBA 4AT3A 3O7LB 3MH2A 1OECA 3LFCA 4JBOA 4G5PA 1CM8A 4MX9A 3GP0A 3WBLA 4N6YA 4FIHA 3GC8A 2X8IA 4RWIA 2XEYA 2GNFA 2YISA 2FO0A 4O0VA 1OVEA 5JQ5A 4B9DA 4U40A 5EOBA 1JBPE 5AR4A 4FKQA 4ERWA 3G6HA 3DTCA 3I0OA 3UYSA 4HYHA 1F5QA 4BCNA 4DFBA 4IB3A 5M07A 3ZLSA 2V0DA 1Z5MA 1H00A 2PZYA 2H9VA 3ORKA 4NK9A 4M15A 4QPSA 5AR3A 1ZAOA 4HYUA 4F09A 5J95A 5HVKA 2FVDA 4J71A 1OBDA 3LMHA 5M09A 3AMYA 3PE1A 4B0GA 3LOKA 4K33A 2GNHA 4UEUA 4YZNA 3I4BA 5D7VA 4F99A 4YHFA 4HCTA 4NKAA 5IQDA 3E8DA 4W9XA 2PYWA 5FTQA 2IZTA 1V1KA 4V05A 2PUUA 4ZJVA 4BGQA 1XH9A 4BY9E 4U43A 4E26A 5LVMA 4FTRA 3MDYA 5ANGA 2YACA 1ZOGA 4RVMA 4BL1A 4DT9A 3T8OA 1BI8A 2ZYBA 3D7TA 2R7IA 3MS9A 3QQKA 5HVYA 4LOQA 3TI1A 2IVVA 2J0JA 4GUBA 4C4JA 1Y6AA 4BGHA 2BVAA 3KK8A 5FP5A 3R7OA 3P7BA 2P2HA 4F0GA 4IB0A 3NW5A 2O64A 2ZV9A 1OKVA 4RQVA 3LXKA 5LVOA 3LFAA 4FTCA 3DJ6A 3OEFX 5TE0A 3SC1A 1Z9XA 2OU7A 3EL8A 1BLXA 5EHYA 2PE2A 4FSTA 3MJ1A 4RC4A 4K11A 2OXYA 3NRMA 5CF5A 2HY0A 4GK3A 4QQTA 4I41A 4IB5A 4K6ZA 5AAEA 4PMPA 4HNFA 4RLLA 4ASZA 5JQ8A 3OS3A 4I5PA 4XBUA 3BHTA 3KY2A 3F9NA 1PXOA 5FQDC 2XK4A 4CFUA 1Y6BA 5C8KA 4RQKA 3ITZA 5IPJA 1WBSA 3WIGA 4DF3A 3D7ZA 3FE3A 3NUXA 4P90A 3D5VA 5HTIA 5IEXA 3LVPA 4UWBA 3FYJX 4WIHA 3WE4A 2XYUA 3GNIB 3R6XA 1OKZA 1YI6A 1P4FA 4ID7A 4QP6A 4O7LA 2UZLA 3HGKA 5DT3A 5D10A 3VS5A 4O7NA 2EUFB 4HZRA 3FAAA 2PVNA 4DG2E 5D41A 4D5HA 1Q3WA 4O22A 3SG8A 4KS8A 1JQHA 4HVSA 4O0RA 4YO4A 5DA3A 2QI8A 3W2CA 3FLNC 3L9PA 3P7CA 4UZDA 4WBBB 3R9HA 2BR1A 3QTRA 2W06A 2XNPA 1UV5A 1PMNA 3ROYA 2GQRA 3ZDUA 5ETFA 4I4FA 3WIKA 4WG5A 4AOTA 3V5JA 4DAWA 2V5QA 3BV3A 5EYDA 4NZWB 2VN9A 3KB7A 4ERKA 5CQUA 2QURA 3MSSA 3AC4A 3QD0A 3A7IA 3EMGA 2C5XA 3EFJA 4C4EA 2WHBA 4GG7A 2C3LA 3TTIA 3ALNA 3Q4TA 4L7SA 4MF0A 5E8UA 4BCJA 2JGZA 4JLCA 2W7XA 3G0EA 5IG1A 3BHUA 3E87A 2SRCA 3L8PA 3UMXA 4XHKB 3QTZA 5J9LA 2GPHA 5IQBA 1H1SA 3DNDA 4FSZA 2PHKA 4JVGA 3RCJA 2E9NA 2F7ZE 3FBVA 5TR6A 1BMKA 4FTKA 3L1SA 4IJ9A 2PE1A 4QP4A 3WE8A 2VD5A 5AP2A 4YR8A 1QPCA 3U4WA 3VW6A 5M51A 3BE2A 1Q8YA 4WNKA 3W10A 4CKJA 3TIZA 3MJ2A 4GT5A 2Z60A 3D94A 4XG2A 2W4JA 3R8UA 3VNTA 4C62A 2P2IA 2XYNA 5E4HA 4YTCA 2PZ5A 1H0WA 3FMNA 5AR2A 5HEZA 4FTMA 4EH8A 4LUEA 3E63A 4S33A 5AWMA 3O8UA 3BU5A 4G2FA 1LP4A 4XRJA 3UVPA 2ZV8A 3FMLA 3R8PA 3EQBA 1PXLA 5T6KA 4ZTRA 4E6QA 4PP9A 4XP3A 5CEPA 1AQ1A 4F9YA 4EK6A 5DOSA 4IVBA 1NVQA 4YO6A 5EM8A 3AOXA 4C8BA 3DXPA 3D5XA 1ERKA 4MEDA 4JG7A 4ZTSA 4EOPA 4O38A 4FKUA 4I22A 4IFCA 2ITYA 2LGCA 3ZZEA 5DG5A 1OZ1A 3VUKA 5E92A 4FK6A 3F6XA 3C50A 1K2PA 3BYUA 4I6FA 5H8GA 5HBEA 5HIEA 2ITTA 4FF8A 3A62A 4ZS0A 4I21A 4PX6A 3BV2A 3OP5A 5F4NA 4XNEA 3ZM9A 3HECA 3IO7A 5HKMA 3EQRA 1DM2A 4F7JA 5CAQA 3TNHA 4BZOA 4DGNA 4R7BA 4O7ZA 2YAAA 3P7AA 3QQLA 4FR4A 2YEXA 4H1MA 5EI2A 4PNIA 5DR2A 3SVVA 2OIDA 4QYGA 3PSCA 1MQBA 3MVMA 3NW6A 3QYWA 5BVEA 2J51A 5M08A 5CI7A 4O7TA 2W5BA 2NNWB 3LMIA 4CV9A 3EFWA 3IPHA 4I3ZA 4UMPA 1YDTE 2W9FB 3K2LA 3OCSA 2R3MA 3BIZA 2G2IA 3D83A 4ZLOA 1H25A 3LLAA 3LCDA 2O8YA 5AUWA 5BVKA 4C58A 4ZMFA 3CTJA 2JC6A 4IADA 4WNPA 4IAKA 1JKKA 2XA4A 5DHJA 2YCQA 5KCVA 4QYEA 3UODA 4CD0A 4N4SA 3PVUA 4AT5A 2QO9A 5EI6A 5IA2A 2HWPA 3VUMA 2RIOA 2XBAA 5GIPE 4QP7A 4H05A 1J91A 3PJ1A 4QYHA 1YDSE 2OZOA 5C26A 2WQBA 3SOAA 1FVVA 3IK3A 4NCTA 3CR0A 4FVPA 4RJ6A 4BI2A 5H8EA 3GEQA 3ZH8A 5KUPA 1DS5A 3PJ8A 4RIOA 5J87A 5A4LA 3ZLXA 3NVKI 2ETKA 3EWHA 2R0IA 3CD3A 3FMMA 3THBA 5AEPA 5LOHA 1NT2A 4DE4A 4QP9A 4XP2A 1TQMA 4TL0A 4A9SA 4FKSA 5J5SA 2C69A 1CKPA 4IX6A 2P0CA 3GU7A 4FT7A 4D9UA 5DMZA 2A0CX 2OJ9A 4ANBA 3OT3A 2QD9A 5BPYA 1YOJA 4U81A 2A2AA 3KVWA 4LI5A 3RJCA 2LAVA 3FL4A 1YI4A 2JDSA 3UOJA 3Q4UA 3MPTA 3COIA 4AZVA 4BBMA 4D9TA 1SVHA 3A60A 4DBNA 4FKJA 3KMMA 4JBPA 4FSQA 3KREA 2J9MA 4E5WA 2VTHA 4IHPA 3EQPA 3JVRA 4BCPA 3ZRMA 3F61A 3KCFA 5HCZA 3PA5A 1ZY4A 