1UXSA

Crystal structure of hla-b*2705 complexed with the latent membrane protein 2 peptide (lmp2)of epstein-barr virus
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN B-27 ALPHA CHAIN
publication title Allele-Dependent Similarity between Viral and Self-Peptide Presentation by Hla-B27 Subtypes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/peptide
total genus 77
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2004-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uxsA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1uxsA01
5KSAB 4NNPH 4X5XA 3QDJD 4QHKJ 2ZSWA 1YYLH 2FEEL 2Z31A 3MV11 4I3GA 4P23A 5F6HJ 1INDH 3CDCA 3DOSA 4HFUL 2NXZD 2A6JB 4U33A 2GTZA 3ECBB 2AJYL 5I1KL 5JQ6L 1GPOH 1QHOA 1IBGL 1BOYA 4PRHD 4XC3H 2VZ1A 1AE6L 1ORQA 2K7QA 4FXKB 4YQXL 4B5EA 5A16A 5IMOB 4MCYA 4X4YA 3AMLA 5KZCD 3QFJB 5BRZB 1FLRL 4WW2F 5AZ2H 3C8DA 4NQEB 5TE4L 4G3YH 2LAAA 5JDSA 4FFEX 5B8CC 1U3HC 4OUUB 4OLUL 4NNYB 3PDOB 4OZIE 2HJLB 5IEKB 1QLRB 3WHXB 1NJ9A 3IGAA 1WZLA 1Y0LA 4FQPA 1FFOA 4PV9A 2DM7A 3BAEH 5F7EL 5E03A 3T4YB 1IGYA 1CL7L 3CX5J 4BKLB 4O58L 4H88H 2ZJSL 4XCYA 3UPCA 3CFJA 1G7MA 3B6SB 3TEUA 1RQ5A 2PNDA 1Z5LA 2ILLA 3W82A 2HLFD 4D3CH 4HFWA 2DQIL 5E1AB 3TH2T 2P8LA 3C2AL 4P5KB 4AEHL 2AQ3A 1ERNA 2IBBA 1SBSL 2AJXH 5EDXA 5GGSB 4Y16A 1AC6A 2IADA 2P4AB 2J1KA 1FSKC 2EDFA 2AEIT 1NGYA 3OKDB 5HPOA 3GIVB 1D6EB 3KPMB 4WGWB 3OX8B 2FX7L 4PJBA 1MFBL 3SDAD 1QRNA 2N7AA 1F5WA 4KV5E 1MFDH 4IRSB 1A5FL 2R2HB 3QNYA 4Y5VC 3L3DB 2IG2L 5DK2B 1AR2A 3EO1B 1CR9L 1G7HB 4L8CB 3BX7C 4OGXL 4B50A 4K8RC 3GFUA 4YLQT 4LAQH 4JHZA 2FATH 3GRWL 3D69B 5KVFH 2D31A 2K9UA 1T5WA 1NFIA 2ORBL 4NKIL 4RGMB 5F93C 1OPGL 2X2YA 2DYPA 2P24B 5CEXA 3V4UH 1C5BH 2DMKA 5HGBB 4AL8L 3D85A 2GKIA 1MY7A 4FP8H 5D2LA 2A9ML 2CDGB 32C2A 2HLAA 1I85A 4N68A 5HYQA 1D5BB 1MJ8L 5B3NA 5LGKA 3VDAA 4PJXF 1FG2A 5CLTA 1NCDL 3JV5A 1FYHB 4KKCD 3MUGA 4ZFZB 3GSWA 2IWGA 3AFLA 4ODWA 2Z8SA 5T3XE 2R0KH 5I66B 5L6YL 1BD2B 5IB5B 2WP3O 1F3RB 3T0EC 3OXSB 3HZVB 3CCHB 5DLMH 4PS4H 1J0HA 4Q0XL 1HHGA 3E6HB 3IJSB 4CUCA 1H3VA 1T1XA 1RV6X 4FRWA 3NIDF 4XP5L 1VKXB 4PP2B 3P9WB 5DMKA 1KJ2B 3PGDA 5E6YA 3FQNA 4YHOH 3D9AL 5J12B 3KPLB 4JHAH 4MNHA 1S9VA 2ZCLL 4WY7L 2XRAL 4O2CA 4F7PB 3BIKB 4Q9QL 2HFEA 4NQDA 4OKVA 5E8PB 1X44A 4GMTH 3OF6D 2P7TA 1UFUA 1TMCA 4K94L 4PJCB 2XXCB 3CFCL 3CSGA 4FQJH 2QADB 4X7DC 4I4WA 1IC4L 4ONGH 3ARDD 2ZOKB 1FNAA 5IESH 1V7MH 3KLAB 3TYFA 5BMFH 3O4LA 4IJ3B 2J88L 4R4BA 3V0VB 4OTXL 5E4EC 5SV4A 4XPGL 2JB5H 1G9MC 4MJIB 3QIBB 4Z76B 2X4PB 4FQXA 1WFNA 3CX2A 4A2LA 1SY6L 3MRLA 1AH1A 5MI0B 3SGKA 4PRIB 2X9XA 1ZTXL 3SDXF 3HR5B 1YQVH 3S37L 4HHAA 4WI6A 1U3JA 1DSFH 1QNZL 2R1WB 4ZO9A 1IEBA 2X7LA 2ICWB 4LLVB 1XIWB 4RGOL 2VC2H 4ZDHA 3SKJH 2B39A 3VD7A 5HHMD 3GSRA 3QPXL 4JO2L 2Q8BH 4FMFA 5D1ZB 3MLVL 4L4TD 4Y4KD 4NZUH 5E6IA 4JFQA 1CLZL 2OMBA 4XC1H 1OQXA 1JGDB 3TYGL 3T2PA 4Z7UA 3TC9A 4ZQKA 1WISA 2Z35B 1LD9A 1NGPH 2IH1A 4K23L 3L1OH 3L7EA 5GHWH 5E2WH 1AY1L 1KJ2H 2WQ8A 4KRNA 5KANG 1IGIH 1WZKA 3RGHA 4PG2A 2X1XR 2FGWL 5C08A 3B5HA 3S98A 3V6OE 4AG4H 3RZCD 3LQAC 2Q8AH 3O6LH 4PJHA 1AHWA 5JR1L 3V5HA 2FR4B 3BPLB 