1UWJA

The complex of mutant v599e b-raf and bay439006.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
276
structure length
264
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATEKSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
publication title Mechanism of Activation of the Raf-Erk Signaling Pathway by Oncogenic Mutations of B-Raf
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 66
structure length 264
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1uwjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1uwjA01
4O81A 2WZJA 3S2PA 4CMOA 5CX9A 5FTGA 3C4CA 2ZJWA 3S0OA 3UNZA 3UNKA 3S4QA 5CEPA 4QTCA 2GQSA 1Q3DA 2VTNA 4QYHA 1BYGA 4R7IA 3T8OA 5F9EA 3UZRA 3NW6A 3UVPA 4PL3A 4YJUA 4G2FA 3AD5A 3FJQE 4QNYA 2XBJA 4NJ3A 5CSVA 4E6CA 1YVJA 5AAFA 3RPSA 3U9CA 2CN5A 5AIKA 2WMQA 3U51A 4EOSA 4DFZE 4BIEA 2I0EA 3QGWA 4YU2A 4O7SA 5L8JA 3Q3BA 4IAKA 4WSYA 3VAPA 1WZYA 4AUAA 4IWQA 3NVKI 3Q6WA 4K2RA 1JWHA 3EH9A 3RK5A 5CASA 4O7RA 4R7BA 2W4OA 3O96A 3TDWA 3ZO1A 4FT5A 2XKDA 5L6WL 2UZNA 2YITA 1Q97A 4X3JA 4IFGA 2HXQA 4ZXTA 4ZMFA 2QOKA 4AW2A 4BB4A 3IQ7A 4QP7A 4WOVA 4E5AX 4C2VA 1Y8YA 3LFFA 3MFSA 5D11A 3AC4A 5IUGA 3N4VA 4C4GA 1OL6A 4S2ZA 4FIHA 4TL0A 4ZY6A 3UO4A 2VTMA 2J90A 4ANBA 4D4VA 4IAFA 3DZOA 3QD0A 3QCQA 3PXYA 4MXXA 5ANDA 1LPUA 4FL2A 2YEXA 5A4TA 2VGPA 5EW3A 2QLQA 4G3EA 2C6IA 1E1XA 4FI1A 3FZTA 2BVAA 2QLUA 2EUFB 1JPAA 3BHTA 2IZRA 2R3RA 4DITA 3DS6A 2XIYA 3UP7A 2JFMA 1V0OA 4CSVA 3BHYA 3HV7A 3C50A 1Q41A 3W18A 3JYAA 3MJ2A 4B8LA 5ICPA 4GUEA 3FI4A 4EQMA 1PMUA 4ANMA 5A4LA 2Y6OA 3LCSA 4R1VA 3TUCA 3KF7A 4RWLA 4ENYA 2GNJA 2J4ZA 4G1WA 4KSQA 1ND4A 4DEEA 1U4DA 1LEZA 3BKBA 4XUFA 3ULZA 5LVLA 3PA5A 4UMRA 2XKCA 2JAMA 3QUEA 3NCZA 3CD3A 3ORIA 4YHJA 3TUBA 1L8TA 3D2IA 4D2PA 5IQCA 4Y46A 5E1SA 5AUTA 4IANA 5CF4A 3JR1A 1T46A 4WG4A 4M15A 4FG7A 3E8NA 1Q4LA 4FV7A 4EH5A 3OWLA 4ARKA 2CJMA 5FWKK 4EOOA 3DU8A 1Y91A 2UZUE 2W1IA 4HZSA 1OBDA 3ZYAA 4C35A 2W17A 4QYEA 4HGSA 4MNFA 3P7AA 3FMEA 4IM2A 4XYFA 4GKIA 3F2NA 2FA2A 4D2WA 2GHMA 3EKKA 5E8YA 2W7XA 1Y8GA 4UV0A 4EH3A 2X8EA 3ZFMA 4RG0A 4FV4A 3TWJA 2GFSA 2QO2A 4NFMA 4ANOA 4KBKA 3VS0A 2HXLA 3WF5A 4F6SA 1IAJA 4WBBB 1QMZA 3Q5IA 3FZSA 4FTMA 4C3PA 5HG8A 4YPDA 2WMXA 3D15A 4YZDA 3SDJA 4HW7A 3RPOA 2XUUA 3TT0A 3CJFA 3DBCA 2C6TA 5CU6A 1YXXA 4AOJA 5HU3A 4XBUA 4HVDA 3S00A 3QALE 1AD5A 2XP2A 2RFNA 3RCDA 3R9OA 4QPSA 4CFWA 1M2QA 1OMWA 3LVPA 4GJ3A 4GYGA 1KV2A 4O2ZA 2X2LA 4I92A 4TWOA 2CGXA 4XG6A 4ACCA 4AF3A 2BAQA 3QGYA 2XZSA 1FMOE 1Q61A 3VS6A 4IHPA 4O38A 4FTTA 4GRBA 3KK8A 3G9NA 3PPKA 3I60A 4DEDA 4ZJVA 2OGVA 4BDFA 2UW3A 3EQBA 3FL4A 5CS6A 4BYIA 1WCCA 4X2FA 1OL5A 4FG9A 3EQPA 5AP5A 3BGQA 5E92A 4CV9A 5JFWA 2VV9A 4JDJA 1ZY4A 3EQFA 4L44A 5AP7A 1UU9A 1XH4A 2WU6A 3ZTXA 2UVYA 4ITHA 4C3FA 5M08A 3BYMA 1YXSA 3FZPA 2W1DA 4DFLA 5KMNA 3DXPA 4G3FA 5E8ZA 3UIBA 1CMKE 1W0XC 3BU5A 3CKWA 1YWRA 3EIDA 2XJ0A 2RGPA 4M67A 4RVLA 3S1HA 3HMOA 5HX6A 4FV0A 2VTSA 5AX9A 3HYHA 2P55A 4WNOA 3ZZWA 1PYEA 2ZYBA 1H00A 5E1EA 2CDZA 5AUYA 3BLQA 4FL1A 2FO0A 4FKVA 5AAGA 4BCQA 5HE3A 4ZMEA 2IZUA 3MW1A 5AX3A 2OZAA 4IBMA 4F0FA 2R0IA 2JDRA 3W1FA 2JFLA 3QC9A 1Q8WA 3FY2A 3PIXA 5CY3A 2BHEA 4S31A 2YCRA 4JRNA 2R3KA 5M4UA 1Z9XA 3FSKA 4R5YA 1H1RA 5FD2A 5AM6A 2JKOA 4BIBA 3PVWA 2Z2WA 2I0VA 3VUIA 3TKUA 2CKQA 4FSNA 3LAUA 5I9ZA 5GJFA 2E9OA 4RLKA 5DT3A 4BCFA 2VWWA 4FZ7A 4ZSEA 5KCVA 4L53A 3B2WA 4IAIA 3UGCA 1NY3A 4DEBA 1OZ1A 2J0LA 3UC3A 1MQBA 2WFYA 1RJBA 3RHKA 5FBOA 2IVSA 3LJ1A 5EHYA 4O0YA 2XBAA 1XKKA 3TKHA 1O6KA 3P4KA 5EFQA 3VHKA 5M4FA 2YM7A 4QMYA 4FVRA 1ZOEA 3ZZEA 1UWJA 2VWBA 1OL1A 3GUBA 3I4BA 2JAVA 5LMKA 1VZOA 5J95A 2YN8A 4XRLA 1YHSA 5CEMA 1S9IA 2Y9QA 3KEXA 3RPRA 2JBOA 4PDSA 4RJ8A 3SKCA 3UOJA 2YCSA 3V5JA 3BHVA 4DFXE 3FXWA 5DT4A 1ZZLA 4H1JA 2BRHA 4LGDA 3W33A 1J7IA 3IDCA 4XBRA 4EYMA 4CMTA 3COHA 1I44A 4QTDA 5LVOA 4KIKA 4K6ZA 5BYZA 4WIHA 5AUWA 4NM0A 4P90A 4LYNA 2H6DA 3FPMA 2J0IA 2V55A 2DYLA 5LCKA 1F0QA 3MVJA 4FTLA 1ZOHA 2GQGA 4O82A 2IW9A 1WBWA 3GC9A 3LCKA 4PV0A 2XK4A 3FQSA 3PXKA 4FT7A 5HG7A 3HX4A 4XH6A 3WOWA 4EHGA 2VTQA 3DY7A 4AP7A 4GG7A 1OITA 2OZOA 1GZ8A 4YTCA 3OMVA 4O6EA 5CEKA 5IMXA 3RKBA 4LI5A 3ZC5A 2OBJA 5IPJA 5KNJA 4JVGA 4C4EA 1XBAA 2JIUA 2FVDA 3V5WA 5GZ9A 2BILB 3ORNA 4EC9A 4ASXA 5CSPA 3R01A 4C4IA 4TRLA 4UYAA 3WIKA 5CQUA 5DN3A 1PMNA 2PVFA 3ZLXA 2Z8CA 1PXPA 2GS2A 2WTDA 5HBEA 3U54A 4JBQA 3QZGA 2W1FA 1MUOA 4JG7A 5LQFA 4PX6A 5M4IA 2BZIB 2G2IA 5LWMA 3D9VA 2XK9A 3RCJA 3NSZA 4AN2A 4J96A 4DAWA 1H1WA 3PPJA 4DN5A 4ZLZA 4RIWA 3MY5A 4IAYA 2C3JA 3VQUA 2QOLA 5HLPA 3R02A 3WZKA 3ZDUA 4HGEA 4IC7A 2WQMA 1R3CA 5E8XA 3BV2A 2B7AA 3LM5A 4AGUA 3KC3A 5AP6A 2J6MA 2A4LA 4F7SA 2SRCA 3NR9A 4C34A 3N4UA 1UNHA 4MX9A 3FZOA 3QWKA 4O0XA 5CWZA 3WF8A 2GS7A 4KB8A 2WTJA 5A4CA 3EFKA 3QD4A 4FTCA 2VX3A 3PA4A 2PUIA 4BY9E 1JSUA 4Y95A 2Y4IB 3DJ7A 4BRXA 4AZFA 1U54B 4I5HA 4O0TA 2Y4IC 4IWPA 2R7IA 2JEDA 3VIDA 4AGCA 3ZRMA 4XMOA 3BBTB 4CRSA 1MQ4A 2ZAZA 1XH8A 4L42A 4EOJA 3ZSGA 4N70A 4F9CA 4CMUA 1PY5A 3Q9WA 2YIRA 4FICA 5B2MA 4QTBA 3TJDA 3U87A 4ZAUA 5CF6A 4YJNA 3GC7A 4IDTA 4UEUA 1JKTA 4IB1A 5JRSA 5HTIA 4KUJA 5HVYA 1YDSE 4JDHA 4DG3E 5LMBA 3ZHPC 4RFZA 4RQKA 