1UXDA

Fructose repressor dna-binding domain, nmr, 34 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
59
structure length
59
Chain Sequence
MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREHNYHPNAVAAGLRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the DNA-binding domain of the fructose repressor from Escherichia coli by 1H and 15N NMR.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulation
molecule keywords FRUCTOSE REPRESSOR
total genus 14
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1996-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1uxdA00
3CECA 2L8NA 2LYSA 4YG7B 1RZRD 4NDWA 2GRMA 2BNOA 3KXAA 2KEIA 4X4HA 1JWLA 2JVLA 1EFAA 2AUWA 2O49A 2LYQA 1ZZ9A 2EBYA 1QQAA 1ZVVA 1R63A 2AWIA 3G5GA 4X4FA 3JXBC 2BNNA 4X4BA 2KEJA 4Z58A 3S8QA 1JFSA 2PUBA 4IA8A 3JXCL 1ZZCA 2AXUA 2MEZA 1ZZBA 1LCDA 3UFDA 2IV1A 1DWKA 3HZIB 3L1PA 4PU7A 1UTXA 2B5AA 1BDIA 2CSFA 2PUEA 3CLCA 1S7EA 2PUGA 1PRUA 1B0NA 3BS3A 3OMTA 3OP9A 4MCTA 4F8DA 3ZKCA 1QPZA 3OQNA 2HINA 3B7HA 4PU4C 4I6RA 2EF8A 1WETA 2R1JL 4PU3C 3RZZA 2FJRA 4Z5CA 4GHJA 2BJCA 2XJ3A 3CROL 3OQMA 3FYAA 4FN3A 4Z5HA 1WH8A 1ZZ8A 2PUCA 2LCVA 3VK0A 1DW9A 1YSEA 2IVQA 4Y42A 2PIJA 1ZAYA 4YARA 1QP7A 1NEQA 1ZPQA 2AXVA 2XCJA 1LQCA 3R1FA 3KZ3A 2PE5A 4OB4A 1ADRA 2AXZA 2PUDA 3F52A 4O8BA 3LFPA 3GBFA 3MLFA 3QWGA 2PUFA 1QP4A 2D5VA 3BD1A 3PXPA 3QF3A 2O4AA 1ZZ6A 2EWTA 1WIZA 3LISA 2XIUA 1GT0C 1JFTA 2LYRA 3G7DA 4Z5DA 1O4XA 2PPXA 1X57A 1L1MA 1QQBA 4IWRA 1Y9QA 2A6CA 3FYMA 1ZUGA 2LYPA 4YG4A 1OSLA 1RPEL 4JQDA 2MQKA 1BDHA 3QQ6A 1UXDA 4X4IA 1X2LA 4JCXA 4X4DA 4I8TA 4I6TA 2ICTA 4X4CA 3SCGA 2CROA 2IUOA 4I6UA 4YG1A 1ZS4A 3D1NI 3GN5B 1VPWA 3DNVB 2R63A 3QYXA 2HSGA 2KPJA 2LYLA 3TRBA 1LCCA 2IVBA 4J1XA 1PRVA 1PRAA 2IVGA 1LMB3 1XWRA 2IU7A 2WIUB 3GN5A 2WUSR 5A7LA 3O9XA 2H8RA 1RZSA 3SCFA 4FBIA 5K98B 3H5TA 2LYJA 3U3WA 3JXDL 1AU7A 3ZHMA 1CQTA 1PERL 1HF0A 4X4GA 4PU8A 2GRLA 4MCXA 2PUAA 4YBAA 3ZHIA 2OFYA 2KZ8A 1UXCA 2LYKA 2ICPA 3SCHA 3F51A 3F6WA 4JCYA 2GZUA 1OCTC 1E3OC 1Y7YA 2O38A 1ZZ7A 2XSDC 3IVPA 2XI8A 1LLIA 3BDNA 1QP0A 2AW6A 4J1WA 1RIOA 2KEKA 1NERA 4GQMA 3OQOA 4X4EA 1JH9A 3KJXA 1SQ8A 2JCGA 1WH6A 1IC8A 2OR1L 3EUSA 3FMYA 1PNRA 4Z59A 2L49A 1R69A 1POUA 4IVZA 1RZRA 1CJGA 2BNMA
