1UWJA

The complex of mutant v599e b-raf and bay439006.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
276
structure length
264
Chain Sequence
b'DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATEKSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
publication title Mechanism of Activation of the Raf-Erk Signaling Pathway by Oncogenic Mutations of B-Raf
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 66
structure length 264
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1uwjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1uwjA01
3FKLA 4FL3A 4QMYA 2F7EE 2YLFA 3NUAA 3OBGA 3F5GA 3OXIA 2WOUA 3FYJX 1MQBA 2JKKA 4MXXA 4FT3A 4IVDA 4CQEA 5DT0A 2J5EA 4BTMA 3UO6A 4YLJA 1YOLA 3Q9WA 5AV2A 4B6LA 5KCVA 4O86A 2WTKB 4FTIA 2WQNA 2R3QA 3HMNA 1H0VA 4K77A 4D1ZA 2Z8CA 4E6AA 4XYFA 3FL4A 4GUEA 2H96A 3RP9A 4F9BA 1OPJA 4ZZMA 3JVSA 4UZDA 5IQFA 3ALOA 3SX9A 2HZ0A 4G3FA 3UO4A 4F6WA 3QQGA 1Y6BA 5IUGA 3DQWA 3HEGA 5IQBA 4C57A 3V5LA 2PMOX 2VNYA 4RMZA 4FV9A 3PJ8A 4HVGA 5CF5A 1PKGA 2JBPA 3Q96A 4IM2A 4ZP5A 4ZS0A 3BU5A 4IJPA 5FG8A 5LMKA 5HO8A 5IDPA 4FOCA 5KMIA 3HA8A 4OTHA 1WBOA 4J52A 4YNEA 4ZZOA 1NA7A 1Q61A 4YURA 4R3PA 3Q6UA 4PNIA 4FV1A 5DEWA 3R1NA 3OG7A 5A4CA 2BROA 4ACDA 2ERKA 3THBA 4FZDB 4FG8A 2CMWA 2ITQA 4KRDA 2QG5A 1TKIA 3FZPA 4FUYA 2W17A 1G3NA 3NS9A 3UYSA 1JBPE 5IA3A 5J9YA 3RALA 1XH8A 2WTCA 2VTOA 4F1OA 3PJ3A 4JBOA 4QYFA 3BI6A 4A07A 2UZTA 5M4FA 3CQWA 3EJ1A 2W1FA 4ERWA 2CN5A 3QHRA 3DJ7A 2WFYA 3TXOA 4BVUA 5BNJA 4FOBA 2VO0A 3QU0A 1A06A 2WMWA 4HPUE 1NVQA 1A48A 1ZMWA 3UMXA 4O84A 4WUNA 2XKCA 5AA9A 5CYIA 3VF8A 3IG7A 3PRFA 4JAJA 3TJCA 3TNIA 3ZH8A 4F0FA 1KE9A 2WQOA 3W8LA 3SXSA 2QOKA 5ETIA 5CEQA 5LVLA 4Z9LA 5HTCA 2QOIA 1Y6AA 4C4EA 4X0MA 3AD6A 3EFLA 3NDMA 5IA1A 2W5BA 1UNHA 4Y46A 5HZNA 4HVSA 4I5CA 5CASA 4C4FA 1K2PA 2PZPA 2XKDA 2WMUA 1M2RA 3CGFA 1TQIA 1XO2B 4HJOA 4JDIA 4P7EA 2GHGA 4NJDA 3U55A 1H08A 3VF9A 1VJYA 3Q6WA 1GIHA 1H01A 4XLIA 1MUOA 4S32A 5FEEA 4BDHA 3QRUA 3ZHPC 2X7OA 5HE3A 3PLSA 3REPA 3TEIA 2C3KA 3FI4A 4DG0E 3F3ZA 4E1ZA 4IJ9A 3FI2A 4KINA 4I3ZA 4RWLA 2QLQA 4UMQA 2VGPA 3LFEA 2XA4A 4R8QA 3DXPA 3I0OA 4PTEA 3R9NA 5EQYA 4YJOA 4WA9A 3LJ1A 2KULA 3LHJA 4ZLZA 3UNKA 4GYGA 2VN9A 1WMKA 1PMVA 2G9XA 4IB3A 3VS2A 2YCQA 5K4IA 1YOMA 2VTRA 2CNQA 4WIHA 1W98A 4NM5A 4AGDA 3ORKA 2XVDA 3FI8A 4AX8A 3FKNA 3NCZA 2P33A 5HCXA 3QGYA 3QALE 5AR3A 2VTAA 4AOJA 1SMHA 3II5A 4I5PA 4BZNA 4XMOA 3QTXA 3FC2A 3Q3BA 3GEQA 3QTWA 4C58A 4QP2A 5JZJA 4GFMA 4Y5QA 4M12A 5AR2A 2OXYA 4ID7A 1IG1A 3RVGA 3QTUA 3D9VA 3VULA 5DR6A 3F3TA 1XBAA 3QZGA 4U9AA 3ORPA 2IWIA 4CXAA 3KXGA 3FLYA 4O7RA 2Z7RA 4CFFA 2I6LA 4FC0A 1IRKA 2I0EA 5CSHA 1UVRA 2PE1A 4FSQA 2WKMA 2EUFB 2J90A 4PMPA 2VX3A 5A6NA 5AUZA 4FA2A 1Q3DA 3SG8A 3GGFA 4JRNA 4AZFA 2R3NA 3PVWA 5JQ5A 3U6IA 3PXYA 3SLSA 2Z7SA 1GJOA 1I44A 1V0BA 3OOGA 4CLIA 2UW7A 3NUPA 1J7LA 3QWKA 4P5ZA 5LOHA 2OJ9A 4E5BA 1YQJA 3Q9YA 4BTKA 3WIKA 2JDTA 3R7EA 3QQUA 2VX1A 3ZFYA 1EH4A 4FKJA 4XHKB 4WT6A 3W2CA 4QMVA 4TYJA 5AA8A 4JJRA 2I0YA 4G34A 4GVAA 1BL6A 3KC3A 3DXQA 4QMQA 4G16A 4W4WA 3BHHA 4FNWA 2PVMA 1H1RA 3G2FA 1XH6A 2BTRA 4CRSA 3DBDA 3QKMA 3GU7A 4FEUA 1J1BA 2VWBA 3RNYA 4D1SA 1S9IA 2YIXA 4EYMA 4O7ZA 4D2SA 5J1WA 4F7JA 3BBWA 1BLXA 5FGKA 4YLLA 4QNAA 4YPDA 4QRCA 3FZ1A 2EXEA 1ZMUA 2GFSA 3CD3A 5FP5A 4QTCA 1YI4A 3ORXA 4L45A 5HESA 3RCDA 3NMUF 3DTCA 4H36A 3ZSHA 4USDA 4QD6A 4JL9A 3LLAA 2FSLX 1Z57A 4G6NA 4KBAA 3DK3A 3FMEA 3LKMA 1JAMA 4EOJA 2ITWA 3EL7A 3ET7A 3ZDIA 4HGTA 4CMOA 2HZ4A 4CSVA 2OK1A 4IAAA 1JVPP 3RHKA 4I94A 1YW2A 3NR9A 3WE8A 3B8RA 4MNEB 5HI2A 1WBWA 4BL1A 3RM6A 1LPUA 3COIA 3GVUA 3EN4A 5T3QA 4NIFA 4G9CA 3NX8A 4BFMA 5LJJA 3UOJA 3P5KA 3G6HA 3MIAA 4CVAA 3IGGA 5AFVA 3PLAE 1PMEA 3HMOA 3O7LD 4CZYB 5A4LA 2OF4A 3PWYA 3HV6A 3LM5A 3A4PA 4C3FA 3K54A 4EH2A 2OZAA 5L8KA 3KGAA 3BV2A 3HKOA 3I6UA 4YJQA 2HW6A 4K33A 4AW1A 2HXLA 5CAQA 4AN2A 5EHLA 2AYPA 1Q41A 2YM6A 4C35A 3PZEA 3KF7A 3BZ3A 1UNLA 4AF3A 5L2QA 2H6DA 1H26A 4QTDA 3P78A 4K6ZA 4QMTA 5JZNA 5CT7A 4CYIA 4YMJA 5LMBA 3MESA 2PE0A 4R6VA 3MFTA 3CGOA 3CQUA 3D14A 3HX4A 5HE2A 5HD4A 2GHLA 1FPUA 3VQUA 2NP8A 3POZA 4YLKA 4E4NA 4EH7A 2HY81 2UZDA 2FB8A 3P86A 4KAOA 4R3RA 1J7IA 3UMWA 1B6CB 1W83A 4AN9A 2G2FA 2VZ6A 1PYXA 3KMUA 5CU4A 1ZZ2A 3PYYA 4EC8A 2VTIA 1H27A 1ZLTA 2A2AA 3PXKA 2PYWA 3BQRA 1AD5A 3CY2A 1KWPA 4HYIA 5EM8A 4EOLA 4YO4A 4B0GA 1U4DA 1YXSA 4MD7E 2DUVA 5EM5A 2W1GA 5KO1A 4FVPA 2WTJA 2Z7QA 3DBFA 4II5A 2B55A 3FZOA 1PXIA 4C4JA 2GHMA 3TZ9A 3VN9A 4AZTA 2ZVAA 4ZMEA 4R77A 3MJ2A 3U54A 3C0HA 2R3HA 2EWAA 2V0DA 4F0IA 5JGBA 3BHVA 3V8WA 5AP5A 4BDGA 3JY0A 4J8NA 4O91A 4KD1A 4CKRA 4BTJA 4IVCA 4QMMA 1IEPA 3S2PA 1YXUA 4FT5A 2ETKA 3V8SA 2HY0A 4AGUA 3C4FA 4EEVA 3QQJA 4UV0A 2W9ZB 5AV1A 4NEUA 3O96A 3C4EA 3UQFA 4TKSA 4BKYA 3MB7A 5FRIA 3OY3A 4LL5A 3UOKA 2YDJA 4A9SA 4I4FA 4U3ZA 4D2WA 5J79A 2R0IA 4RBLA 4QP3A 5DVRA 3WZEA 5H2UA 2O65A 2VTLA 3PUPA 2UW3A 3CE3A 3QCQA 5DNRA 3HUBA 3UYTA 5FXQA 2J50A 2ONLC 3E8CA 4CQGA 5EM7A 5M44A 3C7QA 4IZAA 5I9UA 3MY1A 4R7IA 3ZM9A 4R7HA 2NO3A 1HOWA 5ACBC 5FXRA 2XK3A 2BRMA 2VWZA 4L53A 2C1BA 3LZBA 5IISA 3GC9A 1ND4A 5CS6A 3M2WA 3AGLA 4EUUA 3TI1A 2UUEA 2YHVA 3A7FA 