3BGZA 1WBPA 3MPTA 3E93A 1ATPE 3MA6A 3QAME 3HA6A 3NRMA 2QONA 3W2PA 2X4FA 3VS2A 4G16A 4MWIA 2WNTA 2GSFA 1K9AA 3O8UA 1GZNA 1OUYA 3ZDIA 5IA0A 3ID6C 3ZO2A 3DBFA 2W1EA 4TYHB 4PP9A 5AM7A 3PSDA 4RA5A 1Z57A 1LUFA 4RIXB 5BVOA 4WNPA 5L2QA 3RM6A 4YZ9A 3GT8A 3ZMMA 4I6QA 2F9GA 4RJ4A 4CXAA 3PVGA 4L7FA 3QD2B 2ITWA 5CNNA 4FZDB 5J79A 4PMMA 3REPA 3VULA 4L3LA 4IX6A 2GTMA 4IVCA 4A4XA 4AZSA 2BDWA 3F66A 3ZCLA 4APPA 2R0UA 4YO6A 1BL7A 4HNIA 4R7HA 3H0YA 3ZU7A 2QKRA 1YDRE 4FKSA 3MESA 4BDIA 4FT3A 5CANA 3QHWA 3KN6A 4FKGA 3RHXA 3OBGA 1TKIA 2QVSE 3SGCA 2W0JA 1VYZA 2GNHA 4CT2A 4USEA 3VRZA 4FV5A 5I0BA 3OOMA 2HOGA 3GCUA 3G33A 4TPTA 3V51A 5ITAA 5M55A 1O6LA 4L7SA 4X6QC 5HIDA 3V3VA 4GMYA 1XWSA 2QOIA 3FV8A 3QF9A 3R7GA 3LIJA 5HE0A 4Z3VA 3OT8A 3R8ZA 4R78A 5M57A 4JAIA 2XYUA 5FP5A 2CNVA 4MEDA 3MFRA 2W9FB 3G6GA 1ZXEA 3NUYA 3NS9A 4FEQA 4CKRA 3CQEA 5B7VA 4FUXA 4FEUA 4TYIA 4ZSJA 4EKKA 4NTSA 3KXNA 2FYSA 4IQ6A 3R8PA 3TDVA 4U5JA 2C68A 2O0UA 2YERA 4W4YA 4GFOA 1ZMWA 4Y8DA 4F65A 3KRXA 2OXYA 1OIUA 4QMZA 4K8AA 3Q4CA 4A06A 3AT3A 3MDYA 5C27A 4AN9A 3TZ9A 1ZARA 4I3ZA 3VNTA 4BWKA 4OLIA 5H3QA 4NK9A 3GCVA 4D1XA 3QTWA 3SQQA 4F70A 4FKOA 5DVRA 4ACMA 4BVUA 1SVGA 1SNXA 5KHXA 4G17A 5K5NA 3TZ7A 1U59A 2VGOA 4XEYA 5IZFA 3HUCA 3O7LB 4UWBA 5E91A 3VS4A 2HZ4A 2Z7QA 4JNWA 4R77A 1GIHA 1OBGA 5CSWA 3PRIA 4M69B 3LPBA 1KE5A 2FUMA 4CZUA 5J7HA 5AADA 2I1MA 2WGJA 3KREA 4GYIA 4FOCA 3DV3A 3HRFA 5D1JA 4F6WA 2ZB0A 5M4CA 4J52A 4O6LA 3MJ1A 4RIOA 5CVFA 5DE2A 1RDQE 2XJ2A 4M12A 4EOLA 1G5SA 2OJGA 3PPZA 1XJDA 2XJ1A 2R3LA 3A7HA 4Y83A 3V01A 1ZYSA 3U55A 5J9ZA 2X4ZA 2RIOA 4FV6A 4C61A 1PKGA 5CLPA 4QP3A 4RX5A 2DS1A 3VS7A 3OCSA 4LGHA 4YUQA 5DRBA 3EYHA 4I6HA 3R8VA 2YZLA 2QO9A 5E8TA 3E64A 3SXRA 4GFMA 4FYOA 5BVEA 3KMWA 4ALVA 3LFNA 1A06A 4PNKA 2BTSA 2YDJA 3T9TA 4U3ZA 4PUZA 3HZTA 4KSPA 1W84A 3R22A 4AA0A 3GU8A 5AV1A 2DQ7X 3W2RA 5M44A 3ZSHA 4BTKA 2VWUA 2X7OA 3MH3A 3CD8A 3C4EA 1P14A 3KULA 3Q60A 4GUBA 3DLSA 2HZNA 2VTIA 3MA3A 4TKSA 3UQCA 2VX0A 4FV1A 1Y6AA 1YXUA 1UV5A 2FSOX 2OFVA 4HPTE 4I6FA 5B0XA 1OI9A 3O17A 4E5BA 4DFUA 3KXGA 3QFVA 2VO7A 2R9SA 2OXDA 2QG5A 3R04A 4NEUA 3P5KA 4DF3A 3GCSA 4L45A 5DT0A 1TQMA 5H9BA 4RC3A 4ORKA 2GCDA 3VBVA 4WO5A 2ITOA 2PZIA 2UW9A 5K5XA 1TQPA 3RMFA 4GT4A 5IA5A 4C0TA 4QTEA 4UMUA 4DEAA 1M52A 1ZWSA 2PVNA 3ET7A 3FYJX 3A4PA 3BQCA 1JQHA 4EBWA 3C4FA 5AR2A 3MVHA 4QQJA 3AMBA 2KULA 3EQDA 3KRRA 4ANQA 2A2AA 3ZO3A 3WYYA 5J9LA 2IW6A 3ZS5A 5AUZA 4CNHA 4JRVA 1FVTA 3BCEA 3GOPA 5EM5A 3VUMA 4CKJA 3IO7A 4NIFB 4NYEA 4C62A 4C2WA 2B9FA 3NYOA 4F7NA 4GU9A 3UO5A 3ZM9A 4ACDA 1OKZA 3OEFX 3DB6A 4K11A 4XRJA 3FEGA 2WO6A 3LOKA 5EI8A 4ZZOA 4ZZNA 1F5QA 4FVPA 3M2WA 2XK3A 3QRUA 1DAWA 4DT9A 4CG8A 1XH5A 2PL0A 3MS9A 1YHWA 3OEZA 5FG8A 5K0XA 3KRWA 3C5IA 2CGVA 3AG9A 4PQNA 5A54A 4L3JA 4YC6A 3NMUF 4X21A 3VUKA 4FODA 3R1QA 2GNGA 3WZEA 3F3UA 4EC8A 3G51A 3JVRA 2PWLA 4BDCA 2HZIA 3AT2A 5M53A 1X8BA 3GC8A 3EN9A 3UOLA 2VZ6A 5GINE 4DBNA 3PJCA 5DR9A 4IX3A 1OPJA 4L43A 1WBOA 4QP8A 4XG2A 3SD0A 5EM7A 4EYJA 2X6EA 3Q52A 1CM8A 1FQ1B 4GH2A 3A8WA 3LCDA 4QMXA 4ACHA 4PPCA 1PMEA 3RBWA 4ZTNA 4FIGA 1QPEA 3FHRA 4YZBA 3QTZA 4YTHA 2UZEA 3LLTA 3VS5A 4E6AA 5L2SA 4M0ZA 1SMHA 4DFBA 4I41A 5AP1A 4V0GA 3K3JA 2VO3A 2UVZA 4FC0A 4F1OA 5K4IA 1CKJA 3CQUA 3VJOA 5CF8A 4O0WA 1W98A 4FKRA 4GU6A 2VTTA 2Y7JA 3O8TA 3BEAA 4G5PA 3AMAA 1M2PA 2YM4A 4RFYA 4N6YA 3NWWA 2NO3A 5H2UA 4ASEA 4YO4A 4C02A 2W1ZA 3E87A 4FIFA 2R2PA 4X2NA 4AZTA 4CFMA 4ZTSA 5L2IA 5KBRA 3EFWA 2UZTA 4FGBA 2BAJA 5J5SA 4E4LA 1H25A 5TOZA 3HMPA 5JZNA 5KUPA 4RIYA 4QMSA 1CKPA 5DR6A 3OCBA 1P5EA 3DQXA 2WOTA 1MP8A 3QTIA 5E8VA 1ZYJA 1XQZA 3SRVA 3I1AA 5KMOA 2PUUA 2V7AA 4PF4A 3JY9A 4S33A 4UBAA 5G1XA 1B39A 4A07A 4NKSA 2ZDTA 2BUJA 3ZXTA 1BUHA 5EYMA 2VAGA 4D2RA 5LVNA 3H0ZA 1YI6A 2OJ9A 3GNIB 2CNUA 4H3PA 3OT3A 3NLBA 3QKLA 3MVMA 2GHLA 4J8MA 3LXLA 3VW8A 3DXQA 1J3HA 5BVDA 3F9NA 1KSWA 5E9EA 3L9NA 1XBBA 4YR8A 1URWA 2JDOA 2XA4A 3CE3A 3NDMA 1H0WA 2HWOA 5KZ0A 3FBVA 1OECA 2UW8A 5IUIA 3UE4A 4BDHA 3NUAA 3E7VA 4HNFA 3CR0A 2EB2A 2PZRA 4ZK5A 4IVBA 3P86A 4JBOA 4XG9A 5DI1A 4UWCA 4C33A 4FTAA 2C0OA 4YURA 2V5QA 4QMTA 1YOMA 3UO6A 3R2BA 1B6CB 4M13A 1P4FA 5FM3A 5CEQA 3MFTA 2OJJA 3PG1A 4MQ1A 3BWJA 3FY0A 4E7WA 4D2TA 4XP2A 4V04A 2WMSA 2PE2A 5FEEA 2OJIA 2UUEA 2V0DA 3PLAE 1IRKA 3GGFA 3OUKA 2H34A 2BR1A 1HCLA 4FTUA 3RINA 5CAPA 3RP9A 3T9IA 4FV9A 4DA5A 3MBLA 4ZJIA 1FGIA 4UWYA 3PSCA 1GZOA 3WF9A 4BCPA 4LV5A 4NTTA 2HZ0A 3PA3A 4KNBA 4KWPA 3R7IA 3EWHA 2R3NA 4UALA 3KRLA 2LAVA 1R78A 3WIGA 4G3CA 2YA9A 1TVOA 5HESA 1Q99A 2PZ5A 4DHFA 2RL5A 2ETMA 4LG4A 3MI9A 3LMGA 5CU4A 3MYGA 3A62A 3FKLA 5C26A 5J5TA 2OSCA 3E8CA 5AR7A 4YJPA 5AV4A 3N9XA 4Z16A 3UDBA 4IX5A 4QMOA 5D12A 4IZYA 5E8WA 5B2LA 5IQGA 4AWIA 4YC8A 4W8DA 4G6LA 2RG5A 3K5VA 2XIRA 4CLJA 4C57A 3O8PA 2C5NA 2QOCA 4GVJA 4O7VA 3HV4A 4G3GA 4U97A 2VN9A 3F3ZA 1Q3WA 3IECA 4QOXA 3VBTA 5A6NA 2QNJA 1FBNA 5I9WA 3ENHA 1NW1A 1AQ1A 3TZMA 3PYYA 3IOPA 3PG3A 3MIYA 4O2PA 4QMMA 4RWIA 1Q24A 2R3IA 3GCPA 1WVWA 3MTLA 3ORLA 4BR3A 1YWNA 3KN5A 4OAVB 3DK7A 3TNQB 4B8MA 4Q5HA 4F9WA 4BCOA 2CHLA 5CQWA 2UZWE 3FUPA 2JC6A 3JVSA 3LQ5A 5BMSA 1OL7A 3BYUA 3O51A 4HYUA 4ONAA 1REKA 1UA2A 4WT6A 4ENXA 