3F88A 3R2BA 4DFLA 3UPZA 3ORTA 2R4BA 1WMKA 3PTGA 4U3YA 2YZLA 4ZS4A 2YM6A 3FMDA 4RBLA 4F7SA 3LE6A 4GVJA 3O0GA 3ZBFA 3HV3A 1VYWA 3R7GA 4FNXA 5ITAA 2CKQA 5DWRA 5M4UA 5HNIX 3BYVA 4NYEA 4FKOA 4EOLA 1PMUA 3D2KA 3PXQA 3AT4A 3FUPA 2R3IA 3TNQB 4PPBA 2I40A 3ZXTA 2Z7LA 4UYNA 3I6WA 3KXXA 3P9JA 4AP7A 3QTIA 4QYFA 2BRNA 3R2YA 4EH5A 2YM8A 4EOSA 4Q9ZA 1XH5A 4YTFA 5JN2A 2XIRA 1R0PA 5BYYA 2PVFA 5HE0A 3ZFXA 2NPQA 5ANIA 1QMZA 2W17A 2WIPA 4DGGA 2JKQA 4U8ZA 3UQCA 4EH2A 4JQEA 3MBLA 3V6RA 4L7FA 4XS2A 3ENMA 3W8QA 3DZQA 1XBAA 5FXRA 1J1CA 4Y5HA 1CKJA 4IW0A 4IAIA 3G9LX 5DLSA 4I23A 4NW6A 1DI8A 4CVAA 3LFBA 1A48A 3BU3A 1S9JA 5LQFA 2GTNA 3TV7A 3ETAA 3VS2A 4JL9A 3ID6C 4KAOA 4L46A 4BI1A 3F5PA 1Q8TA 4GL9A 4RMZA 3TKUA 2CLXA 3GGFA 4YZBA 3L9LA 3FLWA 4XG8A 4WOVA 3EQIA 2EU9A 2YM3A 3E64A 4TWCA 3ZYAA 5HD4A 3WZKA 2R3RA 2V22A 4NFNA 1PY5A 3BZ3A 4G3GA 3EN7A 3GT8A 3Q04A 4KIPA 3O8PA 4QYYA 1OKWA 2YITA 3FJQE 4OLIA 4X2FA 4Y46A 4Y72A 5ANKA 2O2UA 1W83A 3PSBA 1SNUA 2FB8A 5LARA 4RX5A 5AV2A 3S0OA 1WFCA 4BTKA 4BWPA 3ERKA 4NKSA 4TNDA 2OICA 1U46A 3R02A 4FV5A 4UXLA 3VO3A 3DGKA 2VGPA 2NRYA 4RVTA 3LJ1A 3DCVA 4CZYB 5CU4A 2ITVA 1KOBA 3QHWA 4CTCA 3QXPA 3DA6A 4P5QA 3N4TA 4KUJA 4S32A 1I44A 4QMSA 4CGAA 3PDTA 4ZXTA 5J1WA 1F3MC 3MVHA 3R21A 3CKXA 5LCJA 3DV3A 4FKVA 4LOPA 5IH6A 3R28A 5A46A 4G17A 4PL3A 4CLJA 4L44A 4G3FA 3VBWA 4DFNA 3KK9A 3M2WA 3QCXA 2BZHB 4YHJA 3R83A 3UO4A 3MVJA 5IQCA 2VTPA 2Z7QA 5ANEA 5GIOE 1OGUA 4YJUA 4R5YA 1IR3A 3FLQA 3ATSA 4EK3A 4MTAA 3UZTA 2WMTA 4TT7A 2C0OA 2GSFA 3DDQA 4UALA 4X0MA 4BHZA 2Y4PA 4YJSA 1B6CB 4QMZA 4UZHA 5AV3A 4I5CA 1SZMA 3CLYA 4U42A 4OUCA 4HGEA 1P14A 2E9OA 2YIQA 1PKGA 3ELJA 5HE1A 4FUYA 4DEHA 4DGMA 4NU1A 4YSMA 3A61A 3RCDA 3BGPA 4BDKA 2UZBA 3DTWA 4LMNA 4XV9A 2CNQA 4BDCA 4A06A 4M14A 5JEBA 1OM1A 4YBKA 4GYIA 4GYGA 4E20A 3CPBA 4M3QA 2X8EA 4NM7A 4AFJA 3O71A 2XK9A 4ONAA 2ITOA 2R0UA 4ALUA 3OWPA 3E62A 4AWIA 4X6QC 2I0EA 4DG0E 3C7QA 4OTQA 3WI6A 2XP2A 3GQLA 2UVXA 4AZEA 2XNOA 3BGZA 5E8SA 1ZMWA 4K9YA 2PVHA 4GRBA 4QP8A 3PUPA 3UYTA 3MV5A 4MXYA 5CU3A 5DEWA 2GQSA 4DT8A 4O21A 1B38A 1TQPA 4FUXA 3TNIA 3ZZWA 2BFXA 5DT4A 4GH2A 4ZZOA 4YNEA 4ITIA 5L6PA 4BWKA 4USEA 3LPBA 1WVYA 4HCUA 3QRKA 4Y5QA 3O51A 2R3FA 4PDYA 3UPXA 2JKKA 1M52A 2BZJA 2F49A 2Y4IB 4YGAA 4FIIA 2CCIA 3MYGA 4DEIA 3MH1A 2HYYA 3R04A 5AP5A 5AUVA 3FXZA 4O84A 4FKPA 2QOLA 4IC8A 5KZIA 3RTPA 4FL1A 4OBOA 1G3NA 1J3HA 5DPVA 3QRUA 4W4WA 3UZRA 3EL7A 4P7EA 3RZBA 3C4FA 2C6OA 4FEXA 2JKMA 3PIZA 1AGWA 2BIYA 4IVDA 3FMEA 3DKGA 3DKFA 4S30A 5GNKA 4CNHA 4F1MA 5FDPA 5A6OA 3IGGA 2XS0A 4BR3A 4YLJA 1KE9A 2JAMA 2GNGA 3S95A 5HLPA 3K5VA 4DC2A 4GG5A 3R01A 1OITA 4KBKA 2V7AA 1PW2A 3FZSA 2REIA 5CEMA 1GIHA 1Q4LA 3Q5IA 4J97A 2DS1A 4EYMA 3HV7A 5KMNA 3F2RA 1GZ8A 1NVRA 3AD4A 3LHJA 3TZ9A 5AV4A 4RJ3A 4IZYA 3H9FA 4AS0A 3BBTB 4OTFA 2C6LA 4FL2A 5CX9A 1BYGA 3V8SA 1EH4A 1Q99A 4FSRA 3I7BA 4YP8A 5H9BA 3KRWA 4RIYB 5C4LA 2BDWA 2GHMA 3LJ0A 4L9IA 3HP2A 5A4CA 4ACMA 2PTKA 3OTUA 3HP5A 3DFCB 2BRBA 2ESMA 4IAAA 4GJ2A 4IJPA 4LM5A 5T3QA 3R7EA 2EB3A 4Z3VA 3MFRA 2VTIA 5TKDA 3BLRA 3R22A 1FMKA 2IZSA 3K3IA 4NM3A 3BI6A 2VWIA 2WQOA 4FV6A 3HV5A 5FG8A 3SV0A 4OT6A 3G9NA 4YNOA 3F66A 5AX9A 4ACCA 3F3ZA 2XBJA 3E8CA 3A7HA 3BHYA 1UU7A 3LFNA 4TKSA 1REKA 4UWYA 4CT2A 5JZJA 3QC9A 2UZNA 3KXGA 1H24A 3C9WA 3CKWA 4R1YA 3K3JA 5L6OA 3NYVA 1UA2A 4ZTMA 3P79A 3HDNA 3RM7A 1M17A 5CLPA 4J99A 5M4IA 4U3ZA 3VULA 3KRLA 4BZNA 3DJ7A 1J7LA 4JOAA 2RFSA 2J50A 1OUYA 2WTWA 2WTKC 3F3WA 3QD4A 3SOCA 4AOIA 3VRZA 3FLZA 1JNKA 4FT9A 5HU9A 5BQ0A 4FVRA 3Q52A 3FHRA 4M84A 3P86A 4JIAA 4MKCA 3P0MA 2QU5A 2FUMA 4X2NA 4XG4A 2XF0A 3AT2A 4PNKA 3KXNA 4QMYA 2Z7SA 4BBFA 2O0UA 2QVSE 5DE2A 3ANQA 2EB2A 4YPDA 3OW3A 4A4OA 1ZYLA 4JAJA 1KE6A 1UVRA 2J4ZA 3PRFA 3SXRA 2GU8A 4L01A 4L43A 3ZS5A 