chains in the Genus database with same CATH superfamily
4NDWA 3KXAA 1EFAA 3TELA 1QQAA 1ZVVA 2BNNA 2HFZA 4X4BA 4Z58A 2PXTA 4IA8A 1LCDA 3A9YA 4F8DA 2HINA 1WETA 3SR4A 3LQXA 2XJ3A 3CROL 4Z5HA 1WH8A 1ZZ8A 3NXHA 3VK0A 2PXLA 3A9ZA 1NEQA 2AXVA 1ADRA 1LQCA 4OB4A 2PUDA 2YBDA 4O8BA 3LFPA 1QB2A 4DE8A 3BD1A 3QF3A 2XXQA 2O4AA 1ZZ6A 2EWTA 4ER7A 2PPXA 3MEJA 2A6CA 3R09A 1OSLA 2LYPA 1RPEL 3QQ6A 1UXDA 4X4IA 2ICTA 3VWSA 2CROA 2IUOA 2LLWA 2R63A 4WVLA 4J1XA 1PRAA 2PXUA 2IU7A 2WUSR 2MXDA 4FBIA 3H5TA 1AU7A 1CQTA 1PERL 4X4GA 4PU8A 2LYKA 3OWQA 3F51A 4JCYA 1E3OC 1QP0A 2XSDC 2AW6A 3UWPA 4J1WA 3OQOA 4X4EA 5DRYA 3GZDA 4Z59A 1CJGA 4YG7B 2GRMA 2KEIA 2O49A 2AUWA 2AWIA 4X4FA 3NROA 2KEJA 3S8QA 2MEZA 3UFDA 3HZIB 1UTXA 2B5AA 2PUEA 2CSFA 1PRUA 3BS3A 4MCTA 4OBMA 4PU4C 4I6RA 2EF8A 1NW3A 4PU3C 3QOWA 4GHJA 3OQMA 3FYAA 5DTQA 2PXFA 2LCVA 1DW9A 1YSEA 4Y42A 1ZAYA 2PIJA 4EQZA 4ER6A 3QOXA 2JQEA 3GBFA 3QWGA 2PUFA 1QP4A 3G7DA 1X57A 2L1PA 1Y9QA 4JQDA 3NZLA 2M4HA 1BDHA 1X2LA 4JCXA 4X4DA 4Q2JA 3SCGA 4I6UA 4YG1A 1ZS4A 3GN5B 2HSGA 2XXPA 3TRBA 2PXBA 1LMB3 3GZCA 3GUUA 3U3WA 2PXDA 2PUAA 3ZHIA 2J7WA 2KZ8A 2GZUA 1MFQC 2O38A 3IVPA 1JH9A 3KJXA 1R69A 4EZIA 4IVZA 1RZRA 3G0TA 2L8NA 2LYSA 1RZRD 3PE5A 1U2ZA 1JWLA 4X4HA 2JVLA 1ZZ9A 4ER5A 1R63A 2PXQA 3A9XA 3JXCL 1ZZCA 1ZZBA 2IV1A 4PU7A 1BDIA 1S7EA 2PUGA 3OP9A 2PXKA 3OQNA 3B7HA 2LLVA 4Z5CA 2BJCA 5DRTA 4FN3A 2PUCA 5DT2A 3KL4A 2IVQA 4YARA 3R1FA 3KZ3A 2PE5A 3MLFA 1HQ1A 3ZPXA 1WIZA 2XIUA 1JFTA 1QZXA 1L1MA 1QQBA 4EKIA 2MQKA 2PXPA 4I8TA 4X4CA 3TFLA 1VPWA 2PXEA 3QYXA 2LYLA 2IVBA 2IVGA 1XWRA 5A7LA 3O9XA 2H8RA 3SCFA 5K98B 3JXDL 4ER0A 2HCSA 2OFYA 3SCHA 3SX0A 1OCTC 4EKGA 3M9LA 4EK9A 1LLIA 1ZZ7A 3BDNA 2KEKA 1NERA 4GQMA 2JCGA 1IC8A 2OR1L 2LNMA 3EUSA 3FMYA 1PNRA 2HCNA 1POUA 2BNMA 3CECA 2BNOA 2LYQA 2EBYA 3NDBB 3G5GA 3JXBC 4DE9A 1JFSA 2PUBA 2AXUA 1DWKA 3L1PA 3ME5A 3CLCA 1B0NA 3OMTA 1QPZA 3ZKCA 2PXVA 5DSXA 4HRAA 2R1JL 3RZZA 2FJRA 2VEOA 3GZDC 3QFIA 