1UXSA

Crystal structure of hla-b*2705 complexed with the latent membrane protein 2 peptide (lmp2)of epstein-barr virus
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allele-Dependent Similarity between Viral and Self-Peptide Presentation by Hla-B27 Subtypes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/peptide
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN B-27 ALPHA CHAIN
total genus 77
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2004-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uxsA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1uxsA01
3RHWF 4CMHC 2WQ8A 3C6SA 5ITFB 1AFVH 2AK1H 3GI8H 4XP5H 1H15B 3C60B 4PJFB 4N0FA 1EUTA 2OR9H 3B6SA 4LCYA 4XMLL 4YUEL 4M1DL 4H1LH 1MCPL 5E24E 1KJ2A 1AO7A 1T7YA 1QP1A 2HMIC 2HN7B 3X13B 4N8VG 3O9WC 3DV6B 3QULB 5TE6L 4DUVA 5FDWB 4WHYG 4Y5XA 3U7WL 3MBEC 2EDEA 4JHWH 5D71H 2ZCKH 3RHWK 2YD5A 2XWJA 5KJRH 1MI5E 5IOPB 4NC0B 4U3XA 5JIKA 5I9QC 2IQ9L 3BGFB 5CBEA 5MERA 5EZIL 3EFDL 1UFUA 1UXWA 2EIZB 1UYWL 2VZSA 1DN0B 2LABA 5D5MB 4GJTB 1IBGH 1D5XA 1OF2B 2F54D 4LHUG 2Z8WC 1NFDE 4KJYB 4YNYA 4OAWB 1SYSA 4PRAA 1QEWA 4PJIF 2EYSA 2P8LA 3ZYIA 4FNLL 4LCWE 3QZWB 4L4TD 1QUNA 5JIHA 1G6RB 5ELIA 5F6HJ 1MHCB 3P9MB 2IAMC 5EOCH 3SE9H 4KK8D 1LO3H 1BQHA 2NR6C 2ZCKL 3DRQA 2A6DA 1U8MB 5SWSD 3MRNB 1SMOA 3LH2L 5DUBA 5TE6H 2VZUA 3Q6FB 3QHZH 4K94C 1JWSB 5BS0E 2V9TA 4HUKB 5I66B 1T21B 3ARFB 4F9PA 4UOW0 1VHPA 3GSNL 3G04A 4Q6YA 4P23C 5D7SH 1WF5A 1J1PH 2VLKB 3KPTA 4HUWA 5EWIH 4NUGL 3U4EB 1KYOJ 3QCUH 4XGZB 4JM4L 1PDKA 4X5LA 2FX7H 3MNWA 2AJXL 5I1CL 4XBEH 4JFZH 3CCHA 5DUMH 4ODXA 3MBEA 2AJUL 3VXSE 4EBQH 5EOTA 1N0XL 3LPWA 3D2UB 3RZCB 3QPXL 3BKCH 1T0NA 3HE6C 4EI5B 4ALAL 2QHRH 1KIQA 4PGDA 3ES6A 2GITA 5FA3B 5LXGL 3BPCB 5D8JL 2JTDA 2YRLA 4XCFH 1S7TA 4NYLA 5KS9A 1JVKA 3DX8B 1R0AL 5C0IA 5E2VL 5FKPA 1I7RB 4TVPE 3L9RA 2EIBA 3QUMA 1CK0L 4UU9A 2FH8A 1DQTA 4Z76B 5B8CA 1L0XA 3BQUC 2VJXA 4LKCA 4RFEB 3QDJA 3LMJL 5E95B 4ZS7H 3TBSA 1N4XL 3L5JA 1H15A 4TUOA 4UT9H 1KELH 1R5VB 5DSCB 2NTSP 4KHXL 4OCWH 3THMH 1EHXA 2GJZB 1VSCA 4R3SA 4Q9CA 4OZGB 2YD4A 2BX5A 3SKNB 4NNPH 2DKUA 3P30L 1MOEA 1Q9LB 2W65A 1PKQE 4JY4A 4QXTB 3ZKMC 3ARZA 3UTZA 1OGAD 4M6OH 4X83A 2VDPH 1F13A 3GKWL 4NZUH 4O5LL 1ZHNB 1MIMH 5KBNC 2GHWB 4JM2A 3WKML 4M5ZL 4X7TB 2J6EL 2A9MH 4YDIH 5CBEB 5J13C 2YWZA 5C0CB 4QYOA 4TPRH 3T2OA 1DL7H 1FZKB 3DHJA 3RPIB 4Y4KA 3HZKB 3EOAA 2DLHA 5FKAA 1M6OA 2BMKA 3MOQA 2DBLH 3PNWB 4TOYH 4Y88A 3ZKSD 3OB0K 4JRYE 4HUUA 1CR9H 1FIGH 2BOBB 1U95A 5D72H 4QHKJ 2Z31B 5AYUL 4NQDB 4GXVH 3AMLA 3HA0A 3MLYL 15C8L 2P8PB 4JZOA 3O6ML 4NO0B 3DGGA 2BDNH 5J6GA 5EU6D 5I1GL 4U2ZA 1NMAL 3PGDB 5BXFB 3K7UA 3MRPB 4UINH 1ZHKB 3CH1B 5ITBL 3WUZA 4G6JL 2Z8SA 5JW4M 1PLGL 3V5DA 1L0YA 3JUYA 2GTWA 5CJ8A 3O45A 4PRHA 1F3JB 4XPGH 1RPQA 3F7VA 3FRPA 1A02N 4G80B 1U8HB 3LKOB 2NZ9D 3D1MC 1B3JA 2A38A 4NDMA 5FYJH 1C08A 5BVPL 3KS0H 1E6JL 1CFNB 3FB7A 5AD0A 4KK9D 1M7IA 1GYAA 4XTRD 4MVBD 3UPCA 4L9LA 3ARBA 4RISH 3INUL 4WDIB 3ARDB 1RUQL 2GK2A 1FNAA 4XNXH 3EHBC 2VLJB 4P59H 2R9HD 3I50L 1CDBA 1MFBL 4NRZB 2VH5H 3RP1A 2NY0D 4ZQKA 1XZ0B 1ZE3C 2ESVE 4RGNC 3REWA 5I2IA 1HINL 3D3VE 2EE6A 1IEAB 3NCBB 3QDJD 3GSRB 1P9MC 3BN9C 2YEZB 4MNQD 4R4FL 4HHAA 4WW1A 4NKMB 2F54A 3LN5A 3ZE2F 1IQDB 1IAOB 5SV4A 2A6JB 2IPUK 4LLWB 1UCBL 1CF8H 2FO4A 4PBXA 1KLFA 3FQUB 3HR5B 3E2HC 5C2BL 2OJEB 1EMTL 5LQBL 1SY6H 4RWYH 5EU7C 1NLDH 1IM3A 3AREC 2X44D 4DGVH 4MXWH 5HI5D 1SJHB 1OW0A 1ZLSL 4JQXA 4X98A 4WI7A 4MNHB 2VLMD 1T7WA 4JPIB 4ZOCA 4PJAF 4P2QA 1I3UA 4X4XA 4YE4H 4BH8A 3AM8C 5EZLA 3QT2A 4WTZA 3MLTA 3NIFF 4PREA 4X99B 4FA8A 5IB5B 4G9FD 3FO9B 1UB5B 3ILPA 1UEMA 1NCWH 1UC6A 3TIEA 1TZIA 3A6BL 4GBXA 4U1NB 3V0WH 4EOWL 2VXTL 1RIHH 2ICWA 1JGEA 4LLVA 5FA4B 1KN2L 4U0QB 1EEZB 1G84A 3C5JA 2JB6B 2LU4A 3FAXA 3DSFL 2VISB 4KTEH 4YIQB 5JPMA 2ZJSL 4I4WB 4JZJA 1E4XI 4GOSA 1EXUA 2ESVA 1CU4H 1UM6H 5I1HH 2Y7QA 2WP3O 1F90L 1CD1B 1MHHB 1SEQL 1ZS8A 4LLDB 3OKLB 3T3ME 3S9DB 3MRKA 2AK4D 2P42B 2BVYA 1N3NA 3CDCA 4XPAL 2GSIA 4ZFGH 3MRPA 4JR9L 2CIKA 1BBJB 3Q1SL 5E9DB 3LY6A 5JLZB 1GH7A 5HGHB 4XC1L 1EGJL 3HS0A 5HHOB 4M1CD 2FGWL 1A22B 3C2AH 3AAZA 1HILA 1XR8B 4X4ZA 1F6LL 2Y23A 1EERB 4FTVD 1IKNA 4PRHE 4OLUH 2B7DT 3S34H 3U0WL 3K8MA 1I7ZA 5C0CD 3VWJC 3DMMD 4IDJH 4YX2H 3EKCA 3L95B 1CFNA 1YQVH 1TQCB 3FB7B 2XN9A 3VFNB 5L9DL 4EZMA 4OI7A 1QKZL 3LKRB 4HXAH 1XF2B 2BVTA 4HS3A 5I18L 4PB9H 3TA3A 3HAEA 4UBDD 5TQ2L 3IU4H 4YHIA 1RK1B 4PJ7B 2GCYA 1G7HB 4JANA 1XF1A 5I1EL 1WV7T 1KCKA 1LNUA 1A4KB 1F42A 3IDIB 4N5ED 5AWNL 1L8JA 4MA3B 3LHPH 1KNOB 1LK2B 3WFEL 4L3AA 1IEAA 4S1DC 5GHWL 4YWGL 2BY3A 4WI8A 4OZFH 2R29L 4U1GB 4Y5XC 4XPFL 3V4PH 3MLVH 4E41A 4ODHL 3L5IA 5HVWA 3AB0C 4X6CA 2VYRE 4W70A 3E1F1 3MRDB 1AJ7L 1K8IA 1PQZA 1PYWB 1CGSH 1S5HB 4XC1H 3IF1A 1IM3B 2MKLC 4L8BA 3TNNB 4J6RH 5A2FA 4GRLA 2BRQA 4MA1B 3VGAC 2IPKA 4BM7A 4XAWL 4N8CH 1B4RA 1I1YB 2H6PA 1ZVYA 1ZA6A 4POYA 1S9VA 2APXA 1HOCA 3UYOD 5LAXA 5JA9A 2XWJB 4Z7OF 5FYJD 1WFNA 3I6LE 3T0EC 2A6KA 4OD3H 3C5ZA 3JV4B 1QQDB 4CMHB 4O2CB 1HI6B 4Y5VC 3CDFA 1P9MA 2CDGB 3IXAB 4Q6IB 2V2XB 5DJCB 1OOAA 3O8XC 3JWDH 4MAYD 2DKSA 4ZTPL 1TPXC 1YEDB 2EDDA 