1SVGA 2QONA 4R78A 4TYEA 4D2VA 1ZYCA 3RMFA 1PYEA 5LVOA 4E4MA 3PY0A 4M69A 4DG2E 3HV3A 3T3VA 4ERKA 4UN0C 3OD6X 2QO9A 4BCKA 3MSSA 2B9HA 2JIIA 4RA4A 2XMYA 2UZLA 5H3QA 1YI3A 3R8UA 2XK6A 4MHAA 5GZ8A 3D5UA 3A7JA 3P9JA 4B99A 3R9OA 3P08A 1MRUA 5HOAA 5CI7A 5M57A 2IZSA 2WGJA 3GBZA 4FIFA 4DT8A 1PXPA 4U40A 2R3PA 1SVEA 3F6XA 4XV9A 5IZFA 3POOA 4N4SA 2R3FA 1Y8GA 3PXQA 3VS6A 4C3PA 5IQDA 2AC3A 4YZCA 5DEYA 1KOBA 3EL8A 5E8VA 3WZKA 1PXLA 1JLUE 5CAOA 3H9RA 3VWAA 1WBNA 2BRGA 2I7QA 3CQEA 3EQIA 3GCVA 1STCE 2YEXA 1E9HA 3E8EA 3UZTA 3FSKA 3NVMB 4ZSLA 3KKVA 3FLZA 5A9UA 3AC4A 3OWJA 3AD4A 2BCJA 4DITA 3GQIA 4YBKA 4AOTA 2GNIA 4W9XA 4AOIA 4GUBA 4G3GA 5EW3A 3W32A 1M2PA 3AT4A 2XS0A 3G9LX 2RFNA 3F69A 1GAGA 3TNPC 3VNTA 3DZOA 3FWQA 2BIYA 3PXFA 4FODA 2XNEA 1OM1A 2W1EA 3EN9A 5A3XA 3PA3A 4PP7A 4LYNA 4LFIA 3LCKA 1PXJA 3C1XA 4FG7A 3N4TA 5DE2A 5IH5A 4KWPA 4D1XA 3TDVA 5BVKA 5JKGA 2QURA 2C3LA 3UODA 4LOPA 3FQEA 5K9IA 4C0TA 3EQHA 4RJ5A 5AEPA 4GIIA 4ZJIA 4N6YA 1NT2A 3TDWA 4XBRA 4GL9A 3OT8A 1CM8A 3ZO1A 3RAWA 5EKOA 2H34A 3FYKX 5HO6A 1U59A 3VIDA 4H3QA 1DAWA 4EOIA 4ZTRA 4LOOA 2WQBA 4TYGA 3E3PA 3MA3A 3T9TA 4O7VA 1P5EA 2X2LA 2WTWA 4ANMA 2QKWB 5IA2A 5KUPA 2X8EA 1OL5A 2PHKA 3WF7A 4NTSA 4MXZA 5DR9A 3KMWA 1BUHA 1U5QA 2VUWA 2XB7A 1WVWA 4MXAA 1NVRA 4FZ6A 5CLPA 4YTFA 5CU0A 5EYKA 3FC1X 4HYUA 4RT7A 4E8AA 4PDPA 4ZJVA 5CEPA 3GXLA 1FGIA 3NW6A 4TYIA 4BYIA 3NIEA 5L2WA 1W82A 2LAVA 3VUKA 5EI2A 4ZTHA 4FKTA 3ZCLA 5HNIX 3JR1A 4FKWA 5D10A 3O50A 4YZ9A 1JSUA 5BVWA 3LMHA 5IQAA 4NW6A 4UMPA 3HL7A 3DK7A 3RTPA 4L8MA 4FSWA 4GMYA 3V5PA 4E73A 4EOMA 2B54A 3ORMA 2C5VA 3QGWA 4DH7A 5E1EA 2YM3A 3RAHA 4R1VA 1ZAOA 4EH3A 2OICA 2Z2WA 3H10A 3W8QA 3QXOA 5AAEA 5KMNA 3GENA 4BICA 4FKOA 4CG9A 1RQQA 2JGZA 4M97A 2YWPA 2XH5A 1P14A 4S31A 2PZYA 1CKIA 2R3KA 4IX4A 3ULZA 3QYWA 3W55A 3GCPA 3QCXA 3D7ZA 4U5JA 5C8KA 5EKNA 4RLLA 4DEIA 4BC6A 3MH1A 4O0YA 4X3FC 4XRLA 1WBVA 4D4RA 4ENXA 1PJKA 5BUJA 3W10A 3V5TA 3ZMMA 4JBQA 1G8SA 4E4LA 2C68A 3ZONA 1CKPA 1OUYA 1S9JA 2R0UA 2IZTA 4QPAA 5EW8A 1OMWA 3QTIA 5D41A 2C5NA 4CYJA 4E5AX 3S3IA 3F5XA 1BI8A 2ZDTA 3IDPA 4QP8A 1PXOA 4O83A 3TTIA 3MVJA 2UZOA 4DCEA 2C5YA 4O2PA 4YU2A 5GJFA 4S2ZA 3W2QA 3DTWA 4IZ5A 5CT0A 5HNBA 3MJ1A 4TL0A 4BDAA 3Q52A 4XG4A 4FGRA 3LVPA 5TF9A 1ZYSA 5DMZA 2GNLA 3G0FA 3PIYA 2WNTA 2XNPA 5EDRA 2QO2A 3VBVA 2PWLA 3ACKA 4WHZA 2R3LA 5ANOA 2X8IA 3ANRA 4O1OA 5D7VA 4BBMA 1ZOGA 4MKCA 3BLHA 2W1HA 4CLJA 2NRUA 5AV0A 2IW6A 3HA6A 4YNOA 2PZ5A 5CENA 5HGIA 3ZUVA 4AE6A 3WF5A 3G33A 4K8AA 4IEBA 3F3UA 5BVDA 3SC1A 3E7VA 3MVLA 5K5XA 3TUCA 2IVTA 2ZM3A 2BRHA 3LQ8A 5HKMA 3F2RA 3OC1A 4ACGA 1W8CA 4IACA 2BZHB 5E90A 4FIHA 4HGSA 4A9TA 3ETAA 1UU7A 4ZJJA 2BTSA 3KULB 4BDCA 3QUEA 3ZFXA 1Q8WA 5GIPE 2E9NA 3L9NA 1YWNA 2Y0AA 3I0QA 4EI4A 5IQGA 4A4XA 3MPMA 5JRSA 4FTKA 3NLBA 5FM3A 4JIAA 3Q5ZA 4AS0A 4PL4A 4UMUA 3EQBA 2XEZA 2B1PA 2QOCA 3A7HA 4I1ZA 2X39A 4IBMA 4DH3A 4EOSA 4EWHA 3S00A 3GP0A 4M0YA 3WF9A 3VHKA 4ONAA 2PVHA 3BV3A 5I9YA 4X2JA 2HZNA 3WYYA 2QG7A 2XNMA 3RPVA 4KIOA 2R3MA 2Q83A 4M67A 2B4SB 5AMNA 2J0MB 4FKRA 2CHLA 4FT0A 1E1VA 1U46A 4KIKB 4E5WA 4TWNA 5IEVA 3Q53A 2YM5A 2JD5A 4MYGA 5BYYA 5AM6A 2WQMA 2WEIA 2G2HA 4QQJA 4AZVA 1H4LA 1REJA 2X9FA 4CFXA 4FICA 3BGQA 3FQHA 4JX7A 3IW7A 2OJIA 4Y8DA 5DA3A 1JNKA 3FPMA 3LFQA 4AW5A 2Y9QA 4XH6A 3V5JA 4OTDA 2IO6A 3EZVA 5CU2A 1M14A 2YLEA 3UJGA 4H3BA 4BBFA 4RLKA 3RWPA 3ZLYA 3UP7A 2BFYA 3V51A 3I5NA 3UPZA 2W5AA 5CVGA 5CSXA 3GU6A 3ZO2A 4J53A 4Q5HA 5EM6A 2GNHA 5DG5A 2C6IA 5HIBA 3ZXTA 5HG8A 4BF2A 3IW5A 4QTBA 5HX8A 5IEYA 4RIWA 3W2RA 5CZHA 4A9UA 2H9VA 4GCJA 2ZMDA 2JDOA 2RFDA 3LFSA 5L6PA 4MNEA 4Q9SA 5CU6A 4IB5A 3COKA 4QP1A 4TNBA 2RFSA 1WVYA 4FTUA 4S33A 4ASDA 5KNJA 4ANBA 4UWCA 1GIJA 3KB7A 4EZ7A 5EFQA 4FUXA 4ITJA 2YCFA 2JDSA 4FKSA 4JQEA 4X2NA 3R9HA 3V6RA 3FLNC 2VTHA 1U54A 4TY1A 2OJFE 5HHWA 3EN7A 3ZRLA 3ZZWA 3ENMA 4KA3A 1DM2A 5CWZA 3EN6A 5GZ9A 5TKDA 4XCUA 1K3AA 2RG5A 4LRMA 3RPSA 1SNUA 4JR3A 4CTCA 2AUHA 2QOBA 3LQ3A 4AAAA 5JSMA 2FUMA 3A62A 5B7VA 1OIUA 4NK9A 4F0GA 2YABA 3CR0A 4DFNA 1ZARA 4IZYA 1GZKA 5EH0A 5KX8A 2XK8A 1YRPA 4Y83A 3UQCA 1BI7A 2QLUA 5IA4A 3LW0A 3FSFA 3TIZA 3IW8A 5HCYA 4AT5A 4MEDA 4EWQA 2QU5A 3LPBA 5DRBA 3MH3A 2PU8A 3AC2A 1JKTA 4UB7A 3RKBA 2X2MA 3UG2A 2V55A 3I6WA 1JKLA 2GQRA 5GIOE 3QQFA 4O7NA 3WF6A 4YSMA 2W96B 3VS7A 4NTTA 5KHXA 4J98A 5HLNA 3R7YA 1OIYA 5HICA 1FMOE 3P7AA 5I9ZA 3KK8A 4B9DA 1B39A 4RFMA 3R9DA 4MD9E 4BDIA 4ZTLA 4CFUA 3EIDA 5GNKA 1H1WA 2UW4A 5L8JA 3TZ8A 2JLDA 3DAEA 3KFAA 3U4WA 3SW7A 2QC6A 5IH4A 3O8PA 4FNZA 3R8PA 2CGVA 2YCSA 3M11A 5FDPA 3IONA 1PY5A 3QUPA 3D7TB 2XRUA 3K2LA 4PPCA 3R04A 1PW2A 1XH5A 3PE1A 4G5JA 1F0QA 4GIHA 4X2FA 5KE0A 2IG7A 4DCAA 4FSRA 4BRXA 4NUSA 3VVHA 3QHWA 4XOYA 3SRVA 1IASA 4RX7A 3IW6A 3PTGA 4D9UA 4NM0A 4XLVA 4DTAA 3UZPA 4ZTMA 3W2SA 2V7OA 2BRNA 3EKNA 2OWBA 4XP2A 3NGAA 2OU7A 3TKUA 1W7HA 4BBEA 2R3RA 4MXCA 4XG2A 1WVXA 2W9FB 5E91A 4QMWA 2WQEA 3R8LA 4CMTA 3U8WA 5E8TA 3AD5A 3LXKA 3TNHA 4BDJA 2CKPA 4G6LA 1UA2A 3NUSA 4I41A 5HG7A 1GNGA 4D5KA 1NVSA 4RWIA 4XG3A 3HMMA 4EBVA 2ETRA 4X3FB 5D7AA 4YHJA 5KBQA 3LFNA 3FJQE 3D5WA 3DDQA 1GY3A 3PE2A 5T6KA 3R7OA 3UC4A 2CJMA 3O0GA 3L8SA 4OTIA 4UZHA 4AWIA 5AUWA 