3O50A 2DUVA 3FMKA 5AEPA 3R8LA 1J1BA 4EJ7A 3PP1A 1BI7A 3IW4A 4MQ2A 5T3QA 4MXYA 4BWXA 3EQGA 2QOFA 3E3PA 1YQJA 5J1VA 3QQUA 4L9IA 4ZTLA 4O84A 3SXFA 4QNAA 4XG4A 2C5XA 4D5HA 4W4XA 3KK9A 3FZRA 3NIZA 4N6ZA 4DGNA 2YIYA 4FKLA 5ANIA 5IQEA 5EYCA 3WBLA 2C4GA 4PL4A 2CSNA 2F2CB 3C13A 2XB7A 5JFSA 4J7BA 3GBZA 2ITNA 4EH7A 2BHHA 4KRCA 5CF5A 4M3QA 3VJNA 4NZWB 4J53A 3QX2A 4EZ7A 2F7XE 4FKIA 5KO1A 1XO2B 3R0TA 4NCTC 3SC1A 3D5XA 4YC3A 1WBNA 5I4NA 2F2UA 3KVWA 2ZMDA 4USFA 5IKWA 1M7NA 2R3JA 1GZKA 3OZ6A 4K1BA 3MWUA 4JOAA 5HICA 1IA9A 3NUPA 3SG9A 3K5UA 1ZRZA 2XF0A 4FL3A 4IDVA 3H10A 3TV7A 1VJYA 3MIAA 2CKPA 2E9UA 2A0CX 2UW5A 3NZ0A 2A27A 3PVBA 2YIWA 4FKQA 4FT0A 4HCTA 4IB5A 5KMLA 4QMLA 2CKOA 3B2TA 4HYHA 3OY1A 4DH5A 3ATTA 3QYWA 4C59A 3U6HA 3AC8A 1ZY5A 2P4IA 4G6OA 5TF9A 2AUHA 3UTOA 4Z7GA 3ATSA 3F3VA 5L4QA 5E8SA 2YDIA 3BE2A 4KABA 4X3FB 2OXXA 4X3FC 4YSJA 3I79A 2W05A 2YLEA 3THBA 2BALA 2XEZA 1IAHA 2PU8A 2NNWB 1SZMA 5AUUA 4PTEA 4QP4A 4ZLYA 3MY0A 2FB8A 5CXZA 5IG1A 1H08A 3RPYA 3FDNA 1QPJA 2WOUA 2HIWA 5AA9A 1J7LA 4J99A 1CDKA 3VBWA 3DNDA 1OPLA 2H8HA 3Q9XA 4EHVA 3I0OA 3QQHA 3RPVA 3FLZA 4JAJA 5H8EA 4LM5A 3TEIA 4EK8A 3I7CA 3LCTA 1VR2A 3D83A 3QRJA 3TTIA 4BTFA 2WTCA 3KQ7A 4H39A 3CPCA 5LMAA 5HBHA 2XRWA 4BKYA 2ITZA 2WMAA 5CAOA 2PMNX 4KIOA 3HMNA 3EZRA 4O7YA 4FVQA 5L2WA 1XH9A 1H01A 1GJOA 4RX7A 5AMNA 4BTMA 1J91A 1I09A 4U41A 4HVGA 3OW4A 4I4EA 4ID7A 4NFNA 2BZHB 4I5CA 3G90X 3PJ1A 4I24A 4EBVA 4QMNA 1KE9A 4AGWA 4S32A 4JR7A 1PF8A 3A4OX 2YM8A 4ALWA 2CPKE 3PLSA 5HVKA 4FBXA 3IW5A 3FKOA 3A60A 4IAAA 2WD1A 3PXZA 3V6RA 3TNIA 3EJ1A 3ZUUA 4H36A 4GK4A 5I9VA 4QYGA 3SOCA 3BHHA 3LFEA 4CKIA 3FSFA 4J95A 3PE1A 1ZYLA 1STCE 1PXKA 2XEYA 1GOLA 2WQNA 4IIRA 4ANLA 4C38A 5BPYA 3FLQA 3I6UA 4M84A 1YOLA 4DBXA 3ZO4A 3AD4A 3C4XA 4MXAA 4CQGA 3L9PA 3ODZX 2C6LA 3LKMA 2XNPA 4IVAA 5DIAA 1H07A 2G2HA 4IWOA 5BUJA 1PXLA 2QD9A 5FEDA 4GCJA 4D1ZA 2VRXA 3F61A 5DEYA 4QO9A 4AOIA 3OXTA 3R21A 2FSLX 2BDJA 4F0GA 2QG7A 2R3HA 4O1OA 3KGAA 4RZVA 2QQ7A 3JPVA 3Q2MA 4YMJA 3NNVA 4DGLC 3U6IA 2P33A 4BKZA 4FSYA 4O21A 2QR8A 4IWDA 4X7QA 4CFFA 4FSQA 2I6LA 3ACJA 4HVSA 3OWPA 4GEOA 3BU6A 4D9TA 4RPVA 4EQUA 5IUHA 3AC5A 5JGBA 2F57A 2ZB1A 2J5FA 4J71A 5IA1A 2A19B 4ANSA 4BCJA 3NAXA 4EK4A 2WIHA 3JY0A 3D7TA 4BDBA 3FMLA 2VTLA 4PNIA 4U6RA 2PHKA 1JKKA 4YJRA 2UZDA 3UOKA 4JXFA 4FTJA 3EQRA 5FP6A 1B38A 4FZFB 2J9MA 4PP7A 2XIXA 3L1SA 4OTQA 5AFVA 4XV9A 1H27A 4HYIA 4AFJA 4KIQA 1GAGA 3NW5A 1Q62A 5IDPA 4IZ5A 3KXHA 3TNPC 3V5TA 1JOWB 4E20A 1EH4A 5HTCA 5FDXA 4BDGA 4OT6A 3ORTA 5HBJA 3BLRA 5D7VA 5AP0A 3HV6A 5AWMA 4BCKA 2NP8A 4JBPA 2YACA 4WNMA 5IH5A 5A46A 1H1PA 2CNQA 3PY3A 4OGRA 5LJJA 3E8DA 4GSBA 4H05A 5DLSA 4TTHB 5HNGA 5KE0A 3QWJA 3C51A 4OTWA 4UXQA 5HKMA 3A61A 5J1WA 3QRTA 2F7EE 3BQRA 5I3OA 3RGFA 4F0IA 2W5BA 3DTWA 3C1XA 4CD0A 1DI9A 2RG6A 3AGLA 5BUEA 2W4JA 4IE9A 3RJCA 3LFSA 4OTFA 4WUNA 3HRCA 4BICA 4RJ5A 3LQ8A 4EOIA 3OBJA 2BFXA 5J8IA 3PZHA 2X2KA 4LL0A 5EI6A 5CVHA 4OR5A 3TN8A 4CFVA 3QHRA 3E3BX 3IONA 3HECA 4CFXA 4DTBA 3PIZA 5M09A 2W1GA 5CZIA 5GIOE 2CN8A 2C1AA 2QCSA 4O7TA 2WPAA 5FTQA 5IH6A 2VO6A 2XYNA 4W4WA 3QRIA 3NNWA 3SA0A 2HAKA 2Y0AA 1IG1A 3SW4A 1WVYA 1OIRA 5JRQA 1BKXA 2IVUA 4KS7A 1SNUA 4LUDA 1P4OA 5GJDA 5CAUA 3KF4A 4X2JA 4FEXA 4QYYA 4NW6A 2CLXA 3Q04A 4TYEA 3P08A 3F7WA 1QPDA 3PIYA 5DPVA 1R39A 4WG5A 3S95A 1RE8A 2ZV7A 3NX8A 5HI2A 5IEXA 5AAEA 4RGJA 3MH2A 4BC6A 4QP2A 2PUNA 2PSQA 1M14A 1YW2A 2B1PA 2EVAA 1W8CA 2PY3A 5CYIA 1REJA 3HMIA 4BCGA 3RALA 4WNKA 4LMNA 5EQPA 1LP4A 4LRJA 3FLSA 3OD6X 5DGZA 2O65A 4I0TA 4JR3A 2OK1A 4FSMA 4J8NA 2UW7A 1VYWA 3DZQA 4GL9A 3R8MA 4EUUA 3AGMA 5JT2A 2F7ZE 1YHVA 1K3AA 2C6MA 2YIQA 3A7GA 4E8AA 2RFSA 3M11A 4RJ6A 5I5ZA 4KA3A 1Q8UA 1ZZ2A 4K0YA 1O9UA 2OZAB 2WTIA 3CTHA 3KXXA 3TIZA 4MBIA 4APCA 3NYVA 4O7LA 1OIYA 4DLJA 1PHKA 2VUWA 3ULIA 3W8QA 3DT1A 5IA2A 4PMPA 1GIJA 4GIHA 3VBYA 3WF6A 1BL6A 1ZOGA 3ORMA 3AMYA 3FQEA 3LLAA 2OH0E 3LM0A 5C4LA 3FXZA 5I3RA 1UU8A 4M66A 3FMJA 2VWZA 3MN3A 4LRKA 4BCMA 4MCVA 4XV2A 2WIPA 2H9VA 3EZVA 4ZS4A 2Y4PA 3QTRA 3V8SA 4R5SA 2RSVA 4RVKA 3QRKA 4U44A 4AT4A 3D7ZA 4P4CA 4AW0A 3I5NA 3R00A 5F94A 3F3WA 5BX0A 3ROCA 4HGLA 4DH8A 4E1ZA 3KL8A 1CTPE 1UKIA 5DEWA 3FAAA 3QTUA 4MHAA 4PPBA 4XLIA 3VUHA 4QQTA 4FT9A 3C7QA 2C3KA 4UMTA 3VUGA 4IXPA 2QOHA 4B7TA 5IQFA 3KB7A 2W5AA 5I9UA 3HGKA 3UIXA 4D0WA 4F1TA 4M14A 1J7UA 2WEIA 3AD6A 3BYVA 3L9MA 4EKLA 5LMKC 4BGHA 2Z7RA 4GJ2A 3KU2A 3K54A 4NU1A 1PMVA 3CCNA 4NL0A 1URCA 4N0SA 2PTKA 2RKUA 5JQ8A 3QZFA 4O27B 2UVXA 4FKWA 5M06A 2XIZA 3TUDA 4DH1A 1LR4A 2PYWA 2C6EA 5E7RA 4F4PA 3P23A 5EM6A 3G15A 2BIYA 5DR2A 3N51A 3DFAA 2ETKA 4KIKB 5G6VA 3TI1A 1V0BA 2O3PA 3UVQA 3ZEPA 3VN9A 2X81A 1FMKA 2O63A 2XMYA 4IB3A 5IH4A 4GV1A 1JAMA 1PJKA 4I5MA 4XOZA 3OC1A 2ERZE 3TXOA 4F63A 2J50A 2WHBA 3UG2A 4GVAA 5AP2A 4H58A 3A2CA 3GCQA 4RWJA 3E8EA 2JKKA 2YIXA 3EKNA 3RNYA 4TYJA 5TT7A 3TV4A 1R0PA 1YDTE 2I0HA 3ANRA 3R9DA 4BTJA 1WMKA 2Q0NA 3HP2A 3Q96A 2PE0A 4G31A 4NJDA 3ZSIA 1UWHA 3GB2A 3K2LA 1F3MC 3COMA 4BCNA 3CSVA 3P1AA 4IVDA 4TNBA 2F49A 4QRCA 2ZV9A 3Q5ZA 3WZJA 2BCJA 2RFDA 2VWIA 3C0HA 4YZMA 3R7EA 4HVHA 5CSXA 4MBJA 4YLLA 4DG0E 3AC3A 4F9BA 2ACXA 2QC6A 1XH7A 3GVUA 4EH9A 5JSMA 