1XEDA 4WU7B 5JXEA 3LB6C 5DUPL 1YMME 1CL7I 3RWJA 3O6FD 1NCBH 4HF5L 3QI9C 5EU3B 2ITDB 1F00I 2H3NB 4BQ8A 3BEWB 4FQIH 4EKXA 2JB5L 4MDJA 4YXKH 4B7IA 1HXYA 2R1XA 1A6ZA 4NO2A 3IU3B 4G9FB 3MUJA 1NGQL 1SM3L 2VO5A 5JPNB 5GZNC 3UZVB 1OAXL 2EH7H 3UJJL 2J7LA 1I1FA 5HSFA 1WIPA 4PBVC 4IS6B 3WIHL 2NX5B 4IMLA 4H0HB 1QZ1A 4JFXB 4P4KD 1KCUL 2DQFB 1IC4L 4CVWA 3UDWC 1QFUH 2YMXL 1OCWH 3HPLA 4KTDL 1MRCL 4BYHA 4LQFH 3PL6D 1T2QL 4PJFA 4OI9A 1G6RH 5MP6H 4MJ4A 4OZIE 5IESH 4LSVL 3V0VA 5FGBA 3CXHK 3QDAA 3RWDB 4ODXB 4JO1H 2VDLH 4JGJA 3P2TA 4U6XA 1JGDA 2VH5L 3IKCB 4IEFB 5FYKL 4J4PA 4J3UA 4HAFA 4WI6A 5BZWB 1U3ZA 1WZ1H 2OI9C 5KZCB 4H26A 1VDGA 2XPGA 3NZHL 1X5LA 3V6FA 4CDHA 3AU1B 5DK2B 4ETYA 5LCVL 2J8UE 3U6RA 2X05A 4HWEH 3U7AA 1NFIB 4LCWA 4UV4H 2HRPH 4QTIL 5EULV 2XA8H 2ICCA 1QLRA 4G9DA 4MDIA 3WNOA 3VXPA 1R3JA 2Z35B 1ZK9A 3QWRD 3K81A 1W0YT 4KRMB 5ANME 4QKXB 3GO1H 3MOBL 3RL1A 4YNYB 1FLRL 1ONQB 3QDHA 3LN9A 2O26U 5EC2B 3S88H 1F2XK 3PL6B 4OGYL 3ZSTA 5C0AD 5A2JH 1R5VA 1P7QA 5CLWA 3RVWD 1QFWH 1XCQB 4XNZC 3DO7B 4LVHC 2EXYD 3L3HA 4Y2OA 2R2HA 2XG5A 1ETZA 2OYPA 1MF2H 3ARGC 4XVJH 1OSPH 5IB1B 3BDBA 1OLLA 1A2YA 3FQNB 1FFPB 5D4QA 2HFGL 1AO7E 5I66A 1RHHA 2Y5EA 4LAJH 3O8XB 1OM3H 3LCYA 4ZODA 1I9EA 3VE0A 3BPLC 1QLFA 1A9EB 5DD1H 1V7MH 4Y4KB 4Y1AB 3IS1X 3PQYB 4UILH 4XH2A 1U2CA 1LMKA 4K3GA 1H3TA 5H35A 1UH2A 3ULSB 5E4IA 4KKAD 4GRWH 3OJDA 2WAHA 4FQ2L 4P2RA 2X2YA 3SQOH 3D48R 3WHXA 3QUXB 2QADB 4Z6AT 3TVMA 3DGGB 3ZL4L 3OR7B 2YD9A 2YPLD 3W2DL 3ULUL 1INQA 2Y06H 3GMMA 4X9BA 3OKDA 4BKLA 3QA3A 2WBWB 4LHUB 1CYGA 1XGPA 2FIKB 2APVA 1RZGB 1GAFL 1EPFA 1MUJB 4JO2L 4MD0B 3WE6B 1T7ZA 2CGRL 3BUTA 1I8LC 4ZYKA 4IRJA 2VN4A 3LKOA 1YY9C 1D5MB 1A0QL 5JW5B 5I1JH 4LRIC 4Y4FD 1LEKB 1SMAA 1QFWL 1G6VK 3EFFB 5A3IC 3FQTA 4XRCB 3UXFA 4W6WB 3DROB 3HKFA 1CDYA 5F93C 5BO1H 3SGEI 5GGVL 1JNHB 2D2OA 4PLOB 3T2NH 2M2DA 3VWJB 3DXAB 3X3FL 1FN4B 4HGKC 4F8TA 1S3KH 2Q7YB 5GXBB 3EYFA 2AJZA 1T1YB 3TYFB 1BWMA 5EPMA 4GAYA 5DMYA 3T0AA 1Q0XH 4HWEL 4QCIA 5SWSE 1KLGA 4OFYD 1WC7A 2VXUL 5CHNB 1JGVL 3O3DB 3GSRA 1JZ6A 3QO1B 3MACH 1K5NB 4M8VA 2HA1A 3C6LA 3TPUB 1IAII 4X6DB 5DA0B 3HG1A 3SDAC 4KXZI 2VZ3A 5TF1L 4GO6B 5FK9A 1B6UA 2VXUH 1PY4A 3TT3H 4L3EA 2DQHH 3H9SB 5D1QA 4Z0BL 3KYMB 2C3VB 4ZUWB 3UYPA 3UAJC 1I7UA 3HI1B 5FO7B 1OAYH 5H2BA 1C7SA 1U6AH 4OLXH 1EAJA 1MSPA 4MJ6B 1FYHB 1XGUB 3V5HA 1EV2E 2R1YB 4U7MA 4Q9QL 3VXNB 2K7PA 1MNUL 4QF1B 4Y2DB 2VIRB 1C16B 1VFBB 4MB4A 1A3QA 4F57H 1MY7A 4TRPL 3VXUA 2BY2A 4QRSB 3VI3E 1QLFB 4OT1H 3MJ9H 1TZIB 1LD9A 3SKOB 2FEEI 2VAJA 5C0AB 1A0QH 3T77A 1DANU 3PWJB 4G80A 5J6HA 4A6YA 1VB9A 1FGVL 1GGCL 1S7SB 3BHBA 3KYOA 1A7QL 2ITCA 1JNLH 3WUWB 1U41A 3FOLA 3HFMH 4LNRA 1YNLH 1HHIA 1TXKA 3OZ9H 5AAWA 4Q97A 3STBA 5AD0B 5IT2H 2E9JA 3L5WA 4E42B 1GPOH 5D9SB 1F6AA 3RGHA 1AHWB 3ISWA 2Y36L 5T33H 3AREB 3BDXA 5F1OB 4J4PD 5D71L 3E2HB 3PWVB 3KPLA 4WI2A 1IQWH 2EDFA 2YA2A 4Z95L 4PRDA 4HZLA 1MWAA 4KH2A 2H41A 1TFHA 4AY0A 4O2FB 2V7HB 1EJ6A 1HQRB 2NCMA 2BSSB 4GKSB 4M1GL 1E28B 3SQOL 5L8JB 4FQ2H 3OJ2C 3F6IA 1FO0A 4O9HH 5BVJB 3JBG7 3B4NA 5E8NA 3GI9H 1HHGB 3OZ9L 1QTYT 3HNTL 3GM8A 4WFED 3VXUE 1ED3B 2X9YA 3L7EA 3O41A 5FM8A 4MXQC 5CCKL 3OAZH 3X11A 1AO7B 1P7QD 2XKSA 1M71A 3QUKA 1DLFL 5T3ZL 1BVKB 3MNVB 3SOBH 1QFOA 3WD5L 4H1LA 2D31A 1MCWM 4TRPH 2GSGB 1KTKE 5JA8B 4PJ8B 5HI3C 2IMMA 1EGJA 1I8IB 5M94B 3VWJA 1EJOL 1V8HA 4JG1L 4KKNA 1EO8L 4XNQA 3VXOA 3G5XB 4AEHL 4BA8A 5F7UA 5I1DA 4X6EB 1HH9B 1HSBB 3LHPL 3FQWA 5IQ7L 3GSOB 4NQEB 1BVLA 3HMXH 3OMZA 2NYYD 4LEOB 2BY0A 3HG1E 1OQXA 3EYOB 1DSFL 1QRNE 4CBPA 5KVGH 1WK0A 3QEQE 3LD8C 4K7FB 2P24B 3SJVD 3WHE1 3O6FA 2AK4E 1SVCP 1E4WH 1SBBA 4NJ9L 1GGBL 4RWHA 1NFDB 3WN5C 3QXWA 4X6CF 1YQVL 3G5YB 4ZUUA 4IDJL 1U8PB 4LP4A 4ZG1A 5TF0A 4IIQB 4PV9B 5LCVH 1BQHB 1T80A 3BMVA 5LGKA 1I1AA 2DWEB 4M62H 1II4E 2PW2A 2BJMH 1XGRB 4QHLA 2I5YH 3FN0H 1UACL 1IKNC 1JWSA 3BP6A 4LBEA 1DQLH 5DJ6A 1XGYH 1N0LA 3DXAE 2FGWH 1X5AA 4HS8L 5JHLH 1SHMA 5GGVH 2H8PB 4ZDHB 5FXCH 2MJWA 1VEOA 1FNSH 5IF0A 4PJ5B 5MEPB 2DQUL 5GS1C 1T2QH 1KGCD 2VB5A 3QUZA 2EYTB 4Q0XH 1T1ZA 4KTDH 2XQYG 3T1FA 3GUTB 4U1JA 3PV7A 1R3HA 3P0YL 1FFNA 4WNQA 5F7FA 2EDBA 3MLXL 2QQNL 3P4OA 4OLZL 3KPQB 4F37F 3MGAA 1S7UA 4I0KA 3W0WA 4R0LC 1OTUC 3GJEA 3HB3C 3GHBL 4K71B 4P3DA 5EU5A 4HDIB 3WS6C 1KT2A 4WHTA 1FORH 2IGFH 1RIHL 3MREA 2BSTB 4JQIL 3F12B 1NLBH 2CH8A 3R06B 2WLZA 4R26L 5FGCE 4ISVB 3BWAA 4LSRL 3BN3B 5IFAH 4XBGB 4KV5F 3UJTL 2J4WH 1BOYA 32C2B 5D93B 4RA3A 4Y5VB 1YPZE 1XMWA 3H0TA 5JOFA 3LKQA 4M3KB 3ZZ1A 2YBRB 1CD8A 3T0EB 1ORQA 4I3SL 5CEXB 3QFDB 3STZB 2VE6B 3BGMB 4MAYA 4X0KB 2M26A 3RFZC 1J18A 3JV0A 5DVLA 1EHLH 2NLJB 3TC9A 4MA1C 2DLIA 3VGAB 3QIWB 1V7ML 3Q3GB 1OT1A 4OZGA 4RMSA 3BUYB 4HIJA 4PDCE 3FHQA 5FYJE 5DJ8A 1I3RA 2BK8A 1OM3L 3W5MA 4IRSC 1I8IA 3OKNA 1JIBA 5DQ9B 1U92B 2QKIA 2HFGH 1FGNH 4PJDF 4DKFL 4J6RL 1ZXQA 1MH5A 4XCEB 4R8WL 4M7KH 4JFEB 4S1QL 4J3OC 4CJ1A 3S96A 4OZHF 5C0BE 4NO5A 1AGBB 1DQLL 2AEWA 1C5BL 4ZUTA 1QA9A 2OJZL 5E4EB 3BEVB 3O81A 4HH8A 1U58B 1KPUA 1T0MA 3WDHA 5IVOA 3ARFC 3UBXB 4YPJA 2KQMA 4XCYB 4UUJA 2A77H 3WS6A 4NHCL 1Q0YL 1X5HA 3GGWB 4ZS6D 25C8L 1AGCA 3B8YA 3O2DL 4FXLA 4OD1L 1NMCC 1SVZA 3ESVF 