1UXSA

Crystal structure of hla-b*2705 complexed with the latent membrane protein 2 peptide (lmp2)of epstein-barr virus
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
276
Chain Sequence
b'GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN B-27 ALPHA CHAIN
publication title Allele-Dependent Similarity between Viral and Self-Peptide Presentation by Hla-B27 Subtypes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/peptide
total genus 77
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2004-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uxsA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1uxsA01
5KVEL 1U93A 1HHIA 1N7ML 4GT7A 4CDHA 5LBSL 3L3JA 4I4WA 2E8YA 4LIQE 1QSVA 4G42B 5FKAB 2NTFB 1JYWA 5CJQL 4K55A 4V3EB 1U95A 2X4QA 2A83B 3TVMC 3AU1A 2XN9D 1MRDL 3GIZH 5HHNA 5C6TH 5ESVA 5GS0C 5D2LE 2J6EL 1ZHLA 2W9DL 1QFUH 2WNGA 4IRJC 4NT6B 2QSTA 4FNLH 5CD3B 3D87B 1HHJB 2V5SA 2WSKA 2CDEB 4E41B 3D85D 4UIMB 3DXAD 4OZ4B 1WGOA 4XMLH 4ODSL 4MJIA 2B39A 3U83A 3QI9A 3V7MA 1RHHB 2AAVA 5GJSH 3U0TA 2VXTL 3AVEA 4YHOL 2X4NB 5C09E 5JA8B 2X1XR 1W0WB 2B1HH 3IDNA 3EOAB 4MMZC 5E1AA 4L4TA 4WCYH 1N0XL 3GMPB 4M1CC 5E5MB 1KUMA 2E3VA 4XXDA 5FF6B 1YDPB 4JPWL 4PY8J 1BQLL 3REWB 3BZDA 3O0RH 3WHXB 4EVNB 4FTVE 1JVKA 3X12A 4NRXA 4HQQH 3CX5K 4LAJH 4AG4H 2Q1EA 1CQKA 4G7YH 5CLTA 3DMMC 2Q6WB 5DJ6B 1P4BL 2H2PD 1AFVL 2YK1L 2EDYA 1XCQB 4BUGA 4QCIB 1NBYB 3UC0H 4GQ9H 3MLWH 2YKLL 1V8HA 1MHPL 4DGIH 2K3TA 5T3ZL 2GAZB 1QFPA 5HVHC 3FQTA 4Y7MA 2DQUL 4Z8FL 5EO9B 5C0CB 5AZ2L 4JFPA 3CK0H 5BQ7B 4P9HL 1NKOA 1A6PA 3EYSH 4HJJH 3C8DA 1EVUA 1T1WA 1K3ZA 3DTXB 3QEQD 1S9KC 3WIHA 1H15B 2AV7B 2X9YA 5CGMA 4NGHH 4K3DL 5FHAL 4DJMA 2C4XA 4RGND 3ULVD 3WDJA 4I8DA 5E6YA 3VXSD 3ROLB 5IHLB 3LPGA 3SHSA 3VFWB 3QCTL 2GTWA 3IJHB 1A6TA 5GHWL 1EO5A 1OGTA 2JB6A 3IKCB 4D9LH 1ETZB 1IAKA 4EXPX 1GAFL 2EDEA 2ZWLT 4WHYH 1IEHA 3O4LB 5DRNB 4YC2C 3BRFA 3TIEA 4A2MA 4I18B 1A4JB 4XPFH 5KANI 4F37K 1XGUA 4NQXA 2G9HA 4Y5YA 4RWYH 3LSOB 4AMKL 2H8PB 1WV7T 2VZOA 3C08L 4HUVA 5T3ZE 2FD6H 3T77A 1KC5L 4PJEA 2EDTA 5J1AB 3LN4B 4LPWA 3RVXC 1FSKC 1AXSA 1KPUB 3GI9L 2D0HA 3NVQA 2HN7A 1JGDB 3GSNA 1Z5LA 2D7TL 4ALAH 5IHUH 2BXZA 4ZUWB 4FQCL 5C9KA 1L0QA 2F15A 3EDJA 5B8CC 2BRRL 4QXUL 3D3VA 3I6KB 1AXIB 4P46A 2X09A 3OR6A 1JNLH 3HNTH 3TEUA 2JJSA 5F9OH 3KJ4B 5HVGB 1A6VH 3V6OE 3MV9E 2VL5B 1S5IH 5FHBL 2HFFA 4G6KL 4KDTC 5DS8B 4DUWA 4GS7B 3TZVB 4F2MA 2DIAA 2JJTC 3BH9A 2B1AL 1IGCL 3QIWD 1UXWA 2DQEH 4MNQA 2E7MA 2VIRB 2HVKA 3MGOB 3TT1H 4ZG1A 5EULV 3PXHA 2X1OA 2W65B 4URTB 2CKBH 2VDNL 4OFPA 1O7SA 3AUVA 4WHCA 1R5WA 3HE6A 4Q9CA 5DSCB 1SJEB 2NX5A 5E03A 3ARBC 3NCJH 5GGVL 5JLZB 1HE7A 1LE9A 4P5TC 2QBWA 1XR8B 5L9DL 1CR9L 1U8NA 1TZGL 1TTFA 3JWOC 3D18B 3CMGA 4HIIB 4Y2DA 3P0VL 5GQBA 5J56B 1Z3GL 4JFEE 5BRZD 3GMNA 3RWCA 5DUMH 1VENA 3KPSA 4KTEL 4LLDB 3ZHDA 4YPGA 1OAZH 4HFWA 1QFOA 3MRMA 4HULB 5JIPA 5DD1L 1ZLVK 3W81A 3MUHL 3WD5L 4IMKC 1AC6A 4ZYKB 3RWDB 1NUDA 5I17A 1G6RB 1MCPH 4RAUA 3TPKA 3VXMB 1EK3A 3VDCA 1ORQB 1D9KB 4X6EB 4G6ML 3QO1B 3WNNA 3ARGA 2NR6D 3MLVH 4HFUH 2BVQA 4J3SA 4L29B 2ARWA 1GRWA 4I0KA 3U36A 4H0GA 1PYWA 5IJKC 5D1ZB 1NQBA 3QUML 1HSAA 1JRHI 4O2FA 3V0WH 4MDIB 1Q94B 5L0QB 3MRJA 1RIUL 3R0NA 1FZJA 4PD4J 4ZTOH 1WITA 3NFSL 1WZLA 4LSSH 1TQBC 3MUGA 2JJTA 5HHPA 4PREA 1N6VA 4RISH 3RPIA 4YDLC 3T0AA 1T7XA 4V3DB 3FN9A 5I15L 4QT5B 4OCMC 5DK2A 5JMOC 2CIIA 4BUHA 3CDYA 3OXRB 5FA3A 5TDOA 4D8PB 1J10A 4MNHA 3PGCB 1ZGLA 3ARBA 5MEND 2OS7A 3WXVH 4H1LG 1T5WA 3ZLQC 1A7PL 1HINH 5EOQH 4OFYA 5GZOC 4P5TA 3RFZC 4I5BB 3IU3A 4YHLH 5FFLA 3O9WD 1FLRL 2HTLC 3EOBB 5INCB 1ES0B 3SDXA 3ORJA 4P23B 1J05A 3T8XB 4P2QB 1DBKH 5DVMA 5ECJE 1D7FA 5J13B 2EH8H 5LQBH 2DQIL 1U3JA 2AQ2A 4IMKA 4K94C 4X4YA 3O2VH 4NZUH 4JFOA 3HG1E 4PS4L 2UZIL 3RL1A 4F7TA 1DE4B 1T66D 5DJXB 1MNUL 3S96A 4XBGB 3ES6A 5EU6A 1INEH 3CUPB 1QRNB 3LN9A 2XPGA 1G9ML 2P49B 3Q5YA 4F33A 4OZFH 1HI6A 3S97C 1PD6A 1T2QL 5DMGC 3D69A 4BH8A 3TYGH 1FPTL 4L3CB 1J8HE 5KSVA 3RY6C 2DLTA 3RAJL 1NDMB 4HEME 1OSPH 3MCLL 1F2QA 3RUGF 3DRQA 1AHWA 3INUH 3MACH 1WT5C 3O3EA 1I3GL 1KCSL 5MEPB 1YMMD 5JXAL 2DM7A 1N4XL 2AJSL 4I9WE 1S7XA 1FDLH 1U9KA 4HGKC 4LEXL 4IDJL 1MFEL 1OAXL 3FB8B 1A3LL 4PY7A 1DQTA 1ZANL 2UYLB 3CMOH 4LOUD 4NQTA 5DMJB 4PJ8B 4PGDB 3EJYD 2M1KA 3FRPA 12E8H 4HDIA 1LVEA 2E27H 3LMJL 4ZUTA 4DN4H 3QUZA 1BEYL 2DJSA 2F53B 5F88A 4PRPB 3DX6A 2OR9L 2HLFD 4U6HB 4YDJA 5D7JC 2G2RA 3VFNA 4LPUA 3ZE2E 3ULUD 1GH7A 2Y6SC 4E5XB 1JNHB 1KT2A 3BIKA 3MBEB 5I74C 5JW4R 3VD5A 5T1DH 5TJWK 4HKJA 1K8DB 5HHOD 3THMH 2DDQH 1P7QB 1IKFH 3AREA 3MOQA 3WS6C 3BYTA 2O61A 4UU9B 1RJLA 2NTSP 4G9FA 4KVNH 5IWLC 3NFNB 1FN4A 3M17A 1KGCD 1FL6B 1S9VB 3HI5H 2AEQL 4POZC 5J6HA 1XF5B 1JK8A 4HZAA 1YPZF 2VE6B 1A7QL 4WI3A 3BIAX 4PJIB 3VMOA 1SYVB 4NP4H 4WFGD 1OTTC 4ZDHB 4ZSOA 2Z31C 3MR9A 2L0DA 2EDBA 2UY6A 3IDYC 4XVJL 1HILB 3OKLA 2E6QA 5ID0B 2R0KH 3LHPH 4JKKA 4ZFOL 3MOBL 1AO7E 2Q7YA 5DEZA 4W4NA 4DFIA 5ISZA 1K8IB 2BVTA 5HYJA 3QXDA 1M7DA 3QXAB 4M6OH 4MAYC 4N9GB 1YNLL 5GGRA 4QEGA 4YHNA 5JHLH 5I1AB 5E6ID 4YHML 1FFNB 3HNVH 1OAYH 3O6MH 1A5FH 3IS0X 3IXTB 1G9NC 1FVCA 3OF6D 3P77B 4Z95L 5BVJB 1E4XI 4YDVB 