2ODRD 2V3CC 1QP7A 1ZPQA 2XCJA 2FFHA 2AXZA 3F52A 2D5VA 3PXPA 4ER3A 3LISA 1GT0C 2LYRA 4Z5DA 1O4XA 4IWRA 3FYMA 2J7UA 1ZUGA 4YG4A 5GAGi 4I6TA 3OKZA 3D1NI 3DNVB 2KPJA 1LCCA 1PRVA 3DM5A 5JUWA 2WIUB 3GN5A 1RZSA 2LYJA 2XXAA 1DULA 3ZHMA 1HF0A 2GRLA 4MCXA 4YBAA 1UXCA 2ICPA 3F6WA 1Y7YA 2XI8A 3TEPA 1RIOA 1SQ8A 5DTRA 1WH6A 5GAHi 5DTMA 2L49A
chains in the Genus database with same CATH topology
3CECA 2L8NA 2LYSA 4YG7B 1RZRD 4NDWA 2GRMA 2BNOA 3KXAA 2KEIA 4X4HA 1JWLA 2JVLA 1EFAA 2AUWA 2O49A 2LYQA 1ZZ9A 2EBYA 1QQAA 1ZVVA 1R63A 2AWIA 3G5GA 4X4FA 3JXBC 2BNNA 4X4BA 2KEJA 4Z58A 3S8QA 1JFSA 2PUBA 4IA8A 3JXCL 1ZZCA 2AXUA 2MEZA 1ZZBA 1LCDA 3UFDA 2IV1A 1DWKA 3HZIB 3L1PA 4PU7A 1UTXA 2B5AA 1BDIA 2CSFA 2PUEA 3CLCA 1S7EA 2PUGA 1PRUA 1B0NA 3BS3A 3OMTA 3OP9A 4MCTA 4F8DA 3ZKCA 1QPZA 3OQNA 2HINA 3B7HA 4PU4C 4I6RA 2EF8A 1WETA 2R1JL 4PU3C 3RZZA 2FJRA 4Z5CA 4GHJA 2BJCA 2XJ3A 3CROL 3OQMA 3FYAA 4FN3A 4Z5HA 1WH8A 1ZZ8A 2PUCA 2LCVA 3VK0A 1DW9A 1YSEA 2IVQA 4Y42A 2PIJA 1ZAYA 4YARA 1QP7A 1NEQA 1ZPQA 2AXVA 2XCJA 1LQCA 3R1FA 3KZ3A 2PE5A 4OB4A 1ADRA 2AXZA 2PUDA 3F52A 4O8BA 3LFPA 3GBFA 3MLFA 3QWGA 2PUFA 1QP4A 2D5VA 3BD1A 3PXPA 3QF3A 2O4AA 1ZZ6A 2EWTA 1WIZA 3LISA 2XIUA 1GT0C 1JFTA 2LYRA 3G7DA 4Z5DA 1O4XA 2PPXA 1X57A 1L1MA 1QQBA 4IWRA 1Y9QA 2A6CA 3FYMA 1ZUGA 2LYPA 4YG4A 1OSLA 1RPEL 4JQDA 2MQKA 1BDHA 3QQ6A 1UXDA 4X4IA 1X2LA 4JCXA 4X4DA 4I8TA 4I6TA 2ICTA 4X4CA 3SCGA 2CROA 2IUOA 4I6UA 4YG1A 1ZS4A 3D1NI 3GN5B 1VPWA 3DNVB 2R63A 3QYXA 2HSGA 2KPJA 2LYLA 3TRBA 1LCCA 2IVBA 4J1XA 1PRVA 1PRAA 2IVGA 1LMB3 1XWRA 2IU7A 2WIUB 3GN5A 2WUSR 5A7LA 3O9XA 2H8RA 1RZSA 3SCFA 4FBIA 5K98B 3H5TA 2LYJA 3U3WA 3JXDL 1AU7A 3ZHMA 1CQTA 1PERL 1HF0A 4X4GA 4PU8A 2GRLA 4MCXA 2PUAA 4YBAA 3ZHIA 2OFYA 2KZ8A 1UXCA 2LYKA 2ICPA 3SCHA 3F51A 3F6WA 4JCYA 2GZUA 1OCTC 1E3OC 1Y7YA 2O38A 1ZZ7A 2XSDC 3IVPA 2XI8A 1LLIA 3BDNA 1QP0A 2AW6A 4J1WA 1RIOA 2KEKA 1NERA 4GQMA 3OQOA 4X4EA 1JH9A 3KJXA 1SQ8A 2JCGA 1WH6A 1IC8A 2OR1L 3EUSA 3FMYA 1PNRA 4Z59A 2L49A 1R69A 1POUA 4IVZA 1RZRA 1CJGA 2BNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CEC A;  2L8N