5B21A 4QT5A 5GS1B 3S37X 2MQ0A 1M4KA 2AABH 3KS0H 4WI7A 4X6DA 5D2NB 3VXRA 4H26B 2VDPL 4MJ6B 1QFWH 2D7MA 3WSQH 5KTEL 4CMHB 4L8DB 2XYCA 5D6DC 2C3VB 5DK0A 5DEFB 1HYSC 4JY5L 4POYA 5EIIA 2W60A 3UBXI 2GITA 4K7PL 1NCWL 2XG5A 2A77H 4LHUD 4N1HB 2R1YB 3SDCC 4UIKH 4YJZL 5LVEA 5C07B 3AS2A 3IDYB 1ZLWH 1RIHL 1WAAA 4V2BA 3I6LD 5GJSH 5TPWL 5DRZA 4ZYKB 3SY0A 4QHLA 5CSZA 4KK6C 1K6QH 5ANME 5JLZA 3UTQA 1UA6L 2ZPKL 2NNAB 5GISH 5E9DB 3LN5B 5E8OA 2OS7A 2YEZB 4NSKA 1J8HA 4Y5XB 4TQEL 3MRBB 3NCBB 1LDSA 4EI5B 4GW1A 5C0FA 1B4JL 5GRUH 4KMTH 5IHLB 1B0GA 3C8KA 3UBXA 1XGTB 3WKML 2DQUH 4JM4L 3ZTJH 4YHPA 3S3JA 4QTHA 2EDTA 4Y4HA 1UJTA 5EC1A 2DQJH 5CEYB 5T5FH 3N1FC 5J11C 4JFFB 2VZVA 1RK1A 1DE4B 5D7IA 1L8JA 2BERA 3B3IA 4L8SA 1EFXD 2Z92A 5TGBA 3ULUE 4M43H 1F4XL 1D9KA 3J8F7 1NSNL 1HI6B 5DZOA 4F8TA 5EBMB 1FVCB 4YPGA 5FYKD 2E8YA 4K7PX 5IFJA 3QQ9C 1ED3B 3LRHA 4HMEA 1XGYH 2IFFL 3RIAK 3QEQD 3LQZA 4QGTA 3CUPB 3W39A 5H2BA 4Q74A 5HGHB 2MHAA 4POZD 2J5LB 1A7QH 5GS3A 3PL6B 2E6JA 4KVNL 1IAIM 5K9OB 3QH3B 3ORJA 1G9ML 2AV1A 5EWIH 3J7HA 3BKMH 3LKSA 4OLXL 3MBEA 1Q94B 4XI5D 1CS6A 2ICWJ 5FGBC 3EAKA 4Y19A 1NUFA 2H3NB 3BMWA 2UWEE 1I8IA 4GRLA 2R0WL 1EEYA 4PFEA 3TVMA 1HCFX 5DUBB 1XR8A 1GZPB 1A6UL 3HFMH 3WMSA 1I9JH 4H20L 1S7UA 3TJEL 1JF1B 3DBXA 3MYJA 3LN9A 5I73C 3M45A 3MV7B 4RMTA 4U2YA 4XX1G 4JVUA 1A0QL 5C0AE 1FN4B 2F53B 5TH2A 1JZ7A 1DR9A 3DIFA 1K3ZA 2H45A 4N8CL 5CCKH 1MNUL 1YEJL 2LVCA 1TZIB 4R4FL 1CE6A 1UGNA 3L6FB 5FO7B 4PJEF 5A2LH 2UY7A 3C6LA 1ND0A 3MRRB 2BSED 2NY1B 3O11B 3IKCA 4M5YH 1JYWA 2Y07L 2DM3A 4KUCF 1KXTB 1UT9A 1JK8A 5DI8B 1EHLL 2BSTA 1N8ZB 3I75B 3P9MA 4GOSA 3WUZA 3DVGB 3KDMA 3ARGD 3H42L 4KWUA 3OG6B 4OCYH 4NM4L 1AKJB 3IDXL 3EOBB 4O51A 3O6FA 4O9HL 3T4AA 3T0XA 4OCXH 3HG1B 3IDNA 3TT1H 1LO0H 4UI2A 3L3GA 3IFLH 4GH7B 4JO3L 2K3TA 3DSNA 3ARBA 2FJFA 4NQCD 2HTLD 2YD3A 4DKFH 5E2VH 3B2VH 3SDDB 3QUMA 1NFDA 4YFLF 1JWUB 1HDMA 4NO2B 4MVBD 3DURB 2VH5H 1LEKB 2NY4C 1XF2A 4KRPC 4PJ5D 1P53A 4OLVH 3LMJH 3VWJB 5BV7C 5LBSH 3NCCB 4E41B 3QR2A 3HC4L 1I1YA 5EU6A 1IKNC 1RZKC 5DQDL 5FYLE 4X7TA 2VR4A 5D1QC 1BFOA 2HT3D 2A6IA 3HPJB 1I3VA 3O6ML 5H37H 2NY3D 2XTJD 3ULVE 4RWHA 3KJ4B 5A40E 1Z3GH 3UTTA 4WNQA 4J12A 2ZNWA 4WUUD 1L7TH 1NAMA 5JXAH 2GAZB 1AXIB 4WWKC 4MA3B 5DFWH 2QQKH 5D5MB 2DJSA 1KPRB 3E6FA 1YNLH 3TBWB 1WQVT 5IM7A 4MA1B 4AT6A 4N5EA 1BX2A 4KTEL 3GMOA 1CG9A 5DJ0B 2HWZL 1TJGL 3VG9C 4DUXA 4U1GC 5E56A 4XCCH 1OB1A 4ONHA 4GBXA 3H9YA 2EH8L 4PJBE 3E2HC 1OQOA 2PO6C 2X70B 4C59B 3RPIB 1QRNE 4HKJB 1BZ9A 1KJMB 2OL3B 4L3EB 1KEMH 4D0CB 5I8KL 2O61B 1KPUB 2J6EL 3DXAB 3IF1B 1RZ7L 1AO7D 1MFCL 3P2TA 3F8UB 4U1SA 1UACH 3DMMA 4YXHL 1JNNH 3G6AA 5DO2C 4AJ0A 4DW2H 4XCNA 2AXGB 2PXYB 1RAMA 4M6OH 1T0PB 1MLBB 4JFZH 4LPVA 5A2FA 4OZHA 1WSST 1G6RL 2JF1A 4UV7H 5A3IC 1QFOA 4JPVL 4S1RL 4C4KO 3UC0L 3KNBA 2O5ZL 1EXUA 3KWWB 3UZEA 5C0RL 1VADB 3WFHA 2CRYA 2XA8L 4FG6C 1D6VL 3B4NA 4MNQB 3E3QC 3G6DH 3W0WD 2ZCHH 1F4AA 4P3WA 3N1MC 4YK4B 4ZTOH 2J8UF 4U6XA 5KVDH 1KLFA 2PTTA 5D2LE 4PR5B 4I0KA 2NLJA 2LU7A 2M2DA 5I30L 3RWIA 2FSEA 3O0RH 4GXVH 3EYQC 1X9QA 5GGRB 3N9GL 3HRPA 4QRUB 2ED9A 1EUTA 2DWDA 1DQQA 1UEMA 1J1OL 3GBNL 3HI1B 