2YM7A 3RALA 5CXZA 3KL8A 3LMGA 4ZSJA 2HCKA 1IRKA 2BAJA 3R71A 4PDSA 3FXXA 3DBDA 2QONA 4BDHA 4UMUA 4EUTA 3MB6A 4FNYA 4E6CA 2PK9A 4AUAA 3FZTA 4EK8A 2GNLA 2XKEA 4HCVA 2QQ7A 2XIZA 1H1PA 4C57A 4WUAA 4EH3A 5KKRB 4PQNA 4F70A 2VWYA 3KF4A 2WOTA 3IGOA 3MIYA 3V5QA 1W98A 4H58A 5JFWA 2C6KA 4CG8A 5AP1A 4GT4A 1XH6A 4IX5A 5AP7A 5M57A 5JFVA 3G0FA 3ZUUA 4TWNA 3KCKA 4TRLA 4G5JA 2VO3A 3ZDIA 5KMLA 5EDPA 2Z02A 4P2KA 3ZRLA 1LEWA 3QCYA 3AMAA 3OFMA 3EOCA 3E92A 4S34A 5C4KA 3RPVA 5FEQA 4CMTA 2WMXA 4GMYA 2VO6A 4FOBA 2J5EA 4HYSA 4RX7A 3OWLA 2J0MB 3VW8A 4AZTA 5FLFA 1P5EA 5JKGA 2VU3A 3NYNA 5D1JA 4L8MA 4QMOA 3VS1A 5A4TA 5JRQA 4DH3A 4IAYA 1RJBA 3MFTA 5FEEA 4DFUA 2G2FA 1YWRA 3TNWA 5J5TA 3W18A 2BIKB 5JRSA 3F3UA 1FOTA 3OOGA 2X2KA 1ZZLA 3I6UA 4MQ1A 1IAHA 4O7WA 3K54A 3NUNA 5HU3A 4I6BA 3QC4A 4ITHA 1YHWA 5EM7A 3KC3A 1ZXEA 5J7HA 4TXCA 5E8WA 3TXOA 4G34A 2PMOX 4JAIA 3AMBA 4IANA 1BUHA 3CJGA 3U8WA 2IG7A 3V8TA 3O2MA 4HGSA 5AADA 2B54A 4EHVA 5KZ0A 1V0PA 1XBCA 3A8XA 4EOOA 3EZVA 1V0OA 3JY0A 3OWJA 1PXPA 3NX8A 4C3RA 4EORA 4O0UA 5A14A 5KE0A 4IDVA 1Q5KA 2WTJA 4DCAA 2J2IB 2JDVA 2Y7JA 3DZOA 2RFNA 2G15A 2WAJA 3NNVA 4A9YA 5I0BA 3PLAE 3EYHA 3H0ZA 3W32A 1ZY5A 2O65A 3CEKA 3PXZA 4EH7A 2YWPA 3KU2A 3PWDA 4FKTA 2IW8A 2GS6A 1STCE 2VO7A 1Q8UA 3GCQA 4R3PA 2HW7A 2W96B 3ZONA 3DJ5A 4L52A 5CEOA 2I7QA 3PZHA 1XR1A 5I9UA 5JGBA 4IX4A 2QO7A 2WU6A 3LFQA 1JOWB 4BYJA 5ICPA 2B4SB 4IWPA 2WPAA 3TN8A 4Q2AA 1CTPE 5IKWA 2WQEA 4BDBA 3QWJA 2YHVA 2E9VA 3DOGA 2V62A 3VS6A 2Q83A 2VWXA 3OCBA 5F95A 4J98A 2OH4A 3AC1A 3CGOA 3NS9A 2CKPA 2XK6A 2F2UA 3TIYA 3DK3A 3D4QA 2OJFE 4A4LA 2UZTA 4QMQA 3TKIA 4BKZA 2JAVA 4MD9E 2C5OA 2GDOA 5CSHA 2X2MA 4NL0A 5BX0A 5CNOA 3VC4A 5EKNA 3CTHA 2VUWA 3ORMA 3ANRA 1L3RE 4KBAA 1PYXA 4LL0A 4BTFA 3BE9A 4O7RA 4J1RA 2X0GA 1MP8A 1CKIA 3UG1A 4E4XA 3LQ3A 3TCPA 3HEGA 4M0ZA 3L8SA 4ENXA 4QNYA 4CRSA 3DAJA 2VTMA 1M2RA 3UNZA 5K9IA 2ZMCA 4AF3A 4MWHA 3WOWA 3EN6A 2YJSA 4I20A 1KE8A 4JDKA 4NTSA 4BN1A 4KRDA 2RF9A 4O27B 3AC3A 1FBNA 5EM5A 4ANQA 3EN9A 4B8LA 4EOMA 2AUHA 4PPCA 4DFYA 4E6AA 3GC7A 5EYKA 2X4ZA 3II5A 4R6VA 3NWWA 1R3CA 5HBHA 5AV0A 2BHHA 2W05A 3LCSA 3QX2A 4AFEA 4BVUA 2J0LA 1L8TA 3NYXA 4K77A 2PUIA 2BUJA 3B2TA 1JKSA 3E5AA 1ZWSA 4FNZA 3U6JA 5FUTA 4BCGA 1REJA 5IA5A 1YQJA 3VVHA 4P4CA 4ZIMA 3N51A 3NEWA 5BVWA 1M14A 4IQ6A 1G8AA 3CY3A 3NUPA 3JXWA 3ZO1A 2X2LA 3GOKA 2UW8A 3H9OA 1GZNA 2WD1A 2XRWA 4G1WA 4QMVA 3OXIA 4U9AA 2W5AA 2BRHA 3PYYA 4ANNA 2VWVA 1YW2A 3R30A 3ZXZA 2H8HA 4WA9A 5GJGA 3IW4A 1UU3A 3DLSA 5CSVA 3VF8A 2AC3A 3O7LD 4L53A 4LYNA 3DB8A 4LGHA 3AC5A 3V3VA 4D0XA 5AMNA 4OAVB 4DTAA 4FIGA 4JXFA 3E3PA 3KXZA 2BHEA 2FGIA 1UU8A 3Q96A 1WCCA 4L3PA 4RJ8A 2ITUA 2F7XE 4YJOA 3CE3A 4GK4A 3FLYA 3TDVA 4UMTA 5HHWA 2QG7A 3MFUA 4BDAA 4D2TA 4WO5A 2UVYA 4FV1A 4PTEA 1Y8GA 4U0IA 4UBAA 1GNGA 1OIQA 3WILA 3PVGA 3ZLWA 1ZYCA 1UWHA 4KBCA 5EDQA 3WARA 5JSMA 5K5NA 3TNPC 3P23A 3JS2A 4BIDA 4U97A 1W7HA 3S3IA 2XH5A 4M68A 4D4YA 4YJRA 4ANLA 1ZOHA 4FZ7A 2BZIB 4ANSA 2OI4X 3V5TA 4E73A 4AQCA 3MN3A 4KKEA 3AGLA 1KUTA 4UB7A 4YJVA 2ERZE 5E8TA 5IEYA 4FYNA 4CZTA 3R7IA 2O63A 5AIKA 5D7AA 3JY9A 1GIJA 1XH8A 2CLQA 4CQGA 1A9UA 2FSLX 2FH9A 2ZM3A 1OL2A 1PF8A 4JR3A 5HVJA 4IXPA 3UOHA 4EZ5A 5LMKC 3FQEA 3QTWA 3W2QA 5AX3A 4X2GA 2ZDTA 4C36A 3IDPA 4PL5A 1SYKA 2HK5A 4FL3A 5LWNA 4C0TA 4YU2A 1U59A 3POOA 1NW1A 1LR4A 5DVRA 5TF9A 3LFSA 3NUAA 4R5SA 2WNTA 4BIBA 5L2SA 3KGAA 3OXZA 4A4XA 4TYEA 3SW4A 3FPMA 3ULIA 4DG3E 4NSTA 5I5ZA 4H1JA 1YKRA 2KULA 4NEUA 3LCOA 4RVLA 5AR8A 2BRGA 5EH0A 4OAUC 5IQFA 3ZO3A 3QGYA 4ALVA 4ZAUA 5M4CA 2I1MA 2CGVA 4Z7HA 4QRCA 4IAZA 2BDJA 1MRVA 4C7TA 1J7UA 1Y91A 1XKKA 4ACGA 2OH0E 1YDRE 2W99B 2CN8A 4ZP5A 5C9CA 1MRUA 2C6DA 3KRJA 5HOAA 3DK7A 2VX3A 3MY0A 3V51A 1SVGA 4EJNA 1IEPA 3QZGA 3DBCA 4AZFA 3KEXA 5ANJA 