4E3CA 2HENA 2B9FA 4UEUA 2GFCA 3RJCA 1LUFA 5J8IA 3FBVA 1MP8A 2ITNA 3UE4A 4O6LA 4YBJA 3K5UA 3BYSA 3FMDA 4OTWA 4EK6A 1R0PA 3O17A 4CRLA 3Q4CA 3IECA 2PULA 4BWPA 4XJ0A 5I4NA 5E7RA 2XCKA 5FLFA 4O81A 4PDYA 5KZIA 2J51A 2VRXA 5GHVA 2YN8A 3VUGA 5IUHA 5EK7A 4AW2A 4ORKA 5LMKC 3QFVA 4GT3A 4RC3A 3QZHA 3OT3A 2R3IA 3ROYA 2XUUA 3R00A 3ZRKA 3W16A 4O0VA 3EQGA 4ZIMA 1OKZA 5IDNA 2B9JA 3WZDA 4FKQA 3NUYA 5T68A 3MV5A 3FMNA 5E8ZA 5LCKA 3R01A 4HZRA 2WIHA 4FSYA 4WRGA 3VJNA 4OAVB 3QD4A 4IC8A 4RWJA 4V0GB 5AUUA 3OCSA 1WZYA 1OL7A 5E9EA 2XNGA 3GOKA 3C51A 4QMLA 4EOKA 4M0ZA 5AUYA 2R3JA 3R1YA 5LVNA 4L9IA 3C4XA 3H9FA 2FVDA 4AA4A 4F9CA 5E4HA 1OVEA 4GU9A 5CEMA 5L8LA 2CCIA 3DGKA 4UXQA 3VBTA 4ZAUA 4EUTA 3VUDA 3CKXA 2F7ZE 5GJDA 3QLGA 3AT3A 4F7SA 5L6OA 2BRBA 1IA9A 4O7LA 4ZXTA 4PQNA 4APPA 4O1PA 5L2IA 4WRSA 5KMKA 2GCDA 4TT7A 5DFPA 2OFVA 4IADA 2V22A 4B4LA 4BCIA 5I3RA 2QD9A 2JFLA 3AG9A 3UIMA 3VBXA 3VQHA 1QL6A 2H8HA 3DQXA 3PG1A 3WZUA 2QU6A 4IAKA 3QAME 3TG1A 3HECA 3QZFA 3S95A 3BCEA 3CPCA 3R7UA 3EFWA 1XBBA 3MFUA 4JG8A 4GV1A 2VTQA 3CC6A 1Q3WA 4PV0A 1V0PA 2ZM4A 1OL1A 4MH7A 5K0XA 2WU6A 5BX0A 1ATPE 3LCOA 4GKHA 2QR7A 1ZZLA 4L52A 5G6VA 1CKJA 3PP0A 3GU4A 4LGDA 2PMLX 1XH9A 4PL5A 2C1AA 2VO3A 2QO7A 4FZFB 3UG1A 3TN8A 2C5OA 1G8AA 3MTFA 3R21A 2W5HA 4FGBA 4EOPA 1YWRA 2VO6A 3CTJA 4MQ1A 3GT8A 3IW4A 4G2FA 5KMMA 5DT4A 1Q8ZA 4AU8A 4MVFA 2HWPA 1SYKA 2WEVA 3FZTA 3QRJA 5J5TA 2ZDUA 3Q4TA 3ORZA 3QC9A 4U0IA 2W4JA 5M51A 2XBJA 2GQSA 4FL1A 2WAJA 2WMQA 3C5UA 5IMEA 2P2HA 3MFRA 1OI9A 2J0IA 3PPZA 4O0WA 4PY1A 4FKPA 3OROA 4RQVA 3H9OA 4M14A 5D1JA 4F64A 3BRBA 2O8YA 4M15A 4MD8E 2WMRA 4J71A 2CN8A 3HNGA 3RHXA 4D9TA 5L2TA 5EDQA 4YJPA 5IF1A 2ESMA 3ZO3A 3R8MA 2BAJA 5LXMA 3CKWA 1VYWA 3LCSA 4JDJA 2C0OA 3E8DA 5KMLA 2YISA 1PF8A 3LCDA 4CFMA 4LUEA 4AA0A 4IH8A 4UBAA 2XIZA 3EQPA 4CFNA 4EYJA 1NXKA 1QPJA 4L43A 2RFEA 4ZY4A 3F2NA 4TXCA 5DH3A 5JFXA 3QF9A 2G1TA 3BEGA 4TNDA 2FO0A 2VTMA 1Q5KA 5DOSA 2JKOA 3C4ZA 3NNVA 4A06A 4EORA 3A61A 4V04A 4DH1A 5FTGA 4BZOA 4QQCA 5KHWA 4NWMA 4ALWA 3GU8A 2GNGA 2X6DA 4NYEA 2VWYA 3RPRA 4IFGA 4BIBA 4X3JA 4F1TA 3FY2A 3DT1A 4AE9A 4JQ7A 2E2BA 4QTAA 4RIXA 4EH5A 4D58A 3IDBA 3WI6A 4YR8A 4R1YA 3DB6A 4C4GA 5CVFA 4K9YA 4EJ7A 2ZOQA 4FSTA 2IVVA 4TYHB 2GQGA 5HU9A 1DS5A 3DPKA 1ERKA 4BGHA 2YM7A 1ZYLA 3O23A 4BWXA 5FBOA 5CSWA 3PFQA 2A4LA 3DFCB 4XUFA 2XK9A 4USFA 1GZ8A 5HBJA 2HYYA 3QZIA 5AAFA 4K1BA 5FTOA 5HE1A 5AR4A 2C0TA 4XV2A 5BVOA 4P2KA 3HZTA 3ZEPA 4K11A 3UBDA 4U80A 3OW4A 3VS4A 3WIGA 2HOGA 4YTHA 4XRJA 1F3MC 1VR2A 3MWUA 4NZWB 4ZLOA 3TZ7A 4RIYA 2WMSA 4OGRA 5EHOA 3ZDUA 2WTVA 3QTSA 3ZUTA 4HVIA 4O38A 1FOTA 3BYOA 3ZOSA 5IG1A 5CEKA 2OXXA 3QYZA 3RINA 3JPVA 2PY3A 3EQDA 1PXMA 3VC4A 5KMOA 5AP2A 4RJ6A 5EOBA 4ZEGA 2BVAA 1DAYA 4DFLA 3IOKA 2XZSA 4WKQA 2QOFA 3CEKA 5IKWA 2P2IA 5M09A 2FSOX 4IDTA 3F7WA 4IWQA 3A7GA 3PZHA 5M4CA 1ZXEA 3U6JA 1IAJA 4C33A 3OTUA 4KIPA 4J7BA 4QMSA 4Y85A 4DEDA 5C9CA 4ZY5A 4DF3A 1LP4A 4PTCA 5TE0A 1YVJA 2ITYA 5HLWA 1H07A 4BCPA 1H1SA 4GW8A 3JY9A 4GYIA 3KXHA 4KBKA 2YAKA 4D5HA 3TM0A 4FMQA 4L00A 5HORA 4TPTA 5BMSA 3MW1A 4GU6A 3KXXA 4MF1A 4Q5EA 3F5UA 5H8BA 3PSBA 2W4KA 4GT4A 5BYLA 1CSNA 3F66A 4ZK5A 4W8DA 4C37A 2WOTA 4XS2A 2NNWB 3D5XA 4FE2A 4BZDA 4JQ8A 3JUHA 2IJMA 2YM4A 5FD2A 3OEFX 2ITXA 3QTQA 5ANGA 4J8MA 1JKSA 1OL2A 4L7FA 3QXPA 4WNPA 3TV6A 3PSDA 3BWFA 4GT5A 3Q2JA 2X9EA 3QRTA 2ZAZA 2VTTA 3RAIA 5I9VA 4RSSA 3DOGA 1K9AA 5ANKA 2XBAA 3DJ5A 5FXSA 3UIXA 3NUNA 3MY0A 4J1RA 4LRJA 4ZSEA 3RBWA 4F63A 5AJQA 5HCZA 2BDJA 3O7LB 3V01A 5CU3A 4YGAA 3VBWA 3W18A 4I24A 4IE9A 3FY0A 2CKEA 3EQCA 2R64A 5M53A 4BY9E 3ERKA 2OJGA 2PUUA 3BGZA 3D4QA 4EC9A 2CCHA 4FTAA 4S34A 1JSTA 5M56A 4I5MA 4OBQA 2QOLA 4MAOA 3DNEA 2R3OA 4G6OA 3AC8A 4DGGA 4O7SA 3NSZA 1GOLA 2ITPA 4USEA 5DWRA 4R7BA 1OITA 2CPKE 3NNWA 4OT5A 4ANNA 4XEYA 3E7OA 3OHTA 2OBJA 4NM7A 2GPHA 4ASEA 5M07A 4TZRA 2VO7A 1F5QA 4QYGA 4YJNA 4CNHA 2FH9A 3AT2A 3DBEA 5I5ZA 1T45A 4ZTNA 3SD0A 5CEOA 4BGQA 3G90X 4E7WA 3OCTA 3VUHA 3QKKA 4BI2A 4OTPA 2VWUA 1WAKA 3G51A 5E92A 2J0LA 3MPAA 3C4CA 4PPBA 3MVMA 2WO6A 2X0GA 2WXVA 3U87A 5I0BA 2XYNA 2I40A 3BU6A 3HDNA 2Y8OA 5JN2A 3CSVA 3I79A 2PUPA 4IX5A 4EZ3A 5HG5A 3V8TA 4CV8A 4YUQA 2QKRA 3U6HA 2B52A 2O2UA 2BKKA 4Q2AA 3UVRA 4C2WA 1UWJA 3I4BA 1Q8UA 2VWXA 3EKKA 4UYAA 5HBHA 3HUCA 4I21A 4JI9A 3NNUA 4IC7A 4DT9A 1UWHA 5AP7A 2QI8A 3SW4A 2IW8A 3VUMA 3PVUA 4M68A 5JGDA 4DBNA 5JFSA 3CP9A 5C1QB 3MI9A 5H8GA 3Q4ZA 3E88A 3FHRA 5JMSA 1JSVA 1YKRA 2ACXA 3A60A 4GG5A 4WNKA 1H8FA 3K3JA 1WBPA 5AX3A 4AZWA 2YITA 4F7LA 3HAVA 5HO7A 4L46A 1OIQA 2RGPA 3DFAA 3TUDA 1OBDA 2NRYA 1PMUA 2ERZE 2XKFA 3TL8A 1NY3A 2AC5A 2WMTA 4GSBA 3HP5A 4K2RA 3U51A 2WMXA 4QMNA 3FHIA 3NCGA 2E9OA 5IA5A 3UVPA 3DLZA 3OZ6A 3BEAA 4GRBA 5E8WA 4DH8A 4XX9A 2DQ7X 3KVWA 3OBJA 4FSUA 3UQGA 4NKSA 3D5VA 5JGAA 2BIKB 2IPXA 2XM8A 3KEXA 2Q0BA 4H1JA 3TTJA 4CZUA 2I1MA 3OCGA 2V5QA 3FLQA 3G6GA 3ZO4A 3VRYA 4BIEA 5HTBA 4UMTA 3MTLA 4ACMA 3SV0A 3NAXA 4UMRA 4ASXA 2UW5A 2WMBA 5GINE 4LGHA 3KXNA 3KMMA 3ID6C 5C03A 1QPDA 3E64A 5ACKA 4EH6A 1M7NA 3A8XA 4DEHA 3ZBXA 2RG6A 2WELA 2ZJWA 4L68A 2I0HA 3N9XA 4DN5A 2BHHA 5HG9A 5CZIA 4L3LA 5A4EA 4OTGA 5ETFA 2OGVA 4EH9A 4ENYA 2B0QA 5D11A 