3WHE0 4YHZH 4X4YA 2BHZA 1HYSD 2CO7B 3HTLX 4MHHG 5GGTH 4YHLH 3BPNC 5E2WL 2COQA 3U83A 1BZQK 1OP3K 5J8OA 2Y9RT 3MOAL 3VXRD 4QHLB 2YWYA 2Q6WA 4YXHL 1B0RB 4GLRI 4LAQL 4ONHB 3FRUB 4J1UB 2AJVL 2GQHA 1G7IA 2ARJB 4FQXA 4K55A 4PRHB 4RMUA 2XQYK 4JG1H 3KPMA 1V3JA 5IEHB 1BFVL 5EBLB 1LE9B 2R0LH 5C7XL 5HGBB 3ZKXC 2HTKD 1YYML 2J3SA 3QWOB 4LQFL 2G5BA 3VFWA 4WENB 4QGTA 5D2LA 5CCKH 4KPHL 1IC4H 5CEZE 3HE6D 2QSTA 3IDMA 4GAJL 5DMGC 5A2LH 4F37K 3NH7H 2NY0B 2XG4A 4P2OB 2A1WH 2GTZA 5BW7A 4PJXF 2QSVA 3C60C 1ZA3A 4X9HA 2PTTA 5A3ID 4QOKA 2PXYA 1CU4L 1UM6L 5KW9L 3R0NA 3ZKMD 3MXWH 2VDPL 2NW3A 1NEZA 3T4YA 2ZOKA 3MRBA 1IGYB 5L2JA 3KYKL 1DBAL 3RIAK 3H7BB 3BIBX 3RQ3A 1DBAH 1RFDL 4KHXH 4OCWL 2UUDH 4K71C 1J12A 2FHFA 3MRHB 4HPOH 1F97A 1R3IH 1A6TA 4QRQB 2WZPD 3S98A 1NC4B 1IC5L 3VMNA 3BRGC 5JW4N 3SY0B 1FFPA 1N6QH 2UY7A 2EDQA 2LTQC 2F74A 3EOBB 5E94A 3AS2A 4NGHL 3FB5A 5IB5A 4GAYB 4H25B 4P46B 1UB5A 5C0DA 1JYWA 4BZ1L 1CF8L 3KPSA 2VKXA 4GW1B 1TVDA 1KCVL 1KPUB 1T0MB 1O7VA 5D7JA 1MRFH 3ROLA 3PDGA 1WGOA 4KMLB 1CN4A 2BVPB 2WWMD 2VDMH 4D3CL 4HLJA 2XKNB 4C58B 12E8H 4NSKB 1JN6A 1YEHH 2YUXA 4K8RC 2WUCH 4P59L 1NC2A 4HIIB 3V5HB 1B2WH 2ZPKH 4LCIL 1IGCL 1FNFA 3DVGB 2EKSA 1MAKA 5EC1B 3FONA 3PGFH 1V5JA 4R7DB 1JPFA 2HH0H 3MBXH 4JGUA 4YHZL 4JKMA 1BEYL 3WJLA 1BF8A 5IB2A 3KPMB 3LDBB 4FN0A 1H3PH 1T1WB 5D96C 4IRJB 3SGJC 4XNMB 3Q5YA 3U0TA 3WS3B 3VXSD 2R0KL 2OTPA 1HNGA 2YPVH 4WV1A 3OHXA 1RJLA 2RIKA 3CX5K 1W72A 3RX8A 5IMLB 4TTGA 4OV5B 1DANT 1Z5LA 3W39B 4UDTB 1F6AB 3AROA 4FNLH 1AC0A 5T5FH 4Z78A 3VA2C 2NMSA 4JFQA 1IEBA 4DW2L 4ELMF 4ZFFA 4YLQT 3VXQA 1RK0B 3CU7A 5DJ2A 1MWAB 1F3DH 3MRRA 3FMGL 5KS9B 2OBGA 2AJZB 1QFPA 5GRUH 2AW2A 5E8DH 3JUZA 2AS5M 1Q38A 4RFOH 5IGXL 5B8CB 4FTVB 1KIPB 5MEND 4L8CB 1RIVL 3LZFH 2BFVH 5SWZA 5L2JB 2RJMA 3MV01 3KLHD 4K3HA 2E3VA 2EDOA 4HKBB 3DYPA 1P2CB 3EW3B 4EUPB 4CU8A 5E03A 5B3JE 5HI3D 4EOWH 3WKMH 3KYMA 4ZUWA 3ARGA 1AXSA 1JWUB 3MGOB 1J0KA 3TVMC 3QI9A 5H2BB 5C92A 3P9LB 2EZ0D 3BO8A 2ZWLT 3LS4H 1Z0MA 4ONGH 3G6JF 4QXTA 4R26H 1G7MB 5A1AA 4V3EB 2HVJB 1NLBL 3D85D 1RJZB 4L1HA 5K9KB 5H94B 2DB8A 4WO4A 4K23L 1R6VA 2R23A 1IE5A 4HK0B 4QRTB 3GSOA 3K2MC 2W9EL 4QNPE 2IFFH 2BNUB 2BCKB 5E8PA 3GK8H 1H8OA 2J8UF 2HLAA 1QFHA 1LDPL 2OQJA 4RX4D 2MOVA 4W6XB 1JMZA 1YN6B 3IFOB 4L8DB 2HLFD 3NTCH 2FIRT 3R4DA 4XVJL 2APFA 5BRZA 3J8F7 4I18C 2X7LB 1TJIL 2G2RA 3I75A 1IGIL 3T0BA 4NQCD 4YAQA 1SJXA 4ZMAT 1KB9K 5L88L 5KSAA 1P1ZA 1DTUA 3OQ3B 1GHFH 2R1XB 1NMBL 1XGYL 4N8PA 2YD2A 1S7VB 4APQD 2YRPA 1OL0A 4DCQA 1GGUA 2DLEA 3W11D 3T4AB 35C8H 5ACMA 3MZGB 4QOKD 4EBQL 2QQKL 3H3KA 4IMKC 1P5VA 5KZCD 4Z7UB 4JFED 3SDCA 4RISL 4S1SH 5DURB 5IF0B 4WFEE 3VXUD 1FBIH 2VXSH 3GIZH 4AQ1B 1CDHA 2MHAB 4EXKA 5CD5C 2AJXH 5I73B 1KTLB 4HH9A 3CVHA 1J0ZA 1J1XH 3GUTA 5GGSB 4HWBL 2H32B 3ZHDA 1CXFA 1PG7W 4OCMC 2XRAH 5D7SL 2WINA 1HK6A 4M7JL 4PPTA 4XT1C 1M7IB 3X11B 1WT5A 3QG6B 5BS0B 4DAGH 5KSAD 4OFVA 5F3BB 3GBMH 5DJYA 1F58H 3PDDA 4MAYC 5IQ7H 3CH8A 1WWAX 1H5BB 1OPGL 1J05A 1NCDL 1IC7H 2YMXH 5JOEA 1ZSDB 1D5IH 3HMWH 4U1MB 2BHYA 3QIUC 1EJOH 1FO0H 4ORGA 1A6AA 4F7CA 5TFSL 1FVDB 4DJMA 4ZQKB 1IJ9A 4QRUA 3WIHH 4I77H 2M1KA 1MJUH 4G6KL 3K80A 4WJ5A 1UZ6F 4YDLB 3JWDC 4HZAA 3HLAA 4FQLL 3PQYE 1WFTA 4WU5A 2HT3C 5EC2A 1MVUA 4ZOBA 4NC1C 5FUOL 1N59A 2X4UA 4FQIL 5KSBB 1K8DA 4GW4B 4AG4H 1MCQA 1KV3A 5FF6B 3M07A 4G7YL 3H9SD 4FABL 1I7TA 3ZE0E 3D25A 5EU7E 1FL6B 3CJJA 4HIHB 3W0WD 2PW2B 5CLTA 2OZ4H 4PD4K 3BIAX 5H37H 1HXMA 5CJXC 5D2NB 2D03L 2QBWA 1SBSL 4YFLF 3GMRA 4M1DH 1PKQB 3QUYC 4HKJB 1L6ZA 4Y4FB 1S9YA 5ADPH 3MO1B 3U46B 2ZCHH 3RU8L 3TM6A 5KVEH 1F6FB 2Y6SC 3MODH 4NT6A 4R97C 2ICWB 4UT7H 1NBQA 2DIBA 2CKBA 3C5JB 4Y4HC 4KZEL 2KL6A 4HJGA 5ERWB 3WNNA 1JNLL 4UUJB 4NQCA 4ZXBA 4MXVE 3B3IA 5EIVA 1GGTA 4RBPK 1AJ7H 4X6DE 5KS9E 2QSCL 5E6IB 1FPTL 5EZOL 3MJ9L 3TPUE 1H3XA 4LPYA 3X14B 4HX1A 4RAUB 3RGVA 2Z4QB 4XMKL 1IAIH 4XPFH 1KT2B 4WHTB 1R0AH 3A6CH 4H1LG 4PRPE 3WIHA 1MQKL 3DLQR 4P2CG 2CMRH 5GS1A 1FRGL 3QDGE 4JHZA 3NGBC 1J7VR 3F65A 1EAPA 2AKRB 2E9BA 3FL7A 1S9XB 4GKZB 4MJIB 4K3EL 4J3WA 4W68A 3VXSB 3DIFA 5I1EH 3ZDZE 1OB1A 3R8BB 4XPBH 3LQAL 5GGSA 4RGND 4TVPL 2NX5E 3JVGC 5JNYB 3ZDYF 5BS0A 1UVQB 3ARGD 2CLRB 5HGAB 1OD7A 4NOFA 5GRJL 4F7MA 4JPKH 4QHUB 3UTTD 2GCYB 4M6ML 2YPLA 4Z7UE 1WAAA 4EUPH 2FYYA 4MA7H 1MH5B 2Q20A 4Q7DA 3LH2H 1KG0A 3DPBA 2QV2A 4CVXA 1LQSR 3QHFH 4R9HA 1LO3L 3U30C 3NIFE 5J1SC 3BEVA 4JG0L 2B20A 3QO1A 4NWTH 4BZ2H 5ESVA 2ZOKB 5D6CA 1D9KD 3SDXB 4YDVA 3LQAC 4U7SA 3C09B 2AQ2A 3QNYA 4UDUA 3SE3A 1Y18A 4ZOEA 3ME0A 2PETA 3IT8D 3MRIB 4HT1H 3EGSB 3SO3C 3WIFB 1GGYA 1RZFL 2P5ED 3PWUB 2ADFL 4L8BB 4QY8A 3TNNA 5IWLA 2ENSA 4X80H 4MJ6A 5CILH 5EZIH 2XZCH 1BD2E 2BOCA 4KKBC 4JFOB 1DBML 1YEIH 1ZA6B 2VXTH 1ZGLA 4NM4H 1UEYA 4S2SB 2CXKA 3MCKB 2Q87A 3A6BH 4WGWB 4NNXA 1AD0B 4ZO9A 2DS4A 3V4VH 3WO3B 3C5ZB 3E8UL 4U1HA 4YZFF 4NN5B 3MGTB 4OZHB 1G9NC 2PTVA 2X1OA 3AFLA 1CQKA 3P0VL 3BD3A 2JKXA 4P3WA 2IPUG 3MV8E 3RAJL 2DICA 4QXUH 5HGBA 3LEVH 1MCSA 4JFHD 2ILLA 3SKNA 1N26A 2PCPB 4MWFA 4NQCB 1UJ3C 1EMTH 3QUZD 5D1ZD 5EU3A 1DUZA 4X6BA 1AHWA 3W82A 4ODVH 1Y0LA 2NW2A 1XGTA 5F9WB 1SJVA 1JYXA 3D2UA 1N5YL 2DYPB 4PGEA 2GTZB 