5JK3A 2GFCA 3DDPA 4FK3A 1Q24A 4BIEA 4DGOA 4KIQA 5IQEA 3MH3A 4EJ7A 4U80A 3TKHA 2XEZA 1HCLA 1VYZA 2WZJA 3IKAA 4WUNA 5CAUA 4V0GB 3P78A 3ZM4A 4DFZE 4QTEA 3KN6A 3BKBA 5I9YA 3ZLYA 3REPA 4RX9A 5FBNC 4B8MA 3BWFA 3GENA 5CSWA 2IN6A 3N4UA 2BKKA 3KXMA 3ZSIA 4EYJA 2YERA 5A54A 2PULA 2R3JA 5L2QA 1O9UA 4I6HA 4CV8A 1O6LA 4UV0A 4QTAA 1OIRA 4ITJA 4AGUA 4DH8A 2YIWA 4EC9A 4IAFA 2ACXA 2W1FA 3F2NA 2WKMA 2J7TA 4IMYA 4TNBA 4X2KA 2FYSA 5E9EA 3WZJA 1OPKA 3CS9A 5CASA 3SHEA 3NMUF 3RINA 3B2WA 3FQHA 3S00A 4O83A 3LXLA 4FGRA 1YHVA 5GINE 4JDJA 5H8BA 3E8NA 4EWQA 2AC5A 4J52A 3V5WA 4D1XA 2DQ7X 4QMMA 2WQNA 2B53A 3ODZX 4II5A 4ZEGA 1ZYDA 1FVTA 3C4WA 4AW1A 4LL5A 3HV4A 4U6RA 3V01A 2C5VA 4X3JA 3OOMA 2WMUA 4C02A 4UWCA 4MH7A 4ACDA 4BCQA 3V8WA 1U5QA 3FQSA 3ORNA 1KOAA 2OLCA 3CXWA 5EM6A 4NH1A 4DLJA 1IASA 5CANA 1SVEA 4QP3A 2R3QA 4XOZA 3OG7A 3W2RA 3ROCA 4GCJA 3QTUA 4MXOA 2G2HA 3L9NA 2UZOA 2I6LA 3CIKA 5CU0A 3LFEA 3MFSA 3NYOA 2IVUA 4TY1A 3R1SA 1H1WA 2GQGA 4E3CA 1R0EA 2BCJA 4QMWA 4JDHA 3MB7A 2PSQA 1XO2B 2Z7RA 5LCKA 2B7AA 3UP2A 5IF1A 3QA8A 1XH7A 1VZOA 2QKWB 2XIKA 3NCZA 3BWJA 1W82A 3KF7A 4IVAA 5AAFA 3VUTA 1BL6A 4IIRA 3TUCA 4F0FA 2JKOA 4E6DA 5EYMA 2PZIA 5B2LA 4F9BA 3CP9A 4EI4A 3NR9A 4ZY4A 3P08A 3V5PA 3NGAA 2GNIA 3PFQA 4YJQA 5AM6A 4E4NA 2OIBA 4I0RA 3RNYA 4BFMA 4JNWA 4JI9A 4UXQA 3TG1A 5I9ZA 3BQCA 4RPVA 5LMBA 5I9WA 3VRYA 4X21A 4RZVA 2X7OA 2E9UA 2KTYA 4D4VA 5CAVA 3Q9WA 4BICA 2XK8A 1OBGA 4M67A 4AX8A 4A9TA 2WGJA 4X3FC 4F6UA 4AXAA 4F9CA 4JBVA 3WF6A 4M97A 4R8QA 4CKIA 3CQWA 3KVXA 3NAXA 3FPQA 5IQAA 3JVSA 4XMOA 5E7RA 3UZPA 3VWAA 1NA7A 4I1ZA 4QMTA 4WG4A 2YM4A 5CZHA 3ZUTA 4XCUA 3LKMA 3LW0A 3NAYA 1M7NA 2IW9A 4FKRA 5E8ZA 4AGDA 4IH8A 2ONLA 2ZM4A 4AE6A 1DI9A 3PJCA 4HGLA 3FDNA 2Q0NA 3OHTA 3PG1A 5GZ9A 2PPQA 4FKWA 4L6QA 3EIDA 4TWOA 4RRVA 4WKQA 1R78A 5HG5A 2JDRA 3FI3A 2GMXA 3LCKA 3GU6A 1H4LA 2OO8X 4O1PA 5FRIA 4DGLC 4W4YA 4FZ6A 2CGXA 4CCUA 1OI9A 4FT0A 2VWWA 2OBJA 3IQ7A 4K1BA 5L8JA 4FMQA 3SLSA 4GIHA 4V0GA 4LFIA 3VQHA 1RQQA 2QOOA 3Q2JA 3H10A 2VNYA 3U6HA 3COKA 2GNJA 2O5KA 5K0KA 5HO6A 4MD7E 3TV6A 5IDNA 5G6VA 4D2VA 3IW5A 1JAMA 2XIXA 3R8MA 5EG3A 5AUUA 4JX3A 4NFMA 1Q8ZA 3DAEA 5LVPA 2BILB 2JIVA 2VTQA 3ULZA 3UO5A 4Z9LA 3UP7A 2UVZA 5ETIA 2PVRA 3HA8A 4FNWA 2OSCA 4MHAA 4W8EA 3QBNA 1URCA 4IM0A 2A27A 4YTIA 2X6EA 3PJ3A 2W4KA 5FWKK 2ETRA 3R7YA 5CAOA 3U9CA 1A06A 2QOFA 2JDOA 2BALA 2C3KA 3HRBA 1VEBA 3PIXA 4MWIA 2XMYA 2QKRA 4RIWB 1H28A 3FZRA 5TO8A 3HLLA 4ASEA 2WMBA 2BPMA 2R3HA 4C2VA 4I94A 4J8MA 3DLZA 5GZ8A 1YOMA 2R3OA 3T3VA 3EQFA 2R9SA 1H01A 4EOJA 3ODYX 4H3BA 2HENA 4RIXB 3QUDA 4AT4A 3NNWA 5I3RA 4YC6A 3MY5A 4YC3A 4EONA 2XIYA 3OROA 4L3LA 1WZYA 4WSQA 5I3OA 5TOZA 3S4QA 4U44A 3COMA 4DH5A 3SQQA 1ND4A 1GAGA 2UW5A 3RZFA 2W1GA 4OBQA 2RFDA 5G1XA 1E1VA 4HYIA 5DRBA 2W1ZA 2Z2WA 3LIJA 3ZCLA 3HMOA 4U79A 2QOKA 2QC6A 2VTOA 3RAWA 4RFZA 5CVHA 3AQVA 5AP4A 1J7IA 1LUFA 4C4FA 1KSWA 4NUSA 2WMSA 4ZY6A 3TJDA 2OFUA 2BTSA 5AR5A 4PV0A 3ZOSA 3ZO2A 4FSUA 2HELA 3T3UA 3QQUA 1IA9A 3IG7A 3I81A 3PXFA 5JFSA 3FV8A 4BCOA 2WTKB 3EQCA 4R3CA 4ZK5A 3V04A 5JH6A 3R7UA 2WU7A 4O0YA 1K3AA 4H39A 4GU6A 4LGGA 2XRUA 1QPJA 2PVMA 5AV1A 4RG0A 3VN9A 4FV0A 4UX9A 5M06A 3ENHA 3WYXA 4D5KA 3GC9A 5IA4A 4TN6A 4MCVA 3MTLA 3BHVA 2OFVA 3U54A 5CALA 1T46A 4DEDA 5E8VA 3UOLA 3LJ2A 5IQGA 5HNGA 3DS6A 1H27A 3KRXA 3DU8A 4F63A 1KE7A 3U87A 4AW5A 4CFWA 3DBQA 3GCVA 5DR9A 4E7WA 2W1IA 4C33A 2C5NA 5HBJA 4YLLA 4JG6A 3Q5ZA 2J0KA 2EXMA 4A9RA 2WQMA 2VRXA 3BYOA 4C3FA 1WBPA 4V04A 4MBLA 4QMLA 5KMOA 3RNIA 1OUKA 3HVCA 4GUEA 4F1OA 3NVMB 3HNGA 1UNHA 2CPKE 2Y6OA 2YIRA 3Q3BA 4FT5A 4GS6A 5CEQA 3R9OA 3RKBA 4YZ9A 1W84A 1U5RA 3NNUA 1ZARA 2PZRA 2C0IA 3RWPA 4B99A 4F7LA 5EFQA 2OG8A 1JSVA 3SGCA 3CCNA 4I6QA 4X6RA 3JYAA 2ZB0A 2BTRA 3C51A 2X4FA 2V55A 1PJKA 2XNNA 