2O5KA 3P79A 4EQMA 4XP3A 2NPQA 3SGCA 4X3FA 1E1XA 2J6MA 2CGUA 5TR6A 4AGCA 2IVSA 4BCHA 3BPRA 2XF0A 4NT4A 2C6MA 2C6OA 4YJVA 1YHVA 3DU8A 5A4QA 5AIRA 4Z7HA 3LXPA 2UW6A 3OCBA 4FTJA 5KMJA 3MY5A 3D94A 1PRYA 4LUDA 2HWOA 3P7BA 3H3CA 1OECA 2PMNX 1AGWA 1Q99A 1CTPE 2UW8A 4O27B 1FVTA 1OKVA 4ZTSA 3SDJA 4AT3A 1Q97A 4IX6A 4FV0A 5CAUA 4AUAA 4EK3A 4A7CA 1NW1A 1SVHA 3RZBA 5M08A 4FKVA 2XJ0A 3PDTA 3R7GA 4TWPA 5AIKA 4M66A 2W0JA 4Z55A 5AP6A 3QX2A 3SAYA 2LGCA 3ZC5A 3HMIA 3KRWA 5F4NA 1UNGA 3SVVA 4FV2A 1T46A 3ZYAA 4CTBA 2DYLA 5I3OA 5K4JA 3MIYA 2BILB 3V5WA 1MRYA 3MYGA 4EBWA 5J9ZA 2FYSA 4HOKA 2FSMX 4IB1A 3LFCA 3VS0A 2W1IA 4NFNA 2QODA 4I5HA 3RPYA 4U81A 4C3RA 2IVUA 1OB3A 4G31A 5HE0A 3LFFA 4RVTA 5J95A 2GS7A 4WSQA 1SM2A 4FTMA 4DEBA 4XBUA 3LLTA 1H25A 4OBOA 1IR3A 2E9PA 4EOOA 1DI9A 3OS3A 1RE8A 5C8NA 3I7BA 5B2MA 2JC6A 3E5AA 2GS2A 4MK0A 3QCYA 3UTOA 2VWIA 3E8NA 2GTMA 2F9GA 2OW3A 2JKQA 4G9RA 4DGOA 3EZRA 2JFMA 4PMTA 4NCTA 2PUNA 3TJDA 3UP2A 2BDFA 2P0CA 4NIFB 5HEZA 4EK8A 5F1ZA 3UNZA 2C30A 5J87A 4AT4A 2QOHA 4BCGA 4D2TA 2ITZA 3L8VA 4YC8A 2XKEA 2WB8A 3EFJA 4Y95A 2UW0A 5AX9A 3ZS5A 5M4UA 3AMBA 1FVRA 2OZAB 3IDCA 4BDEA 4WSYA 2J7TA 5BMMA 4DLIA 1XKKA 4G17A 3W1FA 5HLPA 1PMNA 1H1QA 2VNWA 3VUTA 3MVHA 3DBCA 3FLWA 4R5YA 1WCCA 3VBYA 5CSPA 5DN3A 3PP1A 4MTAA 4FV8A 1GZNA 3HV7A 4DEAA 2XJ2A 2A1AB 4WO5A 3GC8A 4AA5A 1JOWB 2YAAA 5LQFA 4IZ7A 4UY9A 4KBCA 4OW8A 4PP9A 5JRQA 2XEYA 2W99B 2YCRA 4YZMA 5L3AA 2WZJA 4LMUA 3FMHA 4CCBA 4YJUA 2F7XE 5AV3A 3FXZA 4YPSA 3BWJA 4HZSA 3UO5A 3T9IA 1Y57A 2J0JA 4EL9A 5F95A 4QQ5A 4I6HA 2PSQA 4FYOA 2HW7A 2JEDA 4O0TA 2ZV7A 3ZLXA 2YIRA 3QA8A 2RKUA 2ITUA 3AC1A 2VAGA 3CJFA 2HZIA 2X7GA 4EQCA 1OL6A 4RIOA 4W8EA 3O2MA 1APME 3NYNA 2R5TA 5BUIA 1KE8A 4O7YA 5CXHA 4P90A 1JPAA 3MH2A 4CG8A 2OJJA 1RJBA 2HK5A 2C6KA 3ALNA 3LXNA 3QQLA 3O71A 3ODZX 2F2UA 5HX6A 4ASZA 4GFGA 3OXTA 3MGYA 5ETCA 4JDKA 1M2QA 2EB3A 3O51A 4EK5A 2OXDA 2CDZA 2F57A 3HGKA 4WUAA 2QVSE 3IKAA 1UU8A 4EZ5A 4YZBA 4ACHA 3BHYA 4QP4A 4RJ3A 1WBTA 3OEZA 4FKUA 3MN3A 3VW8A 2W05A 1QMZA 4IXPA 3UIUA 4DBXA 2V7AA 2JIVA 4CKIA 3C9WA 2C6EA 1P4OA 5E8YA 2XIKA 5J9LA 4EK4A 1U5RA 4RG0A 2GDOA 4BCNA 3DNDA 3I60A 3QBNA 2PMIA 1PXKA 4AQCA 4L6QA 3BIZA 4CT2A 5CAPA 2BALA 4RFYA 2GU8A 3Q32A 4U7ZA 1CMKE 1XJDA 2CGXA 4ANQA 2XIRA 3QWJA 1Y8YA 4JRVA 4BIDA 1KV1A 3PPKA 4MBJA 4N6ZA 4U43A 3R8VA 3L8XA 4DINA 3NUUA 5L2SA 3ULIA 3UC3A 2UZVA 3ODYX 2X1NA 4TWOA 2OG8A 1AQ1A 3ZC6A 4C8BA 1BKXA 3DY7A 2DWBA 4TYHA 5DT3A 3ELJA 4XOZA 4DC2A 1KE5A 4FSZA 2B53A 3QTRA 4X2GA 5C01A 3NAYA 1KV2A 4M69B 3DAJA 4U42A 4DFBA 3S1HA 2RF9A 4JNWA 4EHGA 4LV5A 2XCHA 4F1MA 2X8DA 4OUCA 5IPJA 5LVMA 1G5SA 1M17A 3JS2A 1LR4A 2EVAA 3LIJA 4OR5A 4M3QA 3QQKA 5IMXA 5B2LA 3OTVA 2BAKA 4Z3VA 1YXXA 3RM7A 4CFVA 3PSCA 4LRKA 2O0UA 4PL3A 1BMKA 4DEEA 5JK3A 4J96A 3FLSA 3VRZA 2W1ZA 3G5DA 3FXWA 2YM8A 5CF6A 3L8PA 3NNXA 4PWNA 2O3PA 3DKFA 4QMOA 2OKRA 4K0YA 5HBEA 3AMYA 3KU2A 4ANOA 3FMMA 3CLYA 2CLXA 3DKCA 2X4FA 2UZWE 3OWLA 2IZUA 4RVKA 4LG4A 3RWQA 3TCPA 4BCMA 3OY1A 5A46A 4BCJA 3A7IA 1H1PA 3DJ6A 3VO3A 3E63A 5LWMA 4BN1A 3B2WA 4IVAA 3A4OX 3GFWA 1HCKA 4I4EA 5HQ0A 4QYYA 2Z60A 4NFMA 1JQHA 2JBOA 2WU7A 4MWHA 3DCVA 3IOPA 3FMLA 4B8MA 4AP7A 3KCKA 4YTCA 1L8TA 4E6DA 4ITIA 3UIBA 5EYDA 2QCSA 3QKLA 3R0TA 3ZUUA 3G15A 4FZAB 4I22A 4AGWA 4RWKA 1ZY5A 3R28A 3RI1A 4YZDA 4F99A 4LV8A 4JR7A 4C61A 2XK7A 4I6FA 2P3GX 3PVGA 3ZSGA 1QPCA 1VYZA 2YIQA 3AMAA 4MWIA 2RIOA 5CSVA 1R0EA 2EU9A 3WILA 2BUJA 3DDPA 2YWVA 3GOPA 5EW9A 3BHUA 1KE6A 4JBVA 4PX6A 3U4UA 3QD2B 4N0SA 3ORIA 4CEGA 5C27A 4WBBB 4EQUA 4XG7A 4ZMFA 3KRRA 1DI8A 4NKAA 2W1CA 2QHMA 4DH5A 3D2KA 4NM3A 3F7ZA 5H8EA 1IAHA 5F20A 5CEIA 2ITOA 3TKHA 3PPJA 4IMYA 4X2KA 5CVHA 1R78A 5CANA 4XG8A 4YTIA 2ZMCA 4JX3A 4NL0A 3FXXA 5DGZA 5AP0A 5C4LA 3Q60A 2OIDA 4PMSA 2VD5A 3BE2A 2QHNA 4AG8A 4F7NA 4IIRA 4D28A 3BGPA 5HU3A 1ZOHA 3FMKA 1REKA 2BR1A 2VTNA 1W0XC 4FIEA 3NPCA 4RQKA 5FEDA 5A54A 5ICPA 2VU3A 2C4GA 2E9VA 5FTQA 4B8LA 1FBNA 1Q62A 4KB8A 3PVBA 5LCJA 1KOAA 5JFVA 3ZU7A 2O64A 1H0WA 3D2IA 4RFZA 3ZSIA 4C7TA 3RNIA 4N70A 5FWKK 4FEWA 3BBTB 3WZJA 3COMA 2BMCA 3PRIA 3ZEWA 4QMXA 4I0SA 3BYUA 4H05A 4ANLA 3GB2A 3AC5A 5AAGA 3RPOA 3R73A 4AFEA 3MH0A 5M06A 4F6UA 3M42A 4FIJA 2UVYA 5EOLA 4I6QA 5AADA 4QP7A 4W4XA 4Z16A 3I1AA 4D0XA 2UVZA 5AWMA 3QTZA 4OBPA 4O0UA 4FV7A 4FEXA 4J99A 4GK4A 4DFZE 5KKRC 3GCUA 3N51A 3SOAA 4FV6A 3PXZA 4C2VA 4KABA 5EYMA 3I5ZA 3KXZA 4IQ6A 4O6EA 3OMVA 3WE4A 4CT1A 4XNEA 1H24A 5IH6A 4QPSA 2X2KA 4X7QA 4RX5A 5FUTA 2CSNA 3JYAA 4JXFA 2J4ZA 5EI8A 4BYJA 1YI6A 4RPVA 4DFXE 4D2RA 4QQTA 4HPTE 2GSFA 4Y73A 4Z7GA 4L7SA 3LFAA 4JOAA 1OPKA 3C50A 1QCFA 3MS9A 3P4KA 3NZ0A 2PUIA 1FGKA 3A2CA 5EI6A 1ZMVA 4RA5A 4FV3A 4D0WA 3OF0A 4EHEA 2QQ7A 2ZYBA 4PMMA 4L3PA 4IB0A 4C59A 1ZRZA 3UOLA 3R30A 4BI1A 5A4TA 3V04A 4YO6A 2PPQA 4FTCA 3QCSA 4P4CA 5ANJA 3D83A 1FINA 4UXLA 4LM5A 3F5PA 3BX5A 4FT9A 4PPAA 1OBGA 4H3PA 3FAAA 4I0RA 4WG5A 3ATSA 2WHBA 5JH6A 1FMKA 4RZWA 1YHSA 1HCLA 4U45A 4O2ZA 5FQDC 2BHEA 3SHEA 3WBLA 3N4VA 4DFUA 5LWNA 2GMXA 2BPMA 2XYUA 4W9WA 4HGLA 3KCFA 4J97A 4HCTA 3F61A 4U44A 2W4OA 2R3GA 4CV9A 3L1SA 4AN3A 2REIA 5FM2A 3FV8A 4YJSA 4XG6A 3WARA 2YACA 3MDYA 3QD3A 4DGLC 4DG3E 2UZEA 