4DEGA 2O2UA 5DWRA 3Q9YA 4UMPA 2YFXA 4I0RA 3DAJA 4RIWB 3QLGA 2B52A 4MNEA 4G9CA 2Z02A 2CLQA 2WMUA 4H3QA 3EFJA 5L8KA 4X6RA 4F9AA 2OW3A 1YXTA 5AP4A 5AR3A 1KOBA 4B99A 3E63A 3EL8A 3KMMA 3QYZA 3Q2JA 2VX1A 3OWJA 3KXMA 4ZZMA 2ERKA 4BDKA 5KMIA 3RAWA 3ITZA 4QMVA 4X2KA 2B54A 3BEGA 4CQEA 1S9JA 3GQIA 5JKGA 5C8MA 1DAYA 1TQIA 2C5OA 3D94A 4IEBA 3ORKA 4AA4A 2HELA 3HV5A 3F2AA 2XIKA 3DDQA 3UIMA 3UNJA 5L3AA 5IA4A 3IW6A 5FM2A 1JLUE 3LW0A 3F5GA 1M2RA 3NUUA 5EQYA 1KE6A 4BN1A 1KWPA 4YZNA 3ZFXA 3WE8A 1R1WA 4R3RA 4G9RA 2VTOA 2GMXA 3D2KA 2OICA 3PJ8A 4AE9A 2GNFA 3CXWA 2X7GA 2IG7A 4O7WA 2WQBA 3BX5A 2WTKB 5T6KA 3TCPA 3IOKA 2G2FA 1JKLA 2QOOA 2WTKC 4O7ZA 4HZRA 1MRUA 1ZYCA 5TO8A 2C3IB 2ITTA 4RQVA 2GDOA 4YBKA 3DAEA 3EOCA 3Q4ZA 4U0IA 4AAAA 4EUTA 3PDTA 3DK6A 4KRDA 4S34A 5L6OA 2WKMA 3IW8A 4G5JA 3ZBFA 4ZSLA 2ZM1A 5EOLA 3BU3A 3R30A 4R8QA 4EWHA 5C8KA 3MVLA 1J1CA 5KMJA 4LFIA 3DBEA 3KCKA 4O0SA 3HDMA 4C4HA 4IB0A 4BZDA 4I22A 4R3CA 4FSWA 1HCKA 4OTPA 2C30A 2ONLA 3S3IA 5J7BA 3ZM4A 2PZPA 5FBNC 3I0QA 5D41A 3WE4A 1KOAA 4HVIA 4NM5A 4C3RA 4C8BA 5DNRA 3GC0A 4R1YA 3PXQA 4RLLA 3HUBA 4RVMA 2HY81 3UIUA 3BZ3A 5HZNA 2EWAA 3V6SA 4I21A 5HHWA 3ZH8A 4BDDA 4C37A 1ZYDA 3BYOA 1YKRA 3P78A 4GT3A 3OTVA 4II5A 4ANNA 4AS0A 2CCIA 2QKWB 5JGDA 3E92A 3OUNB 2X6DA 3SOAA 1ZAOA 4U40A 4PY1A 3LHJA 5L6PA 2WEVA 4BI2A 4LQMA 2B9HA 4Q9ZA 2W06A 3F5UA 4AW5A 4OTRA 3LCOA 2OF2A 5EYKA 3HRBA 4FSRA 5AJQA 5CEIA 4KINA 3F3TA 3PUPA 2CGUA 4BIDA 4BDAA 4TN6A 3LMHA 2XNOA 3IDPA 5CAQA 1ERKA 4IJ9A 3DGKA 2OIDA 2UZLA 4H3BA 4Q2AA 1BMKA 2WMWA 4DLIA 1JKSA 3A99A 3I81A 3V5LA 5KMKA 2QODA 4U7ZA 4DC2A 4ERKA 5D7AA 4UMQA 4YJVA 2P2HA 5K0KA 2ZOQA 1YXVA 3R28A 3ZOSA 2KTYA 4FTIA 4JG8A 3FMHA 4K9YA 4NT4A 5HCYA 5B2KA 4QMQA 5ANGA 2GNIA 3VW6A 5M07A 3BPRA 3U8WA 4CLIA 4B9DA 4MF0A 1NXKA 4WHZA 4OT5A 4L3PA 1KUTA 3NNXA 3C9WA 3O7LD 4MK0A 2BRMA 4I4FA 3EN6A 2IZTA 4YP8A 1E1VA 3CP9A 3ZONA 2B9JA 5JZJA 4L01A 4O86A 2HW6A 2BMCA 4EZ3A 2J0JA 4OUCA 5JEBA 4AXAA 1NVQA 1UU7A 2JLDA 2LGCA 2Y8OA 3DKCA 3AT4A 3VS3A 2PK9A 4BCHA 3E5AA 4NW5A 2PPQA 3EYGA 3C0GA 2PVYA 3PVUA 2EXEA 3HNGA 1U5QA 3DB8A 1G3NA 4RRVA 4XP3A 4I20A 3CJGA 1KV1A 2JDVA 5IA3A 3UYSA 3UYTA 3L8VA 4ASZA 5A3XA 2C0IA 2R3QA 4OW8A 3RK7A 5BYYA 2EB3A 1H8FA 4TWPA 1H1SA 4Z9LA 3PZEA 4ZTMA 5HD4A 4W9WA 4RT7A 3KRJA 3ELJA 3VS1A 3FYKX 5AR5A 4BBEA 2A1AB 3A7IA 4HYSA 1OL2A 2HW7A 2QHMA 2UW6A 3E88A 3R7UA 4BI1A 1LEWA 3FLNC 2C5VA 5ACBC 3BLHA 1DI8A 3RI1A 4A4LA 3LMIA 2OLCA 4IFCA 4WSQA 5H8BA 3ALNA 4UX9A 3G0FA 5C01A 4YJSA 3DAKA 5L2TA 5EQEA 5TE0A 3W55A 4AACA 4R3PA 4EZ5A 4EK5A 4F6UA 3MSSA 2X8IA 2BDFA 4F7LA 1T45A 2XNNA 1PYXA 3FE3A 3I7BA 3KULB 3VC4A 1Z5MA 4DH3A 1E9HA 2PVMA 4FV3A 4NWMA 3Q32A 4JG6A 1Q8TA 4OBOA 3DDPA 5GNKA 2PULA 4FGRA 5KX8A 2O64A 3F7ZA 3UZPA 4YPSA 3K3IA 3PJ3A 3DJ5A 3OW3A 4XHKB 3H9FA 3LXNA 4BL1A 5I9YA 5DBXA 4O1PA 4EK3A 5LVPA 2JDTA 4JBVA 4L00A 4DEIA 3U9NA 2ESMA 5TKDA 3U6JA 3QCSA 5AUXA 3DPKA 2GQRA 3ZXZA 2G01A 4DCEA 4GKHA 2X7FA 1SYKA 4LOPA 2OO8X 2WQEA 4E6QA 5KKRB 5ANOA 4WG3A 3QQFA 3FL5A 3VRYA 5KKRC 3P79A 4FKJA 5CAVA 1WBVA 4AX8A 2GU8A 5F4NA 3R7VA 4FTQA 2UZOA 3NNUA 3Q53A 5EHLA 3SHEA 3UJGA 5EI2A 2O5KA 3MB6A 2ZM3A 2VTHA 2BAKA 2IVTA 5CALA 3BELA 4PDPA 2VTRA 3NVMB 4FG8A 3TL8A 3OXZA 2YWPA 1BI8A 3NYXA 4EQCA 4AZVA 4Q5EA 4FSZA 4W9XA 3MPAA 4G3DA 4E4XA 3G6HA 4YLKA 1AGWA 5IF1A 4A9TA 2JIIA 4JDKA 5AV2A 3R9NA 4ZY5A 2YDKA 5EK7A 4YZCA 5M51A 2JKMA 5FUTA 2QURA 4XNEA 1UKHA 3ORPA 4M8TA 2R5TA 2UZVA 4RZWA 5HX8A 3EQIA 5ETAA 5CXHA 4JQ8A 3ZLSA 3TNHA 5FEQA 3EN7A 5LVMA 2OJFE 3FI3A 3QQLA 4C36A 3NUSA 5JN2A 1RQQA 4ITJA 4E4MA 4ZSAA 4L67A 3NCGA 4HOKA 4EH4A 4EI4A 2WB8A 5ETIA 5HNBA 4DFNA 4BHZA 2HY0A 3UPXA 1OM1A 5HVJA 3R9HA 4JDIA 3ROYA 3NEWA 4FV2A 5LOHA 2VO0A 4CYIA 3DJ6A 3R73A 3OP5A 3CGOA 4FZ6A 2YISA 5AA8A 2AC5A 3FI2A 3VF9A 5ACKA 4V0GB 2YM6A 4A9YA 1OUKA 3DNEA 3QUPA 4EEVA 1FVVA 3NYNA 1ZLTA 4HGTA 4JX7A 4ZSGA 5JFXA 3TNWA 4XG7A 3UP2A 2XNMA 3BIZA 1WFCA 3ERKA 3POZA 2DWBA 2OFUA 4IJPA 4BKJA 5C8NA 4ACGA 4CFUA 4FKTA 5IU2A 3VWAA 4FYNA 5HLWA 5IISA 2QU5A 3QTQA 3T3VA 1PXOA 2EU9A 3TZ8A 3N4TA 2Y6MA 5KBQA 4QMUA 4RIYB 4TZRA 4U80A 4AW1A 2BRNA 3POOA 2QR7A 3ODYX 3SRVB 2HK5A 2R3MA 2UV2A 3FKNA 4MAOA 4YHTA 4D5KA 5JGAA 5AV3A 2WQOA 3ETAA 4AT5A 5IQAA 3Q9ZA 4WBOA 5HO7A 3QQJA 3WYXA 4JLCA 3D5WA 4TXCA 4YTIA 2JIVA 3E7OA 4RBLA 3DBDA 4RFMA 5ANEA 4RC4A 3MY1A 3R7OA 3RWPA 2EXMA 3L8XA 4MD8E 3DOGA 1JSVA 4XCUA 3RZFA 2GNLA 2BFYA 3L8PA 3PSBA 5CZHA 3UQGA 5J9YA 2C3LA 3HKOA 4BBMA 4UXLA 3DKGA 4O96A 3QCYA 4Y85A 2JD5A 3QU0A 5BMMA 2Z60A 4KAOA 4AA5A 2JDSA 2C6KA 4DG2E 3GU7A 5JH6A 3KY2A 1GNGA 2GHGA 3D5VA 2WMRA 2QHNA 2HWPA 4O7NA 3NUXA 3V04A 4KKEA 2XKEA 4DGOA 4FMQA 2UW0A 3MV5A 3ALOA 3C4ZA 4BZOA 4MXOA 3R71A 2ZV8A 4U79A 3ZLWA 4AFEA 5HORA 5E4HA 3G2FA 3GOKA 4HPUE 3LXKA 1H4LA 4JQ7A 4BDJA 4EONA 4AN3A 3DTCA 1SVHA 3HA8A 4U8ZA 2J2IB 4RC2A 1NVSA 3DBQA 2R4BA 2B0QA 4K18A 1V0PA 3FXXA 3UG1A 4M97A 3NUNA 5C9CA 4A9SA 3GQLA 3HVCA 3UQFA 2VTAA 3W2SA 4D4RA 5CNOA 2B53A 4GFGA 3GENA 4YJOA 3CGFA 2C1BA 4XJ0A 4ZTHA 2C47A 5BVKA 1Y6BA 4GG5A 3VO3A 4JIAA 1RW8A 5CI6A 5DMZA 4U81A 3RWQA 5EDQA 2BRBA 3IK3A 5EM8A 3W32A 2NRYA 3DKFA 3FI8A 4A7CA 3GXLA 3R63A 3LFBA 4KIPA 1YWVA 