4PL4A 1R1WA 3Q9ZA 5CAPA 5EI8A 4PF4A 5HTCA 4G6NA 4I93A 4MBJA 1FMOE 2UZVA 3BEAA 1MRYA 3CSVA 3FI4A 5DNRA 4D4SA 3QRTA 3SD0A 3ZFYA 3F2AA 3QGWA 4RJ4A 4BF2A 4HVGA 1H8FA 2JIUA 5EHOA 1IA8A 4MYGA 4F6WA 5CF8A 2A1AB 4D55A 3Q6WA 3WZDA 4D2PA 4O91A 4CEGA 2UZEA 5L2TA 3TZ7A 4QMXA 4MXZA 3RI1A 3LFDA 4RIWA 4ZLZA 3LZBA 3CPCA 5F94A 4R7IA 2XM8A 5CWZA 5HQ0A 3FWQA 3R63A 4H3PA 5CENA 4EOIA 5ANOA 3I5NA 4XG6A 3FKOA 2VTAA 3RK5A 5K4JA 5CS6A 4D28A 5L4QA 5BVOA 2UZWE 4AN3A 3AXWA 4MK0A 1U54B 3D9VA 4RIXA 5KO1A 4FV3A 1WBTA 4RX8A 4PTCA 3OMVA 1XH4A 4HPTE 4RA4A 5AR7A 4O7YA 3NUUA 3F5GA 3JPVA 4QMPA 3FMJA 4YZMA 2VV9A 4PRJA 4LUDA 4QMUA 4XG3A 2VGOA 5HE3A 3UGCA 1BL7A 2WMRA 2BDFA 4WHZA 4D2RA 3P4KA 4XV2A 4YUQA 2C47A 1P2AA 2UW3A 3CY2A 3ZTXA 4C4IA 2RL5A 3EB0A 4QNAA 5L3AA 1BI7A 2W1EA 1URWA 3M42A 4RC3A 5ETAA 2CNVA 3QTQA 4CRLA 3QKKA 4FSMA 4QPAA 4GFMA 4BCMA 3H9RA 4YZCA 3DKCA 5CZIA 4S31A 4ZJJA 5A4EA 3HX4A 5EW9A 3OBJA 3IOKA 4FKIA 4ZTNA 2J6MA 4J8NA 4W4XA 4ZTQA 2HXQA 2ITQA 2XNGA 3I7CA 3OC1A 4O2ZA 2XKDA 5M56A 3EFLA 4FV2A 2XCKA 4FV8A 4BDDA 3VBXA 4EHZA 2B0QA 3C4XA
chains in the Genus database with same CATH superfamily
4LRMA 5B2KA 3GU8A 4MD8E 3C1XA 4FIEA 4RA5A 1XJDA 4WT6A 4UMRA 4I4EA 4BDGA 3WF8A 3HRCA 1F0QA 1JPAA 2PVLA 4YTHA 3QQHA 3MWUA 5DEYA 4C59A 5DRDA 3Q4ZA 4DTBA 1PXMA 3C0GA 3FHIA 2VAGA 1G5SA 1U4DA 2GFSA 4B6LA 3HV6A 1SNXA 3GXLA 2WB8A 3DNEA 4XBRA 5IUIA 4PTGA 3MIAA 3SXSA 3SXFA 3VHKA 2GHLA 2IVSA 2HZ4A 4TYIA 2XKFA 2C6MA 3SKCA 4DCEA 3CGFA 4TYJA 4D4RA 5CI6A 4BRXA 2G1TA 3VQUA 4R1VA 3NUSA 3UDBA 5JFXA 4N0SA 5AIRA 3ZC6A 1M2PA 4M69B 4GV1A 5E90A 5K4IA 2BAQA 3E88A 4FSNA 3KIOC 4YJNA 3NZ0A 3EKKA 2G9XA 1K9AA 4L3JA 3NFGB 4USDA 4K18A 3F5XA 4FEQA 4LG4A 5F20A 3NLBA 3PPKA 4IM3A 4AE9A 2GHGA 4W9WA 3MTFA 4WRSA 2H6DA 5EHLA 4E4MA 5FTGA 3UDZA 4FC0A 3TTJA 2OXXA 3IONA 4KIKB 2PMIA 3AD5A 3QZIA 4IDTA 4GIIA 5HTBA 3R9RA 5EYCA 3QU0A 1PKDA 2OF4A 4FZDB 5KMJA 3MA6A 1ZMUA 4NTTA 1TFFA 2VZ6A 2HW6A 3OY1A 4NWMA 5A3XA 3POZA 4FOCA 3OT8A 4LRKA 2XJ0A 5HIBA 3D5UA 3QLGA 4FTLA 2WMAA 3LM5A 2IW6A 4IZAA 4JQ7A 4OBPA 3W8LA 4ZSAA 4MUQA 4E8AA 2YLEA 2NO3A 4G6OA 2JFMA 4KNBA 3TUDA 4B7TA 3AD6A 4C37A 1U54A 4M0YA 3FSFA 4BZDA 3CTQA 3C5IA 4O82A 2IWIA 4WG3A 4CYJA 4C38A 3OUNB 2Y4IC 4Y85A 5HD7A 4G3EA 4FTUA 3UBDA 5IA3A 4PDOA 3KULB 5LXMA 2ITNA 3GFWA 2WTVA 4D1SA 4HVDA 5J9YA 4MAOA 3VF9A 4EQCA 3DPKA 1OIUA 5HIDA 4FZFB 3QCSA 1O6KA 4AA0A 3VJOA 1IAJA 1XHAA 3BGQA 4FEWA 2F57A 4IWOA 3V5LA 2UW4A 2QG5A 1P4OA 4KD1A 4N57A 3F3TA 2XNMA 4XV1A 3IDBA 4FODA 3I5ZA 3UVRA 2IF8A 2HIWA 5HG8A 4F7NA 3E93A 5CSPA 3FLSA 5HZNA 4NJDA 3HKOA 1SM2A 5JT2A 3OY3A 3C13A 4TW9A 3FXWA 3TT0A 5I4NA 4U45A 1OPJA 3MI9A 3E7OA 2X39A 4PMTA 2X81A 4MXAA 4WBOA 4PP7A 3AKLA 4QTDA 1CMKE 4BBEA 2VTJA 3VHEA 4O7VA 2R5TA 3QWKA 4FTIA 5HGIA 2C5YA 3RBWA 3RMFA 4APPA 4XV3A 2QOQA 3W0PA 1VJYA 3F7WA 3GU4A 1TQIA 3OD6X 2QNJA 3G15A 5FM2A 3DKOA 2J0IA 1OL5A 5HORA 1CSNA 2HAKA 4JIKA 3D5WA 1ZMVA 3HDMA 4V01A 1Z57A 3W0RA 5EKOA 1OB3A 4ZTHA 4U7ZA 5K3YA 3RM6A 3CQEA 4EWHA 4XUFA 4PY1A 4RWLA 2YZAA 3FKNA 2VTTA 3I0QA 5GJFA 5HESA 3ZSGA 4F64A 3A4PA 2UW6A 5DYJA 4IVCA 4CZUA 3N9XA 4BCFA 3RAIA 1DAYA 2XNEA 2ETMA 1H0VA 3UC3A 4R3RA 4AGCA 1KV2A 1OL1A 4X2JA 3PY1A 3PY0A 3Q4CA 4OT5A 4M69A 5CEIA 4GVAA 4KKHA 4O0SA 1WBOA 3UTOA 1UNGA 3QL8A 3W55A 2FA2A 4RWJA 3LQ5A 4Z7GA 2EWAA 2BAKA 1Q8WA 3D2IA 2JITA 2B55A 5FBOA 4LQMA 4OTRA 2WTCA 2QOBA 1XBBA 4F1TA 4EK4A 3ACKA 4GFGA 1ZZ2A 5J1VA 2PUNA 4FJVA 1QL6A 3LQ8A 4KIKA 3DT1A 1PXIA 1W0XC 4L45A 3PPZA 4ANOA 5M55A 2JLDA 3UVQA 5HX8A 4AG8A 2VNWA 2QCSA 4X7QA 3PP0A 1OKYA 2R64A 2PE0A 2GCDA 3PXYA 2UZDA 2P33A 3GOPA 3BLAA 4M8TA 2NP8A 4EHGA 3HMIA 3FI2A 1OL6A 2WTDA 3ZEWA 2PZPA 2ITPA 4EOKA 4M12A 4ZOGA 3UG2A 4FIFA 2QHMA 3C4ZA 2WMQA 3U51A 3FZOA 2B9HA 2X9EA 3O8TA 5GHVA 