1WTLA 5ILTL 2CUMA 2V2TB 2ARJB 4UU9B 2VLKB 5IQ9B 1G7QA 3VI4E 1NBZB 2EE6A 3ZKND 1GOFA 2B1HL 2BDNL 2FEDC 3OHXA 4ERSL 5KVEL 3PV7A 5ESAB 3MCLL 4XP6L 8FABA 3AROA 1JE6A 2R39A 1PG7W 3CDGA 2BCKA 5FA3B 4UDTB 1T0NA 1GGYA 1ZKAA 3GNMH 2ATPB 4LDLB 4I8DA 5DJ6B 3VRLE 4MAYA 2QHRL 5EOCJ 1S9WA 4DQOH 1I1FA 4NQDE 4N9GA 3FB6B 1FNSH 4W6YB 2QQNL 4JN2A 4YR6A 2O93L 2Y5TA 3C5SA 3DUUA 4OLEA 3NZHH 1XCQA 1UC6A 3AM8A 1MEXH 4Z95L 3ISWA 3QPQC 4J3OC 2XKUA 5EUOA 5F70A 3O4LE 3W5NA 4KUZL 1OAXH 3IB4A 1T83C 1JFQL 2YN5A 3D18B 4BM7A 3F7YA 3EFFA 2DMCA 4ZPVB 3QA3B 4HF5L 1P2CB 5HDOA 3SDXB 4F7CB 1QFPA 2DWEA 4U6TA 3UYPA 3EDFA 3CMOH 3JVGC 3D39D 1NMAL 1QSFD 5IEHA 1W72H 3EYUH 1KLGB 3BEVB 2WWMC 1PY9A 1NDMA 4EDWH 5DFVD 3IDIB 3MRMB 2Y25A 3TIDA 4H1LG 4W4OA 2CKBL 4M93B 1QSED 4OGYL 5FECA 3HZYB 3GO1H 3AXLB 3T09A 1ZXQA 3VXUA 1A4KB 3U9PH 3BN3B 2NY0B 2NZ9D 1XCTA 1TJIL 1CVRA 1I4FA 1X4ZA 4ZO6A 4OZFB 2EO9A 1P7QD 3BT2H 3QIUA 4Z7UE 2FLRT 5F3HA 1T7XA 3UXFA 1CLYL 1RMFH 3ELAT 4ELKB 4M61A 4M62L 1X6NA 4ODUA 3PWPD 4JDZA 25C8L 3WNNA 1T3FB 2CIIA 4OJFL 4QRTA 2PYED 3H9ZA 4Q2ZA 2AJSH 2L0DA 2X40A 4FOMA 2IALB 2W9DL 4JR9L 4YE4H 5C08E 1DQMH 1REIA 1HILB 3ULVF 4BQ8A 4PJHE 3H9SA 1KV3A 5T1KD 4E5XB 1JNHB 3SCMC 1XT5A 2VIRA 1KIQB 4HS8H 4X6DE 3VXRE 2VDML 5J9PA 3RHWF 4XBPB 4JREC 4MSWB 1CTOA 4XBGA 5SWQA 2ZUQC 4U0QB 4X7FC 1FYTA 3HTLX 4LCYB 1BMGA 3SGEI 4JN1L 1JGEA 3TF7C 2DIBA 2OSLB 4AQ1B 2OQJA 5KN5B 3U4EB 2E5EA 5TE7L 3ZE2F 4HFUH 1OTUD 2NY6B 2AJYH 5JQ6H 4GG6B 3C5ZA 1WAAE 5DQJA 1AE6H 4NN6C 4YQXH 3T2QA 1S5HB 2R2BB 2Q86B 1DVFB 2XWBA 3HUJF 5CJOH 3EUUA 3BIBX 5DRNA 2J4WL 5TE4H 3KXFA 1KCSL 3THML 4PIRF 3QI9D 2A2QT 2DI8A 4LKXA 2OBGA 4OLUH 2HH0L 5SX5H 3LEXA 3OKEA 1J8HE 4JFDA 3T0AA 3ZDYE 1LQVA 1H3WM 1WBXA 3VFNA 4QCIB 2DQHL 4EN3A 4M7LH 1MAML 2P5ED 2ZUSA 3SKNB 1GXEA 1MCEA 4J4PC 5EC2B 1FNGA 4LOUC 2ZUWA 1UWEH 4N0CD 1I1AB 1OY3B 4YHML 3BP5B 4JZOA 1BF2A 5KSAD 1RIUL 2EIZB 1JPFA 1YY9D 4O58H 2KDGA 3L95B 3EKCA 2HAZA 1BFVL 2OR8A 4GO6B 3RWJB 1AGDB 4JFHE 3OJVC 3VFPA 3R1GH 4XVUC 4NRYA 4ZUUA 2DQIH 4IMLB 3C2AH 1TZGL 4AEHH 3SJVB 4AH2B 1YY8A 1Q1JL 1KC5L 1K8DA 3T08A 3U46B 1SBSH 1UWXH 4PRPA 4NQED 3GHBL 1CDCA 1IAMA 2FX7H 4XVJL 1FVDA 4P46A 1EGJH 3NFSL 5JOFA 3IJHB 5JA9A 3UTZB 2E7HA 3S96B 4MS8C 5C6WH 3NA9L 5GRJL 1UG9A 1WLHA 1A5FH 2EXWC 3G6JF 4KVCH 3VXTA 2XZCL 4DZBB 1IQWL 2IG2H 3I84A 2AJUH 4JDVA 1CR9H 4Y19E 2XQYK 1BLNA 1H15B 5IKCA 5I71B 2CGRL 1Q38A 4OGXH 1EO5A 2FJGB 3JV6A 1G1YA 1FBIL 3S97C 2APXA 3QXAA 5IBTL 2RCSL 1JGLL 1D5XB 2AI0H 2ORBH 1OPGH 1MY5A 3NACL 1A02N 3FQTB 3QDGE 2VITA 4PJEB 4D8PB 1UB6A 2XICA 1CCZA 4K9EL 4MDJA 4RSVA 3L7FB 5B8CB 1U3HB 3UPRA 2A9MH 4QHNA 2YRZA 4FQ1L 1MJ8H 4BA8A 4ALAL 3B43A 2XZZA 4HKXB 1T7WA 4IRSD 1UXWB 3DX6A 5DFTA 3CJJA 4JB9H 4KROC 4LQFL 2X4TB 1W0VB 5DR5H 5FV2A 3MOAL 4HWZB 4MJ5B 4GAYB 5MENA 5L6YH 1P1ZB 4FMKA 2BXZA 3HE6B 5H94B 3MJ6A 4JZNA 4KZEL 5C0EA 1VFBB 5ICXA 1PG7L 4ORGB 4Q0XH 3QEHB 1N64L 2RGSA 4RDQF 4JRXA 3HAEH 3QJHB 1CDUA 4ODTL 4YXLL 1A7OH 2EZ0D 5IB1B 2HFTA 1SJHB 1FSKB 5C8JA 3HC0A 1N0XL 3ZSTA 2I9TB 1IEAA 2ZCLH 4Q9QH 5B3JE 4HJ0D 4K94H 2IPKB 3K4DA 1VFAB 5CINH 3RVUC 1IC4H 3U0TA 4Y5VB 4Z7NE 