1WCBB 4CU8A 3WUWB 3V2AR 3VI4F 1I8MA 4XCYB 3I6LD 3O2DA 1U3YA 3ARXA 5LGJB 1IKNA 2R0LH 2XTLA 5K9KB 3B2UC 2EC9T 2R2BA 5CHNA 1HYRC 5IBLD 1DFBL 1YEEL 2ZUQB 4N0YH 5HYIA 3RWIB 4XPBH 2PYFB 4LSVL 5F7MC 3U46A 4JG1L 3VWKD 1F6LL 2DYPB 1ZS8A 4OLXL 5BZWA 4TUJB 3U1SL 3UAJC 1N64H 5ILTL 4KTDH 1NFIB 3GSQA 1X5HA 4GRLC 5TE6H 3W9DA 4HKXA 1DLFL 3OKDB 2LFGA 3QDGE 2OZ4A 4DCQA 5I6XC 3IAQA 2VC2H 1EZVX 4JFYA 4YHKL 5GRJH 3ZO0A 1U8MA 3BD4A 2A0LD 3MV8B 5I2IB 3O41A 1EEUA 3IAPA 4DKAA 4IDLA 4APQA 4XB7A 3LKRB 1B88A 4LIQH 4CRPA 1HXMB 5FO9A 1A9BA 4GKZA 4Z76B 1S7SA 4O51A 2C4FT 4Z7NE 4JN2B 1KIRB 1R0AL 1CE1L 3O6LH 3MRGA 2Y9RT 1KYOK 3AB0B 4XBEL 4UUJA 5J8OA 4C83A 4WNQB 5IFJB 5DQDH 1QNZH 3ZT5A 4IS6B 4LKXA 4V2CB 5GRXG 1A6WL 3MJ7A 3IDXH 5TH2B 4JPVH 2AK4E 2YSSA 4B41A 4MXWH 1LO4H 1JTPA 5SWQA 1AGFA 4ODUA 3O3AA 1JPGA 4Z5RB 3HI6L 1U91A 3EYVA 3DO7A 3PXJA 3QFJA 1DVFD 4WUKL 4YK4C 1BVZA 2WWMC 3E8UH 4OGYH 4MNGE 1NCAH 5C2UB 1ZVSA 2OJZL 1FCCA 2D7PA 4LLQB 2FGZA 5GRVK 4N1HB 1LEKA 1FZOA 2FJFA 4JFHD 4U1SA 3ZYOA 3DO3A 5KVEH 3MJGX 4BZ1L 2OM5A 2XQBH 3JXAA 1N7MH 2YS4A 5H35B 5GGUB 5IB2A 5DMYA 2DM4A 5L2KB 2V5TA 5SWZD 4XNQB 4YWGL 2VDML 1RHFA 3PP3K 2D31A 2NXYD 4OQTA 4RZCA 1B0GB 5HJ3B 4ERSL 4R0LC 1X3DA 3ZKXC 4KJYA 1I1YA 4WV1A 1MRDH 4I2XA 4MD5A 4AQ1B 4GKSB 2G60L 4P2OD 2IMMA 1OP9A 2J6EH 3P2TA 3TJHA 2HT2C 1UACL 4ZPVB 4RMUA 4FQXD 2XQYK 4WO4D 4P5MB 3I50H 1MH5A 2X7LB 3OHXA 4NSKA 3RJQB 1MFNA 4C57C 3BVNA 3CZFB 1Q9KB 3IFPB 3X3FL 4PRBA 1WZKA 1YMHB 4ODSH 3WYRA 4TSAL 4NQCD 1R3HB 4M1GL 1ZSDB 5C08D 1OTUD 3ULSA 4YHOH 3F7VA 4N0FB 4XPAL 4YBLC 3HR6A 5ICYB 3PWPB 5HI5C 3L6FB 4POYA 4JPWH 1I1RA 5C0DB 1BQLH 1MCBA 4U1MA 4Y2OA 1DQML 4E41E 4PJFB 5E24E 1E6JH 4M9OA 2AGJL 1UEMA 1P4BH 2D7OA 4UQ2B 1IRAY 4X4ME 1W2KT 1AFVH 1RZJC 3ETBF 2CR6A 5JOPE 3G5VA 5HPMA 4ONHB 2YKLH 4OF7A 5HGHA 4PLKC 1MHPH 1OLLA 1A6AA 4M61A 4N9OB 5AG9A 2ZKHL 2EDWA 3PQYB 5AZ2H 1UQSB 2DIJA 3SDCB 5JW4N 4P9HH 3C6LC 5CBEA 4XRCA 4UI2A 32C2A 3BPLC 5HD8C 1FV1B 3TCXA 5D5MF 2HJKB 3OX8A 5FCSH 2D7QA 2AXHA 2DBJA 3C5ZB 5I8CB 4I0PD 1LEIB 4K3DH 4ZUVB 4RGOL 3ZYJA 2Z4QB 2X42A 1MFAL 5F44A 4PJ7A 4PJIF 5C0FA 4PRIB 2BNRD 3QCTH 1VSCA 4NM8H 4FQIL 5GHWH 3LEXB 4YDKL 4HBQA 1KBGH 2YPLD 4OLWL 5C0CE 1YJDH 4BSWA 2VLKE 2ZNXA 5DHVB 5C07A 1GAFH 2FHBA 1ERNA 1NC4D 1A6ZB 4ZNCD 1F58L 1CLYL 1DANT 1BFVL 4O9HH 3IXAA 1OT2A 2D9CA 3FT4B 4LHUB 4AMKH 1HQ4B 1AJ7L 4M1DH 1INQB 1FO0A 3C08H 1DQQB 3MYZA 2OI9B 5ANMB 5IGXL 1GGCL 1KC5H 4XNXH 5FYKD 5J6GB 3P4NA 1EH9A 4RMTA 2C1PA 4OM1L 4NWUH 2IQAB 5DEFA 5I9QC 2HLAA 2D7TH 2MPAL 5ESAA 5JIKA 3RNQA 3QEHB 3O4LE 4BFIA 2E9IA 1H3UA 1T6WA 1LHZA 1G7JA 3QQ3A 5KS9E 4QXUH 4WHYG 1NEZB 1B4RA 2Z8WC 4CMHC 5MI0C 2VQ1B 3STZB 3I9GL 3L3KA 3PWLA 5EOTB 3TCLA 3JTCA 3O6FC 4R97B 3RWHA 1KELH 2R2EB 5DD0L 5FHBH 4EUPB 3L5WB 4G6KH 3QQNA 4LVEA 2H2SC 4HJGB 3MODH 4P5KB 1M1SA 1EO7A 5ALCH 1QLEL 3QCUH 4G8IA 1IGCH 1TPXC 3DPBA 2Z93B 1CL7L 2YC1B 1QYGH 2OTUB 4X80L 2VWEE 1T1XB 2YBRA 4YQXL 4F80A 3WKMH 5H37H 1FG2A 1IM9B 1LGVA 1TENA 1F4XL 1X4XA 1F4WL 2VLLA 1BF8A 3QUXD 4LF3B 4OCXL 3C8KA 4Q9BA 1G6RL 1CR9H 1PKQE 5L9DH 4ZS6D 2A9NH 4HMEA 4N5EA 3KLAA 1ED3A 4PV8A 5D7IA 5D1XB 2P45B 4H5SA 4M5YL 2XWBB 1WFOA 2H2PC 1Z3GH 1ZT4A 4Y19A 2Y5TA 3S5LB 4HHAA 4JZNA 3ZYZA 1I1AD 4K3GA 4KTEH 3H3PH 4NHCL 3EYQC 3KPMB 1J0JA 3CJJA 3OG6B 2OTWA 3LAFA 4Y4KC 5DD1H 2PXYB 3WD5H 4KUZL 1LNUB 3LRGA 4QRRE 4Y0GA 5DI8A 3TBTA 4WI4A 4GBXB 4J1UA 4PGJA 3VFGL 2VLRB 3O8XD 4QOKD 3Q0HA 1PGRB 4JFFD 1P84K 4NFBA 5HDQL 3S7GA 4OV5A 1IL1B 3I6GB 4H1LA 2P5WB 2QSCL 4S2SA 5D2NC 3BDBA 4X6DA 3ULVC 4YNYA 2XN9A 2WANA 4PJAF 4PG2C 4CNIA 3U9UA 5B39A 3U7AA 1JWMA 3PDOA 2HWZL 2X89D 4ZD3L 1XH3A 3QDME 4NO2B 3ZTNL 1T3FB 4ELME 5ACZB 1U8QB 3VFUA 4LSRL 3VXME 3NFSH 1KCVL 3VH8A 3VRJA 2BOBB 2E7HA 5JXED 4AT6A 3MRLB 3D85A 5IMOB 3TH4T 5KVDH 3DXAA 4F7PB 3QEGL 1YNTB 2V2WB 1BJ8A 3QH3B 3A6CH 3GEWB 4OT1L 1A4KA 1NAKL 4ZUUA 4JZOA 3WN5C 2J5LB 1MAKA 3KWWB 3RVVC 5CSGA 3KNBA 1XGQA 3SJVB 4V1DB 5DJYA 5CEYB 5CCKH 5ICZA 2ZZUT 1D5IH 3BEVA 3PL6B 1IEBB 4OCWL 3WFEL 4RQQB 5L8KB 3SGKC 3BKML 5FCUH 4LRNL 4P48A 4RMRA 5I1LB 1RZGA 1A2YB 1NGQH 4PYHA 5E9DE 4QRPD 3BPNB 2EC9U 1FLRH 3F5WA 4JDTH 5F6HI 3ARQA 3E3QE 1A0QL 2YZ8A 3TV3L 2CRZA 4ODHL 5TQ0H 3H7BB 4OF6A 3T1WA 3MRCA 5EN2A 1DBBH 2A6KA 3TBSA 1E0OB 4NJAL 4GG8A 2IBZX 1N0LA 3RI5K 5EBLA 1K4DB 2VL4A 1X5KA 4I48B 1UJ3C 1Q0YL 4PJDB 2NY2D 3VFSB 1WUNT 2UZIH 4PJFF 1LDPL 4QO1A 3QEQA 1Q9LA 4P2QE 4R4BB 2RIKA 4YXLH 3LQAL 1J0YA 1S9YA 3L1OH 1U92A 3WUZA 2QKIB 5KBNC 1CK0L 3VXSA 1LK2B 3ARTA 4OLVL 3DUSB 4Y5XC 5DXWA 2RHEA 1G9MC 1K2DB 1T2QH 5D9SB 3GMLB 5FIEA 1J9CT 4FTVD 2CXGA 3V5KB 3E2HA 4U1KB 3EW3B 3RAJH 3HMXA 3BGAA 3VWJA 1HQRA 1WBZA 5KVGL 2E7CA 3IDJA 3VXRE 4O2CB 4LLMB 1I3GH 5LVEA 4BFBD 2BJML 5CJOL 5JXAH 5JNYB 1N4XH 8FABB 3GO1H 4HUWA 4QRSB 4LEXH 1AC0A 3OAYK 1MFEH 2DLGA 1EPFA 4LPTA 4NZRL 4IRZH 43C9A 2QHRL 5KG9A 4GRWB 4PR5A 5IF0A 2W9EL 3B6SB 3P9LA 4LVOC 4OGAC 3KYAA 2EDHA 2VKXA 3MRIA 4LVNC 3MFFB 4X0KB 1VDGA 4U4BA 4Z7OE 2FO4A 3KXFE 1XGRA 5CD5D 3JWDC 2EDFA 1C5DA 1Q9WA 3GIVB 4QHKJ 3FQWB 4ZXBC 3E6HB 3UTSB 3CXDL 3K81A 5HY9A 5D7KE 4XAWH 1UJ3A 5HGBA 2QL1A 5K9QG 5KW9L 3QIWA 3V79C 5I1GL 2F53E 5F1SA 