5LMAA 1H1QA 4F0IA 3G51A 1PMVA 2R2PA 3KMWA 5KKRC 3Q6UA 2ITXA 5E8YA 4IZ5A 5J7BA 3NSZA 2VO0A 4ASXA 4DEEA 1LPUA 2C6TA 4EUUA 5A6NA 4G31A 1UKIA 2ZDUA 4RJ7A 4GT3A 3KULA 4ACHA 4BC6A 2CKOA 3QQJA 4F4PA 4GKIA 3RWQA 1LEZA 3M1SA 3RPSA 3QRJA 4BDIA 1JKLA 2OKRA 4FG7A 3DK6A 2VWBA 3QCQA 5HO7A 1WBVA 2QODA 3EQDA 4GJ3A 3EFKA 5HO8A 1MUOA 2WMVA 3NDMA 4RGJA 2VX1A 4MXCA 1Q62A 1JLUE 4Q9SA 4WNMA 5HICA 4EK5A 2FSOX 5HG9A 5JMSA 2PL0A 2RFEA 4QDVA 3ACJA 4JRNA 3TJCA 3ZO4A 5LMKA 3DBEA 4QP2A 4O96A 4OW8A 5E1EA 3TZ8A 3ORZA 3IW8A 3NW7A 3BCEA 2VWUA 3LCTA 4FKGA 3UNKA 2DYLA 4FEVA 2BROA 5D11A 4FX3A 3IW7A 2QLUA 1ZOEA 4CT1A 3MW1A 3KXHA 4D0WA 4KSQA 4OTWA 2RSVA 2XUUA 5IA1A 4EH9A 3OUKA 3OVVA 3PZEA 4X3FB 5HCYA 2X6DA 2QHNA 5KMKA 3ET7A 4O7SA 3DQWA 3UC4A 3EJ1A 2VTSA 5ACKA 3WZUA 4F6SA 3RPRA 4O6LA 5KNJA 3LM0A 4I5HA 3MGYA 2PMNX 2YDIA 4CMOA 3O5AA 2RG5A 3VS3A 1YOLA 2R7BA 4RC2A 3GBZA 3VUGA 4K2RA 4MXXA 4OTGA 3TV4A 3G2FA 4BHNA 4L68A 5FP6A 1DAWA 4XYFA 3RVGA 2UV2A 2RGPA 2XK7A 5ETCA 2E9PA 5FTOA 2ITWA 4KA3A 3RK9A 5CXHA 1GOLA 1VR2A 4JJRA 3IW6A 4BKJA 1NVSA 3PVBA 4YURA 2QLQA 3V6SA 3ZRKA 4CFNA 3AT3A 5I9XA 2BRMA 5IMXA 3EN4A 5CNNA 4FIJA 3FEGA 4FTOA 5HNBA 4O86A 3L9MA 5B2MA 2ERKA 2QR8A 2XK3A 1X8BA 3I60A 5CU2A 1NXKA 5DN3A 3DXQA 2JDTA 2HOGA 1H1RA 3DY7A 3QUEA 5IH5A 3S1HA 1WBWA 2YCSA 3BLHA 4BCHA 3E8EA 1Q61A 3IECA 3KN5A 2X8DA 5GJDA 4WD5A 4YC8A 5KBRA 4DLIA 3I1AA 4F65A 3PG3A 3W0MA 1FINA 3VUHA 1YXUA 3TDWA 2NRUA 2Q0BA 3MVLA 1RW8A 4C4HA 4LV8A 2P55A 1UU9A 3HUBA 4HZSA 4C61A 3A99A 3GC0A 3QA0A 5KX8A 1ZYJA 3R1NA 2PWLA 4ZTLA 2PVYA 3ZEPA 2PUPA 2W9ZB 2ZAZA 4FKLA 3QF9A 4KINA 2GTMA 2EXEA 1OPLA 3FZPA 1OL7A 5FDXA 3JUHA 5DR6A 3W2SA 2B9JA 4AW0A 4G16A 2R3KA 3A8WA 2YIXA 2CCHA 5HLWA 3DB6A 2VTLA 3PJ2A 4LV5A 4U5JA 5C8MA 4AAAA 3PPJA 2C6IA 4U41A 5ACBC 3H0YA 1WVXA 3EQHA 4EBWA 3T9TA 4DINA 3B8QA 2O3PA 2W1CA 5C01A 3UJGA 4EH4A 4I0SA 5JGDA 3ZUVA 2PMLX 3GQIA 5HE2A 3R7VA 4PWNA 4FICA 4FSYA 3WF9A 1E9HA 4LMUA 4BTJA 4AN2A 2ZOQA 2YABA 2JIIA 4G3DA 1HCKA 4DH1A 2HWOA 3O96A 2WO6A 3QQGA 3FSKA 4L42A 4TWPA 5E91A 3R9NA 1B39A 2YN8A 3WYYA 2A4LA 3HMPA 3FI8A 1JSUA 4YSJA 4CQEA 3NUYA 4Q5HA 4BJJA 1H08A 2ITZA 2ZM1A 3GU5A 4G9CA 4YJTA 4MNEB 2OF2A 1YWVA 3BLQA 1PXKA 4FG9A 3PXKA 5FM3A 4K8AA 3RAKA 4D58A 5AUTA 3U9NA 3MESA 3A7JA 3FZ1A 4WNOA 3W2PA 4AGWA 3SAYA 4IB1A 4DYMA 4Z16A 4RZWA 3O50A 4FBXA 4DTKA 3BRBA 3RP9A 4JRVA 4XX9A 2XVDA 4X3FA 3PP1A 4FI1A 1PXJA 1SMHA 3QHRA 3R00A 3PWYA 1XQZA 2H34A 3ZU7A 4E1ZA 4XLIA 4N6ZA 4NCTC 3WZEA 5GZAA 4ENYA 5EK7A 2HXLA 5CSXA 3C4CA 2B9IA 4ZSEA 5IUGA 3QUPA 4CG9A 5I9VA 4BI0A 4I24A 5H2UA 5EQPA 3B8RA 5E8XA 1UKHA 4TYGA 3SA0A 4ORKA 4CFVA 5F9EA 3K5UA 4G6LA 3MY1A 4TYHB 1M7QA 2WXVA 1JSTA 1NY3A 4L00A 2XANA 4DBXA 1YXTA 3Q9YA 3ZSHA 2DWBA 3KMUA 4EL9A 2YCRA 3Q32A 4FVQA 4J53A 2E2BA 4FYOA 3O23A 1H07A 4QOXA 4JS8A 3VUDA 3SG9A 3F5UA 2AQXA 3HUCA 2BMCA 4DDIA 5EQYA 5K0XA 3AG9A 3QZHA 4JQ8A 3GI3A 3HRFA 3W2OA 2WIHA 3ORLA 3COHA 4XJ0A 4OTDA 2CDZA 4QTCA 1KV1A 1TKIA 2PU8A 4ALWA 4D2SA 4AU8A 4C35A 4E93A 2CNUA 3W0QA 4C4GA 2PVJA 3FMKA 2R3NA 4OR5A 4YMJA 5H3QA 2W0JA 3MH0A 3BHHA 3A7GA 3HL7A 3UOKA 4GK2A 3ORXA 4H3QA 3KKVA 2JBPA 4KIOA 3C0HA 4IACA 3UQGA 5IDPA 5LJJA 3W0NA 1T45A 4RFMA 4AA5A 3CD8A 3DFAA 3PVWA 3BPRA 3LAUA 1WBNA 2DUVA 3PA3A 3R8VA 2IEWA 4NW5A 3BEGA 4GW8A 2YIYA 3W1FA 2B9FA 2ONLC 4NM0A 2CJMA 3EZRA 3QTSA 3G5DA 4XRLA 4TZRA 4HJOA 4KWPA 4BDJA 5HI2A 3RGFA 4MNFA 5CY3A 2YFXA 5HCXA 4AZWA 5L2IA 3FL5A 2WTIA 5IA0A 2IPXA 4EZ7A 4QDEA 3HMNA 5AAGA 3FMHA 4HOKA 4AA4A 4XG7A 5L6WL 2WEVA 4NIFB 3OTVA 4Y95A 3BBWA 5FEDA 3ZBXA 2HZIA 1OIYA 2PVKA 4AN9A 3GVUA 3QD2B 4CXAA 2UZUE 2W1HA 3EQGA 3N4VA 3PRIA 4PPAA 3OZ6A 3UNJA 3PA4A 4EZ3A 3VS7A 5BYZA 5L8KA 4H36A 1JWHA 2IO6A 3NCGA 4QTBA 4XLVA 5AP0A 2HY81 1PXNA 5IQHA 2OIQA 4AZSA 3L8VA 