4LLQA 3RDTA 4XNMB 4C55A 3VWKC 2WWKT 5AUMB 1KB5H 4OTXH 2I60L 1DEDA 3I85A 1BVKA 4MGXA 1BD2D 4KKLC 3SHSA 4P2RA 4RMWA 4XB7A 1BVLB 5BZDA 1YNTA 1ES0A 1EFQA 2Y9RT 3UTTE 2BRRH 5CUSL 3IFNH 5EU3A 2HKHH 3MNWB 1T0MB 1S7TB 2HYMA 1R3HB 1PG7X 1ZTXH 3DX9A 3GBML 5LXGH 3JTSB 3O4OC 3FAWA 1QNZH 1T2QL 3BZ4B 4NC0B 3T0BA 3ZHLA 4RGOH 3VH8B 5LAXB 4F33B 4U1NB 3BW9A 3MLVH 3NH7L 3LH2L 3RNQA 2QADD 5FUOL 1ZHLB 3G04B 1CLZH 5EFIB 3BPOC 2I26N 4QNPE 3L3OA 1TCRB 3QIBD 2F5AL 3RGVD 2Y1VA 2FL5A 3MLXL 3T0EB 4NT6A 4ZFFB 3EYVA 5D9SB 5JUEH 1UB5B 1AY1H 2MJWA 4ZS7H 4XXCC 3B9KC 3FQRB 3RQ3A 1S9XB 3MV8B 2YSSA 4OZHE 4P2OC 4NJ9L 4F7TB 4PRID 5I16A 2J8UB 4HDIB 3NMEA 5IW1B 1SYVB 2XKNA 1WVZA 1YEKL 3KYMB 1VFOA 3UTSA 1W8OA 3QULA 5JR1H 5D1ZD 4EOWH 3L9RB 1SJXA 3L3IB 4AIZA 3PWNB 5DJAA 5IJVB 2H9GB 1MCIA 5KTEH 1AD9A 4PRNB 3ES6A 1W0WB 1S8DB 5KOMC 2YPKB 1KJ3L 5C0GB 1ZHKB 4KI5C 5E4EB 4X9BA 4LLWA 5FCUL 4EVNA 2GJZB 1OP5H 4UIMA 4K7PH 5D7KD 5EO9B 4TVPD 1EAPB 5ELIA 3P4MB 5GRZA 1B2WL 1F45A 3O45B 4YGVA 3STBA 4L9LC 3G5ZA 3LRSB 4P2YA 3QQ4A 1CGYA 3MXVL 4LSTL 2PW1A 3MXWL 5TDOA 3RVVC 4I48A 2V5MA 1FORL 3CSYB 3FT3A 3KGRA 4G9FD 1IAII 2ZPKH 5DJCB 4YFEA 1FL5A 4OZGA 5FKAA 4ZUVB 3NIFF 3OKLB 1K8IB 3FOLA 3QIWC 4Y7MA 5DC4B 3KPOB 3WKMH 3FN3A 3WDHA 4YHNA 5DJXB 4YBLC 4BZ2H 3VXOB 3GJFH 4G8IA 2MPAL 3SGDI 1EIBA 3TN0A 4TTDC 1OSPL 4KKBD 4NKOA 3Q6GL 4N0UA 5EUOE 3WNPA 5JPMB 3L3KA 2YS4A 4OAWA 2YD8A 2VNCA 1F4XH 4JJ5A 4G6AC 1AI1L 1I8KB 1Q9LA 4GKZB 5C07D 1NSNH 4APQC 4I18A 3DTXA 3L3HA 4TPRH 1B3JA 2N7BA 1KEGL 5IMLA 5JORB 2IFFH 4U31A 1U8MB 3BH9A 3CXHK 1J1PL 5EG6C 4MX7B 5E9DD 1HNGA 4QRSA 3MRHB 3FO2A 4RFEB 3RZWA 5IGXL 3TBTB 4P4KC 4KVNH 4UQ3A 4NKMA 5DUMH 3CZJA 4ELMB 1G7PA 5IG7B 1C12B 4OLXH 2MKLC 3PP4H 5JW4Q 1ZOXA 4JO1L 4X9FA 4JFFD 4OV5A 4CW1A 1C16A 4P2CG 5L2KB 1OP9A 4XBEL 1MCHA 4OIIL 4LCIH 4OCWH 3I6KB 5T5NF 3ARDA 3QUZC 1UH3A 3SDCB 5D7SL 3MA7B 1EEQA 5EZJA 5IVXA 1F6AA 4NC1E 3GSUA 4D9QE 1A0QH 5D70L 2MTPA 1Q9KB 1RURH 1HN1A 5ITBL 2XNAA 1DZBA 4N8CH 5E8EB 4RFNC 4TVSa 3PL6D 3V7MA 1MNUH 1YEJH 5DS8A 3O2DH 1S7RA 4XP1H 1PLGL 5TDPA 2GI7A 3GMRA 3JWOC 1JNLL 2RJMA 4Y8AA 3IU3A 2VDRL 4YHYB 1UCTA 5F89B 3SE8H 4LARL 2H2PC 4IRJA 4I0PC 2Y07H 4WTWA 1UWGL 1FYTE 4F57L 5J11B 3MQIA 4L4TA 4OKDA 3WE6A 1EHLH 4HQQL 4JRWA 1OP3K 5E8NB 2MOVA 1W72A 4NM4H 4WEBL 4OFDA 4G8EA 4CN4A 2QSCH 3MV7D 3OKKB 1RK0A 2GY5A 3MZGB 4O9HH 2F53D 3RIAF 1FPTL 5FDWB 1N5YL 4QNPF 4JO3H 3D3VB 4X7SH 3T0VA 1K5NA 3NCEB 4QXTA 4XH2B 4LLAA 1ZT7A 1FO0L 1QFWM 3LPFA 5JO5A 1BQSA 2NY1D 5CWSA 1X5HA 2ZG2A 4JFDE 1UH2A 3HC4H 2OM5A 1MWAA 3PHQB 4PJDE 5DQDH 1QHPA 2OZ4A 1J0JA 1WZMA 4N0FA 5HXMA 2X1OA 3OL2A 4KQ3H 2YBRB 1K2DA 4KJQC 5DJDB 3T1WA 3VFOA 3U0PA 4HUMB 1AKJD 4HS6B 2YRLA 3HZMA 1JN6B 4YHLH 1UYWL 1HOCB 4Z9KB 4AM0A 1IC7L 1MUJB 3GGWA 1G9EA 3P4NA 4RNRA 1FZOA 4U1JA 5ALBH 4KTEH 4MXQD 4PRPE 3SDDD 1ZVSB 1TJGH 2HWZH 5F1NA 5BOZG 1KSRA 3U7WL 5T3XL 4KHTL 1U92A 2MKWA 2R29H 2EH8H 4RWYL 1I1CA 3WDJA 4EIZC 3VWJD 1T89C 3OKMA 4XPTL 5E2TL 3OB0K 1M05A 4L3CA 4PTTB 2A6KA 3VFWB 4HGKC 4OD3L 2O5XL 3BO8B 2Z8VC 3BP6B 2J6EH 2E7CA 3OR7A 1RZ7H 4KJYA 2NXYD 2P5WB 1A7NH 1LP9A 2VL5B 2X89A 1ZEAL 3KYAA 4Y5YA 