A;  2LYS A;  4YG7 B;  1RZR D;  4NDW A;  2GRM A;  2BNO A;  3KXA A;  2KEI A;  4X4H A;  1JWL A;  2JVL A;  1EFA A;  2AUW A;  2O49 A;  2LYQ A;  1ZZ9 A;  2EBY A;  1QQA A;  1ZVV A;  1R63 A;  2AWI A;  3G5G A;  4X4F A;  3JXB C;  2BNN A;  4X4B A;  2KEJ A;  4Z58 A;  3S8Q A;  1JFS A;  2PUB A;  4IA8 A;  3JXC L;  1ZZC A;  2AXU A;  2MEZ A;  1ZZB A;  1LCD A;  3UFD A;  2IV1 A;  1DWK A;  3HZI B;  3L1P A;  4PU7 A;  1UTX A;  2B5A A;  1BDI A;  2CSF A;  2PUE A;  3CLC A;  1S7E A;  2PUG A;  1PRU A;  1B0N A;  3BS3 A;  3OMT A;  3OP9 A;  4MCT A;  4F8D A;  3ZKC A;  1QPZ A;  3OQN A;  2HIN A;  3B7H A;  4PU4 C;  4I6R A;  2EF8 A;  1WET A;  2R1J L;  4PU3 C;  3RZZ A;  2FJR A;  4Z5C A;  4GHJ A;  2BJC A;  2XJ3 A;  3CRO L;  3OQM A;  3FYA A;  4FN3 A;  4Z5H A;  1WH8 A;  1ZZ8 A;  2PUC A;  2LCV A;  3VK0 A;  1DW9 A;  1YSE A;  2IVQ A;  4Y42 A;  2PIJ A;  1ZAY A;  4YAR A;  1QP7 A;  1NEQ A;  1ZPQ A;  2AXV A;  2XCJ A;  1LQC A;  3R1F A;  3KZ3 A;  2PE5 A;  4OB4 A;  1ADR A;  2AXZ A;  2PUD A;  3F52 A;  4O8B A;  3LFP A;  3GBF A;  3MLF A;  3QWG A;  2PUF A;  1QP4 A;  2D5V A;  3BD1 A;  3PXP A;  3QF3 A;  2O4A A;  1ZZ6 A;  2EWT A;  1WIZ A;  3LIS A;  2XIU A;  1GT0 C;  1JFT A;  2LYR A;  3G7D A;  4Z5D A;  1O4X A;  2PPX A;  1X57 A;  1L1M A;  1QQB A;  4IWR A;  1Y9Q A;  2A6C A;  3FYM A;  1ZUG A;  2LYP A;  4YG4 A;  1OSL A;  1RPE L;  4JQD A;  2MQK A;  1BDH A;  3QQ6 A;  1UXD A;  4X4I A;  1X2L A;  4JCX A;  4X4D A;  4I8T A;  4I6T A;  2ICT A;  4X4C A;  3SCG A;  2CRO A;  2IUO A;  4I6U A;  4YG1 A;  1ZS4 A;  3D1N I;  3GN5 B;  1VPW A;  3DNV B;  2R63 A;  3QYX A;  2HSG A;  2KPJ A;  2LYL A;  3TRB A;  1LCC A;  2IVB A;  4J1X A;  1PRV A;  1PRA A;  2IVG A;  1LMB 3;  1XWR A;  2IU7 A;  2WIU B;  3GN5 A;  2WUS R;  5A7L A;  3O9X A;  2H8R A;  1RZS A;  3SCF A;  4FBI A;  5K98 B;  3H5T A;  2LYJ A;  3U3W A;  3JXD L;  1AU7 A;  3ZHM A;  1CQT A;  1PER L;  1HF0 A;  4X4G A;  4PU8 A;  2GRL A;  4MCX A;  2PUA A;  4YBA A;  3ZHI A;  2OFY A;  2KZ8 A;  1UXC A;  2LYK A;  2ICP A;  3SCH A;  3F51 A;  3F6W A;  4JCY A;  2GZU A;  1OCT C;  1E3O C;  1Y7Y