3VS4A 3UMWA 3PY3A 5C8NA 4R7HA 3PLSA 1ZRZA 4O0WA 4MNEA 4PMMA 2XNBA 4YPSA 2UW0A 4ZSLA 4BWXA 2ZV2A 1BKXA 5BMSA 3W33A 4DH7A 2BZKB 3LXNA 3R8LA 3IDCA 2IZUA 4RWKA 4MBIA 5BUIA 2C6EA 5T68A 4OTPA 4KSPA 2CKEA 3I79A 5AP6A 2C4GA 1J1BA 4O1OA 1YHSA 3D14A 5LWMA 3IS5A 4XOYA 3RK7A 4JBQA 3NIEA 3NPCA 3U4UA 3TEIA 4Q5EA 3FKLA 3UE4A 3DQXA 3FY2A 2X0PA 3BU6A 3ALOA 3Q9XA 3UIXA 2OGVA 4DEGA 4DN5A 3WF7A 2YAKA 1Q3DA 4R78A 3G90X 2I0YA 5TT7A 2XARA 1I09A 3OBGA 5EOLA 2UW9A 3LXPA 2OJIA 3DAKA 3UIUA 5EW3A 4TYHA 4ZJIA 4GEOA 4ZZNA 2X7GA 4ZZMA 3EKNA 5CT7A 3QALE 1KE5A 4M13A 3OCGA 2WFYA 3R73A 2OWBA 2F2CB 4ANMA 3MPAA 3EYGA 4PMSA 4EQUA 2OXDA 4DDGA 1ZYSA 2ZVAA 4EH6A 2XM9A 2CN5A 2CSNA 3GB2A 3H3CA 5CYIA 5FXSA 3VUIA 3QKLA 4CFXA 4UYAA 4GFOA 3Q53A 3FC2A 4IZ7A 5BMMA 5A9UA 3ATTA 5E1SA 3TZMA 4BDEA 4WRGA 5AA9A 5BVDA 3OEZA 4TTHB 5B7VA 4L67A 3GCUA 2JD5A 2W1DA 2B1PA 4XP0A 3NIZA 3FYKX 3H4JA 4J95A 4ZSGA 4DA5A 2CGUA 4IX3A 5CVFA 4D2WA 5AP3A 3ZHPC 1Q97A 5DI1A 2VWZA 4LRJA 4EBVA 4UY9A 1O6YA 4N70A 4FSWA 1WAKA 2W4OA 3L8XA 3PIYA 5BVNA 1Y8YA 2X9FA 2YLFA 3VBYA 3GCSA 5EDRA 3QX4A 2C3IB 4A7CA 5M44A 4G9RA 5BUEA 2CGWA 2F4JA 2VTRA 4CCBA 4UMQA 4NJ3A 4E5BA 2F9GA 4FTAA 3RPYA 5AM7A 2CMWA 4BKYA 4S2ZA 4ASDA 1QPEA 5LVLA 4E4LA 5J9ZA 5IUHA 2UW7A 3R0TA 1GZOA 3TM0A 4I92A 1WVWA 4F9AA 1FGKA 1FQ1B 4MF1A 4QT1A 2WELA 1ATPE 3HZTA 1YI3A 5AUZA 3UIMA 4DFXE 1H26A 4IEBA 4EHEA 1S9IA 4XH6A 3UIBA 4NIFA 3R1QA 3SX9A 2ZFYA 1TVOA 4OTHA 2HZ0A 1XWSA 4A9UA 4DEBA 2W5HA 4BYIA 2C3JA 1HOWA 4LOOA 4C3PA 4EKKA 2ZB1A 4F08A 5K5XA 4M66A 3A7FA 1M2QA 5C03A 4CMUA 4USFA 4YBJA 4CFFA 3TL8A 3VS0A 4QQJA 1Y57A 3LLTA 1APME 3QFVA 5DH3A 3A2CA 4O2PA 4AACA 5C27A 1YWNA 4HW7A 1FVRA 2R3PA 5CVGA 2QOIA 3G33A 4J96A 4JT3A 4QD6A 5ANDA 3F82A 4APCA 2YDJA 4BTMA 4QEBA 2GS2A 3M11A 3PSDA 3SRVB 1MQ4A 3VBTA 1RDQE 4FTTA 4O0TA 4KS7A 3Q60A 3S2PA 4C34A 2OZAB 3QRIA 4HNIA 4UN0C 3KRRA 3QAME 5KHXA 2YWVA 3LFFA 2XKCA 3BL9A 1R39A 3EN5A 3NNXA 4QQCA 4O6EA 2B52A 3VAPA 2XB7A 5CU6A 2G01A 4LGDA 4Z55A 2RKUA 3A4OX 1JVPP 2C1BA 3CJFA 3OCTA 3TWJA 5M4FA 2IJMA 4CLIA 5M53A 2YM5A 3BYSA 5L2WA 3WF5A 3UQFA 2RG6A 3T9IA 4ARKA 2A98A 1UWJA 2H96A 3BYMA 5DFPA 5DGZA 3ZFMA 2JBOA 3ZMMA 5J79A 3HAVA 4FEUA 4O81A 4ZLYA 3BELA 5CEKA 5AUYA 2Z8CA 1W8CA 3ORPA 3QYZA 1E1XA 4KABA 4NM5A 1ZLTA 2XCHA 3ZC5A 4AW2A 1PHKA 2EXCX 5IISA 3OF0A 2I0VA 2Y0AA 2C0TA 2VX0A 4DEAA 4FV9A 2Y6MA 1BX6A 1UNLA 2C68A 1G8SA 2QOHA 3U55A 2IVTA 4GSBA 4YZDA 4EKLA 4I5MA 1FPUA 2ZV7A 5CF4A 3JR1A 5DT0A 4BCIA 4CSVA 5AFVA 4IC7A 4MQ2A 4FV7A 4JDIA 4PUZA 4TPTA 3R8ZA 3SW7A 3R1YA 4O0XA 5D9HA 3G6GA 4QQ5A 3OW4A 4FV4A 2C1AA 4RFYA 4RT7A 5B0XA 3VBVA 3F7ZA 2WOUA 3EH9A 1GIIA 2X1NA 5IMEA 3QKMA 3FY0A 4IWQA 4FG8A 1GZKA 2JEDA 3CC6A 2YA9A 5IQIA 4ZMEA 4W4VA 5IEVA 1GJOA 2J90A 1GY3A 3BQRA 4YJPA 3QD3A 5FD2A 2XZSA 2ZJWA 2PY3A 1IG1A 3DXNA 3GUBA 4EEVA 4QP1A 2WEIA 4RSSA 5IH4A 4C2WA 4F9WA 4LV7A 4IWDA 3U6IA 4QPMA 3P1AA 3Q2MA 4W8DA 4AXEA 4MVFA 4QO9A 4M7IA 3KQ7A 3C0IA 5JZNA 4DHIB 2OK1A 3ORIA 4YHTA 4G3CA 5CT0A 2A19B 3OXTA 3P5KA 1PRYA 4Y73A 1FGIA 4O4CA 4FTQA 5AUXA 3D0EA 5IU2A 4EOQA 1QPDA 2YJRA 4XEYA 5DIAA 4FTJA 4KB8A 5D12A 4FE2A 5BYLA 4EC8A 4P5ZA 5JGAA 3RHKA 2YDKA 3DBFA 5L8LA 3D7TB 4Y8DA 1RE8A 5AA8A 1PMEA 2QU6A 2JFLA 2ZMDA 5EW8A 2UUEA 3VJNA 2OW3A 3E7VA 3AGMA 3KFAA 5HG7A 4OGRA 4CKRA 1JKTA 2YCFA 4J7BA 4HPUE 4HGTA 2Y8OA 4PDPA 1YXXA 5CF6A 5J8IA 2X7FA 2HZNA 2V7OA 2F7EE 3FC1X 4IE9A 2GS7A 4IBMA 1Q41A 2QO2A 3PXRA 5BUJA 2OJGA 3OWKA 2FSTX 2AEGA 3RHXA 2FSMX 3IOPA 5CTPA 5CQWA 1YXVA 4AOJA 5HX6A 3BX5A 5HLNA 5BVFA 1ST0A 4RVKA 3AC8A 4GKHA 4RJ5A 1YRPA 2IZRA 3W0SA 3VONA 5KMMA 4HVHA 3QLFA 3QZFA 3D15A 4BDFA 5A4QA 4FZAB 2P3GX 4B4LA 5KMIA 3GCPA 4WSYA 5AJQA 3F3VA 5LVNA 4LDTA 2BKZA 2EVAA 4DHFA 3QTXA 3BL7A 3TUBA 4ZY5A 4NT4A 4YLKA 3HMMA 4I0TA 