1BX6A 3K3IA 4YJRA 1URWA 3VHEA 5J7HA 3CJGA 2YFXA 2KTYA 1H28A 3KY2A 2X4ZA 4HCVA 3I7CA 2OH0E 3NEWA 4W4VA 2V62A 3S4QA 4BHNA 3JXWA 4HCUA 3R2YA 5AP4A 4M13A 4JT3A 3PIXA 2IN6A 3SG9A 4A4LA 2PVLA 1QPEA 5KBRA 4QT1A 1OGUA 4OTQA 2CKOA 4ZTQA 1H00A 2RSVA 2WMVA 2WD1A 3EWHA 4XP0A 3HRCA 4F6SA 5IQIA 2VGOA 3PIZA 3K5VA 2Y4IC 3CPBA 4FEQA 3AOXA 3TNQB 4JDHA 3QA0A 1KSWA 3R22A 3ITZA 5K0KA 3TUBA 3R63A 3KL8A 4GG7A 3R02A 3ROCA 5HVJA 3AGMA 3SXFA 4UYNA 4LI5A 5CNNA 2JIUA 1BYGA 3R1SA 3TKIA 4D4VA 2C47A 5IA0A 4KRCA 3PJ2A 3BU3A 1M52A 4KS7A 4RRVA 3CS9A 4AFJA 4IM3A 4J95A 1KE7A 3DBQA 4ITHA 4QTEA 1YOJA 3E3BX 3R6XA 4H1MA 4X21A 1URCA 4FVQA 5FDXA 4FTTA 2C3JA 4O82A 4V01A 3OXZA 2F4JA 5CF8A 4O21A 3MA6A 4MBIA 5FEQA 1PHKA 3GC7A 4KUJA 4DTBA 4ARKA 4BI0A 4C38A 3NYOA 4OTRA 3SKCA 2PZIA 3H0ZA 1SNXA 3GCSA 1OUKA 5HIEA 4FNXA 5CF4A 3OP5A 4RIWB 3C13A 3EFKA 2WTDA 4ZS4A 4IAIA 3DB8A 2G01A 3KA0A 4JLCA 4FSMA 4RZVA 2HELA 5ANEA 4MF0A 5C26A 4L44A 4LQMA 4CFWA 3GFEA 4BCQA 3LE6A 4E6CA 1TQPA 2C6LA 3FPQA 1JWHA 2X81A 4KNBA 3AC3A 4C62A 1U54B 2BZKB 3T8OA 3VS1A 4BB4A 4YJTA 3L9MA 4FTLA 3AQVA 5I9XA 4V05A 3ORLA 2ETMA 5HIDA 2A19B 3I81A 1PXNA 3BHTA 3NYVA 3H4JA 3OW3A 5GZAA 3SQQA 3E62A 2C3IB 2EXCX 4QMUA 2FGIA 4EKKA 3LMGA 3M1SA 3KULA 3OVVA 5A6OA 3RGFA 1ZWSA 3HYHA 3S0OA 4QYEA 2E9UA 5CXZA 2C5XA 2ONLA 3NIZA 4FX3A 4O0XA 4YC3A 3SXRA 3Q5IA 5J5SA 5CNOA 1PKDA 4ANSA 4QO9A 4BR3A 4RX9A 4A9YA 4H39A 4GH2A 3N4UA 2BZJA 3AXWA 5HTIA 3ACJA 2HIWA 3OWKA 4LGGA 5LARA 3SOCA 4FNYA 3KF4A 3R1QA 3Q9XA 3E87A 4XV3A 3EYHA 4FTNA 4R3CA 2EXMA 2OI4X 4KIKA 2UV2A 4CGAA 3IGOA 1OIRA 3EQFA 5AUVA 3L9LA 3E92A 3HMPA 5C8MA 4GJ3A 4U79A 5K3YA 3HAMA 2FA2A 4YZNA 3UVQA 3NW5A 1W84A 2OZOA 4QMPA 4PF4A 5E8UA 2YJSA 1RDQE 4JIKA 4C36A 5F94A 3EHAA 3GQLA 3FMJA 4QMZA 2J5FA 4GJ2A 5DIAA 5HVYA 5EQPA 1UKHA 3FI3A 3CBLA 3SRVB 3TV4A 3C0GA 5CALA 2PVYA 2BZIB 3LJ0A 4ACCA 3LQ5A 3VS5A 2QNJA 3ZXZA 4TW9A 5D9HA 4BDDA 2RL5A 3C0IA 4I20A 4ZOGA 4DGNA 4BDBA 4JG6A 1WFCA 2PVNA 4C4IA 5IQEA 5G1XA 4IAZA 1UV5A 3BKBA 3GU5A 3GCQA 4OAUC 1YXTA 3PWDA 4E93A 3HRFA 4HVDA 2PE2A 4DFYA 4KKEA 4MNFA 2C6DA 4WOVA 2R7IA 1YDTE 5AM7A 4Q9ZA 4FIGA 1XQZA 4IANA 3C5IA 5CQUA 2XM9A 4BDFA 3R83A 5KKRB 3W33A 2Z7LA 3VAPA 2W7XA 2JDVA 4D4YA 3HVCA 1YXVA 4FV4A 2OIBA 5AR7A 3ZZEA 4NU1A 4PRJA 4U41A 4I93A 4C34A 3L9PA 3QRKA 4YC6A 4EHZA 5JFWA 1KUTA 4GKIA 1Q8TA 3DK6A 5AP1A 4FI1A 5HNGA 2VWWA 5ITAA 3LOKA 4BWKA 4QYHA 4O7WA 3NW7A 1O9UA 1UU3A 3U9CA 3MPTA 4KKHA 4NSTA 3KK9A 5JT2A 2VWVA 2YDIA 1XH4A 1M7QA 2OO8X 2PTKA 3P1AA 4RJ7A 1TQMA 1YDRE 2ITVA 4TN6A 4RJ8A 2GS6A 2GNFA 5AUTA 2CGWA 1Q8YA 3UDBA 4FKIA 4HVHA 4HNFA 4FL2A 5BYZA 4FR4A 5TO8A 2WMAA 3CY3A 3FL5A 1O6LA 4IWPA 3QRIA 3PY3A 2XNOA 1CDKA 2QOQA 4DTKA 5CX9A 3G9NA 4IVBA 2YA9A 3TWJA 4B7TA 4Y5HA 1IA8A 2OSCA 1WBSA 3DZQA 5CQWA 2C69A 3P23A 4DLJA 4L42A 4KSPA 3QC4A 4EKLA 4FVRA 4I0TA 2HCKA 4F70A 3RK7A 5EDPA 3F82A 5DRDA 5L6WL 3TV7A 4JS8A 3W2OA 4X6QC 4TWCA 2ZB0A 3VBQA 2VV9A 4S30A 1R3CA 4IDVA 1XHAA 4ZSGA 5M55A 5J7BA 3GC0A 3BQCA 4D2PA 3D7TA 3G0EA 4MX9A 4FT7A 3ZTXA 5D12A 3F9NA 1V1KA 3H30A 2G15A 3Q04A 3DXNA 4G3DA 4KSQA 3W2PA 3QX4A 3H0YA 4R5SA 5AR8A 4QOXA 1Q24A 4N57A 3QD0A 3SA0A 4NW5A 1P4FA 4FV5A 2WTIA 2Y4PA 2BKZA 4OTFA 4DEGA 2Y4IB 3CIKA 3CTQA 2XK4A 4GVJA 5ANIA 3NWWA 4I23A 2VTSA 3F2AA 4OLIA 3R9RA 2Y7JA 2YIWA 5C4KA 2F2CB 4YHTA 3LCTA 1OPLA 3Q4UA 2XP2A 4ZSJA 4CCUA 4FKLA 4DAWA 4YSJA 3UPXA 5BQ0A 4NJ3A 2PZRA 4WG4A 2B7AA 2C6TA 2W1DA 2WIPA 3DA6A 2PVJA 3ENHA 3F3VA 3F88A 5EG3A 3TACA 3OFMA 4DHFA 4DA5A 5IQCA 1V0OA 3ANQA 4FK3A 3ZLSA 2ITTA 3UOHA 4FZ7A 4O0SA 5L4QA 2P4IA 3EN5A 4X6RA 1MRVA 4FTRA 3B8QA 4FEVA 2YIYA 4F9WA 4D55A 4IWOA 4M8TA 5B2KA 4APCA 3HDMA 2WTKC 5BVEA 3V6SA 3FQSA 4FG9A 2GNJA 3PG3A 1GZOA 3VW6A 4PDOA 2PL0A 3MFSA 4BKJA 4MCVA 2UZBA 4PNKA 3FZRA 4BCFA 4RC4A 1A9UA 3NRMA 4GFOA 4FTOA 4GK3A 4IW0A 2UZUE 3F3WA 2GTNA 3PXRA 4BTFA 2F49A 4E20A 4EH8A 3OWPA 2QOOA 2FSTX 2XIYA 3A99A 4G3CA 2J9MA 3LAUA 1R1WA 2JITA 3D15A 4LL0A 4FKGA 1XBCA 2Q0NA 3TZMA 3NVKI 5FBNC 3WOWA 2OF2A 2CLQA 3MBLA 3TIYA 4IHPA 2R2PA 4DGMA 1Q4LA 3KN5A 4KIQA 3EH9A 1JKKA 2XJ1A 4O7TA 4L3JA 4ZY6A 4CZTA 3ZRMA 1UU9A 2X6EA 3EB0A 4DE4A 2OFUA 3RK5A 3BLRA 4G5PA 3GUBA 3ORNA 3IQ7A 1TVOA 2PK9A 4HNIA 2ZV8A 4JBPA 5LVPA 4G1WA 4M84A 1J7UA 3HV5A 4F4PA 3DKOA 2A27A 3TT0A 2R7BA 3R8ZA 5TT7A 5AV4A 2IW9A 3BELA 4U6RA 4V0GA 4I6BA 5A14A 2VX0A 4QNYA 5ETAA 4YP8A 4Y72A 3C4WA 5TOZA 4AACA 1XWSA 1XR1A 4CKJA 3OUNB 5HVKA 2Y6MA 2ZM1A 4A9RA 2CNVA 3FZSA 1Z5MA 1YDSE 4LMNA 4H58A 3RAKA 1J1CA 5GJGA 4RC2A 4AZEA 4F09A 5AP3A 4F65A 2XNNA 5IQHA 4HYHA 5HD7A 4F9YA 4EHVA 2HXQA 3P0MA 3PJ1A 5BUEA 2B9IA 5FP6A 5BPYA 4EOQA 3V3VA 4YHFA 2C0IA 2G2IA 4K18A 1SZMA 3E93A 4RJ4A 3VS3A 1OZ1A 3HRBA 3BE9A 4RIXB 5DLSA 3DAKA 5AR5A 5BVFA 3QUDA 4IAFA 4TRLA 2XRWA 4FSNA 3R71A 4G3EA 1X8BA 5CAVA 5CY3A 4A4OA 3FUPA 2QR8A 4KKGA 1J3HA 2VTJA 3VJOA 3PJCA 4E4XA 4P5QA 2UVXA 1XH7A 3IO7A 4F9AA 3ATTA 2VTPA 3O8UA 2PVRA 4BGGA 2ZB1A 5DI1A 3UZRA 3HLLA 5DPVA 2X7FA 4JAIA 3EYGA 4U8ZA 2J0KA 2Y6OA 2J2IB 2UZNA 4GK2A 4QP6A 3UGCA 3ZLWA 4AZSA 2ZV9A 4BDKA 4C02A 4HW7A 3IS5A 3JVRA 4WG3A 3KN6A 1OKYA 4XV1A 4WD5A 3GNIB 4RIYB 5EYCA 1FQ1B 5LMAA 4MBLA 3R7IA 5DBXA 3WF8A 3EOCA 