3MRCB 3JWOH 5EUKA 3IU3A 4G9FA 3AB0B 2PYEE 5INDA 1GC1C 2R4RH 1U8NA 2NY5C 1ZT1B 5J12B 4GXUM 1QSFD 4E0RB 1AD9B 2W0FB 1E28A 3H3PH 2VXVH 5T5NF 4HUUB 5BV7B 8FABB 3MLUL 2XTLA 3V6ZB 1Y6KR 3WYRA 4RFEA 3L3JB 3H9HA 1VADA 4U3HA 2HJLA 4YC2C 3MLSL 3D18B 4QHNA 1C08B 4OM0L 5IHLB 3OHXB 3U4BL 3BKYH 3BZFB 3O3UN 1JNJA 1D5ZB 3G08B 5DJZB 1O5DT 3JTTA 1E6JH 2CLRA 2P5EE 5I30H 4KK5D 2GAZB 3EDEA 3SGJA 4HWNA 4FZ8H 3QPQD 3QEUB 3SDAA 4XAKE 5I15H 5T3XE 4P5TD 1NCAH 1AR1D 4M5YH 1F8TH 1NC2D 5LGJA 2FR4B 3VFPA 4XNQB 4ZAKA 4NM8L 3CFDB 1K6QL 5K9JH 2FBJL 3LRSB 3M17A 2GJ6E 4N8VA 3NFNB 1UM4L 5ITBH 3KDMB 3OF6D 1R3JB 2Z35A 1IARB 1RY7B 3OXRB 1JRHI 3PIQB 3MV8D 5BJTB 2ZOLA 5GS2H 5I1GH 3ROLB 2A6JA 1MFCL 1UZ8B 2IBBA 1FHGA 3PABB 3QNYB 4MNGE 3SCMB 1ZGLM 2F19H 5EORL 3VRLF 4JZNB 4K7PY 2LVCA 3WIFA 5EUOB 2EDYA 2EXWD 2XKNA 3X3GL 2OJEA 5FGSA 1JWMB 1W8OA 3EJZC 3O2DA 5IMMB 1KCUH 1BECA 4IIQA 3RVXD 2X4SA 4GUPB 4LPUA 3TO4C 5E7BA 1AGDB 5DD0L 1R3KA 1HNFA 3P11L 2HFEA 3GSWA 3RKPA 3TH2T 3ZDZF 3P77B 1DE4B 4NKMA 4ZPVA 4B50A 2CKNA 2IALB 3RUGF 5MEPA 1NDMB 1OAKL 3TNMA 2P1YA 3KYNB 1RVFH 4ZO8A 2JELL 1PVHA 3IFOA 2VLKD 4KMTH 4WFFD 5D6DA 1QLEL 4OZFB 4WV1B 5I1KH 3ARVA 3C5SB 4UI2A 1QACA 2OTWB 4PLKD 3P4OB 2BC4B 3VFGL 3QUXA 4KDVA 5F9JB 2AXHA 3GHEL 3WEXA 1T83A 3TJHD 4RGMB 3VFMA 3WFHA 4NRYB 5C0FB 3MYJB 1S78C 3OKDB 2IWGA 5CJQH 1XF4A 2B1HL 1ZT1A 3SQBA 3R06A 1XGPB 2YD3A 4KAQH 1WWWX 1RZFH 3RIFK 1AD9A 2W0FA 4XAWH 3QXAB 2MQCA 4HT1L 4PJ7E 2UWEE 3WSQL 3S37H 3V6ZA 3LKQB 2NR6D 1ORQB 2BSRB 1BQUA 2ZSVB 3IGAA 1P4LB 4PJ8D 2E6QA 3JTSA 4G6FD 2EE2A 5CZKA 4JFPA 5IBUB 4YHKH 3VGBA 5L2KB 4L8SB 3IDGB 5DT1H 4HD9A 2OM5A 3EO9H 2XN9B 3VFNA 3C9NB 2R0WL 3QEQD 5AZEL 5E9DA 5F3BA 1J88A 5CUSH 3QSKB 4OFYA 1AE6H 3Q0HA 4L4VA 4YHIB 1A7BA 1U2HA 4MNHA 5CSZB 5FDWA 5HD8D 2KZ1B 5L7XL 1BX2B 1KLUB 5ISZA 3MA9L 1JI2A 5DEGA 4U1MA 1NPUA 2L7UA 4X99A 5EPMB 1PBYA 2PO6D 4KKLD 2IH1A 4N8VB 5B38B 3BN9D 4G3YL 4DEPB 1VERA 3MBED 4R4BA 1QKZH 5D1XA 3O3DA 4TVPH 3VGGA 2FWOA 4PG2A 3RDTB 1JGLL 5DEZA 3PGCA 2HMID 3DTXA 1T83C 2ZNXA 2B39A 4OLUL 5CJ5A 3KPNB 2P4AB 5DQDH 3HE7B 3VDCA 1H0DA 4ZD3L 1QNZL 4ESKA 5C0RL 3Q6GH 2A2QT 2W9LA 4M7LH 1T1XA 1FRGH 1IGJB 3GSUB 1N3NB 4PJHE 3CC5B 2NTFA 3OBAA 1U93A 4YHOH 1V7NL 2J1KA 4DCQB 2Z31C 4KK9C 4OM1H 1CDIA 4OF7A 4XPAH 4I3GA 2A73B 4HQQL 1YDPA 4U0RC 1RZKL 3QQ4A 3V6OA 1HKLH 4U6VH 4Y19B 1MRDH 4FQXB 1JI1A 1DQQA 5EU4B 3WSQH 4UMGA 2I9LA 3VFOB 4U4BA 4ZNEA 2NY1C 5CMAA 3R0MA 4NJAH 3FCTA 5DZNA 5GGQH 1WBXB 3TT1H 3VG0L 2YKLH 5F89B 3RUGB 5KVEL 1WSST 1U42A 3C5SA 4EXPX 4KKCD 1CT8A 2HJKB 3QXTA 5EB9A 4XWGL 1Q9KA 1A7NH 3R1GH 2WK2A 2FX9H 4YBQD 3WIIL 2MSPA 5FYLH 3DURB 1FYTA 3N1GC 1U8IB 2BVOA 4NQVA 5M7QA 2HTLD 3EOTH 3WFHB 4XBPB 4WFHD 4KMQA 4HZLB 3ZHKA 1A4KA 1XF4B 4KI1A 2CDGA 4Q74A 4WI4A 4MJID 3KPRE 5CIPH 3KJ4B 4FABH 3QUML 2VLJE 5C0IB 4Q2ZB 4AL8L 2EDWA 2XTJD 3QBTB 4PR5A 3L9RB 3GMPA 2GFBB 1NLDL 4QNPF 1S9XA 1OTTD 1A1MB 4PP2B 1IGYA 5E8NB 4BQCA 5IFHH 3VXME 1P4LA 4DGYL 4MD5A 4OIBA 3LPGA 4M9OA 5TDOB 1K8IB 4PJFF 5F7EH 4N1CA 3O41B 1MPAH 5I71C 3V0VB 2R2EB 4LSQH 2OXGA 3GB7A 2OXHA 3SO3B 4NCDA 4ZPTB 4K8RL 3UYRH 5BZWA 1ORSA 1KPVB 4Z7NF 1EIBA 3TH4T 3CFBB 3ZTNH 5C0JA 5JDSA 1N6VA 5MEQB 2V9RA 2DQFA 4C57C 2Y07H 1WUNT 3MLPA 4XVTL 3RVVD 1OQOA 2ZUQB 5F7NC 4R2GB 3EYSL 1WEJL 1QQDA 3HZVA 1S7QA 2IH1B 5FDYA 4PV8B 1OGTA 3RL2B 1CDGA 4Y4FA 4XXCA 5C1MB 3O4LD 5C2UB 1QSEE 2FL5B 4XPTL 2I24N 3B8SA 1S7RB 4DUXA 1XGQA 5DO2C 3RWDA 1BIHA 1A6WL 5ESVB 4HK3N 3CU1A 3RDTA 5D7JB 1L9NA 3KPOB 4NP4H 5IJKC 5GQBA 3DVIA 4JRYB 5AEAA 2IBGA 1ZLWK 5LBSL 5JMOC 1O0VA 3EZJB 4XVSL 3RGVB 3UPRA 3RVXC 1QSEA 2VTFA 1U3HB 1PLGH 4JHBA 2OL3L 4LPWA 2EH8H 2X4OB 1MCCA 4ELKA 4NKOB 2OP4H 4LSTH 3FFCE 3UTTA 5HXMA 2NY7H 3PJSB 1OP5H 2G5RA 5CZVH 3IAQA 2I60L 5EO0B 5T1MA 1IGIH 2ARJQ 4GRMA 3V0AC 3N9GL 2V2TB 5FUZH 2C4FT 1NANI 3SBWA 4JFXA 5F7EL 2GUOB 2FEDC 4N90E 2CRIA 3QRGH 4U6HA 1X7QB 3VXMB 2I9LB 3BGFC 1P84K 5I9QB 2VDOL 3DIFB 5K59E 2E6JA 5D72L 4WNQB 1ACZA 3RWHA 1BIIB 4NWUH 5IMKA 3OAZK 1H3GA 3UJIL 1UXSB 4F3FA 4QWWD 4G7VH 2DBLL 4JJ5B 1NGPL 3EYQD 4TSBH 4KK8C 5I1LA 3QPQC 4PJIB 2WIIA 1FYTB 5JOPD 5DK0B 3GJEB 4KK5C 4ODVL 1DZBA 5TE7L 1FL3A 3GMMB 1VEPA 2XZZA 4KGLA 4HJJH 3SDXF 1MJ7H 4X5WB 3QCTH 5F88B 5KSUB 3MJ8A 2PYFB 5E99L 4NQED 3PWLB 5TE7H 3BWAB 3UC0L 5I2IB 1R3LB 1JTPA 1Y6MR 5JHDA 1ZGLP 2R8SL 2RFXA 1ZEAH 1RZJH 2GFBA 2OTUB 5DC9B 3FAWA 2VXQH 4UQ2A 3P4LA 4D0CB 2DLGA 2WLYA 4BSVA 1J8HE 4M48H 4YDVB 4ZYKB 3BP5A 5GISH 3TO4D 3EJYC 4PG9A 4PJBE 1N4XH 1CLCA 3O3EB 3FN9A 3ARWA 4J2XA 1XF3B 3FQTB 3UP1A 3VFRA 2NX5D 4Z7WB 1T4KB 1YEGL 5F7KC 5CD3B 4U1SB 1PJ9A 4JFOA 2AXFB 1INDH 2Q1EA 3SE8L 4D9LH 4KVCL 3V6OE 2G75A 5F3HB 4M6AA 1EZVY 2DQIL 5EZLB 5C0RH 4MZ2A 4ALAH 4D0DB 4UTBL 1HHHA 1XR9A 2OMNA 4DQOL 4FMFA 2O93L 5AAMA 4G8GB 1QSFA 3O2WL 4GAGL 1KENL 1ITBB 1T6WA 2ADJB 3TF7A 1DN0A 2IEPA 1F4XL 1MAJA 5IBLD 5B39A 4JRWA 5H8DA 4Z77B 5BJTA 4ZAKC 5FGRA 1ES0B 2R2BB 4ZXBD 4LPCA 4WI5A 4PJXE 5FK9B 1IMHC 4P2RB 3QIBA 5DHYB 5F70A 5GSVA 5IVXE 1YMHB 1XT5A 4PTUB 1FN4A 3GMOA 1JWMA 4G5ZL 3OKLA 4YGVA 3GJFH 1P1ZB 3VFSA 4H8WC 5DJ0A 3GSNH 1S7WB 1TZHB 3FT3B 4PY7A 1RZIA 2BNRB 1KLGB 2DI9A 4P3CH 2NY5L 