4IFGA 3RPOA 5KBQA 1YVJA 2C30A 3HYHA 4CFMA 4GU9A 5BNJA 2XJ2A 5EQEA 1AD5A 3SRVA 3VBQA 3HA6A 4DITA 3KA0A 3PE2A 3AC2A 4IM2A 2QR7A 4RLKA 1YXSA 3RAHA 2XJ1A 4XG9A 2OZAA 2R3GA 4RIYA 3H30A 4JR7A 3W16A 4CYIA 5FGKA 5F1ZA 4K0YA 1CDKA 3CBLA 1KWPA 3C4EA 4HVIA 1PYEA 4KRCA 4FT3A 4BB4A 2BFYA 5KHWA 2P4IA 3GFEA 5DBXA 4A07A 2AYPA 3MA3A 1OMWA 4BCKA 3MPMA 3CQUA 3SDJA 1G8JA 4Y83A 2Y9QA 2J5FA 3QXOA 4FA2A 4FTNA 3TACA 4CTBA 3F69A 2XALA 4E5AX 5C1QB 4JX7A 5FXQA 4JG8A 3EHAA 3C5UA 4EQMA 3VIDA 3O17A 2CHLA 4KKGA 1QCFA 2WMWA 2QOCA 1ST4A 3QQFA 4OTIA 3E3BX 1V0BA 2R3LA 3R9DA 4R77A 3UO6A 2OJJA 3HAMA 4D1ZA 4QMNA 2VTNA 2I0HA 4BGGA 5IZFA 4FGBA 4AT3A 3O7LB 3ML1A 3MH2A 1OECA 3LFCA 4JBOA 4G5PA 1CM8A 4MX9A 3GP0A 3WBLA 4N6YA 4FIHA 3GC8A 2X8IA 4RWIA 2XEYA 2GNFA 2YISA 2FO0A 4O0VA 1OVEA 5JQ5A 4B9DA 4U40A 5EOBA 1JBPE 5AR4A 4FKQA 4ERWA 3G6HA 3DTCA 3I0OA 3UYSA 4HYHA 1F5QA 4BCNA 4DFBA 4IB3A 5M07A 3ZLSA 2V0DA 1Z5MA 1H00A 2PZYA 2H9VA 3ORKA 4NK9A 4M15A 4QPSA 5AR3A 1ZAOA 4HYUA 4F09A 5J95A 5HVKA 2FVDA 4J71A 1OBDA 3LMHA 5M09A 3AMYA 3PE1A 4B0GA 3LOKA 4K33A 2GNHA 4UEUA 4YZNA 3I4BA 5D7VA 4F99A 4YHFA 1TZDA 4HCTA 4NKAA 5IQDA 3E8DA 4W9XA 2PYWA 5FTQA 2IZTA 1V1KA 4V05A 2PUUA 4ZJVA 4BGQA 1XH9A 4BY9E 4U43A 4E26A 5LVMA 4FTRA 3MDYA 5ANGA 2YACA 1ZOGA 4RVMA 4BL1A 4DT9A 3T8OA 1BI8A 2ZYBA 3D7TA 2R7IA 3MS9A 3QQKA 5HVYA 4LOQA 3TI1A 2IVVA 2J0JA 4GUBA 4C4JA 1Y6AA 4BGHA 2BVAA 3KK8A 5FP5A 3R7OA 3P7BA 2P2HA 4F0GA 4IB0A 3NW5A 2O64A 2ZV9A 1OKVA 4RQVA 3LXKA 5LVOA 3LFAA 4FTCA 3DJ6A 3OEFX 5TE0A 3SC1A 1Z9XA 2OU7A 3EL8A 1BLXA 5EHYA 2PE2A 4FSTA 3MJ1A 4RC4A 4K11A 2OXYA 3NRMA 5CF5A 2HY0A 4GK3A 4QQTA 4I41A 4IB5A 4K6ZA 5AAEA 4PMPA 4HNFA 4RLLA 4ASZA 5JQ8A 3OS3A 4I5PA 4XBUA 3BHTA 3KY2A 3AKKA 3F9NA 1PXOA 5FQDC 2XK4A 4CFUA 1Y6BA 5C8KA 4RQKA 3ITZA 5IPJA 1WBSA 3WIGA 4DF3A 3D7ZA 3FE3A 3NUXA 4P90A 3D5VA 5HTIA 5IEXA 3LVPA 4UWBA 4BJJB 3FYJX 4WIHA 3WE4A 2XYUA 3GNIB 3R6XA 1OKZA 1YI6A 1P4FA 4ID7A 4QP6A 4O7LA 2UZLA 3HGKA 5DT3A 5D10A 3VS5A 4O7NA 2EUFB 4HZRA 3FAAA 2PVNA 4O4BB 4DG2E 5D41A 4D5HA 1Q3WA 4O22A 3SG8A 4KS8A 1JQHA 4HVSA 4O0RA 4YO4A 5DA3A 2QI8A 3W2CA 3FLNC 3L9PA 3P7CA 4UZDA 4WBBB 3R9HA 2BR1A 3QTRA 2W06A 2XNPA 1UV5A 1PMNA 3ROYA 2GQRA 3ZDUA 5ETFA 4I4FA 3WIKA 4WG5A 4AOTA 3V5JA 4DAWA 2V5QA 3BV3A 5EYDA 4NZWB 2VN9A 3KB7A 4ERKA 5CQUA 2QURA 3MSSA 3AC4A 3QD0A 3A7IA 3EMGA 2C5XA 3EFJA 4C4EA 2WHBA 4GG7A 3TMOA 2C3LA 3TTIA 3ALNA 3Q4TA 4L7SA 4MF0A 5E8UA 4BCJA 2JGZA 4O4EA 4JLCA 2W7XA 3G0EA 5IG1A 3BHUA 3E87A 2SRCA 3L8PA 3UMXA 4XHKB 3QTZA 5J9LA 2GPHA 5IQBA 1H1SA 3DNDA 4FSZA 2PHKA 4JVGA 3RCJA 2E9NA 2F7ZE 3FBVA 5TR6A 1BMKA 4FTKA 3L1SA 4IJ9A 2PE1A 4QP4A 3WE8A 2VD5A 5AP2A 4YR8A 1QPCA 3U4WA 3VW6A 5M51A 3BE2A 1Q8YA 4WNKA 3W10A 4CKJA 3TIZA 3MJ2A 4GT5A 2Z60A 3D94A 4XG2A 2W4JA 3R8UA 3VNTA 4C62A 2P2IA 2XYNA 5E4HA 4YTCA 2PZ5A 1H0WA 3FMNA 5AR2A 5HEZA 4FTMA 4EH8A 4LUEA 3E63A 4S33A 5AWMA 3O8UA 3BU5A 4G2FA 1LP4A 4XRJA 3UVPA 2ZV8A 3FMLA 3R8PA 3EQBA 1PXLA 5T6KA 4ZTRA 4E6QA 4PP9A 4XP3A 5CEPA 1AQ1A 4F9YA 4EK6A 5DOSA 4IVBA 1NVQA 4YO6A 5EM8A 3AOXA 4C8BA 3DXPA 3D5XA 1ERKA 4MEDA 4JG7A 4ZTSA 4EOPA 4O38A 4FKUA 4I22A 4IFCA 2ITYA 2LGCA 3ZZEA 5DG5A 1OZ1A 3VUKA 5E92A 4FK6A 3F6XA 3C50A 1K2PA 3BYUA 4I6FA 5H8GA 5HBEA 5HIEA 2ITTA 4FF8A 3A62A 4ZS0A 4I21A 4PX6A 3BV2A 3OP5A 5F4NA 4XNEA 3ZM9A 3HECA 3IO7A 5HKMA 3EQRA 1DM2A 4F7JA 5CAQA 3TNHA 4BZOA 4DGNA 4R7BA 4O7ZA 2YAAA 3P7AA 3QQLA 4FR4A 2YEXA 4H1MA 5EI2A 4PNIA 5DR2A 3SVVA 2OIDA 4QYGA 3PSCA 1MQBA 3MVMA 3NW6A 3QYWA 5BVEA 3UDTA 2J51A 5M08A 5CI7A 4O7TA 2W5BA 2NNWB 3LMIA 4CV9A 3EFWA 3IPHA 4I3ZA 4UMPA 1YDTE 2W9FB 3K2LA 3OCSA 2R3MA 3BIZA 2G2IA 3D83A 4ZLOA 1H25A 3LLAA 3LCDA 2O8YA 5AUWA 5BVKA 4C58A 4ZMFA 3CTJA 2JC6A 4IADA 4WNPA 4IAKA 1JKKA 2XA4A 5DHJA 2YCQA 5KCVA 4QYEA 3UODA