1MQ4A 3O8TA 4QP9A 5E1SA 1Y91A 1YWVA 2XIXA 4O22A 3PA4A 4O96A 4WNMA 4M7IA 4ZZNA 4JG7A 1VEBA 3LMIA 2PVFA 4RVMA 4IM0A 1LEZA 4FBXA 4JVGA 3DS6A 1BL7A 4IAYA 4EONA 4HGEA 3NYXA 4RGJA 3VUIA 4ZSAA 4EH4A 1ZOEA 3IK3A 3MB6A 4IWDA 5EHYA 4BHZA 4C4HA 5IU2A 3FEGA 2OH4A 2YERA 4TTHB 3RCJA 1UKIA 2UW9A 3HP2A 3DV3A 5K5NA 3R2BA 2Z02A 3Q2MA 3KRLA 5KZ0A 3CD8A 4U3YA 3KVXA 4NCTC 4FK6A 1YHWA 5H9BA 4ALUA 4F08A 2XNBA 2P55A 3B2TA 1OKWA 3HV4A 4RX8A 3KQ7A 4UWBA 2YZAA 4PUZA 3BYMA 3ZFMA 3CTHA 3FDNA 4WBOA 2HAKA 3DKGA 5CTPA 1LEWA 4FIIA 3IPHA 3EQRA 1ZY4A 2OIQA 3BLQA 3P7CA 3RK9A 4HYSA 2O63A 2IZRA 3LJ2A 4IFCA 3FKOA 3V5QA 4CD0A 3DLSA 1B38A 3OUKA 4U97A 3OOMA 3ORTA 4UX9A 3Q9ZA 3KXMA 1R39A 5ANDA 2YZLA 2WPAA 4BCOA 3CCNA 5JQ8A 2BFXA 3LM0A 4UALA 3CXWA 3R7VA 4MXOA 5E8XA 2W06A 2ZV2A 5J1VA 2BAQA 3EMGA 3NUXA 3COHA 4XG9A 5AUXA 4D4SA 4E6QA 4FF8A 4CMUA 4EJNA 4MXYA 4LOQA 1O6YA 2YJRA 2I0VA 3RZFA 3A8WA 5DYJA 3KRXA 2CNUA 4ZLYA 3D0EA 1J91A 4QPMA 5EQEA 5F9EA 1Z9XA 2R9SA 2JAVA 1FVVA 5DHJA 3ZM4A 3T3UA 5I9WA 3PA5A 5BVNA 4BKZA 3LFBA 5E8SA 1O6KA 2YDKA 4KS8A 3LFDA 1ZYDA 2EB2A 2DS1A 4GS6A 4MQ2A 4WNOA 3UNJA 5M4IA 4OT6A 4PDSA 2SRCA 4FYNA 4I92A 4PTGA 2R4BA 3GI3A 5CI6A 5IUIA 5DR2A 3TNWA 2JAMA 3PY1A 3ZBFA 3FE3A 4FTQA 2PVKA 4O0RA 3KREA 3BYVA 5B0XA 2JDRA 2BDWA 3LXLA 3QQHA 2JKMA 4IX3A 4L01A 1VZOA 5IEXA 4E26A 4NH1A 3QLFA 4RVLA 4AW0A 1L3RE 4L67A 4ALVA 3KRJA 3QL8A 3WYXA 3U9NA 4GEOA 1I09A 2CKQA 1GIIA 2A0CX 4AXAA 4DYMA 4W4YA 5JEBA 1P2AA 2OLCA 1RW8A 1ZYJA 4UWYA
chains in the Genus database with same CATH superfamily
3FKLA 4FL3A 4QMYA 2F7EE 2YLFA 3NUAA 3OBGA 3F5GA 3OXIA 2WOUA 3FYJX 1MQBA 2JKKA 4MXXA 4FT3A 4IVDA 4CQEA 5DT0A 2J5EA 4BTMA 3UO6A 4YLJA 1YOLA 3Q9WA 5AV2A 4B6LA 5KCVA 4O86A 2WTKB 4FTIA 2WQNA 2R3QA 3HMNA 1H0VA 4K77A 4D1ZA 2Z8CA 4E6AA 4XYFA 3FL4A 4GUEA 2H96A 3RP9A 4F9BA 1OPJA 4ZZMA 3JVSA 4UZDA 5IQFA 3ALOA 3SX9A 2HZ0A 4G3FA 3UO4A 4F6WA 3QQGA 1Y6BA 5IUGA 3DQWA 3HEGA 5IQBA 4C57A 3V5LA 2PMOX 2VNYA 4RMZA 4FV9A 3PJ8A 4HVGA 5CF5A 1PKGA 2JBPA 3Q96A 4IM2A 4ZP5A 4ZS0A 3BU5A 4IJPA 5FG8A 5LMKA 5HO8A 5IDPA 4FOCA 5KMIA 3HA8A 4OTHA 1WBOA 4J52A 4YNEA 4ZZOA 1NA7A 1Q61A 4YURA 4R3PA 3Q6UA 4PNIA 2AQXA 4FV1A 3R1NA 3OG7A 5DEWA 2BROA 4ACDA 2ERKA 3THBA 5A4CA 4I6LA 4FZDB 4FG8A 2CMWA 2ITQA 4KRDA 2QG5A 1TKIA 3FZPA 4FUYA 2W17A 1G3NA 3NS9A 3UYSA 1JBPE 5IA3A 5J9YA 3RALA 1XH8A 2WTCA 2VTOA 4F1OA 3PJ3A 4JBOA 4QYFA 3BI6A 4A07A 2UZTA 5M4FA 3CQWA 3EJ1A 2W1FA 4ERWA 2CN5A 3QHRA 3DJ7A 2WFYA 3TXOA 4BVUA 5BNJA 4FOBA 2VO0A 3QU0A 1A06A 1W2CA 2WMWA 4HPUE 1NVQA 1A48A 1ZMWA 3UMXA 4O84A 4WUNA 2XKCA 5AA9A 5CYIA 3VF8A 3IG7A 3PRFA 4JAJA 3TJCA 3TNIA 3ZH8A 4F0FA 1KE9A 2WQOA 3W8LA 3SXSA 2QOKA 1XMMA 5ETIA 5CEQA 5LVLA 4Z9LA 5HTCA 2QOIA 1Y6AA 4C4EA 4X0MA 3AD6A 3EFLA 3NDMA 5IA1A 2W5BA 1UNHA 4Y46A 5HZNA 4HVSA 4I5CA 5CASA 4C4FA 1K2PA 2PZPA 2XKDA 2WMUA 1M2RA 3CGFA 1TQIA 1XO2B 4HJOA 4JDIA 4P7EA 2GHGA 4NJDA 3U55A 1H08A 3VF9A 1VJYA 3Q6WA 1GIHA 1H01A 4XLIA 1MUOA 4S32A 5FEEA 4BDHA 3QRUA 3ZHPC 2X7OA 5HE3A 3PLSA 3REPA 3TEIA 2C3KA 3FI4A 4DG0E 3F3ZA 4E1ZA 4IJ9A 3FI2A 4KINA 4I3ZA 4RWLA 2QLQA 4UMQA 2VGPA 3LFEA 2XA4A 4R8QA 3DXPA 3I0OA 4PTEA 3R9NA 5EQYA 4YJOA 4WA9A 3LJ1A 2KULA 3LHJA 4ZLZA 4AXEA 3UNKA 4GYGA 2VN9A 1WMKA 1PMVA 2G9XA 4IB3A 3VS2A 2YCQA 5K4IA 1YOMA 2VTRA 2CNQA 4WIHA 1W98A 4NM5A 4AGDA 3ORKA 2XVDA 3FI8A 4AX8A 3FKNA 3NCZA 2P33A 5HCXA 3QGYA 3QALE 5AR3A 2VTAA 4AOJA 1SMHA 3II5A 4I5PA 4BZNA 4XMOA 3QTXA 3FC2A 3Q3BA 4O4EA 3GEQA 3QTWA 4C58A 4QP2A 5JZJA 4GFMA 4Y5QA 4M12A 5AR2A 2OXYA 4ID7A 1IG1A 4O4FA 3QTUA 3RVGA 3D9VA 3VULA 4O4CA 5DR6A 3F3TA 1XBAA 3QZGA 4U9AA 3ORPA 2IWIA 4CXAA 3KXGA 3FLYA 4O7RA 2Z7RA 4CFFA 2I6LA 4FC0A 1IRKA 2A98A 2I0EA 5CSHA 1UVRA 2PE1A 4FSQA 2WKMA 2EUFB 2J90A 4PMPA 2VX3A 5A6NA 5AUZA 4FA2A 1Q3DA 3SG8A 3GGFA 4JRNA 4AZFA 2R3NA 3PVWA 5JQ5A 3U6IA 3PXYA 3SLSA 2Z7SA 1GJOA 1I44A 1V0BA 3OOGA 4CLIA 2UW7A 3NUPA 1J7LA 3QWKA 4P5ZA 5LOHA 2OJ9A 4E5BA 1YQJA 3Q9YA 4BTKA 3WIKA 2JDTA 3R7EA 3QQUA 2VX1A 3ZFYA 1EH4A 4FKJA 4XHKB 4WT6A 3W2CA 4QMVA 4TYJA 5AA8A 4JJRA 2I0YA 4G34A 4GVAA 1BL6A 3KC3A 3DXQA 4QMQA 4G16A 4W4WA 3BHHA 4FNWA 2PVMA 1H1RA 3G2FA 1XH6A 2BTRA 4CRSA 2XALA 3DBDA 3QKMA 3GU7A 4FEUA 1J1BA 2VWBA 3RNYA 4D1SA 1S9IA 3P5JC 2YIXA 4EYMA 4O7ZA 4D2SA 5J1WA 4F7JA 3BBWA 1BLXA 5FGKA 4YLLA 4QNAA 4YPDA 4QRCA 3FZ1A 2EXEA 1ZMUA 2GFSA 3CD3A 5FP5A 4QTCA 1YI4A 3ORXA 4L45A 5HESA 3RCDA 3NMUF 3DTCA 4H36A 2X0QA 4USDA 3ZSHA 4QD6A 4JL9A 3LLAA 2FSLX 1Z57A 4G6NA 4KBAA 3DK3A 3FMEA 3LKMA 1JAMA 4EOJA 2ITWA 3EL7A 3ET7A 3ZDIA 4HGTA 4CMOA 2HZ4A 4CSVA 2OK1A 4IAAA 1JVPP 3RHKA 4I94A 1YW2A 3NR9A 3WE8A 3B8RA 4MNEB 5HI2A 1WBWA 4BL1A 3RM6A 1LPUA 3COIA 3GVUA 3EN4A 5T3QA 4NIFA 4G9CA 3NX8A 4BFMA 5LJJA 3UOJA 3P5KA 3G6HA 3MIAA 4CVAA 3IGGA 5AFVA 4DDGA 3PLAE 1PMEA 3HMOA 3O7LD 4CZYB 5A4LA 2OF4A 3PWYA 3HV6A 3LM5A 3A4PA 4C3FA 3K54A 4EH2A 2OZAA 5L8KA 3KGAA 3BV2A 3HKOA 3I6UA 4YJQA 2HW6A 4K33A 4AW1A 2HXLA 5CAQA 4AN2A 5EHLA 4DHZA 2AYPA 1Q41A 2YM6A 4C35A 3PZEA 3KF7A 3BZ3A 1UNLA 4AF3A 5L2QA 2H6DA 1H26A 4QTDA 3P78A 4K6ZA 4QMTA 5JZNA 5CT7A 4CYIA 4YMJA 5LMBA 3MESA 2PE0A 4R6VA 3MFTA 3CGOA 3CQUA 3D14A 3HX4A 5HE2A 5HD4A 2GHLA 3W0QA 1FPUA 