2BNQB 3TJHD 2AXFA 1G6RH 5CP7B 4G7VL 5DDHA 3UC0H 4N90E 3AREB 2D7OA 3B2UC 5ACZA 5C0RH 4WO4A 4F7EA 1D6VH 3SQBA 5EBLB 5ESQA 1BAFL 2N56A 4MD4B 1U2CA 2NY4B 3QEQA 2HJKA 5A2KH 5JZ7C 3FQWA 4M6AA 3MR9A 2Z9TA 2YC1A 2CKBB 3IRZA 1MLCB 5I30H 1KNOA 3WIIH 3V4VH 4L3ED 4NIKB 2DF3A 4LHQB 1NCBH 3MREA 4J3SA 1BEYL 3DXAD 3N9GH 5D1QB 5I1EL 5D93C 1MFAH 2FECL 1J1OH 1HHJB 2W9EL 2EC8A 3GBNH 4CJ1A 3STZB 2WQRA 5ILTH 5MENE 4HJGB 4K2UL 4LEXL 5SWZA 2PXYD 4H0IA 5A1AA 1T21B 4XCEA 3MO1A 2VTFA 3LKQA 3DI3B 1KXQE 4V1DB 3WIFB 4D94A 4Q9CA 4WHYG 3IAQA 4LASL 1LO5A 3UCRA 4WWKB 2ZUTA 4ERSH 5KVEH 4JRXE 3P0GB 4PB9L 3MCLH 5DMJB 3KYOA 2OR9L 4XWOD 2XZQL 5D7LA 1KB9K 2HKFL 3MLTA 4MNQD 1EGJA 3RUGF 3VG9B 4U1GB 1TTGA 1NFKA 5E70A 1ZVHA 5IMKA 4EDXB 1G9NC 3FHQA 5D8JL 1RHHA 2DQGL 4DN4L 3E2HB 2PO6B 1IQDA 3PXHA 2NW2B 1CLOH 3W2DH 2PF6A 3V6ZA 3ZDZE 4ZNEE 1LK2B 1P84J 3W9DB 1HXMA 3GSVB 4MHHI 5AYUL 4OV6F 3IXTA 2HRLA 5EA0H 1RZGA 4LLMB 3FCTA 5BO1H 1P7KB 1JFQH 1XF3B 3BI9X 1E4KA 4FZEH 4R0LC 1A9EA 2VLKD 4H1LA 2VQUA 2F8XC 1QEWA 1YEDA 3NIGE 4J3TA 4NUJA 3BZEB 1LEIB 3MOBL 2DL2A 4BH8A 4P57A 2B5IC 1YN7B 2AKRA 1NMAH 3GSXB 2V2XA 3TO4A 2C1PA 1FIGL 4U4BA 4DCQB 1QFUL 2D3VA 1FJ1B 3QDJE 3GHEH 5K93A 5SWSA 3R0NA 4OGYH 1HQRA 3VFRB 1DQJA 2YUZA 2J7LA 3H7LA 3PWJB 2ZCKL 4PRHE 1L7IL 3LS5L 4DGIL 1YMHA 1DBML 1A6ZB 3WLWC 2RHEA 4LF3B 4NWUL 3V6FA 2DIAA 2WBKA 2XWJB 5BVJB 4YAQB 4XRCB 2NR6D 3JUZA 1ZT4B 1T2XA 4U1KB 5TJWK 1E6OL 2IJ0C 4LCCA 1MQ8A 4M62H 1HH9B 5JIHA 4KI5F 2QQQA 3G9AB 5D7JB 5FUCC 4PRBB 4OJFH 5LG1A 5HHOB 2JLLA 3S3SA 2DI7A 5I1AA 1IGCL 1Y6NR 1IKFL 3HR6A 1C8PA 2W9DH 3CX5K 1CFSA 1HHKA 3VGAC 5DVLA 1RHFA 3IXAB 4QWWC 1MHEA 2VR5A 2VDNH 3FB8A 4YDLC 5HDBF 2NY0D 2D03L 5FGCE 3VXSA 4FQQA 4I3RH 4N9OB 1KB5A 1WBYB 3VXQB 1AFVH 2ICEB 2E27L 2GTWB 3QFDB 3QXWA 4NHUB 3QRGH 3NPZB 3BH8A 1ZK9A 4Z7OE 2A6DB 3EZJB 3RZCC 4JN1H 4R8WH 2AEPL 4C58B 2BOBB 3OKNB 1OF2B 5F9OL 2EDXA 2I25N 1NLBH 2YPLB 3HPLA 4LPTA 2EE3A 3PDGA 3IDGA 1WT5C 3DX8A 3CK0L 2VERN 4XWGL 1OTTC 4G8FB 4ETQA 2GEEA 5C0BA 2YD5A 5DSCA 3OG4B 3NFPB 3MJ9H 4QRPB 4X99A 4J7RA 1DN2A 1UQSB 2WMPA 4GRWE 1PQZB 3JWDC 5DYOA 2E6QA 2O5YL 1H3PL 5F1SA 3O2WL 4PBWD 2J4WH 2VQTA 3BUTA 3THMH 4OZGE 4GKSB 1M7DB 2R9HD 3O3EA 2ESVB 3OZ9L 2HH0H 4KRMB 4DVRL 1RUAH 1XH3A 1RSFA 2YZ1A 1TVBB 1CXKA 2AJ3B 3SBWC 2DQHH 3VXMD 3RY5A 3MGOB 4NPYB 4UDUA 3DX7B 1OM3H 3W0WA 4PJGA 1JHTA 1F6FB 5FDYA 5I8EB 1J87A 1TDQA 1ZV5A 3QEUA 4YHMH 1I7TA 3LSOB 2D4FA 5FKPA 1RIUH 4N0UE 2WLYA 5L88H 2AJZA 1NH6A 1CI5A 2HJFA 2YMXL 1BFVH 4PJ9A 1CWVA 1KT2B 4N0YL 4F9LA 3P3YA 4JQIL 1OW0A 3DLQR 1QA9A 1X5LA 3CH1A 4QHKI 2NY6D 1QO3B 3L5XL 1EHAA 3NOIA 1MF2L 1U8LB 5FAAA 3ZTNH 4C56D 3FQUB 1Q1JH 1G9NL 1DVFD 4MNGA 3EJYD 3H9HB 2V7HA 3SPVB 5BXFA 2FZ3B 3X12B 3BQUB 3GHBH 2DD8L 5EZLA 4EI6A 2VDKH 5DHVH 2X4SB 1XGPB 5AEAA 1S7XA 4GS7C 4K7FA 3SCMB 3ZLQC 4XVJH 2H6PA 2A83B 1DQLL 2HT4D 1D5ZA 2VMFA 3NA9H 1G0DA 1AR1C 4JREB 1ZSDA 4DAGL 2ZUQB 5DJ8A 2XZCH 2AXHA 3LHPH 5TE6L 1I1AD 3TZVA 3MV9B 3S4SB 5GIRA 5CEZE 1SJEA 4XX1E 1OGAA 1QSZA 3BP4A 1HSAA 3GDBA 3DVNA 5HI3C 1FBIH 5IBTH 4J6RL 4BELD 2RCSH 5IHZA 1JGLH 1MCOH 1YPZA 4OUOA 2Q7NA 5KW9L 5A2JH 2VLRA 1A3QA 