A;  2O38 A;  1ZZ7 A;  2XSD C;  3IVP A;  2XI8 A;  1LLI A;  3BDN A;  1QP0 A;  2AW6 A;  4J1W A;  1RIO A;  2KEK A;  1NER A;  4GQM A;  3OQO A;  4X4E A;  1JH9 A;  3KJX A;  1SQ8 A;  2JCG A;  1WH6 A;  1IC8 A;  2OR1 L;  3EUS A;  3FMY A;  1PNR A;  4Z59 A;  2L49 A;  1R69 A;  1POU A;  4IVZ A;  1RZR A;  1CJG A;  2BNM A; 
#chains in the Genus database with same CATH topology
 4NDW A;  3KXA A;  1EFA A;  3TEL A;  1QQA A;  1ZVV A;  2BNN A;  2HFZ A;  4X4B A;  4Z58 A;  2PXT A;  4IA8 A;  1LCD A;  3A9Y A;  4F8D A;  2HIN A;  1WET A;  3SR4 A;  3LQX A;  2XJ3 A;  3CRO L;  4Z5H A;  1WH8 A;  1ZZ8 A;  3NXH A;  3VK0 A;  2PXL A;  3A9Z A;  1NEQ A;  2AXV A;  1ADR A;  1LQC A;  4OB4 A;  2PUD A;  2YBD A;  4O8B A;  3LFP A;  1QB2 A;  4DE8 A;  3BD1 A;  3QF3 A;  2XXQ A;  2O4A A;  1ZZ6 A;  2EWT A;  4ER7 A;  2PPX A;  3MEJ A;  2A6C A;  3R09 A;  1OSL A;  2LYP A;  1RPE L;  3QQ6 A;  1UXD A;  4X4I A;  2ICT A;  3VWS A;  2CRO A;  2IUO A;  2LLW A;  2R63 A;  4WVL A;  4J1X A;  1PRA A;  2PXU A;  2IU7 A;  2WUS R;  2MXD A;  4FBI A;  3H5T A;  1AU7 A;  1CQT A;  1PER L;  4X4G A;  4PU8 A;  2LYK A;  3OWQ A;  3F51 A;  4JCY A;  1E3O C;  1QP0 A;  2XSD C;  2AW6 A;  3UWP A;  4J1W A;  3OQO A;  4X4E A;  5DRY A;  3GZD A;  4Z59 A;  1CJG A;  4YG7 B;  2GRM A;  2KEI A;  2O49 A;  2AUW A;  2AWI A;  4X4F A;  3NRO A;  2KEJ A;  3S8Q A;  2MEZ A;  3UFD A;  3HZI B;  1UTX A;  2B5A A;  2PUE A;  2CSF A;  1PRU A;  3BS3 A;  4MCT A;  4OBM A;  4PU4 C;  4I6R A;  2EF8 A;  1NW3 A;  4PU3 C;  3QOW A;  4GHJ A;  3OQM A;  3FYA A;  5DTQ A;  2PXF A;  2LCV A;  1DW9 A;  1YSE A;  4Y42 A;  1ZAY A;  2PIJ A;  4EQZ A;  4ER6 A;  3QOX A;  2JQE A;  3GBF A;  3QWG A;  2PUF A;  1QP4 A;  3G7D A;  1X57 A;  2L1P A;  1Y9Q A;  4JQD A;  3NZL A;  2M4H A;  1BDH A;  1X2L A;  4JCX A;  4X4D A;  4Q2J A;  3SCG A;  4I6U A;  4YG1 A;  1ZS4 A;  3GN5 B;  2HSG A;  2XXP A;  3TRB A;  2PXB A;  1LMB 3;  3GZC A;  3GUU A;  3U3W A;  2PXD A;  2PUA A;  3ZHI A;  2J7W A;  2KZ8 A;  2GZU A;  1MFQ C;  2O38 A;  3IVP A;  1JH9 A;  3KJX A;  1R69 A;  4EZI A;  4IVZ A;  1RZR A;  3G0T A;  2L8N A;  