5HO6A 3RM7A 3QCXA 3CPBA 2VTJA 4DT8A 5C1QB 5GZ8A 1VEBA 3FLWA 3VQHA 2VTPA 4MXZA 2ITUA 4FIEA 2PVKA 3EMGA 3A7JA 3GU5A 1WBSA 2V7OA 4ERWA 1G8AA 2C69A 4C7TA 3EQCA 4CGAA 4NSTA 2BZKB 3HLLA 2YCFA 4CTBA 3H9RA 4U42A 4XLVA 4EOMA 1FOTA 3OY3A 2V22A 3QX4A 5IDNA 4RJ3A 5DYJA 2YAAA 3TKIA 4WRGA 4CCUA 2IVVA 5AUVA 5BVWA 4B0GA 3IS5A 5HG5A 5AP3A 4D2VA 4PMSA 1YI4A 4V01A 2W1CA 1XH6A 3QZHA 1SM2A 4I94A 1PRYA 2OF4A 4HCVA 4FIIA 1PXJA 4LRMA 2ZMCA 2G9XA 4DEHA 4AGDA 2PMIA 3WF7A 1FGKA 4MVFA 4Y5QA 3OCTA 4D58A 1U54A 2UW4A 2XK7A 4ZIMA 1BX6A 3LQ3A 4KKHA 1JSTA 4BGQA 1DS5A 4MD7E 4QTAA 1ZMVA 3R83A 3BWFA 2BKZA 3QXOA 2XS0A 4FTNA 5DFPA 3OCGA 4E73A 2BROA 4ALUA 2X39A 4XG3A 3CBLA 4TY1A 5EDRA 3R1SA 5BVFA 5HNIX 4NM3A 4D1SA 2W96B 4LGGA 4JI9A 4WKQA 2QOBA 3RTPA 4TW9A 4PWNA 3QL8A 4FA2A 5ETCA 5I9XA 2XNEA 4OTGA 2ITQA 3GFWA 4JIKA 3CY2A 2HYYA 3IG7A 2EXCX 3EQHA 3P7BA 4I5PA 2QU6A 3B8QA 4B6LA 3AC2A 2FSTX 4P5QA 3ZC6A 1ZMUA 3CKXA 3SLSA 3CIKA 5GZAA 3OVVA 4EJNA 2WTVA 3W16A 3H4JA 4JJRA 4DTAA 2FGIA 4FZAB 3NW7A 4TYHA 3TG1A 5IEVA 2ETRA 4F9YA 3OS3A 1U46A 5J87A 3OXIA 3EL7A 4N57A 5DG5A 3ZUVA 4RIXA 2VU3A 2X8DA 3PFQA 4ZP5A 5ETFA 4GT5A 3EN5A 2BTRA 3CQWA 3AOXA 3LJ0A 3RAHA 2VNWA 2R3OA 4F99A 3PE2A 4D4SA 3G5DA 5L8LA 3PRFA 2BZJA 1M17A 4TYGA 4D55A 4A9UA 5AIRA 3ZFYA 4IADA 4Z55A 4Z7HA 4E6DA 3KVXA 4YGAA 4O0VA 3DCVA 4WA9A 5D9HA 3ORXA 3Q4TA 1JBPE 1HOWA 4IW0A 1OPKA 4R6VA 5A4QA 2VWXA 4BF2A 4BZNA 2GTNA 3M1SA 3P7CA 4G34A 4U43A 3MGYA 3TM0A 3F5PA 1G8SA 5A14A 3IPHA 1UVRA 3G0EA 5HCZA 3D14A 1WAKA 1Q8ZA 4FUYA 4ZTQA 3F69A 5CT0A 4IX4A 3BYSA 3ZLYA 2WAJA 4CT1A 3C0IA 5FXQA 5KMMA 1OIQA 5TR6A 2BKKA 5BYLA 4FTKA 3D0EA 3R1NA 4NM7A 5HG9A 4EOKA 4MF1A 2V62A 2X9EA 4GK2A 3EN4A 3FC1X 4YNEA 4IM0A 4X2GA 4Y73A 4IMYA 4RA4A 4BBFA 1H24A 2NRUA 2JGZA 4FTRA 4I6BA 1IR3A 3FMNA 5D10A 2W4KA 3LFCA 5F20A 5ANKA 4IH8A 3WZDA 3F5XA 4QT1A 4UY9A 3UODA 4OTHA 5HE2A 3WILA 3BE9A 3HAVA 4USDA 3WARA 4MD9E 3QKKA 2IZSA 2X9FA 2XK8A 3UOHA 2E9NA 4EHZA 5LXMA 4LOQA 4D28A 5EHOA 5A4EA 4MYGA 1MRYA 4QQCA 2XRUA 3TACA 3VBXA 4AZWA 3NPCA 1UNLA 2C0TA 4I23A 5DRDA 3JS2A 5EOBA 3AXWA 2GS6A 5K3YA 3QUDA 4MWHA 3A7FA 3V5QA 1UNGA 4M69A 2ITXA 3AC1A 4P5ZA 4RMZA 2PUPA 3R2YA 1QL6A 3EHAA 3V8WA 3CTJA 3GU4A 4OBQA 4OAUC 3L9LA 2XM8A 1IASA 4XX9A 5CT7A 5E8UA 4F7JA 4PDYA 4FKPA 3CEKA 1MRVA 4B4LA 1WBTA 1Q5KA 3HL7A 3P9JA 4G6NA 1UU3A 3QLFA 2RFEA 4QD6A 3WZUA 2AYPA 4JS8A 3ANQA 2YJRA 2XCKA 2ZM4A 3PY1A 3R6XA 4AG8A 2VNYA 3HMMA 5E90A 4QPMA 2IN6A 5FDPA 4FNZA 4FV8A 5HOAA 2B4SB 2R3PA 3D7TB 3OG7A 3ACKA 3MPMA 4J97A 4UZDA 3UMWA 5A6OA 1R0EA 4K33A 4QYFA 5CU0A 4LV8A 5K9IA 2YZAA 4ZEGA 4ZJJA 4CCBA 2WMBA 1H26A 4JQEA 5M56A 3MH1A 2HENA 4X0MA 5FGKA 4DYMA 3FHIA 3F2RA 5FXSA 5HD7A 3UZTA 3UVRA 5HTBA 5JK3A 5IQDA 1PXNA 3ZBXA 5A9UA 3HV3A 2E9PA 3L8SA 4CRLA 5LCJA 2X2MA 3MTFA 3UC4A 5H8GA 3IDBA 4QP9A 4YHFA 2G15A 4EH6A 2OWBA 4ZTRA 1KE7A 2CKEA 4FKUA 5CSHA 2RF9A 4RJ7A 3FPQA 1GIIA 4EWQA 3R7YA 2I40A 3EB0A 3KXZA 4I1ZA 4PTGA 1IEPA 4M0YA 1P2AA 2AC3A 2WMTA 3F82A 4D9UA 1OB3A 3O23A 2ITVA 3IGOA 4BYJA 1CSNA 4DGGA 3QA0A 3QC4A 2VD5A 3KKVA 4L68A 1WVXA 4FIJA 4IACA 5CU3A 4NIFA 4RX8A 1V1KA 5K4JA 3CY3A 5HLNA 3NGAA 5GJGA 2YAKA 3COKA 4ITIA 5GHVA 3MFUA 4C4FA 4XV3A 4OTIA 5HE1A 4NUSA 3SAYA 4FTOA 4DINA 1L3RE 2QOQA 4O0UA 2P0CA 3R9RA 4E26A 3W8LA 4F64A 2W1HA 1Y57A 2XNBA 3BHUA 5CVGA 3SVVA 4CTCA 4OTDA 5FXRA 2WXVA 4FK3A 2F4JA 4JX3A 1OKWA 4MXCA 2R3FA 4FR4A 3LZBA 2JBPA 4DH7A 3ENMA 3OTUA 4KD1A 4V05A 3FC2A 4AU8A 4JL9A 5C03A 4D2SA 3GI3A 4PL5A 4JT3A 2GFCA 3RAKA 4CEGA 2WU7A 1IA8A 4YNOA 5EYDA 4BCIA 3COIA 4PPAA 3ZEWA 5EW9A 5HU9A 2OG8A 2YWVA 3IGGA 2FH9A 4UZHA 3CS9A 1OKYA 3BRBA 3LFAA 1SVEA 3QD3A 3FLYA 3IKAA 4ZS0A 5FQDC 2VWVA 3W2OA 2J5EA 4FOBA 4BFMA 3QXPA 3AQVA 3ZRKA 1W83A 5AR8A 4EORA 2I7QA 5IQIA 1XR1A 1K2PA 1PXMA 2ITYA 2OH4A 4FE2A 1A9UA 4LL5A 2WELA 4C58A 3DK3A 5JMSA 2R64A 2QO7A 2OIBA 3FZ1A 4RSSA 1YI3A 4L52A 3VHEA 3QTXA 3VBQA 3C4WA 4NKAA 5ANJA 1O6YA 5EDPA 4WRSA 1QPCA 3F88A 2H96A 3KMUA 3OWKA 4XG8A 5EG3A 3DLZA 4FSUA 2IJMA 5CI7A 2YABA 3ZUTA 4F09A 1QCFA 1BLXA 2UZBA 2JKQA 4P7EA 4I0SA 3T3UA 5HEZA 3JXWA 2E2BA 4LUEA 3VVHA 2IWIA 3ZRLA 4M68A 5IMEA 2OI4X 4UN0C 2Q83A 1PXIA 3RNIA 2HCKA 3W2CA 4EH8A 3UMXA 4UYNA 3E62A 4LMUA 3DA6A 5FLFA 4FX3A 4CV8A 5HQ0A 3KFAA 4L46A 1APME 3U4UA 2Z7LA 5EKOA 2JITA 5F1ZA 3A8XA 4QPAA 4FEWA 2YCQA 3GEQA 4J1RA 4TT7A 3PTGA 3HP5A 1GY3A 2YM3A 5BNJA 3BGPA 3VUTA 1KE8A 4AOTA 3O71A 5T68A 4Q9SA 4A9RA 3WI6A 2XK6A 4FSTA 4I93A 1FPUA 2ZVAA 3HDNA 2P3GX 2PZYA 3GU6A 4BGGA 3QQKA 5DH3A 2NPQA 3G9LX 3W2QA 2PE1A 3H30A 2PVHA 3CC6A 4AE6A 2YM5A 4BWPA 1H0VA 1PKDA 4DGMA 2X1NA 2B55A 2E9VA 4IZ7A 4MKCA 3SV0A 1JNKA 2R7BA 2ZDUA 5F95A 1U5RA 4YTFA 4KBCA 4QP1A 3Q6UA 4C4JA 4EHEA 4DE4A 2I0YA 5LWNA 4TNDA 3QQGA 1XBCA 5DA3A 2XKFA 3CTQA 4IAZA 3PXRA 2XH5A 2IW8A 2XM9A 4FNWA 3PWYA 3JUHA 5BUIA 3MB7A 2BIKB 3GFEA 3I6WA 2CCHA 4XV1A 4A4OA 4EH2A 1NT2A 4BHNA 3C5UA 3FMDA 3TJCA 4K77A 4O91A 3RZBA 4E5WA 1OKVA 3KA0A 4KBAA 2Z7SA 3RAIA 5BQ0A 4CVAA 3QA8A 5LARA 3QBNA 2OU7A 2X0GA 3UPZA 5KZIA 3II5A 3D4QA 4CZTA 3CLYA 4YSMA 2J51A 1YRPA 1CKIA 3QZIA 5EH0A 3FMMA 5JQ5A 4F1MA 4RX9A 4TWNA 3FWQA 3PY0A 1W82A 2XVDA 4PDOA 4Y72A 4CG9A 1NVRA 4RWKA 