1XF4B 3QDMA 5IVXE 3ZDZF 2KZ1B 2R8SL 4NN6B 2FWOB 3TBSA 5HI4C 3BPCB 3EOAB 5FYLL 1JHKL 4K9EH 3ZKQD 4XMKL 1I8MB 3HLAB 5E6IC 1U8NB 4JPIA 3GJFA 3P9LB 4M6NH 4O00A 2GJ6D 5BJTB 5ECJE 3OJMB 5HHME 3MOAH 1XEDA 4L4TE 4YDVA 3BISA 5KSUB 3LPWA 4IIQA 3U4AA 4PJAB 3GKWH 4KZEH 5J6HA 1PG7H 3MBXL 4IOFD 1P7QA 2WBJD 1ZGLA 5L7XH 2LQRA 4JFEB 2P8PA 1FZMA 4YXLH 4R7DB 3QXTA 4IMKA 2X4QA 2PETA 3FO1A 3TIEA 1N0XH 2PYEA 1U3HD 4M48L 1U8HB 2QBWA 4KUCD 3ARGC 4EUPB 1D3CA 3V4PH 5HDLA 2XY2A 2H8PA 1X5GA 1CXIA 1BQHB 3X3GL 3AUVA 4MQSB 1UM6L 3U4BL 3BGMA 3QB7C 1WCQA 4P5MA 1FNHA 5FM5O 2IANA 4QHMA 4FFYL 5T1KA 3FT2A 3D0LA 3KPSA 3BFOA 2XN9B 3WO3B 1AXSA 2I60H 5L0QC 1CFNA 2HG5A 2RIKA 4GRMA 4PGDA 4X5WA 1B0WA 3S35H 3NCYS 3HE6D 2FX8L 3D2UB 4QY8B 1U41A 4HKBA 2M8XA 4QTIL 4JPKL 5CUSH 4YEFA 1NLDL 1V7NL 1OLLA 1RULH 1SBBA 1RJLB 1MCJA 4LKCA 5HGAB 2E7BA 3I6GA 3TPUA 1KTDB 3HS0B 3EYFB 3GBMH 4Z7VA 5ALCL 3VFSA 3O2DA 1NAKL 1T2QH 4OZFG 1LEGB 5JNYB 1EBPA 1KTLA 2DLIA 2NY3C 3MJ7A 5F44A 1M1SA 1R3JA 2H32H 1II4E 3IS1X 3LH2H 3NAAL 3T8XA 1QKZL 4UUJB 4Y4HC 1VSCA 4KMLB 2VZUA 1DUZA 2J8HA 2KPNA 3IETB 1WF5A 4KROB 3FTGB 4BSVB 3UO1L 3FFCA 1H8SA 2F5AH 5C09B 4G59A 5ERWA 2VKXA 4U1MB 5EO0B 3EO9L 3MLXH 4GXUN 1LP9E 2P5EA 2CRIA 1W0YT 4S10A 1TITA 3MROB 4GJTB 3CZFB 4M8QB 4M5ZL 5FA4A 3MGTB 2I24N 4NJ9H 2R23B 3MLUL 4EUPH 4J2XA 2FD6L 5I76B 4UNUA 1EEZB 1QR1A 5DJZA 4GUPB 1JRHL 3ECBA 2YOCA 3X13B 3LKNB 1TVHB 3SKOB 2YWYA 4FXKA 3MCKA 2YD9A 5IMOA 2MMXA 2ADIA 3QEQE 2HVJB 3QFJA 5BRZA 2FBOJ 4G8GD 2OXHA 4F15C 3VWKB 5CFHA 4OUUA 4NNYA 4GRLC 2HJLA 5IEKA 3WHXA 3TVMC 1TENA 3OGCB 2BVQB 3T0ED 4MMXC 3RTQB 1B2WH 2FB4H 2DJUA 4P59L 1A4JA 5SWZE 3EGSA 5BZWA 3RUGB 4Q6IC 2XWTB 3MV8D 4LSTH 2YD1A 4FABL 3MXWH 5T1DL 4K71C 4U6HB 4Z0XA 1FORH 3O4OB 4JY6A 2RR3A 5GJTL 5D7LE 4OZIB 3PDDA 5J6GB 5E1AA 2BJML 4P5KA 3C6LC 1J5OH 3T77A 4RAHA 2RB8A 4MJ2A 4XNZC 1QBAA 4Y8DC 1F3JB 4ZUTA 4LEOB 2C9AA 4JY4A 2R56L 1A1NB 4OFKA 3OKDA 4HZLB 4NWTH 1D6EA 4L4VB 3BPOB 2WIMA 5HY9B 3OX8A 3ZKXC 3JUYA 3ZE0E 3EW3B 2MPAH 1F97A 1OSPH 2JJUA 4Z77B 3MRQB 3Q6GH 3C09C 4IRSA 3ROOA 1L9NA 2R2HA 4NCC1 2A74A 2KKQA 2X4NA 3FOMA 1WBZA 5DK2A 2F58H 2XOTA 1G7HA 3B9KB 4D9RE 2GK0B 1U58B 5DK3A 4NZDA 4WJ5B 4RISL 5JMRA 1KEGH 4CN6A 3HNSL 3MRDB 4P2OB 4CU6A 5CSBA 5JHLL 5IBLD 3WN5A 3ARVA 4XTRC 2BXYA 4PGEB 5EU4B 1J1PH 3Q6FB 4E42A 3B9AA 4JQVC 2CKNA 4MD0B 4J8RA 5HHPA 1A2YB 4K07A 1I75A 5TF1L 3T3PF 1IJ9A 2YRPA 1FO0B 4HT1L 4R7NB 3VJ6B 2XZAH 4I2XB 3BRFA 3Q5TA 4JO1H 4RIRA 1FC2D 4UQ2A 1U91B 1FE8L 4XBEH 4UNVA 3NGBC 1DFBL 1DBBH 4OIIH 4NRZA 4N8VB 1HEZA 1JPSH 4L9LB 5D7SH 2AP2A 3CFEB 5E2JA 1RZFH 3F58L 1BD2A 2MCG1 3OXSA 4RAVB 3HZVA 3VXNA 2XTJE 4GAGL 5ITBH 3CVHH 4H8WC 3WIHA 4WUUE 4GBXC 2VUOA 3WJLA 4KKNA 5IWLC 4JFOA 1VKXA 1H8NA 1OGTB 1PLGH 3WEXA 1QQDA 4GW4B 3VFVB 3K4ZA 4JANB 1JNLH 3QIWB 2RQ8A 3C08H 4YBLB 3QUXB 4JRYB 4LARH 4F7PA 1G7JA 3BIKA 3DMMC 5E8PA 1UWGH 1HYSD 5L2KD 4F57H 4PJCA 3SOBL 4H0GA 3OGOE 2ICWI 1JV5A 4RGND 1MCWM 4HQQH 2ZOKA 3N06B 4LPXA 2WZPD 3SDCD 4NNXA 5FOJA 1P4LB 5C9JB 2GFBB 1OAUL 4APQB 4IOIA 1PVHA 5FOBB 4MJIA 4Z76A 3QQNA 4PJ8B 1N5YH 4KK6D 4ODVL 4WU7B 2D7QA 2VRAA 5TFSL 3L3JB 