3VXNA 3BOVA 3QHZL 4YBLC 2AEQL 4M9PA 1PEWA 3SGKC 3LRGA 1YEHL 1TMCA 2IANE 1C5DA 3NA9L 3HUJB 3MV11 4DKEH 3ARPA 3PHSA 4ZTOH 1HSAB 1DCLA 5EOCL 4QXWA 1DBBH 2O5YH 5CJXA 2ICWJ 2VZ1A 5E9DE 3ZKND 1MY5A 5BMFL 1DLHA 4QHMA 5IUSA 5ILTH 4ACPA 2EEAA 4MA8L 5E56A 4HG4J 3BZDA 4Z7UF 2AAVA 4JJ5A 2VDQH 2BC4A 1TENA 1IAIL 1YEGH 1UG9A 3EFDH 2B1HH 1EFXD 4N0CD 4PJEA 3ZDYE 5C8JA 3U2SA 5F9AC 3KPRB 5JHDD 3MJ8B 4U31A 3BI9X 4KZEH 4JHAL 2PXYB 4L3CB 3ZHLA 2D0HA 5IEKA 1AXTL 5CEZD 1C8PA 3QXAA 5DGQA 3NOIA 3MODL 1BQHG 4OBSA 1JUFB 3RU8H 3U7YL 3QH3B 2W59A 3WIIH 2B0SL 1QSVA 3IS0X 2P5WB 3WO4C 1QLEH 3RKDC 3PIQA 4XWGH 1XCTA 2JE8A 1P4IH 3EJJX 4GS7B 2CDEA 3CSYA 4FHBD 1N59B 4MNQA 5CKAA 4F8QA 4L3ED 3HC3L 1CCZA 3IF1B 4XP1H 4ZXBC 3HPJA 5EFIA 4GUPA 1JGUH 1T4KA 4TSBL 5FB8B 4HKZA 2WBJC 1IT9H 1Q9LA 4HIHA 4KUZL 3C8KB 1FH5L 5F3HA 1CFQA 1DVFD 1KACB 5GIRB 3BD5A 1RJCA 2DL2A 3FB5B 4Y4HD 1S8DB 1CD0A 4QRSA 1ITCA 4AEIL 1JPST 5TH2B 5D1XB 3AS3A 3MRMA 3V7AE 4A2MA 4LRNH 4KRPC 3P3YA 1LO0H 4OKVA 2ADIA 4DN3L 2FWOB 5T1LB 3DETC 1KSRA 2I60H 4PJ9A 1G1YA 3Q48A 4MNGA 5E70A 2OP4L 4LSTL 4PJ8A 3B2UD 2XXMB 1OPGH 3OKOA 5CZXC 1C5CH 4IOFD 4P48A 5DC0A 1AIFA 4OQ1A 2ED9A 4PV9A 1DP0A 3GRWL 5IROA 5LWYL 2NTFB 2DL9A 1T22B 3U36B 1ZHKA 1R24A 1Y6NR 2YXFA 4LSUH 2A73A 4OD1H 5E5MA 2P43B 2DQTL 1RZ8B 3HUJA 4MGXA 1JPFB 3ECBA 1EO7A 1XIWC 3EYUL 2AKRA 1D6VL 2F53D 1UADC 2R0WH 4OJFH 5AZEH 5J4MA 1EEYA 3GMNA 1NSNL 2QR0B 4QEGA 2KUTA 4XNUL 2QQKH 3H6JA 2V5RA 1KN4L 3O9WA 1IKFH 2NY6B 4M6NL 2Q76A 1JV5A 4I5BA 4X7DC 2VXVL 2EC9U 2ARWA 4TVSa 5KAQF 5JXAL 4Z78B 3BP6B 2GSGA 3HRZB 2P49B 1BZ9B 3HC4L 2R4RL 5F44A 1UWGL 1MPAL 4XBPA 4O51B 4PJ5A 2FYYB 4LASL 3VXOB 1HE7A 3ARDD 1C1EL 1T04B 1AKJA 2PYEA 4E9LA 4G9FE 5DYOA 2XZQL 3TGXA 3T65A 3RIFF 2QEJA 1OAQH 4H5SA 5FO9B 3ALPA 2Z91A 1RHFA 5L0QC 1KIPA 1ZT7B 3SDDB 3DVNA 1K3IA 5ITFA 5FHBL 1A14H 3CPLB 1RZ7L 5J56B 1KTRL 5DR5H 2NY6D 4KMTL 1N2RB 2DQDH 2C3GA 3I3EA 2DRUA 5HDQL 3F7QA 4I13B 2JELH 4OQTA 3UZEA 3MV8A 5IG7A 2R4SH 3HNVH 4AIZB 3EYVB 3IFLH 3BUYA 5FYLL 3TFKC 1W0WB 3P9WB 4X98B 1G7PB 2F8OA 2VWEC 1YEIL 1FYTD 2JIXB 5TDNA 1XGRA 4GMTL 4C56E 4I48B 5HYQA 3S7GA 4Y4HA 2AXGA 3A67L 4LLMA 4XCEA 5GIRA 3UPAA 5DJ6B 3K46A 4RDQG 5TPWH 1F2QA 3QQ4B 5I8CA 5D7IE 4ZDHA 4OLZH 1S8DA 4P4KB 1OGTB 3GSNB 3C60A 2MQ3A 4OZHA 4RFOL 1MRDL 1DDHA 3GSQA 2A0LC 3FO1B 1YN6A 1AI1L 5DFVC 4HFWB 3TFKA 1K4DB 5DHVA 4HIJB 2R15A 1KN4H 3HMXA 2EEDA 4IM8A 5DQ9A 4FQCH 1T5WA 4OJFL 4XPHH 3G5VA 3W81A 3OR7A 5DD5H 2BVOB 3G6AA 4NQVB 1QFWM 4TQEH 4YJZL 2B2XL 3RNQB 2VLJD 5CD5D 4XZUA 2X41A 4F7TB 1A7RL 4L9LC 2VKWA 1P4BH 4DVBA 2CIKB 1KEGL 2WBKA 4R4ND 1J0HA 2W0PA 1DEEB 3HG1D 2CQVA 4I0PA 3VFUA 1AGFA 2DF3A 1J1OL 1WAAE 1SYSB 4PRAB 1ULVA 2HJFB 4HG4K 5D5MF 3MLWL 4G8IA 1N8ZA 1C5CL 4HMCA 3T8XA 3LQAH 3IJHA 2IBZX 5IEHA 2BNQD 1HHKA 4EN3A 3U9UB 3U4BH 3GDBA 1D5MA 4JREC 4KKLC 4OM0H 4K7PX 4L1DA 1TCRA 4ONFH 4LCIH 4YK4C 1RJYB 1CDJA 5GGUB 1TETL 4DN3H 1NMCB 2P46B 3HCVB 3SGDH 5DUBB 1MVFA 2OCFD 4TYUA 4ZPTA 2WUCL 4LIQL 3TYGL 3ARUA 3OL2A 3KG5A 1WT5C 4UNUA 3DXAD 5D7JC 4TSAH 1KIQB 3A6CL 2GEEA 3UDWA 2LV4A 1FH5H 5C0EA 3CXDH 1T66C 4JO3H 3HZVB 4CW1B 3BYTA 1AKJB 4NQDE 3M17B 3L5HA 3NPZB 2MCPL 4Y1AD 1G9NH 2FATH 3QUMB 1T3FB 1C7TA 4R90H 2OTUA 2OZ4A 5EOQL 3TO2B 5F1KC 4ZUSA 5ACZB 4JLRB 5J1TC 2I07A 3GI9L 2FHBA 4X6DA 4FG6D 4I9WE 3NMEA 3VRIB 5GGVY 3TV3L 4AK1A 5C0CE 5F96H 1RQ5A 3LEVL 3GJFB 5CJQL 5E2JA 3RAJH 2Y72A 4PGDB 1XH3A 1CXHA 3ULVF 1EVUA 3MV7A 1UA6L 3RZCD 2HKFH 3U0PA 2VDKL 4CMMB 2VWEE 5ID1A 1BJ1J 3CGTA 3D25B 4HPOL 1MREH 5CD3A 4L4JA 3S35X 4Y4KD 3ZDXF 1IC1A 4Z7WE 5D7IA 5TDNB 3QDMD 2XNAB 4WUUE 3PJSA 3KS0J 2D7TL 4LNVA 3PHQB 2XZCL 4O2CA 2ATKB 5I16B 5HJ3B 1G7IB 2ARJA 1TLKA 3HZMB 1VKXB 5C0GA 1BD2B 2F5BL 2DLTA 1VGKB 1TDQA 5HD8C 1K9TA 5DS8A 2I9TA 2EDTA 1K2DA 3ESUF 2VAAB 3O4LE 4WHCA 3KYOB 3F6LA 4B5EA 4CU6A 1BGXH 5IMKB 4YR6B 1MJUL 4G6KH 3L5WB 4E42A 4XCCL 5IHBA 3PWPD 3DYMA 4JG0H 2O5YL 4NWTL 3MX0A 5DRZB 3VXRA 3HE6A 4Y5YA 1KB5H 3BX7C 4P2OD 4FRWA 3PHOB 4MJ5B 2W9DH 4FQQB 1ERNA 5C0BD 4EUPG 2NY1B 2AJSH 2H2PD 4QOKB 2AEQH 5GS1B 4G6ML 2PYFA 3Q5TA 3B9VA 4P3CL 4JRXA 4FQXC 1J8HD 1C5DB 5EIIB 3VGEA 4R7DA 1CQYA 4M7JH 1MLBB 5IBUG 4V1DD 2ID5A 2JJTA 5IW1A 1P5UA 3IDNA 4NO0A 1IVLA 3DX7A 3MACL 3BVNB 4YXHH 3T2PA 1M05B 5HDBE 4LSPL 3PWPA 3IAPA 5I6XB 1DQMH 4NO3A 1I85C 4JDZA 4PJGB 4EDXB 1AP2B 2AABL 1JGDB 3D0VB 4DZBB 3I02A 3OKKB 4H1LB 3LPFA 3QNZA 3CLFL 3NCFB 4JREB 3V4UL 2WY3A 5DEFA 4NZRH 1E4KC 1K85A 4U1IA 3T2NL 3BKYL 1NMBH 6CGTA 4HXBH 2A6IA 3GKZA 4D2NA 5E94B 4OF0A 2HTKC 3S5LB 4DEPC 1NGYA 3CIQA 4AIXA 3CDGA 1A47A 4NQEA 3RWFB 4M02A 3NGBB 4FFZL 2HFFA 4XP9H 1JFQH 4UTAL 4LLUA 4JE4B 43CAA 1JPTL 1FPTH 1QO3B 5HHOE 1I9RL 5J57B 2P5WA 1FNLA 4KU1A 4L9LB 4DTGH 1OARL 3OXSB 4MQ7B 3WFZA 1OHQA 5DJXB 3WV0A 3UTSB 4OLWH 4KC3B 5BRZE 4EUPA 1UWXK 1BJ1H 3QEQB 4RBPH 2V5TA 3FZUC 1QG3A 4PTUA 4RMVA 2W07A 1GC1H 5HPOA 1QYGL 3LKNA 2BHUA 2VXQL 3BDYL 4FQHA 1JHTB 3D85B 1U8PA 4NSKA 3BP4A 2EDRA 1CWVA 2X4TB 2VZOA 3LEYL 2ZNWA 1HYSC 3WXVH 4EDWL 1Z3GL 1WFOA 2BNRA 3NCEB 1MFEL 1MCIA 3ULUH 2JJSC 5D1ZC 4CUCA 1CDUA 1MJ7L 1ZVHA 3K8LA 3KPSD 3OX8B 4M00A 4U1LB 1V3KA 4FP8H 5HJ3A 1MHEA 2F53E 5IB2B 