4WDIB 1NAMA 4N8CH 3SBWC 3IDGA 4G80B 2VB5A 2AEQH 4WEBL 3AGVA 3DUUA 1A7QH 1NCWH 4CAGA 4Y4HB 1LO0L 3GB7B 1NGPL 2YWYA 1TETH 3OKKB 4XVJH 5H94B 4MZ3A 2WZPD 5E95B 3MOBH 3SDDC 3MZTA 1RUKL 1BWMA 2H41A 5IB3A 4L8BA 2FJGA 3ZDXF 3N85L 5C7XH 4A6YL 1JWSA 2XKNA 4R4FH 1E4KA 5BRZA 3BX7C 5FV1L 3WBDA 1YNLH 3GMRB 4M5ZL 4NJ9L 3DSFH 3PABB 1BQHG 1OAKH 1HXYA 2B0SL 3UO1L 3PWJB 5T1MB 3RGVB 5MERB 1QO3A 3GNML 1XIWC 4YHMH 1IEAA 2C26A 4G6FB 3H9ZA 1MCNA 4U7MA 1AGDB 1RURH 1CICD 2WMPA 4Z95H 3B83A 3NAAL 3JWNC 5I1JH 2ICWJ 3B9KD 4WGWB 3TPUB 3ARYA 5TF1L 1L0YA 5KVFH 2DJ4A 3L5HA 1JZ3A 1I8IB 1H8SA 3G5XB 4PGCA 1NGZA 4UNUA 5JDSB 4AH2B 1DFBH 3IU4L 1S7QA 1UM6H 4LSVH 1CU4L 3MNZA 3RWGB 4FQQA 4TRPL 3LKSA 3HLAB 4AZ8A 1YNKL 3U1SH 3NPSB 2IAMD 3C60A 3QNYA 4F7EA 2ZCHL 4MSWB 1DQLH 5FO8B 1QEWB 3C2AL 1I9IL 3I75A 5ILTH 1AIFA 2QQNL 2FZ3B 1CG9B 1M7IB 3BW9B 2VABA 3U30B 1DLFH 4JFDE 1AQDA 4LOUC 4M3JA 3GJFA 1GZQB 2B20A 5MENA 1BM3L 1DANU 1A1MA 3EJYC 3NA4A 4YHKH 4YHYB 3ZSSA 3PWUB 5I75B 4XPTL 1HK6A 4M7LT 5IW1B 4Z7WB 5IVZB 4NO3A 3O9WA 2XRAL 4FMKA 3GBML 4N0CC 2NYYD 1I8LC 4G59A 4ETQA 3ULUC 1CE1H 4XBEH 2Z8RA 2FEEI 2MOVA 4MJ6B 1W72H 2RCSL 1WFTA 4UOW1 4L8DA 4JY6A 1R3LB 5TGBA 1CD8A 1I7TA 1FC1A 4DGYL 1R5IB 3EJZC 3DX7A 2FHCA 1ZOXA 5JUEL 1UB6B 3HI6H 4ONGL 2IANB 4LSTL 2JCCA 4CMMA 4G8EA 1WAAF 4WUKH 2H32A 4U1GB 1WTGT 5I76A 3FJTA 3DX8A 1FIGL 1IAIH 4XPHL 3FN0L 1WCQA 1TTGA 2OJZH 2EDKA 4LCWE 4HGMA 1UB5B 3MX0A 4HK3J 3WE6A 4BZ1H 1KXQE 2BSRB 2X6MA 1DBML 2BNQB 4ZOEA 3VXTA 5T3XH 3QQ4A 2VDMH 4ODTH 1H8OA 2R1YA 2UY7A 4S1DC 4CN6A 1ACZA 3STLB 2IFFL 4ERSH 2Q8AL 2IPKA 3QWQB 5BOZG 1AQKL 3VXPA 1EMTH 2IADB 3OR7A 5E6IC 3T0DA 1JWUA 1KJMA 3TM6A 2G60H 4P59H 3BQUB 4YJZL 1C08A 3ZDZF 4HG4J 3VGAC 1UACH 3ILQC 3GMMA 2FIRT 2FIKB 2Y36L 3GSOB 2FO1A 4ORGB 1EXUB 4XX1E 3TA3D 3BEWB 1KJ2A 1E28A 3TN0B 1CFNB 1BBJA 5DQJB 5L2KE 2WP3T 2GK2A 1QR1B 4M6NL 2G5BA 4PJBE 4OSUH 3F6LA 4TSAH 4KRNA 4M1GH 5K9QI 2CLVA 1UM4L 1UC6A 3QFDB 1INDH 1YN7B 4XPAH 3QCVL 5DUPH 5HHOA 1IC5H 5EWIH 1ZLSH 4ZMAT 5EU4B 1GXEA 2WIIA 2ESVB 1B0WA 3RDTB 4LVHB 5BS0B 3IDIB 2ZOKA 2R29L 1DQMH 3WIFB 3N9GL 2A6IA 1LP9E 5T33L 4X7SH 5DVNA 4MAUL 2NY1C 4QRQB 4OJFH 4FFEX 4JQVA 1EO8L 1QLFB 4HV8A 3OGCA 1NKRA 2P47B 4OKVB 5A43C 2HKHL 4OAWA 1Y6NR 3U0WH 2A0LC 2ZKHH 3C5JA 4GAYA 1TQCC 2OSLA 3C8HA 1UGNA 2VXSH 3CH1A 1TVHA 2PTTB 3U4BL 3ROOA 3LVEA 5JQ6H 4Z7VF 1KFAL 1KSRA 3QJFA 4CVWA 3S4SB 1KIQB 1BVLB 1BZ9A 1E27B 4RGOH 4H25A 4KPHL 1MI5D 1N6UA 1X5GA 5E6IA 1MFAH 1T04B 4L8SB 1PSKH 4K3EL 4NYLB 1I85A 2ZCKL 4FQIH 1CDGA 1P1ZB 2AJ3B 2C3WA 4NRZA 2F74B 1S7VA 4CN1A 1T22A 4OLWH 3BUTA 3ZMRA 5DGQA 2K1MA 4LSUL 4KQ3L 4FQ1L 3RRQA 4TYUA 4C59B 4KI5D 3Q3GA 4TPRL 4R96A 2Z91B 1D6VH 1ZA3A 3MRRA 3VFOB 3GDBA 3HC0A 5SX5K 3AAZA 3UZVB 1RUQL 2GFBB 1D5XA 1AI1L 3WEXA 4XCEB 3BZEB 4PRIE 5IGXH 4KXZH 1GGCH 4JRYD 1QHOA 1WBXA 3FO1A 5DJ2B 1PLGL 4JHAH 3VWKA 3LS4L 1HKLH 4OM1H 3KJ4C 3GSXB 4QY8B 3MLUL 2MPAH 4G43B 4MLIA 4UBDD 3TZVC 1LQSR 1VKXA 2NXYC 5C0AB 2WWKO 5JW3H 2RQ8A 1HH6B 1RZFL 3FONA 3VXUB 5EPMA 4ODBD 3CU1A 3VFPB 1JGUL 3BMWA 1G7PB 3NIGF 4D2NA 3FKUS 4FQXC 4X6CB 3ZE0F 5DD0H 3VA6A 2F58L 1FJ1B 5D7SL 1XF4A 3LD8C 1X7QA 2DRUA 2CDGB 3QIBB 4FQPA 5HYSG 2VXQL 4JM4H 1IC7H 2CKBA 4TOYL 4JGJA 1N2RB 2CSPA 1X5XA 4X80H 3QIUB 4PJ7F 2XKUA 4C56B 4YFDB 5D8JL 1F4XH 1F4WH 1NFDA 5BO1L 4DUVA 3DVGB 1BX2A 4EI5C 3T0XA 4OCXH 1P9MA 2WLYA 1JE6A 3TP4A 1VGEL 4OIIL 2HTKD 3WJLA 1G6RH 4XGZB 4OUOA 3SGDH 5DRZA 4H8WC 4JVPA 4KMTL 4Z7WF 1ZA6A 2HFEA 4OV6F 3S37L 4M5YH 3HE7B 2VDOL 3P11L 4DZ8A 1DVFA 3O3DB 3D39E 4F9LC 5HGGS 5C0GB 2C1OB 2GJ6D 3MCKA 2NY6D 3ZE1F 4IRSC 4NHCH 2MTPA 4WWKD 4OCRL 3MRBA 3K2UL 3LKQA 4KUZH 2Q8BL 3HPJA 3RWFB 3NIDE 5DYOB 4GOSA 2OQJB 3ZYIA 4G8FA 2DLFL 3KLHD 4YR6B 2NY5H 4PJ9C 3VFGH 4F7CB 4NKQB 5J11C 1HCVA 3KPOA 4P2RD 1PVHA 4PYGA 1CFTA 4J6RL 5SWZA 4TUOB 5IVXB 1SJHB 4KROD 1KPRA 3F7QA 3AXLB 4K2UH 3WNKA 4HUUA 4P2OA 3WSQL 2NZ9C 3I85A 2HWZH 3DURA 1MJ7L 2AK4D 1FRGL 5HHME 1CD0A 4CU7A 1AE6L 4FQXA 3BP4A 5ITBL 2P5EB 4WO4A 4W68A 3X3GL 5EZLA 1ZLWK 4YFEA 3VW3H 4Y89A 4BH7B 1UFUA 3GGWB 4H26A 4RDQF 3VE0A 1DQJB 1J1OH 3PWVA 1RZ8A 4G8GB 4ZOCA 1LK3L 1RQ5A 3QEGH 4IBLT 3HZKA 5F3BA 1G7IB 1IBGL 4M8QA 1YEFL 2P5WE 4Y1AE 5SWSD 1NAKH 4NQCA 4X6BA 2ZOLB 4IOFD 5C08A 5TFSH 3WNOA 1UXSA 2C3HA 4D9RE 5IMLB 4JREB 4LEOB 1GGTA 4YHPA 2GSIA 3KYOB 3PHOA 2DS4A 4Z0BL 3EYFB 3WFEH 3AROA 2UWEB 1PQZB 4LRNH 5JPMA 3RIFK 3BWAB 4QTHB 4Y16C 1A0QH 1Y18B 1YECL 1CVSC 3L3GB 2DM3A 2X4UB 3TV3H 4Y4FC 2FWOB 4I4WB 5GGVY 3SJVE 4PP2B 4V1DE 1K4CA 3CSBA 1L6ZA 3ZT6A 3BP7B 5DJZA 1U8IB 1F6AA 4JRXE 3HMWL 1V3LA 4W4OA 3L3OA 1OGAB 4XNMA 2H26A 5HHNB 5J12C 3MLRL 4AYFA 4JY4A 2WY3A 3LY6A 1P4LB 1ZHLB 4ZO7A 3RZCB 3EIFA 1LDPH 1R3KA 2BVEA 2GITA 2R56L 4NQVA 5B3JE 1WFNA 2E8ZA 4YH6A 4I0PA 3LQAH 4HWZA 4Y88A 3D2UD 4PGZA 1T7ZA 1CK0H 3HRPA 4MCZA 4KK6D 2Z92B 3FT2B 4JGMA 2BNRA 3RX5A 3QUXC 1S8DB 1V05A 5DQ9A 1IFHL 1F45A 2HJFA 4YUEL 4OLUL 5T3XD 5FECA 5EORL 2VN4A 3GKWL 4PJDE 1NC4A 4M3KB 5DJ8B 5D1QB 1N8ZB 5DD3L 3JTTA 2LABA 2BJMH 2QJDA 1I1AC 4NQEE 2PKDA 2CQVA 2X4SA 3DETC 4TNWK 2NW2B 3ZDZE 1VFBB 3V4UH 3QULA 4IJ3C 2A2QT 3VGGA 1B3JA 4LQFH 3SKNA 1F3DJ 2VQUA 4F7MB 1TZIB 4JN1L 