5HHQB 1N5AA 2ZOLB 5IHUL 4P4KB 4PRIA 5D6CB 3HR5A 4UINL 1ZLVH 3QP3A 2AS5M 5HVHC 2F8OA 2R1WA 3BP7B 4U3CA 3TO2B 5IOPA 1S7SA 1OTUC 1XIWA 3G5XB 5J89A 3FZUC 3W0WE 4P3DA 4IHOA 4PJGE 5D1ZA 3V6BR 4PRDB 4OIBA 1PW3A 2FDBP 3S36L 3DV4B 1FNLA 2V9QA 2GSGA 3QUZB 1CXLA 4ZFGH 1JGDA 1EO7A 3QI9C 1NKRA 2B7DT 3LKRA 4U1IB 3VH8G 4XHQA 1I9IL 2WUBL 5DA0B 4DFHA 3BE1H 3PGFL 3BJLA 1IC7H 4HJJL 4M7JL 4XAWH 3D3VD 4N0CC 5DGRA 2NX5A 4X80H 3S8WA 4RFNB 4MNGE 1LNUA 1K4DB 5KSAC 3U7WH 4LMQI 5T3XH 1MIEH 3RKPA 2Z93B 1LWRA 4QXUH 2BNUB 2EDOA 3BKCH 3ARRA 5E2TH 3AM8C 4YIQB 5J4MA 4JDTL 4IS6B 1E4XI 4XNQA 4I0PB 4OD3H 4XMLH 5FUZL 1FZJB 4H26A 5T1LA 2C3XA 2HFGL 2OX5A 3VD4A 1EMTL 1ZANH 4X4MA 1JNJA 2VZTA 4L8DA 1ZEAH 3L5JA 4EKXA 4YO0B 1G84A 2Q3ZA 3MUHL 5DEFA 3MJ9A 3QUML 3S36X 2VDOL 3IFPA 4LVNC 4X6CB 2VLRE 4LLDB 3QDME 2G9HA 3PIQB 3ZE0F 2R1YA 4QO1A 1RIVL 4L5FH 3O3BB 3QXDA 1TIUA 2BX5A 1J86A 1LE5A 4WRLA 3DHJA 5ICYB 2ICCA 1ZS8A 5J13B 5GSVB 2AJVL 4C83B 1MJJA 4EZMA 1BAFH 1LO2L 3D39E 1UM5H 4PGCB 5IB2A 2MFNA 2NY2C 1YNKL 3LN5A 4GG8A 2K7PA 4PUBL 2AV7B 3FRUB 3QIUC 1U6AL 2E9JA 5ITFA 2I27N 1NAML 1BEYH 4Y5XA 5I1EH 4EI5A 2P5WD 1XF5A 2W9EH 5IB4B 5KJRL 4JFXB 1NCAH 2LFGA 4H5SB 3LIZL 3R8QA 4K2UH 4LEXH 4V2CB 4PJFE 2BNQD 3BDYL 1BIHA 5FO9B 4LCUB 2CRMA 4PY8I 5CEYA 4LASH 3MMEB 4FXGB 1XGQA 3RWEB 4AMKL 2P42B 4JFYA 1CQKA 3ARED 5DVKA 2JB6B 1K4CA 2OR9H 2XZQH 5EBMA 3PWPE 3OAUH 1GGCH 3MLSH 4CRPA 2DLTA 5KAQF 2ZSVA 3SN6N 1CD1B 2BHZA 5E00B 3D0VB 3MJ8B 4DJMA 4HWNA 2PYEE 1KCGC 1YYLL 2ADJB 2DQGH 1YC8A 4DN4H 4RGMC 1A1MA 2DDQH 4MLSA 2VLMD 1GPOL 4XC3L 5K9OA 3C8HA 5D1QD 1PY4A 2IANE 3S7GA 1QBLH 4HXBL 3KPSE 5AYUH 5K9KA 5EORH 3O3AB 5AZ2L 2JELL 2UY6A 3V7AG 3MYZA 1RVFL 1VA9A 5DEZA 1WIPA 4RMUA 2H3NA 3PP3K 3MOBH 4WW1B 4NP4L 5I2IB 1ACYL 5DUBA 3QHTC 5I1IL 5F7DB 3BAEL 3MV01 4J1UB 4MA7L 5EBWB 2XA3A 4OCLC 3FB5A 1NBVH 1JZ5A 3NFNB 1JF1A 1CGXA 4Z7VE 5GGUA 3CXDL 4M3JA 1FN4A 2F53A 4S1SH 5JOPD 4DUWA 2QEJA 5I8CA 2ZCKH 4DGIH 1DBMH 2PO6D 5GGSY 2WUCL 3LKOB 4NWUH 4D3CL 4NQVB 2DOCA 5C0NC 1YEGL 4Y2DA 2C4FT 4L29A 4OLYH 2QJDA 2AJXL 4LSPL 1XGRA 1YQ2A 5D93B 1L0QA 1J0YA 5DO2D 1IZKA 3FFCE 4TSCH 1EJOL 2BSSB 4XNXL 3MLWL 2P5EE 3S5LB 1SEBA 3NZ8A 3UYOD 5F8QC 3W11C 3P73A 4QYOB 2AK4A 5KG9B 1RZJH 3PWVA 1MFDL 1N8ZA 3I75A 2ADGA 4QOKA 3DVGA 1IGCH 1UM4H 1IKFH 5GS0H 5HVFB 1UVQB 3AGVA 5LKNA 2PN5A 3EOBA 4I77H 1IGJB 1DANT 3V0AC 2VZSA 4WW2A 1ROWA 4X6BB 3RGVC 3HG1A 4P46C 5FGSA 3WJJC 1WUNT 5GRVL 1JGVL 5SX4H 3ULUH 3WUWA 3RA7H 2PCPA 3RP1A 3BPNB 3QFJE 4JLRB 1Z0NA 5BRZE 4ZAKB 3EYQD 1T1WB 5J0BA 2E27H 1C5BL 3DURA 3PV6A 4M7KH 4NQEE 3QT2A 1A7RH 3AMKA 1R5WB 3DARA 3WHE1 2AEPH 5L8KB 1IM3A 3GUTA 4R4NC 4E41A 2Z31B 4R90L 4DOHE 4FP8L 4R0LB 5ICZB 5E08H 2GTZB 5D7JD 5LJYH 3CK0H 3HPJA 2FEDD 5HHOD 1YUHB 1ZE3C 2B5IB 5A16B 4MCYB 1HCVA 4X4YB 3OAZH 1P9MA 2RBLA 3H2WA 1MCQA 4I9WD 1KFAH 1FP5A 3TJHA 3AVEA 1OCWL 2R0KL 4P9ML 3O2WH 1C5DA 4LCWB 3UYRH 4OQTH 3V79C 4G7YL 2W07A 1KPRA 5SX5K 3OZ9H 1D5IH 1Y0LB 1FFOB 4DVRH 4LGSB 4PV9B 4JEGB 5CJ8A 1X5ZA 2E9WA 3ZDXF 3RWCA 2DQTL 5TDNB 3MC0A 5E94A 1A8JH 4AY0A 3ARZA 2VABB 1CFTA 2E8ZA 3WLBA 1BJ1H 3BZFB 2X70A 1L0XA 2AEQL 4PYGA 4X6FA 