3VQUA 2NP8A 3POZA 4YLKA 4E4NA 4EH7A 2HY81 2UZDA 2FB8A 3P86A 4KAOA 4R3RA 1J7IA 3UMWA 1B6CB 1W83A 4AN9A 2G2FA 2VZ6A 1PYXA 3KMUA 5CU4A 1ZZ2A 3PYYA 4EC8A 2VTIA 1H27A 1ZLTA 2A2AA 3PXKA 2PYWA 3BQRA 1AD5A 3CY2A 1KWPA 4HYIA 5EM8A 4EOLA 4YO4A 4B0GA 1U4DA 1YXSA 4MD7E 2DUVA 5EM5A 2W1GA 5KO1A 4FVPA 2WTJA 2Z7QA 3DBFA 4II5A 2B55A 3FZOA 1PXIA 4C4JA 2GHMA 3TZ9A 3VN9A 4AZTA 2ZVAA 4ZMEA 4R77A 3MJ2A 3U54A 3C0HA 2R3HA 2EWAA 2V0DA 4F0IA 5JGBA 3BHVA 3V8WA 5AP5A 4BDGA 3JY0A 4J8NA 4O91A 4KD1A 4CKRA 4BTJA 4IVCA 4QMMA 1IEPA 3S2PA 1YXUA 4FT5A 2ETKA 3V8SA 2HY0A 4AGUA 3C4FA 4EEVA 3QQJA 4UV0A 2W9ZB 5AV1A 4NEUA 3O96A 3C4EA 3UQFA 4TKSA 4BKYA 3MB7A 5FRIA 3OY3A 4LL5A 3UOKA 2YDJA 4A9SA 4I4FA 4U3ZA 4D2WA 5J79A 2R0IA 4RBLA 4QP3A 5DVRA 3WZEA 5H2UA 2O65A 2VTLA 3PUPA 2UW3A 3CE3A 3QCQA 5DNRA 3HUBA 3UYTA 5FXQA 2J50A 2ONLC 3E8CA 4CQGA 5EM7A 5M44A 3C7QA 4IZAA 5I9UA 3MY1A 4R7IA 3ZM9A 4R7HA 2NO3A 1HOWA 5ACBC 5FXRA 2XK3A 2BRMA 2VWZA 4L53A 2C1BA 3LZBA 5IISA 3GC9A 1ND4A 5CS6A 3M2WA 3AGLA 4EUUA 3TI1A 2UUEA 2YHVA 3A7FA 1SVGA 2QONA 4R78A 4TYEA 4D2VA 1ZYCA 3RMFA 1PYEA 5LVOA 4E4MA 3PY0A 4M69A 4DG2E 3HV3A 3T3VA 4ERKA 4UN0C 3OD6X 2QO9A 4BCKA 3MSSA 2B9HA 2JIIA 4RA4A 2XMYA 2UZLA 5H3QA 1YI3A 3R8UA 3UDSA 2XK6A 4MHAA 5GZ8A 3D5UA 3A7JA 3P9JA 4B99A 2XAMA 3R9OA 3P08A 1MRUA 5HOAA 5CI7A 5M57A 2IZSA 2WGJA 3GBZA 4FIFA 4DT8A 1PXPA 4U40A 2R3PA 1SVEA 3F6XA 4XV9A 5IZFA 3POOA 4N4SA 2R3FA 1Y8GA 3PXQA 3VS6A 4C3PA 5IQDA 2AC3A 4YZCA 5DEYA 1KOBA 3EL8A 5E8VA 3WZKA 1PXLA 1JLUE 5CAOA 3H9RA 3VWAA 1WBNA 2BRGA 2I7QA 3CQEA 3EQIA 3GCVA 1STCE 2YEXA 1E9HA 3E8EA 3UZTA 3FSKA 3NVMB 4ZSLA 3KKVA 3FLZA 5A9UA 3AC4A 3OWJA 3AD4A 2BCJA 4DITA 3GQIA 4YBKA 4AOTA 2GNIA 4W9XA 4AOIA 4GUBA 4G3GA 5EW3A 3W32A 1M2PA 3AT4A 2XS0A 3G9LX 2RFNA 3F69A 1GAGA 3TNPC 3VNTA 3DZOA 3FWQA 2BIYA 3PXFA 4FODA 2XNEA 1OM1A 2W1EA 3EN9A 5A3XA 3PA3A 4PP7A 4LYNA 4LFIA 3LCKA 1PXJA 3C1XA 4FG7A 3N4TA 5DE2A 5IH5A 4KWPA 4D1XA 3TDVA 5BVKA 5JKGA 2QURA 2C3LA 3UODA 4LOPA 3FQEA 5K9IA 4C0TA 3EQHA 4RJ5A 5AEPA 4GIIA 4ZJIA 4N6YA 1NT2A 3TDWA 4XBRA 4GL9A 3OT8A 1CM8A 3ZO1A 3RAWA 5EKOA 2H34A 3FYKX 5HO6A 1U59A 3VIDA 4H3QA 1DAWA 4EOIA 4ZTRA 4LOOA 2WQBA 4TYGA 3E3PA 3MA3A 3T9TA 4O7VA 1P5EA 2X2LA 2WTWA 4ANMA 2QKWB 5IA2A 5KUPA 2X8EA 1OL5A 2PHKA 3WF7A 4NTSA 4MXZA 5DR9A 3KMWA 1BUHA 1U5QA 2VUWA 2XB7A 1WVWA 4MXAA 1NVRA 4FZ6A 5CLPA 4YTFA 5CU0A 5EYKA 3FC1X 4HYUA 4RT7A 4E8AA 4PDPA 4ZJVA 5CEPA 3GXLA 1FGIA 3NW6A 4TYIA 4BYIA 3NIEA 5L2WA 1W82A 2LAVA 3VUKA 5EI2A 4ZTHA 4FKTA 3ZCLA 5HNIX 3JR1A 4FKWA 5D10A 3O50A 4YZ9A 1JSUA 5BVWA 3LMHA 5IQAA 4NW6A 4UMPA 3HL7A 3DK7A 3RTPA 4L8MA 4FSWA 4GMYA 3V5PA 4E73A 4EOMA 2B54A 3ORMA 2C5VA 3QGWA 4DH7A 5E1EA 2YM3A 3RAHA 4R1VA 1ZAOA 4EH3A 2OICA 2Z2WA 3H10A 3W8QA 3QXOA 5AAEA 5KMNA 3NFGB 3GENA 4BICA 4FKOA 4CG9A 1RQQA 2JGZA 4M97A 2YWPA 2XH5A 1P14A 4S31A 2PZYA 1CKIA 2R3KA 4IX4A 3ULZA 3QYWA 3W55A 3GCPA 3QCXA 3D7ZA 1W2DA 4U5JA 5C8KA 5EKNA 4QDEA 4RLLA 4DEIA 4BC6A 3MH1A 4O0YA 4X3FC 4XRLA 1WBVA 4D4RA 4ENXA 1PJKA 5BUJA 3W10A 3V5TA 3ZMMA 4JBQA 1G8SA 4E4LA 2C68A 3ZONA 1CKPA 1OUYA 1S9JA 2R0UA 2IZTA 4QPAA 5EW8A 1OMWA 3QTIA 5D41A 2C5NA 4CYJA 4E5AX 3S3IA 3F5XA 1BI8A 2ZDTA 3IDPA 4QP8A 1PXOA 4O83A 3TTIA 3MVJA 2UZOA 4DCEA 2C5YA 4O2PA 4YU2A 5GJFA 4S2ZA 3W2QA 3DTWA 4IZ5A 5CT0A 5HNBA 3MJ1A 4TL0A 4BDAA 3Q52A 4XG4A 4FGRA 3LVPA 5TF9A 1ZYSA 5DMZA 2GNLA 3G0FA 3PIYA 2WNTA 2XNPA 5EDRA 2QO2A 3VBVA 2PWLA 3ACKA 4WHZA 2R3LA 5ANOA 2X8IA 3ANRA 4O1OA 5D7VA 4BBMA 1ZOGA 4MKCA 3BLHA 2W1HA 4CLJA 2NRUA 5AV0A 2IW6A 3HA6A 4YNOA 2PZ5A 5CENA 5HGIA 3ZUVA 4AE6A 3WF5A 3G33A 4K8AA 4IEBA 3F3UA 5BVDA 3SC1A 3E7VA 4MUQA 3MVLA 5K5XA 3TUCA 2IVTA 2ZM3A 2BRHA 3LQ8A 5HKMA 3F2RA 3OC1A 4ACGA 1W8CA 4IACA 2BZHB 5E90A 4FIHA 4HGSA 4A9TA 3ETAA 1UU7A 4ZJJA 2BTSA 3KULB 4BDCA 4FJVA 3QUEA 3ZFXA 1Q8WA 5GIPE 2E9NA 3L9NA 1YWNA 2Y0AA 3I0QA 4EI4A 5IQGA 4A4XA 3MPMA 5JRSA 4FTKA 3NLBA 5FM3A 4JIAA 3Q5ZA 4AS0A 4PL4A 4UMUA 4QEBA 3EQBA 2XEZA 2B1PA 2QOCA 3A7HA 4I1ZA 2X39A 4IBMA 4DH3A 4EOSA 4EWHA 3S00A 3GP0A 4M0YA 3WF9A 3VHKA 4ONAA 2PVHA 3BV3A 5I9YA 4X2JA 2HZNA 3WYYA 2QG7A 2XNMA 3RPVA 4KIOA 2R3MA 2Q83A 4M67A 2B4SB 5AMNA 2J0MB 2XANA 4FKRA 2CHLA 4FT0A 1E1VA 1U46A 4KIKB 4E5WA 4TWNA 5IEVA 3Q53A 2YM5A 2JD5A 4MYGA 5BYYA 5AM6A 2WQMA 2WEIA 2G2HA 4QQJA 4AZVA 1H4LA 1REJA 2X9FA 4CFXA 4AXDA 4FICA 3BGQA 3FQHA 4JX7A 3IW7A 2OJIA 4Y8DA 5DA3A 1JNKA 3FPMA 3LFQA 4AW5A 2Y9QA 4XH6A 3V5JA 4OTDA 2IO6A 3EZVA 5CU2A 1M14A 2YLEA 3UJGA 4H3BA 4BBFA 4RLKA 3RWPA 3ZLYA 3UP7A 2BFYA 3V51A 3I5NA 3UPZA 2W5AA 5CVGA 1XMLA 5CSXA 4AXFA 3GU6A 3ZO2A 4J53A 4Q5HA 5EM6A 2GNHA 5DG5A 2C6IA 5HIBA 3ZXTA 5HG8A 4BF2A 3IW5A 4QTBA 5HX8A 5IEYA 4RIWA 3W2RA 5CZHA 4A9UA 2H9VA 4GCJA 2ZMDA 2JDOA 2RFDA 3LFSA 5L6PA 4MNEA 4Q9SA 5CU6A 4IB5A 3COKA 4QP1A 4TNBA 2RFSA 1WVYA 4FTUA 4S33A 4ASDA 5KNJA 4ANBA 4UWCA 1GIJA 3KB7A 4EZ7A 5EFQA 4FUXA 4ITJA 2YCFA 2JDSA 4FKSA 4JQEA 4X2NA 3R9HA 3V6RA 3FLNC 2VTHA 1U54A 4TY1A 2OJFE 5HHWA 3EN7A 3ZRLA 3ZZWA 3ENMA 4KA3A 1DM2A 5CWZA 3EN6A 5GZ9A 5TKDA 4XCUA 1K3AA 2RG5A 4LRMA 3RPSA 1SNUA 4JR3A 4CTCA 2AUHA 2QOBA 3LQ3A 4AAAA 3UDZA 5JSMA 2FUMA 3A62A 5B7VA 1OIUA 4NK9A 4F0GA 2YABA 3CR0A 4DFNA 