4HWEH 1A22B 1JUFB 3NCFB 3LB6D 5JIIA 3FQTB 4PJGB 3BDXA 1MCJA 4MD4B 3HPLB 2XTJD 3LEVH 1DR9A 5GZNC 5DRXA 3G5YA 3O3BB 2EDQA 2GJJA 3NFPA 5KJRL 4F58H 5C0BD 4CADA 3RIFF 4HUMB 2OL3L 4GW1A 1A47A 4X99A 2NY7L 2BSED 3FAXA 4GRWE 5C0EA 4UDUB 3KLSA 5C9JA 3HS0B 3AM8C 5DTFA 2DL2A 1BQHA 3RU8L 4HIHB 1FQ9C 1KEMH 4FFYH 4IRJB 1H5BA 4MX7A 1JTOA 1DTUA 2KH2B 4X6CF 3UTSE 5IV2B 4X5XB 3QUXA 1HHKB 1XGUB 2EDLA 2G9HB 3QXUA 1JGLH 4HZLA 4OUUA 2VXUL 1RZIA 3O4LD 1XCTB 1RUKH 1II4E 2AJUH 1FNGB 2YZ1A 4HUVB 4LNRB 3N85H 4PJEB 2PW2B 3EDEA 3EYOB 3DNKA 4Z0XB 1AXSB 4TSBL 2ZSVB 5IESL 1I1AA 4M5ZH 3QHZL 1GHFL 4PJCA 4WW2A 3Q2CA 3UO1H 3KYKH 3MRPB 3VD4A 3GNMH 4KV5F 2EZ0C 5F7EL 3DMMB 1KLFA 2DI7A 4LARL 3U0PB 2ZUQC 3VXNA 1UH3A 1PBYA 2NY2C 4K7FA 5T5FL 1A1OB 4EN3D 5IW6A 1KYOJ 3NAAH 2Q7NA 1IARB 1QSEB 3O8XA 1UG9A 1SMOA 4JFFA 2J7LA 2X4TA 2Y5EA 5TF1H 3EOYG 1PY4A 4TNWF 5HVHB 3W5MA 3K8KA 5CEXA 2A1WL 1FNSL 3GJEB 1J1XH 2NY4D 4FABL 4OZIE 1QSFE 3MXVH 5FYJL 1OSZB 4GAJL 5DA4A 3UJIH 4OD2B 2NW3A 5HI4C 3A6OA 1RI8A 4TRPH 3GJFK 5D7LB 3BMVA 1QG3A 4MDJA 1YNKH 2AXFA 2X41A 4OGZA 3OXSA 5KSAD 5JXEA 1X5IA 1DN0A 2ZCHH 2DWDA 3AM8A 4QRTA 4TQEL 5TE4H 3TPUE 3C2AH 5FYLD 1UYWL 3MRKB 1Z6JT 2QQNH 4N90D 3IRZA 5IMMA 1JNNH 5DMIH 5EFIA 4P99A 4K07A 4ZQKA 5A16B 1KEGH 3FQRA 1U8PA 2HAZA 2JJVA 4Q0XL 2V7HB 4YC2B 2FECL 3HR5B 3J8F7 1R3JA 3RWCB 3MRFA 3NA9L 5E8OA 4WFEE 4XPTH 1U0QA 1ZHNB 2SEBB 4QRPA 3MREB 1UVQA 2IH3A 3MRMB 2PYED 5IBTL 1EBAA 3GBMH 4EDXA 4N1CA 5D2LA 5I17B 5B3NA 4RAUB 5CD5C 1FSKB 4U1LB 3KYNB 1GGUA 2M8XA 3MLYL 2YPKA 2WBKA 2RCSH 3VGHA 5FYJE 3ARGB 2VO5A 1L0XA 4XCCL 4LK4A 1AGBA 3QXWA 3BSZH 1QD0A 1D9KD 4QHMB 3UTZA 5B8CB 4MVBD 4DGYH 1PYWB 2R0ZL 3U82B 1Q72L 2W38A 3ARUA 3L9RA 3QPQD 4KK9D 3DJ9A 5B38G 4O2FB 4OD3L 1DDHA 2APXA 2Q3AA 4LSTH 5ALBH 2EEAA 3VMPA 1W0YT 1D5MA 3KGRA 2P8PA 2BFVL 5C09A 5E94A 5DF0A 3MUGB 1LO3H 3FN0H 5AWNL 4Y8AA 1CE6A 2BSTA 5AD0A 3CDFA 4FTVA 2JK5A 1DBMH 1O5DT 1EVTC 5ETUB 5IB5A 2YD3A 3MROA 5LWYH 2IANE 3ARBB 1Z0NA 3B5GA 5F7DB 4DWHA 5KSUB 3LRHA 4P5TB 3X13A 1AQKH 4RMWA 1HHGA 3ZTJH 1F4YL 2MSPA 2I5YL 4NZTL 1UM5L 1QVOA 4MJ2A 1I7UA 4GXVL 4KK8D 1T5XA 4ISVA 2BNQE 1BOGB 1UZ6E 3K7UA 4P23D 4ZNEE 5GPRA 1N3NA 1NL0H 4DVBB 3HUJA 3S37X 3TBWA 5CGTA 1FL5A 2HRLA 1UM4H 4X4YB 2JKXA 2R2HB 1NGXB 4HPOL 1UEYA 1XGYH 3JBG7 4F7TB 1HSBB 2VLJD 3BDYL 3NIFF 3HFML 4JQXC 5IFHL 2BVPB 5I1IL 2YD9A 4PRHD 3S96B 2X4PB 5DD5L 1S7WB 3ES6B 2NQCA 5IP4A 5EO1A 2R29H 3S3PA 1SY6L 3SKOB 3V6ZA 1CDIA 4YAQA 1FL3B 1IGYB 1HI6B 4NC2B 4NCC2 4R4ND 3P9WB 4PJGF 1FE8L 2HKFL 4DK3A 1QRND 4BH8B 4NDMB 4G9DA 4MAUH 5KSVB 3FN3A 3QZWB 3CZJA 3V5HA 1TJGL 3WKNA 1TQBB 3C5ZC 2HH0L 2P7TA 1EO8H 2DQTL 4LCIL 2UVFA 2PF6A 3O3EB 1JYVA 4OLEA 4YDLB 4KI1A 4Z7UA 1MHEA 5HHXL 5FOJA 2ESVE 1S7XB 3KPRE 4B50A 1U8LA 3RZWA 1QPXA 3EFFB 5DHVH 3L3IA 1A6UH 1KFAH 3WFDL 4K9EL 1G0YR 2CLRA 2NYYC 5L88L 4LRIC 3EYUL 4PY8I 5D4QA 3CPLB 3L7EA 4HDIB 3QG6B 2BOCB 4RFOL 3ZKND 4KPHH 3GK8L 4WW1B 3MRQB 4PJ8D 3MV9A 3OJDA 4K3EH 2YD5A 5EOCL 2ZCKH 3LPFA 3U2SB 3CFIC 3PE9A 3KPQA 4JO3H 1FG9C 4WWID 5BOPA 2I60L 3T0ED 1CICA 4QWWD 2A9MH 3MO1A 3BIKB 4TPRH 5GRYA 4PRPD 5JW5B 5FK9B 3B9KA 2V9QA 4Q74A 5E00A 4XCNA 5BJTA 3QHFL 3SOBH 1RUQH 1AI1H 1I8KA 1MREL 1GVIA 3H42L 3X14A 5HYSA 1CXLA 1BMGA 1FYHB 4X4ZA 3ALPA 2YMXH 3C2SA 2DB8A 1IGFH 3OB0K 5JIHA 1PLGH 4EUPH 4KKLD 4MJ5A 3LS4H 4LDEB 2VDPL 5EB9A 5F1NA 4D9QE 3QDJD 4MB4A 3MLUH 3MV7D 2IAMA 3DHJA 4MD0B 4U33A 2VN7A 3GSWA 5TDPA 2A6DB 4JFEA 4ZS7H 1RMFL 4FFWC 1A7NL 4KKNA 4WFFE 1A9EA 4ZSOB 4P57A 2V2XA 5K33A 1J0IA 4PTUA 3WXWL 4JQIL 2RJMA 1KNOA 3U6RA 5IKCB 2X70B 1ZKAA 1CLZH 1JGUH 4AEHL 3MA7A 5ISZB 1MFBL 1S5HB 5FKPB 1P84J 1PJ9A 2FX8H 4EXKA 3UTTD 4W6YB 2BVYA 3TA3C 1FZMA 1AP2A 3BZFA 3CIQA 1CDCA 4YHNB 3MLTA 1ZK9A 4IIQC 4MJID 1MHHB 3U9PL 1J1PL 1E6OL 4RSVA 1C12B 4AEIH 2HFGH 5CZXD 3VXUE 5J1SC 1CFQA 1PZ5B 4XMPL 2ZUYA 2J4WL 3EOTH 3OAZH 3UPAA 2C9AA 5BO1H 4GMTH 3GMQA 2LTQC 1JFQL 2AVGA 4OZHE 3IF1A 3SDAC 4OIIH 3GSRA 5D7JB 4IHOB 1Q38A 4KMTH 3GSUB 2EYTA 2ZG2A 3S37H 1EAPB 3LIZL 5I74B 3V9FA 3P11H 1WWBX 2WAHA 5C0IB 3U46B 1OAUL 4K23L 3VMNA 5B21A 3BO8B 3M1BB 4K8RC 4K3JL 3V6FA 5ID1A 4KFZC 4OCYL 1WVZA 3JTSA 4OCRH 3PV7A 3Q6FA 1BGXL 4H88L 2DYPD 3PDDA 4Q6IC 5JHDB 3GSQB 5IVNA 4U1IA 1TZHB 2DLFH 4HKXB 2IPTL 2X4RB 4DCQB 1CFVL 3SDYL 3U4AA 4J6RH 4Y8DC 5E8DL 2QV2A 1IAII 5GSVA 5FDWB 5K9OB 4HH9A 3HAEH 5DT1H 3TT3L 2Z31B 4O02L 1B6UA 3IDYB 1GGIH 3WSQH 5F72S 3WIIH 2J8OA 4Z78B 1FRGH 4HS6A 5LG1A 1AE6H 3R06B 5ITBH 2V17L 3MV8D 4O51B 1DL7H 5CSZB 3TA3A 3JV6A 3HG1A 4MAYB 3BH8B 2Q76A 2ARJA 4KI5C 5K59F 2D0GA 5I8EA 4C83B 1FH5L 1J0ZA 1K3IA 2C3VB 3MGTB 2VDLH 4NO5B 5IVXE 1HN1A 1MWAL 1MQKL 1FAKT 1IBGH 3B9DA 1YEFH 1B0RA 5SWQB 5F96L 1UA6L 1J7VR 1YEDA 4L3EB 3DO7B 4XT1C 1SVZA 4CDGC 5E2UH 3EO1B 1J8HA 1TCRA 4QHUB 4Z0BH 35C8H 5F9JB 1PX4A 2Y7QA 2HRPL 3TYFB 4JDVA 2B2XL 5EZIL 1K6QL 2YRLA 4G8GE 3VCLA 3I02B 3D25B 3D3VD 4WU7A 3SE4C 1FZOB 3JV4A 4PTTB 1YYML 1KB9J 1SHMA 5GGQH 4X7DC 1OY3B 5DJDA 4U05A 3FOLA 2A74A 1EEZB 2I9TB 4LLYB 4HH8A 4JLRB 1DUYB 4O5LL 4XP5L 2WQRA 5LGKA 2E7LA 1RK1A 1MLBA 4KJYB 2UWEE 1I1YB 2KZWA 4GRLB 1IQDB 4KY1L 4MD5B 4LCCA 2ZCLH 3MLRH 1Y6MR 3WJJC 1T1YB 