4JVUA 4P5TC 3WDJA 1NGPH 5CMAB 4XNMA 5FA4A 3UJIH 2BFVL 4LHQB 3LZFL 2VLRA 1A7OL 2HT4C 3P4MA 4V1DE 5FHAH 5C9JA 1CT8B 5IMLA 2AJ3B 2X9WA 1QBMH 3PP3H 1KB5A 2QL1A 1AHWC 4UDTA 4JPIA 3GHBH 1XGTB 1UJ3A 4ETQA 2XT1B 1W8NA 3DX6A 5FUZL 1MCFA 5HYJA 4MJ5A 2QQNH 1LO2H 2DI8A 1ADQL 3RRQA 2EIZA 3U1SL 3L1OH 4DW2H 4NKQB 2FB4H 1ADQH 4HS6A 5T5FL 4KRNA 4OKDA 4XVUD 2AXJA 4TVPD 4PJEE 1WISA 5HYFA 1E4XL 5B39G 3S4SG 3QIUB 4Y2DC 3QZWA 5JHLL 4HS8H 2YRZA 5L6YL 5EA0H 1REIA 1A7OH 2EDNA 2H32A 3OKMB 4N0FB 4MA7L 1YNKL 4M3JA 3WL9B 1F5WA 3EFFA 3FHAA 2C3XA 5F1NA 3PE9A 2R2EA 4M6MH 4ODWA 4L5FL 1D5ZA 3TO4A 4NN6C 1WBZB 3MRFA 2DLFL 1LP9E 3LKRA 3MV7D 1XF2A 3HB3D 4UQ3B 4EVNB 1IGCH 3FO2B 3SCMC 1BZ9A 3QEUA 3SDAB 3WLWD 5DEFB 5JDSB 5I8KL 5I73C 4OCRH 2Q8BL 2J88H 3U4EA 2ZP0T 1U36A 1B0GB 2XTJB 5E8EB 5KAQG 5KVGL 1Z3GH 1FQ9C 1DSFH 1JK8A 2VDML 4QCIB 4WWKA 3LEYH 1QA9B 3UCRA 3O11A 3BDYH 4B53A 1QO3A 1OT2A 1TNNA 4PS4H 3QDGB 4W4NA 4Z8FL 3AY4C 5J11C 1OCWL 1Z2KA 1I85A 4HC1L 4JFFD 2P8LB 3DWTA 5IFHL 2X4UB 4EI5A 3TBYA 2FEEL 2YUVA 2VQTA 2XOTA 3MRDA 1MQKH 5D1QB 2X4PA 1LDPH 1H3VA 3NZ8B 4I18B 4GRLD 1HHJB 4UTAH 2HG5B 4AEEA 2BRRL 2GY7B 1W0WA 2W9EH 3HAEH 1XGUA 3L3GA 4IOSD 1R3KB 3B2VH 5FO8B 2ZG1A 5CP3A 3T4AA 3VRJB 1S9VB 5HYQB 4PJ9C 4PLNC 4JFDB 1WFUA 1U91A 5ESAB 2E27L 4YGAB 1DE4A 1YEEL 4GRMB 2CUMA 4U1KA 3LKSB 1JPSH 2EC9T 4YHPB 4WFFE 3DUUB 3AUVA 4HKJA 1A6PA 2VQ1B 1X7QA 3BH9A 5DMIL 4BFEA 3D39E 4F7PA 3MV9D 4P5KB 1MJJB 3TZVA 4LSPH 1YEDA 4X5XA 3D6GA 2WBJB 3RDTD 1D7FA 1PG7X 2YKLL 1NJ9B 3TT1L 1LGVA 3VFWB 4PJBA 4ZXBB 4NJAL 4L4TB 4BFIB 2CK0L 1IQWL 3UTZB 1W0VB 1L7IH 2DYPD 1KEMH 3BSZH 4PJCF 2VN7A 1UJ3B 3T3MF 4ETQB 1GXEA 5ICZB 5T33L 1OWWA 4N1HB 5DK0A 3NCJL 3EZ8A 4PY8I 1ZKAA 3CFKB 1FZJB 4AG4L 2VITB 3I2CL 4XMPL 3BPOC 3VJ6A 3RBGA 2ZUYA 3BE1H 5FUOH 4JDVB 4M61A 5GSRB 1I8MB 2Z8RA 4QOKE 4NT6B 4NN5C 4HPYH 2E7LA 3EO1B 1KFAH 3Q6GL 4HW6A 2P48B 3ELAT 3RTQB 2NW3B 4XCCH 2DQCL 3QDJB 1ND0B 4BQBA 1X5XA 3U9UA 1NQBA 2Z93A 2QSQA 4KY1H 1IL1A 3RVUC 1JGLH 1PEZA 1D5IL 4J3SA 3WFEH 3V7AG 2OK0H 2FECL 5AWNH 1U6AL 4PTTA 3CX2A 2ZSWB 1JF1A 2ZCLL 2HH0L 3MBXL 3PL6C 4WHDA 4EN3C 1F3DJ 4KJPD 3WFCL 4EVNA 2D7TH 3LN4A 1QVOB 4IRJC 2X6MA 4NQSA 4GKZA 1B2WL 2ZPKL 3G5XA 5I18H 4HWBH 5I1DB 2V5YA 1X4ZA 3FFCA 3UTTE 4JFDD 4OQTL 3VXMD 1Z6JT 3FB6A 3J7HA 5CUSL 3RVTD 3CK0L 3U46A 2A77L 1LO5B 12E8L 1IGTA 4Z7NE 4WHYH 3MXVH 1KUMA 4D3CH 5B39B 1MEXL 5D1XD 3PV6A 3KHQA 1A3LH 4UOJA 5FYKE 3CZFA 3TV3H 3S8WA 3O6FB 3B9KA 1NH6A 35C8L 5DJAB 3PP3K 3HNSH 1H0DB 5J3HD 2ZUTA 5C9KA 3S37L 4APQC 3N85H 1HHJA 1EBAA 5BO1L 1YEJL 4JR9H 4PY7B 3REWB 4WEMB 4K94L 5IB1A 3QIBC 2D3VA 4MXQA 4LEXL 3E3QE 5C0BA 3ZKQD 2A0LD 4FQ1L 4ODSH 4DK6A 1KIRA 3T1WA 1H3UA 3MRQA 2FJFA 3VXPB 1JCKA 4C83A 3FT4B 4OGAD 4JKLA 2NZIA 4TSAL 2DOCA 3SDAD 2FJHA 4I8DA 4MCZA 4P46C 2CGRH 2XA3A 2FX8H 3QIUD 5GRWA 5EU4A 1QBBA 4KTEL 4WY7L 1T1WA 3CVHL 2LU7A 1KCRL 4U7KA 1T1ZB 5JO5A 1OB1B 1KN2H 4HFUL 1M7DB 5E6IC 3JWOC 5IB3B 4ONGL 2Y06L 4FFWC 2J4WL 3LS4L 1CE1L 2C3WA 1FAIH 2ZUWA 2VMFA 4M4RA 5IFAL 2ZG2A 1DBKH 2PXYD 1I8KA 1UB6B 1RK0A 2DIJA 3FO9A 1I8LA 3ILPB 2VLJA 4JKWA 3IFPB 3VJ6B 3KPRA 3DV4A 3EO0B 4QRPB 4Y4FC 4CVXB 2OSLB 4FTVE 3DBXB 3VFVB 4PR5B 2FSEB 3TN0A 2X1WL 3CSBA 4ZFOA 4LQ1A 3W0WE 4IRJD 1IAOA 1IQDA 3D39B 1GZPB 4NQTA 1Y18B 2PTUA 2DM2A 4UIKL 5C09B 4AIOA 3OKEB 4HSQA 1ZTXL 3QUXD 1IAMA 4L29A 4S1RH 1BFVH 4WWID 3HR5A 5KSVA 1ZHBA 3PWNA 1NAMH 5D6DC 5E2UH 5FGBC 4H8WH 4P46D 3TBWA 2GIYA 5DDHB 2E7BA 5DI8A 2AJVH 2BNRD 2FJGA 3ZKXB 4CNIA 4WW2F 3WE6A 4MAUH 5GRXG 3DXAA 2JF1A 4J8RA 4YDLC 3NCCB 4X4XB 4P57A 3S4SB 4JO4L 4NFCA 1R5WB 1N5AA 1DBKL 5E6ZA 3HZMA 1PZ5A 4JJHA 1VCAA 2PR4L 5J3HC 1GGBH 1RUPL 5E8PB 1E27B 3O2DH 3C6LD 5I17A 4U1NA 2CLVB 5T1KB 1L9MA 3DROA 2BERA 1JE6A 1SJEA 4KJYA 5CGMA 3TVMD 3MLSH 3B9KB 5I0DA 3HAEB 2EEBA 3BT2L 1WVZA 4MAUL 3CVHH 3QEQA 5J9PB 1OAQL 2VDRH 4PRIE 1MHCA 3P9MA 1A1OA 4POZC 1YNTB 1YY9D 5HHMD 1C5BH 5F7LB 3EYFB 1LHZA 3IDIA 3TEUA 4UB0H 1T5XA 3CFJB 4LCWD 4S1QH 3MRNA 4PJ7F 4QF1A 1LP9B 3IETB 2FJFB 3Q6FA 1LEIB 3TBTB 1MRCH 4YH6A 15C8H 4J1UA 1KIUA 1QFUL 4D8PA 3VXUB 1PFCA 3VU2A 1W72L 4E41B 3H3BC 4R2GC 1S7XB 2ZUQC 1NDMA 5CJOL 5C0AA 3HNTH 2P5EB 1LO4H 2G60H 5FOBB 3GMNB 2M8XA 4WEUD 4A6YB 2WBJD 3RVUD 4IRSB 1F4YL 4NGHH 4O9HL 5HI4C 5DXWA 4C56B 2X4SB 1OAXH 4X6FA 3P4MB 4KJQC 1N6QL 1JYVA 2IPKB 1JV5B 1MEXH 3VA6A 1UXSA 4NKIH 4QT5A 4YDIL 1UKQA 3MXVL 4M1GH 5GGTA 3K2UH 1J9CT 4M7ZC 4ZUVB 5HHMA 4KKAC 1FNEB 3CK0H 3I02B 4TNVK 3QCVH 1MELA 1IGFH 1FAIL 5D7KD 4PJ7A 3VD3A 3V4VL 4Z95H 1VFAB 1RFDH 4F33A 4JCMA 4HFUH 4AT6B 1JPGA 2WM0A 4OUOA 1A8JH 3THML 3BHBB 3JWDL 4J23A 5D7LB 2D4DA 4WU7A 4JRXD 2H2SC 1LK2A 4ONOA 4X80L 4HKXB 1KELL 3TJEH 3S5LG 3QB7C 2BXZA 1KBGH 3QFJE 2FX8L 4LDOB 2AV7A 3RWCB 2BSRA 3TBSB 2XN9D 2CIIB 1U8JB 1M4KA 4ZOAA 1JP5A 3B5HA 4MVBC 2WWMC 3VCLB 4LKXA 4NFBA 4PRBA 3KGRA 4NBYB 2VC2L 4AIZA 4GAJH 4DUWA 1GZQA 2BZDA 3RI5K 4JAMA 4GKSA 1FL6A 1CGSL 5LXGH 1MWAH 1WIUA 3TCLA 2HFEB 1EDQA 3HNSL 1BX2A 1U0QA 5ISZB 5LAXB 3BP7B 3OPZH 4NHUB 1FCGA 1DR9A 2R0ZH 2VSDA 1A3LL 3LQZA 5I8CB 2XXCB 4I2XB 4Z0BH 5KSBE 3GMRB 3GSNA 2VDNL 5HHNA 1WZLA 5DJDA 1ODAA 4QYOB 1VGEL 3CZJA 5JW3H 5C09D 