1ZARA 4IZYA 1GZKA 5EH0A 5KX8A 2XK8A 1YRPA 4Y83A 3UQCA 1BI7A 2QLUA 5IA4A 3LW0A 3FSFA 3TIZA 3IW8A 5HCYA 4AT5A 4MEDA 4EWQA 2QU5A 3LPBA 5DRBA 3MH3A 2PU8A 3AC2A 1JKTA 4UB7A 3RKBA 2X2MA 3UG2A 2V55A 3I6WA 1JKLA 2GQRA 5GIOE 3QQFA 4O7NA 3WF6A 4YSMA 2W96B 3VS7A 4NTTA 5KHXA 4J98A 5HLNA 3R7YA 1OIYA 5HICA 1FMOE 3P7AA 5I9ZA 3KK8A 4B9DA 1B39A 4RFMA 3R9DA 4MD9E 4BDIA 4ZTLA 4CFUA 3EIDA 5GNKA 1H1WA 2UW4A 5L8JA 3TZ8A 2JLDA 3DAEA 3KFAA 3U4WA 3SW7A 2QC6A 5IH4A 3O8PA 4FNZA 3R8PA 2CGVA 2YCSA 3M11A 5FDPA 3IONA 1PY5A 3QUPA 3D7TB 2XRUA 3K2LA 4PPCA 3R04A 1PW2A 1XH5A 3PE1A 4G5JA 1F0QA 4GIHA 4X2FA 5KE0A 2IG7A 4DCAA 4FSRA 4BRXA 4NUSA 3VVHA 3QHWA 4XOYA 3SRVA 1IASA 4RX7A 3IW6A 3BL9A 3PTGA 4D9UA 4NM0A 4XLVA 4DTAA 3UZPA 4ZTMA 3W2SA 2V7OA 2BRNA 3EKNA 2OWBA 4XP2A 3NGAA 2OU7A 3TKUA 1W7HA 4BBEA 2R3RA 4MXCA 4XG2A 1WVXA 2W9FB 5E91A 4QMWA 2WQEA 3R8LA 4CMTA 3U8WA 5E8TA 3AD5A 3LXKA 3TNHA 4BDJA 2CKPA 4G6LA 1UA2A 3NUSA 4I41A 5HG7A 1GNGA 4D5KA 1NVSA 4RWIA 4XG3A 3HMMA 4EBVA 2ETRA 4X3FB 5D7AA 4YHJA 5KBQA 3LFNA 3FJQE 3D5WA 3DDQA 1GY3A 3PE2A 5T6KA 3R7OA 3UC4A 2CJMA 3O0GA 3L8SA 4OTIA 4UZHA 4AWIA 5AUWA 4E3CA 2HENA 2B9FA 4UEUA 2GFCA 3RJCA 1LUFA 5J8IA 3FBVA 1MP8A 2ITNA 3UE4A 4JMQA 4O6LA 4YBJA 3K5UA 3BYSA 3FMDA 4OTWA 4EK6A 1R0PA 3O17A 4CRLA 3Q4CA 3IECA 2PULA 4BWPA 4XJ0A 5I4NA 5E7RA 2XCKA 5FLFA 4O81A 4PDYA 5KZIA 2J51A 2VRXA 5GHVA 2YN8A 3VUGA 5IUHA 5EK7A 4AW2A 4ORKA 5LMKC 3QFVA 4GT3A 4RC3A 3QZHA 3OT3A 2R3IA 3ROYA 2XUUA 3R00A 3ZRKA 3W16A 4O0VA 3EQGA 4DHJA 4ZIMA 1OKZA 5IDNA 3W0SA 2B9JA 3WZDA 4FKQA 3NUYA 5T68A 3MV5A 3FMNA 5E8ZA 5LCKA 3R01A 4HZRA 2WIHA 4FSYA 4WRGA 3VJNA 4OAVB 3QD4A 4IC8A 4RWJA 4V0GB 5AUUA 3OCSA 1WZYA 1OL7A 5E9EA 2XNGA 3GOKA 3C51A 4QMLA 4EOKA 4M0ZA 1W2FA 2R3JA 3R1YA 5AUYA 4L9IA 3C4XA 5LVNA 3H9FA 2FVDA 4AA4A 4F9CA 5E4HA 1OVEA 4GU9A 5CEMA 5L8LA 2CCIA 3DGKA 4UXQA 3VBTA 4ZAUA 4EUTA 3VUDA 3CKXA 2F7ZE 5GJDA 3QLGA 3AT3A 4F7SA 5L6OA 2BRBA 1IA9A 4O7LA 4ZXTA 4PQNA 4APPA 4O1PA 5L2IA 4WRSA 5KMKA 2GCDA 4TT7A 5DFPA 2OFVA 4IADA 2V22A 4B4LA 4BCIA 5I3RA 2QD9A 2JFLA 3AG9A 3UIMA 3VBXA 3VQHA 1QL6A 2H8HA 3DQXA 3PG1A 3WZUA 2QU6A 4IAKA 3QAME 3TG1A 3HECA 3QZFA 3S95A 3BCEA 3CPCA 3R7UA 3EFWA 1XBBA 3MFUA 4JG8A 4GV1A 2VTQA 3CC6A 1Q3WA 4PV0A 1V0PA 2ZM4A 1OL1A 4MH7A 5K0XA 2WU6A 5BX0A 1ATPE 3LCOA 4GKHA 2QR7A 1ZZLA 4L52A 5G6VA 1CKJA 3PP0A 3GU4A 4LGDA 2PMLX 1XH9A 4PL5A 2C1AA 2VO3A 2QO7A 4FZFB 3UG1A 3TN8A 2C5OA 1G8AA 3MTFA 3R21A 2W5HA 4FGBA 4EOPA 1YWRA 2VO6A 3CTJA 4MQ1A 3GT8A 3IW4A 4G2FA 5KMMA 5DT4A 1Q8ZA 4AU8A 4MVFA 2HWPA 1SYKA 2WEVA 3FZTA 3QRJA 5J5TA 2ZDUA 3Q4TA 3ORZA 3QC9A 4U0IA 2W4JA 5M51A 2XBJA 2GQSA 4FL1A 2WAJA 2WMQA 3C5UA 5IMEA 2P2HA 3MFRA 1OI9A 3W0MA 2J0IA 3PPZA 4O0WA 4PY1A 4FKPA 3OROA 4RQVA 3H9OA 4M14A 5D1JA 4F64A 3BRBA 2O8YA 4M15A 4MD8E 2WMRA 4J71A 2CN8A 3HNGA 3RHXA 4D9TA 5L2TA 5EDQA 2IEWA 4YJPA 5IF1A 2ESMA 3ZO3A 3R8MA 2BAJA 5LXMA 3CKWA 1VYWA 3LCSA 4JDJA 2C0OA 3E8DA 5KMLA 2YISA 1PF8A 3LCDA 4CFMA 4LUEA 4AA0A 4IH8A 4UBAA 2XIZA 3EQPA 4CFNA 4EYJA 1NXKA 1QPJA 4L43A 2RFEA 4ZY4A 3F2NA 4TXCA 5DH3A 5JFXA 3QF9A 2G1TA 3BEGA 4TNDA 2FO0A 2VTMA 1Q5KA 5DOSA 2JKOA 3C4ZA 3NNVA 4A06A 4EORA 3A61A 4V04A 4DH1A 5FTGA 4BZOA 4QQCA 1OGYA 5KHWA 4NWMA 4ALWA 3GU8A 2GNGA 2X6DA 4NYEA 2VWYA 3RPRA 4IFGA 4BIBA 4X3JA 4F1TA 3FY2A 3DT1A 4AE9A 4JQ7A 2E2BA 4QTAA 4RIXA 4EH5A 4D58A 3IDBA 3WI6A 4YR8A 4R1YA 3DB6A 4C4GA 4LDTA 5CVFA 4K9YA 4EJ7A 2ZOQA 4FSTA 2IVVA 4TYHB 2GQGA 5HU9A 1DS5A 3DPKA 1ERKA 4BGHA 2YM7A 1ZYLA 3O23A 4BWXA 2NYAA 5FBOA 5CSWA 3PFQA 2A4LA 3DFCB 4XUFA 2XK9A 4USFA 1GZ8A 5HBJA 2HYYA 3QZIA 5AAFA 4K1BA 5FTOA 5HE1A 5AR4A 2C0TA 4XV2A 5BVOA 4P2KA 3HZTA 3ZEPA 3W0PA 4K11A 3UBDA 4U80A 3OW4A 3VS4A 3WIGA 2HOGA 4YTHA 4XRJA 1F3MC 1VR2A 3MWUA 4NZWB 3PFYA 4ZLOA 3TZ7A 4RIYA 2WMSA 4OGRA 5EHOA 3ZDUA 2WTVA 3QTSA 3ZUTA 4AXCA 4HVIA 4O38A 1FOTA 3BYOA 3ZOSA 5IG1A 5CEKA 2OXXA 3QYZA 3RINA 3JPVA 2PY3A 3EQDA 1PXMA 3VC4A 5KMOA 5AP2A 4RJ6A 5EOBA 4ZEGA 2BVAA 1DAYA 4DFLA 3IOKA 2XZSA 4WKQA 2QOFA 3CEKA 5IKWA 2P2IA 5M09A 2FSOX 4IDTA 3F7WA 4IWQA 3A7GA 3PZHA 5M4CA 1ZXEA 3U6JA 1IAJA 4C33A 3OTUA 4KIPA 4J7BA 4QMSA 4Y85A 4DEDA 5C9CA 4ZY5A 4DF3A 1LP4A 4PTCA 5TE0A 1YVJA 2ITYA 5HLWA 1H07A 4BCPA 1H1SA 4GW8A 3JY9A 4GYIA 3KXHA 4KBKA 2YAKA 4AAYA 4D5HA 3TM0A 4FMQA 4L00A 5HORA 4TPTA 5BMSA 4BJJA 3MW1A 4GU6A 3KXXA 4MF1A 4Q5EA 3F5UA 5H8BA 4LV7A 3PSBA 2W4KA 4GT4A 5BYLA 1CSNA 3F66A 4ZK5A 4W8DA 4C37A 2WOTA 4XS2A 2NNWB 3D5XA 4FE2A 4BZDA 4JQ8A 3W0OA 3JUHA 2IJMA 2YM4A 5FD2A 3OEFX 2ITXA 3QTQA 5ANGA 4J8MA 3AKKA 1JKSA 1OL2A 4L7FA 3QXPA 4WNPA 3TV6A 3PSDA 3BWFA 4GT5A 3Q2JA 2X9EA 3QRTA 2ZAZA 2VTTA 3RAIA 5I9VA 1ST0A 4RSSA 3DOGA 1K9AA 5ANKA 2XBAA 3DJ5A 5FXSA 3UIXA 3NUNA 3MY0A 4J1RA 4LRJA 4ZSEA 3RBWA 4F63A 5AJQA 5HCZA 2BDJA 4FRFA 3O7LB 3V01A 5CU3A 4YGAA 3VBWA 3W18A 4I24A 4IE9A 3FY0A 2CKEA 3EQCA 2R64A 5M53A 4BY9E 3ERKA 2OJGA 2PUUA 3BGZA 3D4QA 4EC9A 2CCHA 4FTAA 4S34A 1JSTA 5M56A 4I5MA 4OBQA 2QOLA 4MAOA 3DNEA 2R3OA 4G6OA 3AC8A 4DGGA 4O7SA 3NSZA 1GOLA 2ITPA 4USEA 5DWRA 4R7BA 1OITA 2CPKE 3NNWA 4OT5A 4ANNA 4XEYA 3E7OA 3OHTA 2OBJA 4NM7A 2GPHA 4ASEA 5M07A 4TZRA 2VO7A 1F5QA 4QYGA 4YJNA 4CNHA 2FH9A 2X0PA 3AT2A