3HHRB 2HT3C 1MRFL 5I6XB 4FQHB 4QXTB 1OF2A 4M62L 4N8VB 2R56H 2ZJSL 5DHYB 2AV1A 5JORB 2NX5D 3QUYD 3LKNA 1MH5B 3QO0A 1MI5A 3BVNB 3NABL 2VDQH 5GXBB 3AMKA 2ICEB 4PRBB 2EDRA 3OGOE 1H3TA 4PPTA 1FORL 1IFHH 4U1JA 2X44D 5KTEL 1CGYA 4YUEH 2HTKC 4D3CL 1EBPA 4OLUH 3MRHA 3WFHB 5EORH 1RZKC 4GRWH 3K1DA 1J5OL 4NM4H 5DD3H 5I1HH 1ZEAH 1A3RH 4XNZB 4WWKC 3O2WL 3PWPD 2EXWD 1CXEA 2VAAB 3MYJB 3UTPE 3EGSA 1BQSA 4IOIB 4JRYA 3RTQC 5BW7C 3WIHL 3KLHC 4L9DA 3S8WA 4YK4B 3G5VB 2DIBA 1G7HB 3L3DA 4PRNA 3BZ4A 4RX4D 3V4PL 4L4TE 4JO4L 4KROC 3SE4A 4KXZI 3D0LA 2J8UB 3LEYL 4P2CG 5HPOA 4L8CB 1KLGB 2C3XA 1I3VA 2Q20A 4NUJB 4R8WL 3PQYD 5FO7A 3HRZA 3C5SA 4NKMA 4XMKL 3KYMA 5D72H 4R0LB 3UCRA 3ZKXB 4DGVL 2FSEA 2W92A 3LCYA 4QRUA 3CC5A 5IM7B 3RU8H 1YA5A 1M4KA 1CQYA 3WLWD 2VYRE 1BJMA 1JPTL 4G6AD 3V52L 3WFZA 1JNJA 4PRID 2RB8A 3GSNL 4ONFL 5HYQA 1EEYA 1Q8MA 1F42A 5IJVA 1YEJL 4PRAA 4P4KC 1MCKA 1NCBL 4NKDB 5JR1L 3VFTA 2A6JA 2VXUH 4X8XA 2GUOB 1OHQA 4JM2A 2G75A 3BP6A 3SO5A 3AFLA 5L8JB 3IS1X 4YBLB 4KKCD 3GRWH 3ARDA 1QZ1A 5IESH 4ZAKC 4RNRB 2GJ6A 2IG2H 3QHZH 5IOPB 5CGYD 3I2CL 5ESAB 3RNQB 4AL8L 4WWKA 4FXGA 3SGDI 4YHIB 3FQNA 4BFIB 4PLJD 5FM4A 1J0KA 5F7EH 4QYOA 2XQYG 2E5EA 4L1DA 2KUTA 4LARH 2H9GB 2ATPB 1VADA 3FB5A 4HX1B 4IOSD 4FP8L 5T5FH 3T0BA 4BQCA 1ZLUH 3S3JA 3PWLB 4P2RA 3TCLB 1RUAH 2FHFA 2OLDA 5CJ5A 1LE5A 4PJEE 2YD6A 4QTIL 3IJYA 1BIIA 1FGVL 5CP3H 3DX9B 4P3CL 5D96C 2A1WH 2MCPL 3WUWG 4HUXB 3SCMD 3DOSA 2RFXB 1UZ8B 1U8JB 4FABH 3C6LB 3NZHH 5DMKA 3U30C 2AK4A 3BPLB 1OARH 1TVBA 1QQDB 3TFKD 4XXCA 2JELL 2P8MB 5EC1A 4LBEA 2YBRB 3E6FA 4PGEA 5AUMA 1MIEL 2OJEB 3MMEA 2D7MA 4YXKH 4GW4A 5ENWA 2GYSA 1UYWH 3QQ9C 4LCUA 1YY9D 3VRLF 4BELD 1M71A 2VZVA 3DGGB 3C8KB 4HMDA 1KF9B 4U1HB 4U7SA 2PR4L 3FO2A 4NO0B 3FQUB 2AJZB 5JZ7C 5B38A 3MRNB 4J3OC 1JYNA 5MP6H 4PJXF 4XWOC 1RJZB 4Y19B 2Y5TB 1MJJA 3P9MA 4BZ2L 5ERWA 5D7LE 1Q1JL 4X83A 1HYSC 2DQGL 4J8RA 1CGSL 3MV01 1NMAL 4UT9L 3LB6C 5BV7C 5SX5H 5ITFB 5DJCA 2X10A 2NLJA 5IBTH 4RRPG 5DI8B 1C5CL 3TBTB 2XTJC 1GJIA 1W72A 4J1UB 3GHBL 4L4JA 3MLYH 2WK2A 2PXYD 5I9QB 4U1GC 3B3IB 4MMXC 4Z18A 2BSSA 1UCBL 5DD6A 4R6UA 2NXZD 4GBXD 4BZYA 4XCCH 1KTKE 4OV5B 3CH8A 2HVJB 4H1LB 2VLRD 4S2SB 3W5NA 4EZMA 4NNXB 2ZSWA 2W9LA 2YD7A 3KPSE 1DZBA 5MI0B 3U9UB 4G42A 5FKAA 2NTFA 1JWMB 2BC4B 3HC4L 3N06B 4JVUA 4OD3H 1YYLL 3O6FB 4JHWH 1VFMA 3SE3C 3U7YL 4XHJC 3P4LA 1H3PH 2BFVH 3D2UA 5E5RB 4AT6B 5KZCB 1TPXB 2VZUA 3D85B 4Y5VC 5FUOL 5CD3A 1HHJA 5C92A 1BD2D 2BDNH 2BZDA 3ILPB 4MQ7B 4M03A 2CDEA 2AQ3A 3ZKMD 4OZ4A 1LO2H 5HYJD 3PHQB 3BE1L 4OF0A 5ICZB 4DK6A 1FFOB 2X4NA 1W0WA 3SJVD 3EOAA 1RZGB 1OCWL 5A2IH 2I5YH 1YDPA 3PL6D 3KPLB 1UM5H 3A6BL 3REWA 3WHXA 4EN3C 2XNAB 4GXVH 2ED7A 4OCNC 2NY0D 5IG7B 4X7TB 2A6KB 4WI7A 5DJ6A 3TBSB 3P40A 4LPCA 2R9HC 5EBLB 1REIA 1N5YH 2VDRL 1RUPL 1XCQA 4QCIA 1NBYA 4Y4KB 5D2LF 4B0MM 3LN5B 3V7AE 1ONQB 1FYTB 4HC1H 1NLBL 2NY4C 4XP1L 1IGML 2GAZA 5C0BA 1CFSA 4JKLA 3SDXE 3BDYH 5IFHH 5IHZB 3ZTJG 5BQ7A 2YPVL 5DD5H 1S9YB 3ZT7A 5D2NB 3RUGA 5KSAC 1JHTB 1H15A 2AV7A 3VFVB 3QUMB 1FE8H 2HKFH 2J8UF 2D9QB 3ROLA 1JMZA 3VFWA 1TJGH 4D0DB 2GTZB 2HH0H 1IAMA 3FFCD 2DQTH 1WBZB 1Z2KA 4JKMA 4LCIH 3IKCA 7CGTA 3W0WD 1ETZA 3BAEL 2IPUG 3HC3L 1NANH 3MJ9A 5EU6E 1AD0B 3MJ8B 5J9PB 3O4LA 2B5IC 3DV6B 5DRNA 4I18A 4DTGH 5DDHA 3WFDH 1BJ1J 4K9EH 5L88H 1MCLA 3LSOA 2H8PA 3EYUH 1H3VA 4JEGB 4K9EC 3Q5OA 4L4VD 5JOFA 1WWAX 3ARZA 2Q3ZA 5J1AA 2D2OA 3LN4A 5EOCH 1VACA 2PO6C 2A73B 1KPUA 3T1FB 4MVBC 1CVRA 4WTXA 1JGDA 3QPQC 1UWXH 4FQ2H 5KVMC 3L95A 1C5DB 3QFJD 4FZ8H 2QTEA 4HCRH 2AJVL 1JZ2A 4PGBB 2R4SL 3GUTB 4DKFL 3I6KA 4NKOB 3QHFH 5F71A 1YPZA 2K9UA 2V7NA 1UJ3B 1MREH 1NUFA 3MLPA 3UJTL 1NAMB 1ZTXL 1DEEB 2ITCB 1YY8A 4GKNB 5DR5L 3WNMA 3PV6B 5KOVC 3IFNL 2OP4L 3MGOA 5KSAA 1R24B 4PJ5D 2V5MA 4Y5XB 3SKJL 3CSPA 1RULL 5TPWL 3LRSB 5LAXB 4FXKB 1SJEA 3TJHD 3WXWH 4JQIH 1BWWA 4W81A 4Y4HD 2MCG1 3HZVB 5JLZA 5F1IA 5TQ2H 4AEHH 1NEZG 1NSNL 4ODWA 1MFBH 4G9FE 1DBJL 1XR8A 4RMVA 3MTRA 4ODXA 1JPSL 1N6QL 1KCKA 2DQCL 4MJ4A 3L5IA 3O4OC 3OZ9L 3D18A 4HIIA 4EUPG 3D6GA 3U9PH 1J1PH 2VXVH 1VPOL 4M43L 1TXKA 4ZSOE 3RGVD 4GFTB 4JFQB 4LVOB 1WEJL 4ZYKA 3RWDA 5ISZE 4LVNB 3ECBA 3VXMA 1JFQH 1D9KA 1MFCH 1AO7B 4MVBA 4X6EA 3AY4C 3QO1A 4ONOA 2JLLA 4PGCB 3DYOA 1A7BA 4LASH 4L29A 4WHDA 2OZ4L 4X6FB 1SJXA 3CFEB 5BZDA 4R4NC 4ZXBB 2AK1L 3LIZH 1O0VA 5DC9B 3PGDB 3QA3A 5D1ZA 4S0SD 1I75A 1FBIH 1OAUH 4K23H 4L5FH 1F3JB 4FQQB 5CJXA 3LKSB 4MDIA 1Q94A 4K3JH 1U8KB 1Y0LB 1TITA 2CJUL 2F8VA 4OCYH 3S5LG 2DOCA 2FH6A 1BGXH 1OOAA 4H88H 4OZGB 5F7FA 3LV3A 1IQWL 3OKMA 1DCLA 2VABB 4X7FC 1P7KB 2FCBA 1RJYB 2VLMD 3SDYH 3E3QA 5GGTL 4QT5A 2GK0B 4WVRA 3PWNB 5A3ID 5T5NF 9CGTA 4MWFB 3G6DL 4D8PA 2O5ZL 3MUJA 5DVLA 3CSYB 3PGCA 3QAZC 3U4EB 3SDDB 1SM3L 4XBPB 5DURD 5J3HC 1EX0A 3VA2C 3T2OA 4I5BA 2V17H 4PUBL 3OBAA 3T0EC 5INCA 1ES0A 1HHHA 4P23A 1FH5H 3T8XA 4FS0A 4JY6B 2COQA 1XIWB 4S1QL 3K46A 1GIGL 3UYRH 1PFCA 3QDGB 3D0VB 2R15A 2DLHA 1IGJB 3HAEG 4I3GA 3OKYA 2VLJA 4KRPC 5KANG 1FIEA 5CILL 4KKLC 3W2DL 4PRHA 4OQTL 4AJ0A 3IGAB 1XT5A 2HRPH 2B2XH 5E7BA 5CIPB 5DJXA 1AKJD 4K71C 4XBGA 1YYMH 1KCLA 4FG6D 1QRNA 3DWTA 4Q9QL 5FM8A 2Y06L 4YFLI 1OTSD 4PFEA 4O5LH 