2LYS A;  1RZR D;  3PE5 A;  1U2Z A;  1JWL A;  4X4H A;  2JVL A;  1ZZ9 A;  4ER5 A;  1R63 A;  2PXQ A;  3A9X A;  3JXC L;  1ZZC A;  1ZZB A;  2IV1 A;  4PU7 A;  1BDI A;  1S7E A;  2PUG A;  3OP9 A;  2PXK A;  3OQN A;  3B7H A;  2LLV A;  4Z5C A;  2BJC A;  5DRT A;  4FN3 A;  2PUC A;  5DT2 A;  3KL4 A;  2IVQ A;  4YAR A;  3R1F A;  3KZ3 A;  2PE5 A;  3MLF A;  1HQ1 A;  3ZPX A;  1WIZ A;  2XIU A;  1JFT A;  1QZX A;  1L1M A;  1QQB A;  4EKI A;  2MQK A;  2PXP A;  4I8T A;  4X4C A;  3TFL A;  1VPW A;  2PXE A;  3QYX A;  2LYL A;  2IVB A;  2IVG A;  1XWR A;  5A7L A;  3O9X A;  2H8R A;  3SCF A;  5K98 B;  3JXD L;  4ER0 A;  2HCS A;  2OFY A;  3SCH A;  3SX0 A;  1OCT C;  4EKG A;  3M9L A;  4EK9 A;  1LLI A;  1ZZ7 A;  3BDN A;  2KEK A;  1NER A;  4GQM A;  2JCG A;  1IC8 A;  2OR1 L;  2LNM A;  3EUS A;  3FMY A;  1PNR A;  2HCN A;  1POU A;  2BNM A;  3CEC A;  2BNO A;  2LYQ A;  2EBY A;  3NDB B;  3G5G A;  3JXB C;  4DE9 A;  1JFS A;  2PUB A;  2AXU A;  1DWK A;  3L1P A;  3ME5 A;  3CLC A;  1B0N A;  3OMT A;  1QPZ A;  3ZKC A;  2PXV A;  5DSX A;  4HRA A;  2R1J L;  3RZZ A;  2FJR A;  2VEO A;  3GZD C;  3QFI A;  2ODR D;  2V3C C;  1QP7 A;  1ZPQ A;  2XCJ A;  2FFH A;  2AXZ A;  3F52 A;  2D5V A;  3PXP A;  4ER3 A;  3LIS A;  1GT0 C;  2LYR A;  4Z5D A;  1O4X A;  4IWR A;  3FYM A;  2J7U A;  1ZUG A;  4YG4 A;  5GAG i;  4I6T A;  3OKZ A;  3D1N I;  3DNV B;  2KPJ A;  1LCC A;  1PRV A;  3DM5 A;  5JUW A;  2WIU B;  3GN5 A;  1RZS A;  2LYJ A;  2XXA A;  1DUL A;  3ZHM A;  1HF0 A;  2GRL A;  4MCX A;  4YBA A;  1UXC A;  2ICP A;  3F6W A;  1Y7Y A;  2XI8 A;  3TEP A;  1RIO A;  1SQ8 A;  5DTR A;  1WH6 A;  5GAH i;  5DTM A;  2L49 A; 
#chains in the Genus database with same CATH homology
 3CEC A;  2L8N A;  2LYS A;  4YG7 B;  1RZR D;  4NDW A;  2GRM A;  2BNO A;  3KXA A;  2KEI A;  4X4H A;  1JWL A;  2JVL A;  1EFA A;  2AUW A;  2O49 A;  2LYQ A;  1ZZ9 A;  2EBY A;  1QQA A;  1ZVV A;  1R63 A;  2AWI A;  3G5G A;  4X4F A;  3JXB C;  2BNN A;  4X4B A;  2KEJ A;  4Z58 A;  3S8Q A;  1JFS A;  2PUB A;  4IA8 A;  3JXC L;  1ZZC A;  2AXU A;  2MEZ A;  1ZZB A;  1LCD A;  3UFD A;  