4FNYA 3VF8A 5HIEA 4IC8A 3OROA 4OBPA 2PMOX 3I5ZA 4YLJA 5DOSA 3OFMA 4AT3A 4EOQA 4O83A 4MNEB 4EOPA 4ZY4A 2YHVA 3LFDA 5HCXA 2W5HA 4AZEA 4QMPA 5CU2A 3V5PA 4KKGA 3NAYA 3OOGA 4D4YA 5IQHA 2Q0BA 4ZOGA 4U3YA 5EW8A 5CENA 2G1TA 2CMWA 2R3GA 4QP6A 4AQCA 5CEOA 4DCAA 3P0MA 3ORZA 5DHJA 2GPHA 3DXNA 4CFNA 3UBDA 3U4WA 2QI8A 2WTWA 4FNXA 4NH1A 4YJTA 4XP0A 2PVRA 3TTJA 3V8TA 3PWDA 3KCFA 4WUAA 3O0GA 3OHTA 3TIYA 2XNGA 4ZLOA 3SW7A 2YLFA 4ASDA 4BI0A 2W9ZB 1XHAA 2OIQA 4Y5HA 3R8UA 4GIIA 2IO6A 2ITPA 4TWCA 4MTAA 4XOYA 2B9IA 2REIA 4L6QA 4QMWA 4O22A 4MBLA 5HGIA 3PXFA 3DKOA 3BBWA 3LXPA 4PTCA 4EK6A 2C6DA 3M42A 1H28A 4GS6A 2WMVA 3LJ2A 4MH7A 5BVNA 3MH0A 5AR4A 2W99B 3H3CA 2BRGA 4W4VA 1M7QA 3LE6A 2CGWA 4E4NA 4F08A 4QQ5A 3RVGA 1JVPP 3TV6A 4IM3A 3BI6A 4PMTA 4KS8A 3Q4UA 3EFLA 3O2MA 4DFYA 2C6OA 4GW8A 5IEYA 4NCTA 2BPMA 4PRJA 2J0KA 5C4KA 3RK9A 5JFVA 3W10A 4U9AA 4N4SA 2PMLX 4W8EA 3HAMA 3HEGA 2J7TA 5FRIA 2J0MB 2XCHA 3PJ2A 3QTSA 5HIBA 1H1QA 3BV3A 3OF0A 5EKNA 3DQWA 3D5UA 4CYJA 1FINA 2ONLC 3SG8A 4E3CA 4M7IA 4EL9A 1OVEA 3SXSA 1YOJA 1FVRA 4BDEA 1W7HA 3SX9A 5IQBA 2IPXA 3DFCB 4J98A 2P2IA 5AV0A 5FTOA 4FEVA 4D0XA 3GP0A 1A48A 2PVJA 4YBJA 3PP0A 5KHWA 4CZYB 4E93A 4UB7A 4HCUA 4IZAA 5GIPE 4X3FA 1NA7A 3NIEA 4GK3A 4DTKA 1OGUA 2O8YA 4H1MA 4L8MA 2YJSA 4RVTA 4S30A 5CTPA 5HO8A 4FK6A 1DM2A 3R1YA 4FF8A 3VUDA 2VWYA 4P2KA 3F6XA 3QKMA 1PW2A 4HJOA 4U45A 2PVLA 3FQHA 2OKRA 2ZV2A 4LOOA 3IW7A 1Q8YA 4O0RA 4WD5A 3H9OA 4YJQA 3B8RA 4XS2A 2C5YA 3LFQA 2FSMX
chains in the Genus database with same CATH superfamily
4O81A 2WZJA 3S2PA 4CMOA 5CX9A 5FTGA 3C4CA 2ZJWA 3S0OA 3UNZA 3UNKA 3S4QA 5CEPA 4QTCA 2GQSA 1Q3DA 2VTNA 4QYHA 1BYGA 4R7IA 3T8OA 5F9EA 3UZRA 3NW6A 3UVPA 4PL3A 4YJUA 4G2FA 3AD5A 3FJQE 4QNYA 2XBJA 4NJ3A 5CSVA 4E6CA 1YVJA 5AAFA 3RPSA 3U9CA 2CN5A 5AIKA 2WMQA 2IEWA 3U51A 4EOSA 4DFZE 4BIEA 2I0EA 3QGWA 4YU2A 4O7SA 5L8JA 3Q3BA 4IAKA 4WSYA 3VAPA 1WZYA 4AUAA 4IWQA 3NVKI 3Q6WA 4K2RA 1JWHA 3EH9A 3RK5A 5CASA 4O7RA 4R7BA 2W4OA 3O96A 3TDWA 3ZO1A 4FT5A 2XKDA 5L6WL 2UZNA 2YITA 1Q97A 4X3JA 4IFGA 2HXQA 4ZXTA 4ZMFA 2QOKA 4AW2A 4BB4A 3IQ7A 4QP7A 4WOVA 4E5AX 4C2VA 1Y8YA 3LFFA 3MFSA 5D11A 3AC4A 5IUGA 3N4VA 4C4GA 1OL6A 4S2ZA 4FIHA 4TL0A 4ZY6A 3UO4A 2VTMA 2J90A 4ANBA 4D4VA 4IAFA 3DZOA 3QD0A 3QCQA 3PXYA 4MXXA 5ANDA 1LPUA 4FL2A 2YEXA 5A4TA 2VGPA 5EW3A 2QLQA 4G3EA 2C6IA 1E1XA 4FI1A 3FZTA 2BVAA 2QLUA 2EUFB 1JPAA 3BHTA 2IZRA 2R3RA 4DITA 3DS6A 2XIYA 3UP7A 2JFMA 3W0SA 1V0OA 4CSVA 3BHYA 3HV7A 3C50A 1Q41A 3W18A 3JYAA 3MJ2A 4B8LA 5ICPA 4GUEA 3FI4A 4EQMA 1PMUA 4ANMA 5A4LA 2Y6OA 3LCSA 4R1VA 3TUCA 3KF7A 4RWLA 4ENYA 4AAYA 2GNJA 2J4ZA 4G1WA 4KSQA 1ND4A 4DEEA 1U4DA 1LEZA 3BKBA 4XUFA 3ULZA 5LVLA 3PA5A 4UMRA 2XKCA 2JAMA 3QUEA 3NCZA 3CD3A 3ORIA 4YHJA 3TUBA 1L8TA 3D2IA 4D2PA 5IQCA 4Y46A 5E1SA 5AUTA 4IANA 5CF4A 1W2CA 1T46A 4WG4A 3JR1A 4M15A 4FG7A 3E8NA 1Q4LA 4FV7A 4EH5A 3OWLA 4ARKA 2CJMA 5FWKK 4EOOA 3DU8A 1Y91A 2UZUE 2W1IA 4HZSA 1OBDA 3ZYAA 4C35A 2W17A 4QYEA 4HGSA 4MNFA 3P7AA 3FMEA 4IM2A 4XYFA 4GKIA 3F2NA 2FA2A 4D2WA 2GHMA 3EKKA 5E8YA 2W7XA 1Y8GA 4UV0A 4EH3A 2X8EA 3ZFMA 4RG0A 4FV4A 3TWJA 2GFSA 2QO2A 4NFMA 4ANOA 4KBKA 3VS0A 2HXLA 3WF5A 4F6SA 1IAJA 4WBBB 1QMZA 3Q5IA 3FZSA 4FTMA 4C3PA 5HG8A 4YPDA 2WMXA 3D15A 4YZDA 3SDJA 4HW7A 3RPOA 2XUUA 3TT0A 3CJFA 3DBCA 2C6TA 5CU6A 1YXXA 4AOJA 5HU3A 4XBUA 4HVDA 3S00A 3QALE 1AD5A 2XP2A 2RFNA 3RCDA 3R9OA 4QPSA 4CFWA 1M2QA 1OMWA 3LVPA 4GJ3A 4GYGA 1KV2A 4O2ZA 2X2LA 4I92A 4TWOA 2CGXA 4XG6A 4ACCA 4AF3A 2BAQA 3QGYA 2XZSA 1FMOE 1Q61A 3VS6A 4IHPA 4O38A 4FTTA 4GRBA 3KK8A 3G9NA 3PPKA 3KIOC 3I60A 4DEDA 4ZJVA 2OGVA 4BDFA 2UW3A 3EQBA 3FL4A 5CS6A 4BYIA 1WCCA 4X2FA 1OL5A 4FG9A 3EQPA 5AP5A 3BGQA 5E92A 4CV9A 5JFWA 2VV9A 4JDJA 1ZY4A 3EQFA 4L44A 5AP7A 1UU9A 1XH4A 2WU6A 3ZTXA 2UVYA 4ITHA 4C3FA 5M08A 3BYMA 1YXSA 3FZPA 2W1DA 4DFLA 5KMNA 3DXPA 4G3FA 5E8ZA 3UIBA 1CMKE 1W0XC 3BU5A 3CKWA 1YWRA 3EIDA 2XJ0A 2RGPA 4QDVA 4M67A 4RVLA 3S1HA 3HMOA 5HX6A 4FV0A 2VTSA 5AX9A 3HYHA 2P55A 4WNOA 3ZZWA 1PYEA 2ZYBA 1H00A 5E1EA 2CDZA 5AUYA 3BLQA 4FL1A 2FO0A 4FKVA 5AAGA 4BCQA 5HE3A 4ZMEA 2IZUA 3MW1A 5AX3A 2OZAA 4IBMA 4F0FA 2R0IA 2JDRA 3W1FA 2JFLA 3QC9A 1Q8WA 3FY2A 3PIXA 5CY3A 2BHEA 4S31A 2YCRA 4JRNA 2R3KA 5M4UA 1Z9XA 3FSKA 4R5YA 1H1RA 5FD2A 5AM6A 2JKOA 4BIBA 3PVWA 2Z2WA 2I0VA 3VUIA 3TKUA 2CKQA 4FSNA 3LAUA 5I9ZA 5GJFA 2E9OA 4RLKA 5DT3A 4BCFA 2VWWA 4FZ7A 4ZSEA 5KCVA 4L53A 4BJJB 3B2WA 4IAIA 3UGCA 1NY3A 4DEBA 1OZ1A 2J0LA 3UC3A 1MQBA 2WFYA 1RJBA 3RHKA 5FBOA 2IVSA 3LJ1A 5EHYA 4O0YA 2XBAA 1XKKA 3TKHA 1O6KA 3P4KA 5EFQA 3VHKA 3BLAA 5M4FA 2YM7A 4QMYA 4FVRA 1ZOEA 3ZZEA 1UWJA 2VWBA 1OL1A 3GUBA 3I4BA 2JAVA 5LMKA 1VZOA 5J95A 2YN8A 4XRLA 1YHSA 5CEMA 1S9IA 2Y9QA 3KEXA 3RPRA 2JBOA 4PDSA 4RJ8A 3SKCA 3UOJA 1W2DA 2YCSA 3BHVA 3V5JA 4DFXE 3FXWA 5DT4A 1ZZLA 4H1JA 2BRHA 4LGDA 3W33A 1J7IA 3IDCA 4XBRA 4EYMA 4CMTA 3COHA 1I44A 4QTDA 5LVOA 4KIKA 4K6ZA 2XALA 5BYZA 4WIHA 5AUWA 4NM0A 4P90A 4LYNA 2H6DA 3FPMA 2J0IA 2V55A 2DYLA 5LCKA 1F0QA 3MVJA 4FTLA 1ZOHA 2GQGA 4O82A 2IW9A 1WBWA 3GC9A 3LCKA 4PV0A 2XK4A 3FQSA 3PXKA 4FT7A 5HG7A 3HX4A 4XH6A 3WOWA 4EHGA 2VTQA 3DY7A 4AP7A 4GG7A 1OITA 2OZOA 1GZ8A 4YTCA 3OMVA 