4L3CA 4UNTA 1HDMA 3DBXB 1YMMB 1DSFH 1NDMA 1JWUB 4FQJH 4KY1H 3ULVF 3DYPA 3KVQA 3QG7H 1MOEA 3QI9C 2DQJH 5MEOB 4MNGB 4M62H 5CZXC 3EO0B 1XF2A 4CUCA 2OCFD 4FXLA 5F6IC 4JB9L 5INDA 3BQUD 3BT2L 1KJ2B 1HEZB 3FB8A 1KULA 2UYLA 3NABH 3GSVA 4PJ8A 4PGDA 4HW6A 1ITBB 1FORH 5EU7C 5DWUL 3FOMB 5KTEH 4HLJA 3TN0D 4D3CH 5GIRB 1T7VA 3RVTD 1IJ9A 5GRWA 2EXYC 2CLVB 4I2XE 2B4CH 5F7NC 3T0EA 1J5OH 3EJJX 4PRPA 3QXTA 4HBCL 1QR4A 4KAQL 2EO9A 4YEEA 5MEQA 5GISH 2W0KA 4LGPB 1JNHA 4HXAL 3MBEA 1HKFA 3JVGA 1MJ8L 4EOWH 2AI0L 3O2WH 4A2LA 1OB1A 4MA7H 4E9LA 2ZG1A 1P7QA 4OFKA 5BS0D 1UKSA 2A6IB 4KHTL 1IE5A 4BQBA 4UU9A 3QDJA 1NCCL 3EZJB 3MV7A 5GS0H 3NFNA 1KG0B 1F11B 5D5MA 3V4PH 4YHZL 3BPCB 1V3KA 1FL6A 3CGTA 1S9VA 3DVFA 1XF5A 1QRKA 2VE6A 3N50A 4GAYB 3HZMA 3G08B 4LSPL 4PJIA 3ABZA 1I9RH 1SYVA 5EDXA 2WIMA 4R7NB 1X5LA 3NZ8B 4DKEH 1KCRH 4ZDHA 1HILA 3UTTA 1MSPA 4CW1B 5ID0A 4WFHE 4DGVH 5E6IB 2LU7A 1XF3A 1FO0L 2NZIA 4Y5YC 1WWCA 3GFUA 1GC1L 4XNYL 5L6YH 3VGAB 3MOAH 3ZE2F 1GOGA 5I1AA 1JPTH 2BY0A 2J8UE 3V52H 3JV5A 1LDSA 2YUXA 4ODVL 1G7MB 4KU1A 4EJ1C 4HLZG 1FFNA 4ONFH 3Q3GB 2NY3D 3TWCH 1ZA3B 3MRRB 5GSRB 1KXVC 1D5BA 1U2HA 4PP8C 3P77A 5J06A 3UDWC 4R2GD 5GS2H 5BVJA 4YDVA 3TBYA 5I0ZA 1RZJL 3FCTB 2WBWB 4QHKI 3WUWA 1MELA 2VMFA 5FA4B 3VFMA 4XCYA 4KGLA 2O26U 3QBTB 4L9LC 4P46C 3I3BA 2F5AL 2F8OA 1WBXB 3FO1B 3QB7C 4PP1C 5LGJA 3DECA 5K9KA 2JJSC 2FJHB 1LD9B 4DN3L 3VXQB 5C07E 3I2CH 2D0FA 3RWIA 4AL8H 2PYFA 4JO2L 4OF8A 1MJUH 2DYPA 2VLKB 5KSBB 4TUJA 3W9EB 4ZFFB 2XZAL 4ZFGL 4WENB 2MKLC 2NY1B 5C0AD 1WC7B 1I1FB 1NFIA 1G0DA 2OXGA 3VXUD 3HE6C 4YDIL 5E56A 4J4PD 1ND0B 1QKZL 3EHBD 3GI8L 3QUYC 4P3CH 4U31A 2MCPH 5CUSL 4GXUM 4RIRB 2EIEA 1TQCB 4TSCH 3MFGB 3LKPB 1BFSA 1BZ7A 3MNVB 1ADQH 3BKCL 2HMID 5ELIA 4AQOA 4KVCL 3VWJD 1T21B 4RRPA 3MV8A 5I2IA 1N59B 1LILA 4Y2DC 1I7ZA 5DFVC 3LKRA 4M6AA 2I25N 3T4AB 1HXMA 5KS9B 5L2JA 4JPKL 3QIUD 4HD9A 1MAMH 2UUDH 4JN2A 1KIRA 3TNNA 4TUKH 4C56D 3AS3A 4WNQA 1S7RA 4IS6A 1B4JL 3W11D 3T0WA 2EXWC 1KTLB 2HFEB 5TH2A 3V0VB 5CEZH 5T1KB 3WL9B 1LEGA 3ARGC 1C16B 4BZ2H 1G9EA 4Z5RA 3UDWA 1NJ9B 4ZPTB 2DQGH 4KHXH 4JM2F 5HSFA 1NMAH 5CWSB 3MBXL 1QBMH 5F6HJ 3BOVA 1YQVL 4MA1C 4KJPC 2XWJA 4L9LA 3BJLA 4PJAA 1YN6A 4HIXH 3SY0B 3OB0H 4LLQA 4UOJA 2YEZB 3GHBH 5D7IE 3RVUC 5FAAA 5SWZB 3X11B 1GGBH 3WNPA 1S7TB 1PKQB 5T1LB 2NXYB 3MJ6A 5H35A 1KPRB 5GGUA 4Y19E 4ENED 1KV3A 5C6PB 1HZHH 5L2KA 3UROR 3RA7L 1MRCL 2EDOA 4WI8A 4XNQA 4QNPE 4S1RH 5GGSA 3HC4H 4S1SL 4UT6L 1D6EA 3DURB 1YYLH 4LP5A 4RA3A 5HJ3A 1B0GA 3HNSH 4Z7NF 3U7YH 4FQXB 3BP4B 1SEQH 2D4DA 5I1EL 2J12B 4NBZB 5FGCE 4X98B 3QUYA 1IZKA 3LD8B 1RD6A 2CXKA 3NTCL 4ZPVA 1VEPA 1CDBA 4QRRB 3SKMA 3T2PA 2P5ED 2V5RA 4P5MA 3JWOH 5E99L 5HXMA 2X7LA 2LE9A 1YQ2A 4X6DE 3NN8B 1MCOL 1Q9KA 3IFPA 2XN9E 4EDWL 1D3CA 4G8GD 1JV5B 4JZJC 1YMHA 4YXHL 2CGRL 4BA8A 3R8BB 3BE1H 5A2LH 1R3HA 2GSIB 3PHOB 2MFNA 4RDQG 4EI5B 3H2WA 1A14L 4HWBL 2WUBL 3QDMB 1OCWH 3TF7C 5JMRA 3DRTA 1I4FB 3PWPA 1SYSB 4PLJC 4ELMB 5ICYA 2QQQA 5F97E 3L6FA 1L7IH 1OW0C 5C0DA 2BX5A 3QJHB 3A6BH 3VGDA 4DAGL 4JGUA 5CMAB 5EBMA 1QBBA 4PJFA 4DVRL 3ULVL 4IRSB 4RX4A 5FB8A 4JRWA 2PCPA 2VDRH 1RUPH 2Q86A 2DQDL 3O81A 4ONHA 5DJZB 5I66B 3SCMC 1KLUB 3LH2L 5E2VL 2XICA 3L3OB 1U8HA 4JY4B 4XP1H 4HKBA 1IGMH 3HMXL 1PDKA 4PJ9B 1DLHB 1KN4H 2ZPKL 5J11B 4B7IA 1TJIL 4BSJA 2GITB 2C7UA 4QLRA 3PQYA 1OGAD 4Z6AT 1UQSA 2X2YA 1AHWC 3C60D 4J3XA 5E9DB 5C6WH 1BAFL 3SN6N 3VFRB 3RJDA 3RZCD 3NCMA 3N1GC 4PDCE 1OM3H 4M00A 2HJKA 4OCLC 4RWHA 4NQUA 5DQ9B 4I77L 4ZUVA 4R3SB 1AXTL 2HJFB 5IEKB 2Z4QA 2YPLB 5EZOH 1FYTE 3TJEL 3RKDD 4PRIA 3LEXA 5C0ND 3PNWB 3NGBC 3BAEH 4MLSA 5B39G 1IC4L 5DHVA 3QUZC 2IQ9L 4LLUA 4XCFL 1SBSL 5D2NE 2YA1A 3QISA 4RGNE 3ULVE 4JE4B 3PF2A 4JZJA 1YEIL 3ZL4L 1U58B 4R9HA 3VH8G 1HQ4A 2A77L 1E4WL 1NMCC 3QEUA 1DQQA 4K94H 1HNFA 5ANMA 2OI9A 5GJTL 5A2FA 5J6GA 2NXZC 2CLZA 3TF7A 4PB9L 4OFVA 5IW3A 1NAML 3AREC 2IQAA 3NBNA 1OW0A 1GZPB 3P30L 4Y16B 1T2XA 3RY4A 1H0DB 4PB0L 2QEJA 3G5YB 3QEHA 1KJVB 4KK5D 4P9MH 3VXRB 5J89A 3BHBB 4HSQA 4Y4FB 4YX2L 4RFNC 1NEZA 1A1NB 2R4SH 1WF5A 3IRPX 2VQ1A 3STZA 4DKFH 2BCKB 5C0EB 3SCMA 2F9BT 4OI8A 5J12B 1I1CA 1BQHB 1B90A 2R2EA 2DD8L 4EUPA 4M7ZC 2Y07L 2I07A 3CDGB 4QKXB 4HJGA 4P5KA 5KSBF 3TFKA 3TVMD 5DR5H 4XVTL 5GS0D 3AS2A 3OTTA 4S11A 4MX7B 3EFDL 2Z93A 2DBLL 2OP4H 1RU9L 3KXFB 1HH9B 1T1XA 3QUXB 4IRJD 4F9PC 1RULH 4MS8A 5TPWH 1WIPA 1L8JA 4OUUB 1RZIB 1MCSA 5CKAA 4LF3A 5DUBB 1NGYA 1NSNH 1JGEA 5I1CL 1N6QH 2DQCH 4DOHB 3NCEB 1I1AB 5D1XA 1JI1A 1TDQA 5IROA 2NY0C 2FGWH 4NFCA 2XWBA 4WUUB 5KS9F 3JWDL 4M1CD 3WDIA 1IKNC 1JHLH 4MA3A 3S5LA 1VPOH 2ITDB 2R69L 3VI3E 4IJ3B 1VFAB 5IT2L 2JB5H 4W6XB 1IMHC 2FECI 2OBGA 5IW6B 1KACB 2ADGB 2PXYA 1Q9OB 4QOKB 3DMMD 1LNUA 4JFFB 2X4TB 1ZAGA 2GCYB 4GBXA 1URLA 3Q6GL 1CF8L 2VLRA 5CEXB 1QSED 1OP3H 2PTVA 4J12A 4U6YB 4J7RA 2CO7B 4HS3A 2AK1H 4UQ3B 1F90H 3I6GA 1QBLL 4WRLA 1MFDL 3C87A 1MVUA 4NO2A 3D1MC 4NNPL 1DN0B 1T3FA 3VD7A 5D6DA 3F7YB 1JHKH 1M05B 5ACZA 1U8QA 5D7LD 4MYWB 3ARSA 1BD2A 4APQC 1IQWH 2BOBA 4G3YL 3MRLA 5IMOA 4F7PA 4KJQD 1YNTA 2V2WA 3HAEA 5IBUG 5GGTH 1EUUA 3OKOB 3UMTA 2QQLH 3G6DH 3LS5H 2O5ZH 3KWWA 4F9PA 5C8JA 3KPPB 4ELKA 3SJVA 2DMBA 