2IV1 A;  1DWK A;  3HZI B;  3L1P A;  4PU7 A;  1UTX A;  2B5A A;  1BDI A;  2CSF A;  2PUE A;  3CLC A;  1S7E A;  2PUG A;  1PRU A;  1B0N A;  3BS3 A;  3OMT A;  3OP9 A;  4MCT A;  4F8D A;  3ZKC A;  1QPZ A;  3OQN A;  2HIN A;  3B7H A;  4PU4 C;  4I6R A;  2EF8 A;  1WET A;  2R1J L;  4PU3 C;  3RZZ A;  2FJR A;  4Z5C A;  4GHJ A;  2BJC A;  2XJ3 A;  3CRO L;  3OQM A;  3FYA A;  4FN3 A;  4Z5H A;  1WH8 A;  1ZZ8 A;  2PUC A;  2LCV A;  3VK0 A;  1DW9 A;  1YSE A;  2IVQ A;  4Y42 A;  2PIJ A;  1ZAY A;  4YAR A;  1QP7 A;  1NEQ A;  1ZPQ A;  2AXV A;  2XCJ A;  1LQC A;  3R1F A;  3KZ3 A;  2PE5 A;  4OB4 A;  1ADR A;  2AXZ A;  2PUD A;  3F52 A;  4O8B A;  3LFP A;  3GBF A;  3MLF A;  3QWG A;  2PUF A;  1QP4 A;  2D5V A;  3BD1 A;  3PXP A;  3QF3 A;  2O4A A;  1ZZ6 A;  2EWT A;  1WIZ A;  3LIS A;  2XIU A;  1GT0 C;  1JFT A;  2LYR A;  3G7D A;  4Z5D A;  1O4X A;  2PPX A;  1X57 A;  1L1M A;  1QQB A;  4IWR A;  1Y9Q A;  2A6C A;  3FYM A;  1ZUG A;  2LYP A;  4YG4 A;  1OSL A;  1RPE L;  4JQD A;  2MQK A;  1BDH A;  3QQ6 A;  1UXD A;  4X4I A;  1X2L A;  4JCX A;  4X4D A;  4I8T A;  4I6T A;  2ICT A;  4X4C A;  3SCG A;  2CRO A;  2IUO A;  4I6U A;  4YG1 A;  1ZS4 A;  3D1N I;  3GN5 B;  1VPW A;  3DNV B;  2R63 A;  3QYX A;  2HSG A;  2KPJ A;  2LYL A;  3TRB A;  1LCC A;  2IVB A;  4J1X A;  1PRV A;  1PRA A;  2IVG A;  1LMB 3;  1XWR A;  2IU7 A;  2WIU B;  3GN5 A;  2WUS R;  5A7L A;  3O9X A;  2H8R A;  1RZS A;  3SCF A;  4FBI A;  5K98 B;  3H5T A;  2LYJ A;  3U3W A;  3JXD L;  1AU7 A;  3ZHM A;  1CQT A;  1PER L;  1HF0 A;  4X4G A;  4PU8 A;  2GRL A;  4MCX A;  2PUA A;  4YBA A;  3ZHI A;  2OFY A;  2KZ8 A;  1UXC A;  2LYK A;  2ICP A;  3SCH A;  3F51 A;  3F6W A;  4JCY A;  2GZU A;  1OCT C;  1E3O C;  1Y7Y A;  2O38 A;  1ZZ7 A;  2XSD C;  3IVP A;  2XI8 A;  1LLI A;  3BDN A;  1QP0 A;  2AW6 A;  4J1W A;  1RIO A;  2KEK A;  1NER A;  4GQM A;  3OQO A;  4X4E A;  1JH9 A;  3KJX A;  1SQ8 A;  2JCG A;  1WH6 A;  1IC8 A;  2OR1 L;  3EUS A;  3FMY A;  1PNR A;  4Z59 A;  2L49 A;  1R69 A;  1POU A;  4IVZ A;  1RZR A;  1CJG A;  2BNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...