4O6EA 5CEKA 5IMXA 3RKBA 4LI5A 3UDSA 3ZC5A 2OBJA 5IPJA 5KNJA 4JVGA 4C4EA 1XBAA 2JIUA 2FVDA 3V5WA 5GZ9A 2BILB 3ORNA 4EC9A 4ASXA 5CSPA 3R01A 4C4IA 4TRLA 4UYAA 3WIKA 5CQUA 5DN3A 1PMNA 2PVFA 3ZLXA 2Z8CA 1PXPA 2GS2A 2WTDA 5HBEA 3U54A 4JBQA 3QZGA 2W1FA 1MUOA 4JG7A 5LQFA 4PX6A 5M4IA 2BZIB 2G2IA 5LWMA 3D9VA 2XK9A 3RCJA 3NSZA 4AN2A 4J96A 4DAWA 1H1WA 3PPJA 4DN5A 4ZLZA 4RIWA 3MY5A 4IAYA 2C3JA 3VQUA 2QOLA 5HLPA 3R02A 3WZKA 3ZDUA 4HGEA 4IC7A 2WQMA 1R3CA 5E8XA 3BV2A 2B7AA 3LM5A 4AGUA 3KC3A 5AP6A 2J6MA 2A4LA 4F7SA 2SRCA 3NR9A 4C34A 3N4UA 1UNHA 4MX9A 3FZOA 3QWKA 4O0XA 5CWZA 3WF8A 2GS7A 4KB8A 2WTJA 5A4CA 3EFKA 3QD4A 4FTCA 2VX3A 3PA4A 2PUIA 4BY9E 1JSUA 4Y95A 2Y4IB 3DJ7A 4BRXA 4AZFA 1U54B 4I5HA 4O0TA 2Y4IC 4IWPA 2R7IA 2JEDA 3VIDA 4AGCA 3ZRMA 4XMOA 3BBTB 4CRSA 1MQ4A 2ZAZA 1XH8A 4L42A 4EOJA 3ZSGA 4N70A 4F9CA 4CMUA 1PY5A 3Q9WA 2YIRA 4FICA 5B2MA 4QTBA 3TJDA 3U87A 4ZAUA 5CF6A 4YJNA 3GC7A 4IDTA 4UEUA 1JKTA 4IB1A 5JRSA 5HTIA 4KUJA 5HVYA 1YDSE 4JDHA 4DG3E 5LMBA 3ZHPC 4RFZA 4RQKA 3BGZA 1WBPA 3MPTA 3E93A 1ATPE 3MA6A 3QAME 3HA6A 3NRMA 2QONA 3W2PA 2X4FA 3VS2A 4G16A 4MWIA 2WNTA 2GSFA 1K9AA 3O8UA 1GZNA 1OUYA 3ZDIA 5IA0A 3ID6C 3ZO2A 3DBFA 2W1EA 4TYHB 4PP9A 5AM7A 2X0QA 3PSDA 4RA5A 1Z57A 1LUFA 4RIXB 5BVOA 3AKJA 4WNPA 5L2QA 3RM6A 4YZ9A 3GT8A 3ZMMA 4I6QA 2F9GA 4RJ4A 4CXAA 3PVGA 4L7FA 3QD2B 2ITWA 5CNNA 4FZDB 5J79A 4PMMA 3REPA 3VULA 4L3LA 4IX6A 2GTMA 4IVCA 4A4XA 4AZSA 2BDWA 3F66A 3ZCLA 4APPA 2R0UA 4YO6A 1BL7A 4HNIA 4R7HA 3H0YA 3ZU7A 2QKRA 1YDRE 4FKSA 3MESA 4BDIA 4FT3A 5CANA 3QHWA 3KN6A 4FKGA 3RHXA 3OBGA 1TKIA 2QVSE 3SGCA 2W0JA 1VYZA 2GNHA 4CT2A 4USEA 3VRZA 4FV5A 5I0BA 3OOMA 2HOGA 3GCUA 3G33A 4TPTA 3V51A 5ITAA 5M55A 1O6LA 4L7SA 4X6QC 5HIDA 1ST0A 3V3VA 4GMYA 1XWSA 2QOIA 3FV8A 3QF9A 3R7GA 3LIJA 5HE0A 4Z3VA 3OT8A 3R8ZA 4R78A 5M57A 4JAIA 2XYUA 5FP5A 2CNVA 4MEDA 3MFRA 2W9FB 3G6GA 1ZXEA 3NUYA 3NS9A 4FEQA 4CKRA 3CQEA 5B7VA 4FUXA 4FEUA 4TYIA 4ZSJA 4EKKA 4NTSA 3KXNA 2FYSA 4IQ6A 3R8PA 3TDVA 4U5JA 2C68A 2O0UA 2YERA 4W4YA 4GFOA 1ZMWA 4Y8DA 4F65A 3KRXA 2A98A 1OIUA 4QMZA 2OXYA 4K8AA 3Q4CA 4A06A 3AT3A 3MDYA 5C27A 4AN9A 3TZ9A 1ZARA 4I3ZA 3VNTA 4BWKA 4OLIA 5H3QA 4NK9A 3GCVA 4D1XA 3QTWA 3SQQA 4F70A 4FKOA 5DVRA 4ACMA 4BVUA 1SVGA 1SNXA 5KHXA 4G17A 5K5NA 3TZ7A 1U59A 2VGOA 4XEYA 5IZFA 3HUCA 3O7LB 4UWBA 4O4BB 5E91A 2HZ4A 2Z7QA 4JNWA 3VS4A 4R77A 1GIHA 1OBGA 5CSWA 3PRIA 4M69B 3LPBA 1KE5A 2FUMA 4CZUA 5J7HA 5AADA 2I1MA 2WGJA 3KREA 4GYIA 4FOCA 3DV3A 3NFGB 3HRFA 5D1JA 4F6WA 2ZB0A 5M4CA 4J52A 4O6LA 3MJ1A 4RIOA 5CVFA 5DE2A 1RDQE 2XJ2A 4M12A 4EOLA 1G5SA 2OJGA 3PPZA 1XJDA 2XJ1A 2R3LA 3A7HA 4Y83A 3V01A 1ZYSA 3U55A 5J9ZA 2X4ZA 2RIOA 4FV6A 4C61A 1PKGA 5CLPA 4QP3A 4RX5A 2DS1A 3VS7A 3OCSA 4LGHA 4YUQA 5DRBA 3EYHA 4I6HA 3R8VA 2YZLA 2QO9A 5E8TA 3E64A 3SXRA 4GFMA 4FYOA 5BVEA 3KMWA 4ALVA 3LFNA 1A06A 4PNKA 2BTSA 2YDJA 3T9TA 4U3ZA 4PUZA 3HZTA 4KSPA 1W84A 3R22A 4AA0A 3GU8A 5AV1A 2DQ7X 3W2RA 5M44A 3ZSHA 4BTKA 2VWUA 2X7OA 3MH3A 3CD8A 3C4EA 1P14A 3KULA 3Q60A 4GUBA 3DLSA 2HZNA 2VTIA 3MA3A 4TKSA 3UQCA 2VX0A 4FV1A 1Y6AA 1YXUA 1UV5A 2FSOX 2OFVA 4HPTE 4I6FA 5B0XA 1OI9A 3O17A 4E5BA 4DFUA 3KXGA 3QFVA 2VO7A 2R9SA 2OXDA 2QG5A 3R04A 4NEUA 3P5KA 4DF3A 3GCSA 4L45A 5DT0A 1TQMA 5H9BA 4RC3A 4ORKA 2GCDA 3VBVA 4WO5A 2ITOA 2PZIA 2UW9A 5K5XA 1TQPA 3RMFA 4GT4A 5IA5A 4C0TA 4QTEA 4UMUA 4DEAA 1M52A 1ZWSA 2PVNA 3ET7A 3FYJX 3A4PA 3BQCA 1JQHA 4EBWA 3C4FA 5AR2A 3MVHA 4QQJA 3AMBA 2KULA 3EQDA 3KRRA 4ANQA 2A2AA 3ZO3A 3WYYA 5J9LA 2IW6A 3ZS5A 5AUZA 4CNHA 4JRVA 1FVTA 3BCEA 3GOPA 5EM5A 3VUMA 4CKJA 3IO7A 4NIFB 4NYEA 4C62A 4C2WA 2B9FA 3NYOA 4F7NA 4GU9A 3UO5A 3ZM9A 4ACDA 1OKZA 3OEFX 3DB6A 4K11A 4XRJA 3FEGA 2WO6A 3LOKA 5EI8A 4ZZOA 4ZZNA 1F5QA 4FVPA 3M2WA 2XK3A 3QRUA 1DAWA 4DT9A 4CG8A 1XH5A 4AXFA 2PL0A 3MS9A 1YHWA 3OEZA 5FG8A 5K0XA 3KRWA 3C5IA 2CGVA 3AG9A 4PQNA 5A54A 4L3JA 4YC6A 3NMUF 4X21A 3VUKA 4FODA 3R1QA 2GNGA 3WZEA 3F3UA 4EC8A 3G51A 3JVRA 2PWLA 4BDCA 2HZIA 3AT2A 5M53A 1X8BA 3GC8A 3EN9A 3UOLA 2VZ6A 5GINE 4DBNA 3PJCA 5DR9A 4IX3A 1OPJA 4L43A 1WBOA 4QP8A 4XG2A 3SD0A 5EM7A 4EYJA 2X6EA 3Q52A 1CM8A 1FQ1B 4GH2A 3A8WA 3VONA 3LCDA 4QMXA 4ACHA 4PPCA 1PMEA 3RBWA 1W2FA 4ZTNA 4FIGA 1QPEA 2IF8A 3FHRA 3QTZA 4YZBA 2UZEA 3LLTA 4YTHA 3VS5A 4E6AA 4M0ZA 1SMHA 5L2SA 4I41A 4DFBA 5AP1A 4V0GA 3K3JA 2VO3A 2UVZA 4FC0A 4F1OA 5K4IA 1CKJA 3CQUA 3VJOA 5CF8A 4O0WA 1W98A 4FKRA 4GU6A 2VTTA 2Y7JA 3O8TA 3BEAA 4G5PA 3AMAA 1M2PA 2YM4A 4RFYA 4N6YA 3NWWA 2NO3A 5H2UA 4ASEA 4YO4A 4C02A 2W1ZA 3E87A 4FIFA 2R2PA 4X2NA 4AZTA 4CFMA 4ZTSA 5L2IA 5KBRA 3EFWA 2UZTA 4FGBA 2BAJA 5J5SA 4E4LA 1H25A 5TOZA 3HMPA 5JZNA 5KUPA 4RIYA 4QMSA 1CKPA 5DR6A 3OCBA 1P5EA 3DQXA 2WOTA 1MP8A 3QTIA 5E8VA 1ZYJA 1XQZA 3SRVA 3I1AA 5KMOA 2PUUA 2V7AA 4PF4A 3JY9A 4S33A 4UBAA 5G1XA 3W0QA 1B39A 4A07A 4NKSA 2ZDTA 2BUJA 3ZXTA 1BUHA 5EYMA 2VAGA 4D2RA 5LVNA 3H0ZA 1YI6A 2OJ9A 3GNIB 2CNUA 4H3PA 3OT3A 3NLBA 3QKLA 3MVMA 2GHLA 4J8MA 3LXLA 3VW8A 3DXQA 4O4DA 1J3HA 5BVDA 3F9NA 1KSWA 5E9EA 4AXDA 3L9NA 1XBBA 4YR8A 1URWA 2JDOA 2XA4A 3CE3A 3NDMA 1H0WA 2HWOA 5KZ0A 3FBVA 1OECA 2UW8A 5IUIA 3UE4A 4BDHA 3NUAA 3E7VA 4HNFA 3CR0A 2EB2A 2PZRA 4ZK5A 4IVBA 3P86A 