1G9NH 2AABL 3KR3H 1NCNA 5CEYA 4QRPB 1SM3H 1UVQB 3UPRB 4N0RA 3PL6A 5HTSA 4RQQA 5ADPL 4OZGE 4EDXB 5I1LA 5JA9A 3PIQB 4KZEL 1A2YA 1F8TL 4A6YB 4XWGH 4U6VL 3H6JA 1MCRA 3DVIA 1LO5B 2XA8H 1ZHBA 1WAAA 3Q1SH 5MENE 1K9TA 2CIKB 3RVXD 4S1QH 4JFDB 4M7LH 2I26N 4XP9H 3VG9C 3UTZB 3H7BA 4NFDA 3L9RB 5CEZD 3MLSL 2BY1A 3F7RA 1YEHH 3KS0H 2NY2B 4MCYB 3CDCA 4ELMF 1HNGA 2XT1B 1J8KA 4HUKB 1L6XA 1K4DA 1OP5H 1S78D 2X1QA 4GUPB 4I48A 4TVPH 3I3DA 3GIZL 5C6TL 3FFDB 3VFSA 5E94B 4JG0L 2NNAB 4KJWC 3BI9X 3PP4H 4WV1C 4R4BA 5E2WL 1H8NA 4FNLL 4X7EC 4HWNA 4AK1A 2QKIA 1MUJB 3TJHC 2JK5B 2YXFA 2R4RH 1LK2A 1CGVA 1KJ2L 4GRMB 4Q9QH 1K2DA 3FFCA 5D9SA 1WIUA 4P49A 2JCCE 2QADD 3W0WA 4U1KA 2BMKA 5DJ0A 2APFA 3X13B 5JO5A 2HA1A 2ADIB 4JCLA 2B1HL 4WCYL 3ULUL 4XTRC 2A38A 4LLMA 3ZDYE 5JNYA 2QSQA 8FABA 2DQFA 3O0RL 4QRSA 2H3NB 4FA8A 4L4VA 4AG4L 1HWHB 1G1YA 1M6OB 4LCWB 2CK0H 4HXBL 1NANI 3CD4A 5L8LB 4IEFB 4XNZC 5F89B 5IMKB 1TIUA 3HUJB 1P6FA 2M2DA 1AY1H 2XOTA 5DWUH 4BSVB 1YMME 1MCFA 5FYJU 2IBGA 3MLWL 5AYUL 1T80A 3B6SA 1FL5B 4ZO9A 3V4VL 4DGIL 3MFFA 1WIOA 2F54D 5SV3A 3LQZB 3QUKB 4KAQH 3IDMA 2EDDA 5JOEA 2Z35B 1QFWM 3EO9H 2I27N 5KAQF 3GIVA 5EUKB 1U36A 3FQWA 3E6HA 5EO0B 4NUGH 5EO1B 1MJ8H 3UTSA 1DUZB 2FEDD 3IFOA 4PJHB 1AD9A 5LBSH 1NBVL 4KHTH 4KWUA 5JW4Q 3ULUE 4WDIA 3B9VA 3MPCA 5CJQH 4Z7VA 4PJBB 4YHZH 4PJ5A 5A3IC 4ORZC 4V2BA 5MHSD 3WHE0 4JPIB 4NPYB 1FC2D 2W9DH 4LSPH 4Y4HA 3SQOL 3L3IB 3K2MC 4XPFL 4WI9A 3RNKA 3IAGC 5H94A 4U1NB 3H9YA 1KGCE 2PN5A 5HGDB 4NQSB 3LPWA 1N5AB 4Z7OF 1MVFA 4R7DB 1LP9B 3UTQB 5DO2C 1GC1H 4WFGE 5GZOD 2VXTH 3RHWK 2CMRL 3PABA 3KPQB 1GC1C 5EG6C 1EFXB 2W60A 5IHUL 1ZT7A 3PWJA 4G5ZL 1T0MB 3RGVA 2ERJC 5MERA 1CICB 1N0XH 3MO1B 3O45A 2HTLD 1RPQA 3FZUD 1AGDA 3FO0L 4JJ5B 2DI8A 1FVDB 1JNLL 1ZT1B 1RZJH 4M6ML 5IIEB 2EKSB 3G6JB 3DI2B 4JDZA 1CLCA 3TPUA 1A6VL 5I18L 3RPKA 1S5IL 3FO9B 3GRWA 5I19L 2YK1H 4KMQA 1I8IA 3G5XA 4N5UA 5JDSA 2DQEL 1MCHA 2W1NA 5T3ZH 2KZ1B 4AH2A 5M94B 4C4KT 1OAQL 1S7UB 2DQUH 1YUHB 4Z8FH 4JO2H 2CKBL 3RWGA 5I73C 4LQ1A 3I6LE 3HLAA 4NRYB 4P57B 2XZAH 4ZFGH 2GJZB 3U6RB 4CGTA 4MSWA 2P43B 5EU5B 5CP3A 3C6SB 1YZZA 3MA7B 4H0HB 1QA9B 5AG8A 1CG9A 5DMGD 1M7IA 5FHAH 4YDIH 3BW9A 1QKZH 3GI8H 2GY7B 5BCAA 2UVEA 4XH2B 3BKCH 2XA3A 4LSDA 4N5EC 3PWUA 5DUML 1RV6X 5KSBE 3RVTC 1S9WB 5IW1A 1KCGC 5ESQB 1EHLL 4Z7WA 5IVZA 4OFIA 4WU5B 4KZDL 5ICXB 2UZYB 2PETA 1H3XA 1MCPL 3IF1B 3W39B 3GSRB 4EI6B 2ILLA 4MJ6A 1EGJL 4X4XB 4Z7QE 3MLVL 3STBA 5E8PB 1R3LA 2R23B 3GI9H 1R5IA 5D7JD 1PAMA 2J1KA 4H1LH 3RX8A 2Y6SD 1UB6A 3V0WL 1C7TA 4FQCH 3RHWF 5ID1B 5E08L 2BRRH 4ZTOL 1AKJA 1YQVH 2JJUA 1KPVB 4LSSL 3QDHA 2LQRA 1NC2B 5FM5O 4F3FA 4RISL 4DQOL 5CFHA 3F62A 2CDFB 1S3KL 3M07A 5JHDD 2Q87A 2B1AH 3CLEL 5E4EC 5TDNA 2OK0L 4POZD 2X1PA 4Q2ZB 2AXGB 3T3ME 4TVSa 1MRCH 4GMSL 3WXVL 3T04D 4OLYL 4WI6A 2VDNH 1OTTD 3D39B 1WBYA 3STLA 4AM0A 2FEEL 2Y1VA 3WCYA 4JFHE 2IADA 4E0RA 3PHSA 1P69B 4F8QA 2GIYA 1UH4A 3TA3B 3BQUA 5GGVH 4YHLL 2ARJB 3NTCH 5I8EB 2JTDA 2NY3C 4YIQB 4WHTB 4IIQB 5F1KC 5SWZE 4ORGA 4M8VA 3VGFA 4H8WL 3L3HB 1EXUA 1DBKL 1TZGH 1TNNA 3CAFA 4MAYD 4R2GC 3TN0A 1CFNA 5DQJA 5FUCE 1X5JA 3TNMB 1B0RB 4EDWH 1KIPB 3RWEB 2EH8L 3P0VH 5LQBL 4YXHH 2CGRH 4QHNB 4KDWA 3S36L 3ISWA 2LTQB 5E1HB 3QFDA 3SDAB 4L3ED 4HWBH 2WUBH 5HHMB 4KTYA 1T0NA 2IPUK 1BBDL 4BQ9A 5EU4A 2VITB 1WK0A 4C54A 4KDVA 4NHUA 1G0XA 2ESVA 5BS0A 1INEL 5FDYA 4DAGH 3IDIA 1V3JA 4G6MH 1NBZB 4NQCE 1T03L 3WIFA 3O11B 4WTZG 4DVRH 5C08E 3ULVH 3DIFB 3ARPA 1FZKA 4Y1AB 4D0CB 4RGNC 4HC1A 3F8UB 2EYSB 4QRQA 3QUMH 4Q6IB 3WNLA 1OSPL 3LH2H 5E2VH 1QLFA 3UAJD 1JPFA 7FABL 1RIUH 4TVPD 3FQXB 2ZPKH 2HMIC 4XAKD 3E2HC 1VGKB 1TJIH 5I16B 4PJHF 3EBAA 3VWJC 4GRLD 4N1EA 2AV1B 4NQDD 3REVB 1EFQA 3QO0B 5IK3B 1BAFH 1MI5B 4PJBF 3CFDB 4MQSB 5I15H 1M7XA 3S4SA 1F5WA 1BVLA 3FB6A 4I77H 4I1NB 4DUXA 1E27A 5FYKL 1AXTH 1FLTX 2V9TA 1IT9L 4DN4L 2AXJA 3H0TB 4NYLA 2MWCA 1A7PH 1P1ZA 2F74A 3FT3B 4HKZB 4JRXB 2ICWB 3WFBL 3QZWG 2VRAA 3LKOA 4JKWA 1IC4H 2Z0BA 2IQ9H 2XZCL 2VAJA 2XY2A 3B5HA 5T1DL 2W0FB 4XZUB 3T65B 1L9MA 4M4RA 1LP9F 1YEIH 4OI7A 4D0BB 4JRYB 1D5ZB 2DDQL 1IKFL 2YPLE 4XCEA 2FRGP 2AKRA 2D03L 3GMOB 3L3DB 3TGXA 2DQIH 5HYFA 1R5VB 1MQ8A 1T89C 1NAMH 4ENEC 3HI5L 2QR0A 3GSXA 3QIWC 4WFHD 3P30H 4QY8A 5FUZL 4PS4H 1U3HD 3G6JF 4HCRA 2LVCA 5C0AA 4LMQE 2I9LA 4X5WA 2X4OB 3IVKB 4YX2H 4NQEB 1HH6A 1MNUH 2PUQT 3VXUA 3OPZL 5FYKE 5C09D 4J4PA 4EKXA 4CN4A 1A7OL 3C09C 2IEPA 3WDHA 4HIEA 2R0KL 1G9MH 3HRZB 3LHPL 4XC3L 3VFPA 4NKMB 1B9ZA 3RL2A 1G7PA 3NCYP 2FSEB 4M7JL 4QRUB 3H7LA 2B8OT 1T4KB 1UCTA 4X6CA 4PV9B 5IEHB 2DD8H 5HHVL 4YFLF 4B5EA 1FJ1A 1FPTH 3FB7A 5JHLL 4XPGL 3CFKA 3MCLH 4XVTH 4P4RA 5C71A 43CAA 3G5ZB 4OB5L 3EFDH 3AC0A 3CVHB 2DBLH 1E4KC 1RY7B 2HT2D 1KCSH 1N2RA 4BQ6A 3MRDA 1A5FL 2YXMA 4QHLB 2AJSH 5F8QC 3QIUA 4YBQD 3TO2B 4IDJH 1OAXH 1A3LH 4C56A 1ZANH 2A6JB 3K74B 1BPVA 2E6PA 1P5UA 3OAZK 2G75B 2XY1A 4OZFG 4LU5L 1TMCB 3LMJH 1UENA 1OWWA 1MEXL 4RBPH 4GG6B 2NR6C 1BEYH 2GJ6B 2KKQA 3CCHA 1MHCB 1OQOA 3HE7A 3JWDH 1EIBA 4WWKB 2OR9H 3O3DA 5HI5D 2UV3A 3C9NB 2R69H 3P73B 5C0GA 1G7LA 3RTQB 5IT2H 1VADB 1JF6A 1N64L 2YRPA 3W82A 2WW8A 3GKZA 2DKMA 1KB5B 4P2RB 4KTDL 2X40A 3RWFA 5DYOA 2OQJA 