3MQIA 1L7IL 1KCSH 3KYNA 4FFVC 1RUMH 3JV6B 4U6YA 1BD2D 2X4QA 3V2AR 1WWCA 2CKBB 4L3EE 2YD8A 4NUGH 1U95B 5ERWA 3T0ED 1P4IL 2X4RB 1J1PL 2Q7NA 3ET9F 4D9QE 3TBYB 5DHYA 3DARA 5TQ0H 4YHLL 3I6KA 4K3EH 1T5WB 4U2YA 1CLYH 2YSSA 4MX7A 2AP2A 4OLYL 2ZCLH 3QIBD 2IC2A 4HXAL 5DJ0B 4OF8A 1T5XB 3CFJA 3MYJA 3RWGB 5E8OB 2E27H 5DMKA 5D96B 1IEHA 2AQ1A 4ZS6C 2YA0A 5D7KE 2FRGP 4NNYA 4PJGE 4O58L 5IB4B 2BNQB 2BVUA 1YDPB 1J0YA 3GNMH 3G6JB 2H8PA 4RAVA 3FO0L 1T20A 3SOBL 3O45B 2P5EA 1MCWW 4OCXH 3L3HB 5DMGD 1NGXB 5BZDA 3Q1SH 5BMFH 1NJ9A 1WTLA 1LVEA 2HJKA 2X4NA 3C9NA 1ZLVK 4PS4L 1A2YB 4PJBF 4YHNA 1RSFA 4AJ0A 1TTUA 1V3LA 2VABA 1B0WA 3X12B 4BFGA 3LB6D 4L8SC 5KJRL 5E9DD 1SEQH 2HVKA 3U2SB 4CKVX 1DQQB 2N7BA 3A0OA 3RY5A 3VH8B 2NY5H 4JDVA 4M61B 3ZL4H 5I8KH 1I8MA 1KG0B 5GRYA 2OZ4L 6FABL 2J2ZA 5EO1B 3L5XL 5H35B 1NDGA 4XP4H 4OGAC 1AGEB 4Y0GA 3TN0C 3CFEA 3HI5L 2YEZA 5F72S 1DUYA 1YEEH 4LSRH 4MVBA 3W0WB 3E0GA 4G6AC 1P7HL 2LAAA 1MCOH 5DD1L 4R0LA 4J3TA 5C6PB 5DQJA 2XWBB 3WKNA 4ODBD 3Q3GA 3GJFK 3PWUA 1ZWIB 4NC1E 3O2WH 4QY8B 5ID1B 1ETZB 3FQRB 4ZSOA 3ARFD 4KDTC 4C55A 3IAGC 3ZE1F 3MLXH 3REVB 1ZGLB 3BQUB 2WW8A 3VG9C 3KXFA 2QKIB 3QUYA 5GS0L 1U91B 3MV9E 5F9OL 5ALBL 4Y19D 5IHUH 3KHOA 4RA0C 5IW6B 4LVNC 1BD2A 3SKJH 4GBXB 3WLBB 2IJ0C 3SGKA 5D5MA 4XH2B 1XGQB 2IANB 4UBDC 3TT3L 4Y7MA 5I19H 4HUVA 1TIUA 4P2OC 3T08A 1UACH 1QEWB 5CKGA 4PJAE 4KZDH 2I5YL 2O5ZH 4OCRL 1J1XL 3HHRB 2BJML 1MFAH 1QPPA 4JFFA 2XQBH 1Y0LB 5HY9A 1RUQH 4N5EA 1G6RA 4S1SL 2Q7YA 3INUH 5EU6E 1FZMA 3QG7H 3E6HB 5EUKB 4YDJB 4NZDA 2X4OA 4EJ1C 2YPKB 1U8NB 4NJ9H 4QTHB 2WNGA 3ZE2E 2L4OA 3I3BA 5CGTA 5IB4A 1X5IA 5EIIA 4JO1L 4ONHA 5IIEB 3RJQB 4Z7UA 5MHSE 3RVVC 4XPGL 5L88H 3FFCD 3AAZB 3L3KA 2HFTA 1QYGH 4X4ME 5ICXA 1JTOA 4LF3A 4XXDA 3L3JA 1J5OH 1ND0A 2ESVD 1AH1A 4RCAA 3LKPB 3BPNB 2HJLB 4XHQA 2Q86A 4AEHH 3L1OL 4PJFE 1BIIA 2IAMB 5TGBA 4BJLA 1U8MA 1SEBA 4I5BB 5JTWA 1XF5B 1NGWA 3SDYL 3B9KD 2MFNA 1OP5K 4OIAA 2VABB 5C08B 1A21A 2ZSWA 4FFZH 4PJIA 1CFTA 4XP9L 2IFFL 1T0NB 1ZLUK 5C0JB 1NGQH 2GUOA 2H2PC 4GXVL 4TNWF 4LVEA 4MD4B 1LNUB 3SKOA 2VLKA 4HUWB 5FHAL 4DOHB 1G7JA 2DD8H 1J8HB 4MJIE 3CMGA 1YEFH 3S36H 2IQAA 3QDME 3DX9B 5F6IC 4Y2DD 3TPUA 1WIOA 3T4YB 3LV3A 4MJ2A 2ATPA 3ZE0F 3AM8A 3KLAB 1JZ8A 5DJXA 5DFTA 3H7BA 4U6TA 4QO1A 5EU6B 4KI5D 5KSVB 3T04D 4TNVF 4L3EB 2ZG3A 3O3BB 1RIVH 4UILL 4EI6B 4YDKL 1WCBA 3WXVL 2DQEL 4OCYL 3PWLA 3JWNC 1P7KA 4ZO6A 5GRUL 4IRZL 3SY0A 4I48A 5F8QC 2AJSL 2NYYC 4UQ2B 4BZYA 2K3TA 4Y4KC 3MYZA 1JBJA 2HAZA 3GBNL 4F9LA 1BPVA 3OR6B 1OARH 4DTGL 3AGVA 2IALA 5B3NA 4MSWB 1A4JA 1D6EA 3RPIA 4LSQL 3MLVL 3FO0H 4UNVA 2X70A 3FB8A 3SCMD 1I3VA 2FLBT 4Y16D 3ZE1E 1LK3H 1F4WH 4GQPH 2YPVL 4XCFL 4LLAA 2JLLA 4XTRC 2ORBL 4FZEH 4OFPA 1CVSC 2RHEA 4XNZB 3RWIA 1H3PL 3V4UH 4LPXA 4LARH 5FCUL 1IAKA 1BEYH 2Q3ZA 1U8LB 1WBYB 2XA8L 1HXYB 3PUCA 4AL8H 3VFMB 2DQHL 4P46A 5DUML 1TTFA 5GRVK 4PGBB 2MMXA 3WJLC 3IFPA 4X5WA 4GW1A 5TQ2H 2X1XR 4PB9L 3PQYD 3TBTA 2QJDA 3SBWC 4JM4H 4PLJD 3V5DB 2RFXB 4X8XA 4ZFOB 3QIUA 1CE6B 5TE4L 2BP3A 4AEFA 1HHKB 3D9AL 3GMOB 2XN9E 2ERJB 2N1KA 4LOUC 2FZ3B 4KVNH 3VFSB 5FEBA 2UUDK 1V05A 1CBVH 1NC2B 4HIIA 1CICA 1I1AB 5F7HA 5JNYA 3T0VA 4R90L 2XTJE 4UOW1 3MNVA 5SX5K 1KB5L 4KI5E 3ARRA 2QQLL 1IEBB 4LDLB 1Q94B 1HKLL 1BJMA 2A74B 4QHUA 2XPGB 4GMSH 4XB8A 2CKBL 1FC1A 2UWEF 2E6PA 1IZJA 1YJDL 3F7VB 3G6DH 1XZ0A 1IC5H 3WS3A 4G8GD 1IBGL 3TIDB 1LQVA 1JUFA 3G6JE 1SYVA 4IHOB 3QO0B 1GL4B 3RA7L 3EYOA 4DN4L 4L8CA 2JJWA 4HIXH 5HYSG 3TJHC 1SJEB 1NCBL 4WDIA 2JCCA 2CIIA 4FQXD 5DUPH 1YJDC 1YY8A 3LSOB 4P2RD 2L7JA 3F5WB 1HIMH 5B3JF 3IJYB 5GSVB 1P7QB 4JN2B 4R6UA 1D9KB 2NNAA 1YECH 3MXWL 2BSTA 4M43H 3QI9B 4XNYL 1IGJA 2XZAL 4CMMA 3V52L 4I3RL 3OV6A 2IPTH 4KJWD 4N0UA 1TZHA 5KW9H 1P7KB 4XBGA 2IAMD 5CEYB 3WXWH 3K2UL 5IQ9A 1BQLH 4KHTH 4P0DA 3TCLB 1G7MA 2RAMA 3RUGE 4R97B 3IETA 4AH2A 5DZLA 2XY2A 1ZLSH 3RNKA 3BD4A 3UTOA 4P2QE 1AD0A 5SWZB 4XCNB 4LL9A 4N8CL 1CVRA 3WDIA 1FDLL 3QFDA 3STZA 3X17A 5C0GB 2D7NA 3CX5J 4RIRA 4MNQB 3CSPA 4ELME 1KJ2B 2PNDA 5DT1L 4L8DA 1WBXA 4MS8C 1M7XA 1YYMH 1FFNB 1SJHA 1OLZA 4RMRA 1I3RB 2C7UB 5DD6A 2PCPA 2AJYL 3WNKA 4IOFC 4PJHB 4L4TA 4BFIA 4N0UE 4R7NA 2F54E 4X6BB 1OSPL 1CXIA 5HHVL 4N9OB 5GHWH 5E5UB 4WO4B 3RWEA 5TJWK 5DD3L 2EXYC 3MRCA 3S96B 1Q9WB 4LAQH 5CIPB 3GSXA 1TETH 1E6OH 3A67H 5GZOC 1QPXA 4P23D 4OGYH 2YC1A 1BBJA 4GMTH 3PP4L 3BXNA 4DVRH 1EUUA 5DLMH 5DRXA 1L0QA 5GGTL 5E5MB 5C6WH 3EO1A 32C2A 1ADQA 2DDQL 4UV7H 4YFEA 1M1SA 4JZJB 1RUPH 4FXKA 5CSGA 2Y7QB 3RWCA 4YPGA 5DR5L 1H5BC 1NGXA 1I7ZB 2EO1A 4MAYB 1X5ZA 4HBCH 3DRQB 3IXTB 2R56H 2ENYA 4D9RE 1AXIB 2B2XH 4YHNB 1U8KA 1TQCC 1VA9A 4G6JH 4PTTB 5KVDL 3OKKA 4DZ8A 1T21A 3ARFA 5J89A 3WUWG 1BM3L 4LSVH 4AMKH 5EBMA 4I0PD 2A6IB 2VZTA 4UIKH 4ZFGL 3VH8A 1CGWA 3KYAA 1S7QB 3HC4H 1NDGB 4MA3A 4QRPD 4NUJB 4NZTL 5DJDB 1B4JH 5IJVB 5HDOA 2A83A 5AYUH 2C1OB 4HC1A 4H5SB 5BRZD 1FIGL 1K5NA 2X9XA 3OXRA 4P9ML 2PO6A 1ROWA 4TOYL 4OB5L 3MUGA 4HS3B 1TJGH 2XY1A 5HYSA 3F62A 2OI9A 3MA7A 1QBLH 3GZKA 4OTXH 3RVWC 1NSNH 4LCCA 4JRYA 2XWBA 4M5ZH 1MLCB 3QIWD 1FE8H 4MX7B 3MV8B 2E9IA 2NNAB 1QHPA 4PRIB 4ZNCD 4RMQA 4NYLB 3ARSA 3GKWH 4NZUL 2R1WA 1DVFA 3KPSE 1U3HA 2KKQA 