4JBOA 4XG9A 5DI1A 4UWCA 4C33A 4FTAA 2C0OA 4YURA 2V5QA 4QMTA 1YOMA 3UO6A 3R2BA 1B6CB 4M13A 1P4FA 5FM3A 5CEQA 3MFTA 2OJJA 3PG1A 4MQ1A 3BWJA 3FY0A 4E7WA 4D2TA 4XP2A 4V04A 2WMSA 2PE2A 5FEEA 2OJIA 2UUEA 2V0DA 3PLAE 1IRKA 3GGFA 3OUKA 2H34A 2BR1A 1HCLA 4FTUA 3RINA 5CAPA 3RP9A 3T9IA 4FV9A 4DA5A 3MBLA 4ZJIA 1FGIA 4UWYA 3PSCA 1GZOA 3WF9A 4BCPA 4LV5A 4NTTA 2HZ0A 3PA3A 4KNBA 4KWPA 3R7IA 3EWHA 2R3NA 4UALA 3W0NA 3KRLA 2LAVA 1R78A 3WIGA 4G3CA 2YA9A 1TVOA 5HESA 1Q99A 2PZ5A 4DHFA 2RL5A 2ETMA 4LG4A 3MI9A 3LMGA 5CU4A 3MYGA 3A62A 3FKLA 5C26A 5J5TA 2OSCA 3E8CA 5AR7A 4YJPA 5AV4A 3N9XA 4Z16A 4O4CA 4IX5A 4QMOA 5D12A 4IZYA 5E8WA 3UDBA 5B2LA 5IQGA 4AWIA 4YC8A 4W8DA 4G6LA 2RG5A 3K5VA 2XIRA 4CLJA 4C57A 3O8PA 2C5NA 2QOCA 4GVJA 4O7VA 3HV4A 4G3GA 4U97A 2VN9A 3F3ZA 1Q3WA 3IECA 4QOXA 3VBTA 5A6NA 2QNJA 1FBNA 5I9WA 3ENHA 1NW1A 1AQ1A 3TZMA 3PYYA 3IOPA 3PG3A 3MIYA 4O2PA 4QMMA 4RWIA 1Q24A 2R3IA 3GCPA 1WVWA 3MTLA 3ORLA 4BR3A 1YWNA 3KN5A 4OAVB 3DK7A 3TNQB 4B8MA 4Q5HA 4F9WA 4BCOA 2CHLA 5CQWA 2UZWE 3FUPA 2JC6A 3JVSA 3LQ5A 5BMSA 1OL7A 3BYUA 3O51A 4HYUA 4ONAA 1REKA 1UA2A 4WT6A 4ENXA 3O50A 2DUVA 3FMKA 5AEPA 3R8LA 1J1BA 4EJ7A 3PP1A 1BI7A 3IW4A 4MQ2A 5T3QA 4MXYA 4BWXA 3EQGA 2QOFA 3E3PA 1YQJA 5J1VA 3QQUA 4L9IA 4ZTLA 4O84A 3SXFA 4QNAA 4XG4A 2C5XA 4D5HA 4W4XA 3KK9A 3FZRA 3NIZA 4N6ZA 4DGNA 2YIYA 4FKLA 5ANIA 5IQEA 5EYCA 3WBLA 2C4GA 4PL4A 2CSNA 2F2CB 3C13A 2XB7A 5JFSA 4J7BA 3GBZA 2ITNA 4EH7A 2BHHA 4KRCA 5CF5A 4M3QA 3VJNA 4NZWB 4J53A 3QX2A 4EZ7A 2F7XE 4FKIA 5KO1A 1XO2B 3R0TA 4NCTC 3SC1A 3D5XA 4YC3A 1WBNA 5I4NA 2F2UA 3KVWA 2ZMDA 4USFA 2AQXA 5IKWA 1M7NA 2R3JA 1GZKA 3OZ6A 4K1BA 3MWUA 4JOAA 5HICA 1IA9A 3NUPA 3SG9A 3K5UA 1ZRZA 2XF0A 4FL3A 4IDVA 3H10A 3TV7A 1VJYA 3MIAA 2CKPA 2E9UA 2A0CX 2UW5A 3NZ0A 2A27A 3PVBA 2YIWA 4FKQA 4FT0A 4HCTA 4IB5A 5KMLA 4QMLA 2CKOA 3B2TA 4HYHA 3OY1A 4DH5A 3ATTA 3QYWA 4C59A 3U6HA 3AC8A 1ZY5A 2P4IA 4G6OA 5TF9A 2AUHA 3UTOA 4Z7GA 3ATSA 3F3VA 5L4QA 5E8SA 2YDIA 3BE2A 4KABA 4X3FB 2OXXA 4X3FC 4YSJA 3I79A 2W05A 2YLEA 3THBA 3UDTA 2BALA 2XEZA 1IAHA 2PU8A 2NNWB 1SZMA 5AUUA 4PTEA 4QP4A 4ZLYA 3MY0A 2FB8A 5CXZA 5IG1A 1H08A 3RPYA 3FDNA 1QPJA 2WOUA 2HIWA 5AA9A 1J7LA 4J99A 1CDKA 3VBWA 3DNDA 1OPLA 2H8HA 3Q9XA 4EHVA 3I0OA 3QQHA 3RPVA 3FLZA 4JAJA 5H8EA 2X0PA 4LM5A 3TEIA 4EK8A 3I7CA 3LCTA 1VR2A 3D83A 3QRJA 3TTIA 4BTFA 2WTCA 3O5AA 3KQ7A 4H39A 3CPCA 5LMAA 5HBHA 2XRWA 4BKYA 2ITZA 2WMAA 5CAOA 2PMNX 4KIOA 3HMNA 3EZRA 3BL9A 4O7YA 4FVQA 5L2WA 1XH9A 1H01A 1GJOA 4RX7A 5AMNA 4BTMA 1J91A 1I09A 4U41A 4HVGA 3OW4A 4I4EA 4ID7A 4NFNA 2BZHB 4I5CA 3G90X 3PJ1A 4I24A 4EBVA 4QMNA 1KE9A 4AGWA 4S32A 4JR7A 1PF8A 3A4OX 2YM8A 4ALWA 2CPKE 3PLSA 5HVKA 4FBXA 3IW5A 3FKOA 3A60A 4IAAA 2WD1A 3PXZA 3V6RA 3NFFB 3TNIA 3EJ1A 3ZUUA 4H36A 4GK4A 5I9VA 4QYGA 3SOCA 3BHHA 3LFEA 4CKIA 3FSFA 4J95A 3PE1A 1ZYLA 1STCE 1PXKA 2XEYA 1GOLA 2WQNA 4IIRA 4ANLA 4C38A 5BPYA 3FLQA 3I6UA 4M84A 1YOLA 4DBXA 3ZO4A 3AD4A 3C4XA 4MXAA 4CQGA 3L9PA 3ODZX 2C6LA 3LKMA 2XNPA 4IVAA 5DIAA 4DHZA 1H07A 2G2HA 4IWOA 5BUJA 1PXLA 2QD9A 5FEDA 4GCJA 4D1ZA 2VRXA 3F61A 5DEYA 4QO9A 4AOIA 3OXTA 3R21A 2FSLX 2BDJA 4F0GA 2QG7A 2R3HA 4O1OA 3KGAA 4RZVA 2QQ7A 3JPVA 3Q2MA 4YMJA 3NNVA 2XAMA 4DGLC 3U6IA 2P33A 4BKZA 4FSYA 4O21A 2QR8A 4IWDA 4X7QA 4CFFA 4FSQA 2I6LA 3ACJA 4HVSA 3OWPA 4GEOA 3BU6A 4D9TA 4RPVA 4EQUA 5IUHA 3AC5A 5JGBA 2F57A 2ZB1A 2J5FA 4J71A 5IA1A 2A19B 4ANSA 4BCJA 3NAXA 3UDZA 4EK4A 2WIHA 3JY0A 3D7TA 4BDBA 3FMLA 2VTLA 4PNIA 4U6RA 2PHKA 1JKKA 4YJRA 2UZDA 3UOKA 4JXFA 4FTJA 3EQRA 5FP6A 1B38A 4FZFB 2J9MA 4PP7A 2XIXA 3L1SA 4OTQA 5AFVA 4XV9A 1H27A 4HYIA 4AFJA 4KIQA 1GAGA 3NW5A 1Q62A 5IDPA 4IZ5A 3KXHA 3TNPC 3V5TA 1JOWB 4E20A 1EH4A 5HTCA 5FDXA 4BDGA 4OT6A 3ORTA 5HBJA 3BLRA 5D7VA 5AP0A 3HV6A 5AWMA 4BCKA 2NP8A 4JBPA 2YACA 4WNMA 5IH5A 5A46A 1H1PA 2CNQA 3PY3A 4OGRA 5LJJA 3E8DA 4GSBA 4H05A 5DLSA 4TTHB 5HNGA 5KE0A 3QWJA 3C51A 4OTWA 4UXQA 5HKMA 3A61A 5J1WA 3QRTA 2F7EE 3BQRA 5I3OA 3RGFA 4F0IA 2W5BA 3DTWA 3C1XA 4CD0A 1DI9A 2RG6A 3AGLA 5BUEA 2W4JA 4IE9A 3RJCA 3LFSA 4OTFA 4WUNA 3HRCA 4BICA 4RJ5A 3LQ8A 4EOIA 3OBJA 2BFXA 5J8IA 3PZHA 2X2KA 4LL0A 5EI6A 5CVHA 4OR5A 3TN8A 4CFVA 3QHRA 1XMLA 3E3BX 3IONA 3HECA 4CFXA 4DTBA 3PIZA 5M09A 2W1GA 5CZIA 5GIOE 2CN8A 2C1AA 2QCSA 4O7TA 2WPAA 5FTQA 5IH6A 2VO6A 2XYNA 4W4WA 3QRIA 3NNWA 3SA0A 2HAKA 2Y0AA 1IG1A 3SW4A 1WVYA 1OIRA 5JRQA 1BKXA 2IVUA 4KS7A 1SNUA 4LUDA 1P4OA 5GJDA 5CAUA 3KF4A 4X2JA 4FEXA 4QYYA 4NW6A 2CLXA 3Q04A 4TYEA 3P08A 3F7WA 1QPDA 3PIYA 5DPVA 1R39A 4WG5A 3S95A 4QEBA 1RE8A 2ZV7A 3NX8A 5HI2A 5IEXA 5AAEA 4RGJA 3MH2A 4BC6A 4QP2A 2PUNA 2PSQA 1M14A 1YW2A 2B1PA 4DHIB 2EVAA 1W8CA 2PY3A 5CYIA 1REJA 3HMIA 4BCGA 3RALA 4WNKA 4LMNA 5EQPA 1LP4A 4LRJA 3FLSA 3OD6X 5DGZA 2O65A 4I0TA 4JR3A 2OK1A 4FSMA 4J8NA 2UW7A 1VYWA 3DZQA 4GL9A 3R8MA 4EUUA 3AGMA 5JT2A 2F7ZE 1YHVA 1K3AA 2C6MA 2YIQA 3A7GA 4E8AA 2RFSA 3M11A 4RJ6A 5I5ZA 4KA3A 1Q8UA 1ZZ2A 4K0YA 3BL7A 1O9UA 2OZAB 2WTIA 3CTHA 3KXXA 3TIZA 4MBIA 4APCA 3NYVA 4O7LA 1OIYA 4DLJA 1PHKA 2VUWA 3ULIA 4AXEA 3W8QA 3DT1A 5IA2A 4PMPA 1GIJA 4GIHA 3VBYA 3WF6A 1BL6A 1ZOGA 3ORMA 3AMYA 3FQEA 3LLAA 2OH0E 3LM0A 5C4LA 3FXZA 5I3RA 1UU8A 4M66A