1SEBB 4NC1C 1T89A 4KROB 3C60C 4YR6A 3R1GL 3Q6GH 4DOHE 4PLKD 4TUOA 4WUUE 5IVXA 1J12A 5GRJL 1SJHA 1N26A 5H8DA 1ZHKB 2OR7A 3AXLA 1W8NA 4U6TA 5T3ZD 3GBNL 1JPST 5FXCH 3QSKB 3C6LD 2P8LB 2OL3B 4PGEB 5AUMB 1ZMYA 1XZ0B 1FP5A 4NNPH 4QOKE 4EEEA 2QSVA 1OPGL 4JFFE 2P5EA 1EA9C 4UDTA 4BH7A 1M71B 3HZYB 3GGWA 3O6LL 5J1TC 5SWSB 3O9WC 1DQJA 4Q58C 5DQDL 1QNZL 3FO2B 4G3YH 2XXMB 4G8GA 1U41A 3G6AA 3IDXL 4Z77B 1MY5A 5JPNB 1G7IA 1C1EL 2NCMA 5I30L 4MXWL 1LO4L 3R8QA 2ZOLA 4NO0D 4P4KB 1A3QA 3P9MB 3MV9D 3V5DB 5EIIB 4OZIB 1QSFB 3LDBC 5IMLA 4U0RC 2GHWB 3UPCA 5IB1B 4J8RB 2AABH 4LEOA 3NIDF 3KYOA 3EYFA 2NLJB 3E8UL 4OGYL 1PQZA 2VZTA 3DV4A 4R26L 3BWAA 4KZEH 5ACLA 2MHAB 3D9AL 5GGRY 4QTHA 1T66C 4ZAKB 4U6VH 3N1QC 1J0HA 2RAMA 5CIPH 4NN5C 1EEQA 1V3MA 5J4MA 1TVDA 1Y18A 2XQBL 4AY0A 3L3GA 2X4UA 2IH1B 2VISB 2H6PB 2FWOA 2ZSWB 4N0UA 1NGWB 1YEEH 3K3QA 3MLSH 5J57B 3TO4D 4PP2A 4QRPE 4JG1H 5HGAB 2HJLA 3BP7A 3VXOB 1U8IA 4OLXH 1EJOL 1OGAA 5FGBA 5D96B 5F7UA 3T08A 3D2UB 5DEGB 1P4LA 1F02I 4JG0H 4JFED 3RZCA 1RIHL 3O6FD 3VU2A 4LPYA 3KDMB 2WP3O 3I50L 5E2WH 4CL7A 2H2SD 4LFHD 2Z92A 5KZCD 1KJ2H 3FT2A 1MIML 1MLCB 1S8DA 4BKLA 4EBQL 2EYRB 2P24B 4JFXA 1P2CA 5IQ7L 3ARFD 3P3YA 4OQ1A 1UWEL 4N8PA 2J3SA 3LZFL 5DJ8A 5D1QA 2DKUA 1N8ZA 1CBVL 5E4IA 1IVLA 3TIDA 3ULUH 2HLFC 4WI5A 1P5VA 2R1XB 4IM8A 2ZUXA 1X5YA 1R0AH 3T2QA 2APVA 3DSNA 5B4MD 1A64A 2NW2A 4RMQA 1E6JL 1VFBA 1A6WH 4N8VG 4HXBH 5FEBA 2JJWA 4KI5F 5BV7B 3BGMB 1UWGL 4F7MA 1T20B 1TZIA 4ACPA 3CXHK 5AYUH 4LLWB 2XTJB 3EYQD 3V4VH 1JUFA 4B7LA 3U7WL 1VFUA 2ICES 4HK0B 3QPXL 4PJGA 5B3JF 4RFEB 4Y4KD 5C0BB 1CFSB 4MD4A 3HPLA 1FYTD 5HDBE 4JQVC 3O3BA 3SO3C 3IETB 3CX5J 4HG4K 3RUGB 4RA0C 5DZLA 4LKCB 4LAQL 2GEEA 3HUJE 4OM0L 4PJDF 4UDUA 3TVMA 2EKJA 1NBVH 3HS0A 4YWGH 4KJQC 3OKEB 5J7CC 1KTDB 2FYYB 4HIHA 3KG5A 4NM8L 4HIJB 5CP7B 3B8SA 4LHQB 3M8OL 1KBGL 4Y5VB 2C5DC 4GSDL 4U6XB 5KN5A 1YJDL 4IRJA 1NUNB 4GAGL 4AIZB 1BFOB 1I85C 4WGVB 3SQOH 5IV2A 4O9HL 4X5XA 1HHKA 4DEPC 5F7YC 5DDHB 4PJHE 3HG1D 2DWEB 6FABL 3RBGA 3BP5B 1CXKA 2W0PA 4M1DL 1XCTA 3X3FH 5JOFB 2FX9L 4K3HA 1FNGA 1QLRB 2HG5B 2IALB 4U3XA 4LNRA 3RVVD 2EIZA 4XNXL 3CFBA 4UV4L 1R3IL 2PW2A 3EYOA 3VJ6B 4Z0XA 1VACB 4WEUD 3SE9L 4KH2A 2ZSVA 4NWUL 4Z7UE 2CMRH 5IBLC 4KUCF 3S36X 2JIXB 4G5ZH 4EN3B 3MRPA 3L95B 1IAOB 4UZGA 3UEZA 1J8HD 1FNEA 3VWKC 1S78C 3DMMA 3BUYA 3H9SB 3CFJA 4GRWF 4UB0L 5D93C 3U0PA 3KPRB 3FO0H 1A1OA 4GG6F 1YPZB 2V7NB 4M6MH 1I7RB 1QSEA 5CINL 4BFEA 1ZLUK 3MXWL 5I18H 2AGJH 3WLBB 2NY4B 4I9WD 4Z9KB 4GW5A 1KELL 4P3DB 3HCVA 4M93C 5I19H 4FMFA 1YY8B 3SQBA 3MODL 5ALCL 3VRIB 3QCUL 3GJEA 4G7VL 5EUOB 3FRUB 4HGWB 2GY5A 5KSAB 4CU6A 1OAQH 1OSZA 1QYGL 4OD2A 2QADC 3NCCB 5K9JL 5D7LA 5ACMA 3WKML 4NBYB 2DI9A 2AJYL 1Z9MA 3ERYA 3G6JE 2IF7A 5F1IB 3P0YL 3MRKA 1OLZA 3BKYL 1VCAA 4ODWB 3WS3A 4NNYB 2Y4SA 4ODXB 2A9NL 2N56A 5A16A 1ADQA 1P9MC 5DHXB 2WV3A 4YDKH 2B5IB 1KTRL 4O2EB 2V7HA 3WJLC 5C3LD 3HR5A 1VHPA 2PYEB 2MMXA 3P4MB 1NDGB 3H3PL 4ETYA 1F58H 1CLYH 1ZHNA 2SEBA 1EHLH 5EBWB 1BFVH 3MREA 1DVFC 3RWJB 4KZDH 2CK2A 4PG9A 3SPVB 5C0JB 1AJ7H 3ECBB 3ARRA 2PO6B 4U1LA 3KYNA 4F37F 4OZIF 1CLOL 4OGAD 1EGJH 3V8CA 2VR5A 2BVOB 5BZDB 5EC2B 2FEDC 4QHMA 5B8CA 1AO7D 3LQMA 3QA3B 3FMGL 4YO0B 2XXCB 2ZP0T 3TBVA 4AIXA 4ZXBD 1PG7W 5E08H 3CLFL 2ARJQ 2WINB 5FUCC 5A2KH 4P2OC 4KDTA 3I9GH 3LV3B 3OKMB 2W0LA 1CD1B 4LCYA 4DQOH 5KVDL 4WO4C 5EZJA 2GT9B 5F21B 4YGVA 1S3KH 4OZHB 5DZNA 3A6CL 4XI5D 1RUML 1QLEH 3CLEH 1U2CA 2OK0H 5ETUA 1CL7H 1XGPB 4X8JB 4MXVE 4GMSH 5F7DA 5CCKL 4OLYH 4XNUL 2XWTB 5KSUA 1D5IL 1U8OA 4YQXH 5FCUL 1OTUC 5DRWB 3E0GA 4IMLB 4MGXA 1NGQL 3O4OB 3SDDD 3MA9L 2EE6A 5F3HB 4JDTL 5T5NG 1HHHB 4WTZA 1JZ6A 3UYPA 3FZUC 4H8WH 1IZJA 1CT8B 4LFHG 4CVXB 5F8RC 5TQ0L 1BOGA 4JM2D 1DBBL 1CI5A 3NPZB 2F54A 3QWRD 4DVBA 1XIWD 4K8RL 3ARDD 2VLJB 4JVWA 3QDGD 1RK0B 2EDNA 3S36H 3T4YB 4PRHB 2R2HA 3OG4B 1NGXA 2DM2A 5H37G 1HSBA 3ARVA 5AAWA 5CBAB 1BBDH 3LOWA 2BVPA 4W4OC 5D6CA 4YXLL 2X4PA 5A1AA 1S7WA 2DL9A 3L1OL 5H2BA 5IJKA 3FAWA 3SKOA 4I0CC 1T03H 1FL3A 1IGYA 5HDQH 1L9NA 4I0PC 2QSCH 2FR4B 4LPVA 4NDMA 3IJSB 1HDMB 1J18A 3QZWA 1X5FA 2IGFL 2VERN 3EKCA 4ZD3H 7FABH 3ZTNH 3HI1B 3DVNB 2VR4A 1W0VB 4LSRH 4OLZL 4UMGA 1KCVH 3GO1L 1XF2B 4D94A 1IM3B 1UZ6F 5INDB 3EFFA 4UAOC 3QAZB 2PTUA 3GSVB 1JTTA 4OT1H 3RVWD 4IRZL 1NUGA 4XVSL 3CPLA 3QG6A 2BOCA 5FYKH 2E7LE 4WW1A 3MRQA 3UX9B 1B6DA 1IT9H 1KCUL 2EE3A 3T0EB 5AYQA 5HHQA 1I3UA 3U2SA 4OCWH 4PBXA 4RAHA 3WFBH 3ET9F 3VD3A 3BKMH 3F12B 4N0CD 5I1DB 5MEQB 4E42B 3CFCL 3UBXB 2XZCH 5BXFB 5E8NA 1UWXK 5JW5A 1MI5E 5FK9A 1MWAB 1OB1B 1U93B 1X6LA 1HHIB 3EAKA 4KRPB 3A67L 4ODHH 4XAWL 2WBJD 3EJZD 1U42A 3L3JB 4NJAH 3L7FA 2D03H 1AR1D 3ZKQD 3QDJB 3MV7B 1QPPA 4N8CL 1U95B 4RAVA 4KI5E 5D5MB 2X4QB 5F7WC 5C2BL 4YEFA 3AU1B 1Q0YH 5ESVB 1ZWIA 4K71B 5FUZH 1TCMA 1NCWL 1IGIL 3HZMB 4MD0A 2A6DA 3CVHL 2VJXA 4BFGA 1H5BC 1ODAA 4JRYE 3OPZH 1TETL 4OZFA 3UTTB 1A7OH 4J3WA 5IKCA 2X70A 5EUOF 4XC3H 3RY6A 4OLVH 4Q7DA 4M7JH 5C7XL 1S5HA 5FKPA 4Q9RL 4MJIB 1XF3B 1EUTA 1RZKL 5CSBA 2XZZA 5HHVH 1WT5A 3QI9B 4R4FL 4S1DD 4ZS6C 4L1HA 3S98A 3U0TB 4E41D 5BVPL 2FLRT 3DSFL 4XPGH 5IB4A 1OAKL 3PDGA 5F6IB 5KVGH 3DGCR 1MHHA 3IDNB 4OB5H