3LS5H 1GCFA 1YC7A 5IHZA 5K9JL 3N1PC 1RV6X 2R56L 4NM8H 2DQDL 5IV2B 4HF5H 4G59A 4YE4L 3GSWB 3MRQB 1FNHA 3MNZB 5K9QG 1UH4A 4UU9B 5E7FA 3STLA 4Z76A 1T89C 1RU9L 1LEGB 1A14L 1VFBA 2IGFL 3MRBB 2A6KB 1OTSC 5JZ7C 4U49A 4OF6A 4WY7H 1PKQA 1S5IL 5I30L 3LAFA 5DFVD 4MXWL 5HHPA 4X6CB 4ODUB 3MO1A 4UT9L 3DMMA 5FUCE 4OD3L 5IG7B 5EBWB 4C4KT 4DVRL 2VLRB 3BKML 4NBXB 2Q76B 2XIDA 3RKDD 3ULUD 1NC4A 4JY4B 5JW4R 4Q0XL 3QUXC 3HI6L 4K94H 4GRWB 3QDJE 1CFVL 1N7ML 3VWKD 1FNGB 5F7MC 1FNSL 1YPZB 3H3PL 4D9RD 5JXAH 3PWVA 1I8KB 4H25A 3JV4A 3I6GB 1HDMA 1X6LA 1MFBH 3D87B 3UMTA 3I50H 5FFLA 3T0DA 4WTZG 1JRHH 2JJSA 3FO1A 3V4PL 3JWOL 4N0CC 4CVUA 2PYEB 3CUPB 3FTGA 4K2UH 3QDMA 2F58L 4HJGB 3T65B 4F15B 4XP1L 4E41D 2ITDA 3IFNH 3DVNB 4QRPE 4MJIA 1YEKL 2IADB 3BMWA 3HRPA 3W9DB 1X5KA 3BEWA 5IM7A 5D2LE 2VLKE 3TESA 1FVCB 4PG9B 3ARXA 4RAUA 4YFLI 1R5IB 5FYJL 3ARDC 4QXUL 4HMDA 1CTNA 5ADOH 4FFWD 5JPNA 4ODWB 3PGDA 2FNBA 5GJTH 5BXFA 5LWYH 1RI8A 3VWKA 1UVQA 4HGWB 2O61A 3FQRA 3HMXL 2J8OA 4F7MB 2WMPA 2OL3A 5B4MC 2JIXD 5HTSA 3CSGA 1HIML 5FECA 1RULH 3M8OH 5CBAB 3LDBC 3SKMA 3BW9B 4KY1L 1FC2D 1BVZA 4PGJA 4K9EL 1HHHB 1E4KA 1XR9B 1NFIA 4LCWB 5DRWA 5C07A 5CWSB 1WWBX 1HCFX 5T3ZH 1DDHB 3T0XA 4ODTH 3BFOA 3TO2A 1XIWD 2PO6B 3I9GL 4DFIA 2CR3A 2Y25A 4D0BA 1YJDH 2OI9B 5HYSB 4UDUB 2BVPA 4H26B 3EYQC 1BBDH 5EU6A 5MEOB 1A6VL 2QQLH 4KWUA 5DF0A 1F02I 3G6AB 5I1IH 3EDJA 4QXGH 1NBVH 1PG7H 3OAYH 4JFFE 4O02H 2A9ML 1N6UA 2P45B 2ZZUT 1MIML 3H42H 5I1HL 1YPZF 3NBNA 2Y6SD 4PJAA 1KOAA 3ULUF 5IV2A 1GSMA 2W1NA 1CBVL 3QEGH 3RVTC 1AGFB 3UBXI 3DGCR 4NNXB 1J86A 2MKWA 4OCNC 5IIEA 4JPKL 5J13B 3DETD 2YD1A 5D1ZA 1S7XA 1P84J 4KRPD 2VQ1A 2UZYB 3BH9B 1F11B 1IRAY 2LTQB 5FM5M 4OZGE 4KK6C 1I4FA 2AK1L 3LKPA 2VAAA 3MV9A 4HULB 3KXFE 4X5XB 4OLEA 3ULSA 3X13A 4KDWA 4NCC1 1RJYA 1H8NA 2HYMA 1TZGL 1UKTA 2O5XL 2ADGA 1Z9OA 3S97C 1SEBB 3B2VL 1NUGA 1ZHLA 4RFNC 5JUEH 1NUDA 1S7UB 5JORA 4GG6A 1IAKB 4ZFFB 1FL5A 1YPZA 3ARTA 4JPVL 5C2BH 3NPSB 4NQXA 2DTML 1FJ1A 2EC8A 3KVQA 4KRLB 3MRRB 5C0EB 4KVCH 2I9TB 4UIMA 1INDL 1OF2A 2WP3T 2IF7A 2ZUUA 2CO6B 4JPVH 2IQAB 4Z8FH 4GW5A 2VLRD 5BCAA 1J8KA 5JOFB 3RTQA 2IADA 3W9DA 3RI5F 2DM3A 3S37X 2O5XH 1MHHA 4JFZL 5HGDB 3BZEA 3MJ6A 2NY0C 2X10A 3NN8A 5EUOF 1DJSA 4WCYL 5TDOA 3MRJB 1CLZH 2R9HC 3BZ4A 3B2UC 4NO3B 4PRBB 3MV7B 2H32H 2WV3A 5C08E 2B4CH 5ADPL 1JGVH 2HN7A 2APTA 2DQEH 4OCYH 4LCUB 4DZBA 4HKZB 2FD6L 3QNZB 2YZ1A 4U1GC 2CUIA 4Y5XB 2XNAA 1NFKA 3QEGL 3MRLB 3X3FH 4OF5A 2MHAA 3OR6A 5IW1B 3QNXA 1RIUH 4NQDD 2VNCA 1E4XH 4JQVC 4V2CB 1VGKA 1A6VH 3S36L 4DQOH 4OKVB 4JDZB 4PJGA 4JFDE 4EDXA 4UTBH 3H9SE 4Y5YC 5EOTB 3CZFB 3TA3B 3VWKC 3RZCA 2I25N 5DO2D 1JNHA 2AK4A 3FFDA 3ULVC 4TTDC 4HUXA 2X7LA 2C4FU 5T3XL 4IOIA 3BKJH 4YAQB 3VFPB 3LKNB 1DQDH 4Y5YB 1SY6A 1WBYA 3S5LA 1FFRA 3BKJL 1FCCA 1GAFH 4G8FB 4UT6L 5CEYA 1ZLVH 5SWSB 3NFNA 1KIRB 5DMJB 2NXYD 1N64H 3LIZL 5E4EC 3FT4A 1EVTC 3QISA 1QRNB 4OV6F 5EO0A 1NCDH 3VH8G 3HG1B 2GYSA 3I3DA 5E08L 1S9KC 2PW1B 3ORJA 4HWZB 2E7CA 4FP8L 1GIGL 4RIRB 1MCPH 3QWRA 1PYWA 1AQDA 5FO7A 3DX7B 4XMLH 2FZ3A 5E99H 5BZDB 5DVOA 5GS2D 2C7UA 5AZ2L 1LDSA 3IDJB 3SJVB 1LP9F 1BAFH 3QIWC 5IB3A 3QG7L 2A9NL 4GKNB 1AP2A 2D7OA 4HJ0D 1QRKA 3LEXA 3BIKA 4EI5D 3QZWG 1GC1L 4TSCH 5C08D 4U1IB 5C0FA 2ZKHH 1VFOA 3ES6B 2O5ZL 2Y07L 4HLZG 1J10A 4Z7VB 2J12B 2YC1B 3ALXA 4Z9KB 5KSUA 1A6AB 1C12B 4HS6B 2F15A 3W9EB 3LMJH 4S0TD 5D93C 5DRXB 3U82B 2QLVB 3MTRA 3DBXA 4B0MM 43CAB 2R69L 1YZZA 3GRWA 3NPSC 4MMZC 3HI6H 2C4XA 1CDCA 3ZT7A 2JJUA 2FLRT 5GS3A 1HZHL 2R69H 5CAYB 1JZ3A 3K8KA 4HX1B 3K4DA 3DX6B 4TUOB 2J5LC 2UVEA 4R0LB 1PSKH 4HXBL 5B21A 5DRNA 2YD6A 3CXHJ 2QHRL 2EH8L 3BKCL 3QPXH 4WW2B 3CH1A 1N0XH 5JZ7D 1HQRA 5DDHA 1S5IH 2AABH 4TSCL 3OAYK 1NL0H 4L4VB 3MROA 4IMLB 4HBQA 2AXFA 4V1DB 1EAPB 3WNMA 2A9NH 3QXUA 3S4SA 2IAND 3T3PF 5E8EA 4MQSB 5C0AE 4C54A 1ZANH 1A6WH 3NABL 1QD0A 4KTYA 3JTSB 2Q8AH 4RGNB 3ROOB 3IJSB 3WL9A 5JR1H 1FP5A 2LFGA 4O00A 3VGDA 1TVHB 4WEBL 4N0YH 1BVKA 1QBLL 5IESL 5HGGS 3O3AB 5JOPE 1UH3A 4OB5H 2FO1A 4YO0B 1I1AC 1QOKA 2P8PA 4YHMH 1KLUA 3WN5B 1IM9B 4PRIA 2Y5TA 3U9PL 5IJKA 4NRZA 4N9GB 2PO6C 1CZ8H 1HH9A 1HSBA 4PUBH 3RNQA 1JMXA 3LD8B 5ESQA 4HQQH 5SWSA 4PGCA 1BVLB 2CSPA 4G9DB 1T0PB 2EH7L 1DEEA 5E1AB 4JFDA 5CSBA 4YHOL 5D6CB 1FFOB 1BM3H 2B5IC 2BSED 4U1KB 3O4OC 4ODTL 4CN1A 2P24A 4Y19A 2GTWB 2WIMA 4M7LL 3PL6A 2JB5H 2F5BH 3MUZ1 4RMTA 4NFDA 3GNML 4GG6F 5IFJA 2IQ9H 3O2VH 1XCQA 4PJ8C 5LGHL 4WUUB 3S3SA 3ERYA 4O2EA 2YR3A 3HZYB 3M8OL 3EJZD 4QRRD 5F1IB 3U7WH 4QT5B 1FG2B 3EOTL 1TJHL 2F9BT 3ARBB 3ZTJG 4P4RB 1MREL 5C08A 3O9WD 3OKYA 2HKFL 3ARDA 1CLYL 2DJ4A 4JCLA 2FD6H 5TQ0L 3F7PC 4F15C 1U3HD 1VFAA 2OR9L 3MREB 4S0UC 5L7XH 1BF2A 3TZVB 2EYTA 1EFXB 2CR6A 5C07D 1A6UH 1A7PL 1EH9A 3L7FA 4U1JB 5HPMB 1AE6L 3RBSA 4IMKA 1G9ML 4FMKA 3TPKA 4LFHD 3C08L 3GMPB 5AUMB 4MQXD 1T3FA 4MWFB 3VD9A 5KVFL 2F58H 3JTCA 4FTVA 1NANH 4JPWH 2OLDA 1CD1A 1RZKH 3VXTA 1DBJH 5J1AA 4MS8D 2R0ZL 4GG8B 1MRFL 1K4CA 1DBJL 4YHYB 1CXEA 1YMMB 5DRNB 3VCLA 3MFFA 4KFZC 4GG6E 4I18A 3RJDA 4YWGH 2HTLC 2WQRA 5HGHA 1A1NB 3TBVA 4EQ2A 2KPNA 5ALCH 4KAQL 3CFBA 2QQQA 4HIEA 5D7IB 5F6IB 2ZUVA 5C6TL 3O4LB 3SKMB 3DI2B 3IDUA 4KJWC <