3CFJB 4XCYB 1L9MA 3RL2B 3RPIA 4BQ9A 2BY3A 3AC0A 4AIXA 2OL3A 3OSKA 1CDJA 5EU7C 4D0CA 4ZS6C 5GS1C 4ZUWA 2O61A 4GMTL 3DXAA 4N0YH 5DUPL 2P8LB 4JQIH 2F15A 3GMQB 2QHLA 4ONGL 4UTBL 2VXQL 2VAAA 4Y16B 1MF2H 1V7ML 4QRPD 2L4OA 2WWMD 3DV6B 2AXGA 1GH7A 3MNVB 3VRIB 1UWXK 1NGYB 1MLBA 1I1RA 3VGAB 4XHJC 3VE0B 4PJBB 1YEEH 3N1QC 1EA9C 2DD8H 3GJEA 4PJFF 2ESVD 1FG9C 2Y06L 1DQLH 4YUEL 3QNYB 4PJXA 4FQLL 4DKEH 1H3TA 4ZXBA 3LQAH 2PYFA 1C5CL 3VFGH 5GZOD 3PQYA 1WC7A 2R4SH 1JL8A 4PR5A 5TE6H 5IROA 1J88A 2H2SC 1DSFL 4HUUA 3UJIH 1QSVA 5BS0B 2P45B 1T5WB 1NFIB 1CFQA 5GGRA 3G9VA 2EIEA 4QRUA 2DYPB 3H3KA 5CEXB 4L1HA 4NZUL 4TSBL 3AS0A 3VD9A 5C6PB 1I9RH 4UU9A 1BD2E 1SEQH 5IQ9A 1BBJA 3D85B 2R8SH 5C7XH 5HYIA 1CN4A 5D2LB 5FYLH 1FVEA 1JHKH 2EDYA 1BJ1J 2HLAB 32C2B 3BQUD 3SDYL 4HCRA 4XMKH 1FNEA 5ESAA 5GHWL 3SCMD 4RDQG 3UEZA 3A6CL 2GUOA 3KHQA 4BFBD 3ULVH 4U6YA 3EJZD 5FA3A 3MUGB 5MERB 3GSWB 4ODWB 4PGBA 4K3EL 4M1CC 5DJ6A 2YUWA 4AG4L 1ORSB 2OP4H 3MV9D 2V5YA 4H25A 1CT8B 1CIDA 4PJCE 1TQCC 1F2XK 3PL6C 1HHGB 3DO3A 3HC3H 4F7MB 4NJAH 1T1XB 3WNOA 3MBXH 4HUNB 1ONQB 1AXTL 1O7VA 3ILQC 4NQXA 5DMKB 3D18A 2ZP0T 3D1MC 5KOVC 4MJIE 3FQNB 1H8OA 3QA3A 3SDXA 4DEPC 4F7CA 4MNHB 4WEUD 5JW5A 1S9VB 4O2CB 4M1GH 1DJSA 4IDJH 4OKVB 1EFXB 2P7TB 4J3WA 4M48H 1TMCB 4UT9H 4PRIE 3IDIA 1CL7I 3UZVB 3X3GH 1UM6H 3TYFB 3U4BH 1Q0XL 3O4LB 2F19H 4R4BB 5CIPH 5GJSL 2BVOA 2HP4A 1G7IA 3AXLA 3FT4B 4FFYH 1L4IA 3TFKD 5J57B 4F3FA 1VACB 5FYJD 2DTML 3VDBA 1A6TA 2FX8H 3CU1A 3U48A 3MX0A 3LN4B 4OZFA 3UROR 5LWYL 4QTIH 2P1YA 2VWEE 2NY1C 1NLDH 1V7NH 3CVHA 2DQUL 3K2MC 4LRIA 4JFED 3SO5A 3IFOB 1IC5H 1JHLH 3SKUD 2XY1A 3NCYP 5D7KE 4X0KB 4TVPE 2Q7YA 2X7LB 4ZDHB 1T3FA 3H0TA 1UJ3A 1VERA 3GSRB 5DJYB 1FL3A 4M43L 2DQDH 3QSKB 2VDQH 1DQDL 2QQLL 3ABZA 5E6IB 1TTFA 4ISVA 3PJSA 1BECA 1JUFA 4MDIA 3NAAH 5IJKA 1QKZH 2EXWD 4DKAA 3ARFD 2ZUVA 1NEZG 4RBPH 3TN0C 4HG4J 3CFBA 2CLRA 5CMAB 4PP1D 4ZQKB 5CD3A 1JNHA 1LD9B 2XN9D 2IH1B 1KIQA 3UO1H 5D2NE 1U0QA 1H5BC 3REVA 4XBPA 3SDDC 4MSWA 1A7QL 5MEQA 2DAVA 2EKSA 5IQ7L 5JXEC 3HI5L 2EICA 3MODL 2VE6A 5J56B 1A14H 4Y1AB 3K3QA 4M5ZH 3VWJC 1L0YA 5C08B 5D96B 5KN5A 1R0AH 3U4EA 3MLUH 2BC4A 1AHWB 2FD6H 1MCKA 5C92A 2NXYC 1JRHH 4NO0A 4X6DB 4KDVA 5HYJB 1I9JL 1DVFA 3SE4C 4POUB 2V6HA 3QNZB 3JZ7A 4XMPL 5DK0B 2P49B 4XXDB 5HYFA 3FFDB 3PF2A 5EIIB 3IVKB 4KROD 2GITB 4KXZI 4TOYH 3WFCL 4ODXA 3WNKA 5C09D 2YXFA 3C6SA 4G43A 5F88B 1OP5K 1J8KA 1YECL 4NQCB 4QCIA 1JMZA 4AENA 4A6YB 1OD9A 2EYRA 3QCTL 3TA3D 4A2MA 4PJ5B 1NGQL 3TNNA 2I07B 3BP5A 3DWTA 5DRZB 35C8L 4JFFE 5CSZB 3HMXA 4FABH 5JLZB 3L95A 4CL7A 4U1LB 4PRAB 3GMNA 5T1DH 3WFDH 1R3LA 5F7MC 3RWJA 2DL9A 2X4UA 1UADC 2NY3B 3PGCB 3I3BA 2A38A 4GW1B 2CDEB 3SJVA 4AH2A 4OCYL 1B0GB 1M71B 2EDWA 3DI2B 1R5VA 2R56H 4CGTA 4Y4HB 3RWDA 3TT1L 1LO0L 3VWKD 3WNLA 4CVXA 2YA0A 1XGUA 1RK1B 4Q7DA 5D7IB 3FJTA 3B3IB 4L8SB 5TGBB 3IJHA 4KKLD 3B2VL 5JHDA 3D25B 2J12B 4RA3A 5IFAL 4MB3A 3RTQD 4YK4C 4HAFA 4LU5H 1ZVYA 1F4YL 1H15A 4UNTA 4HPYH 5LBSL 3LDBC 4RISH 3W39B 1AJ7L 2VXUH 5T5NG 4ZPTA 1AO7B 4WHTB 3FQTA 3MV7E 4HK0B 1Z3GL 4G80A 2FYYA 2F53E 2C3GA 3RL1B 4PJEA 4LLYB 4D8PA 3LKSB 3VFMA 1XFPA 3MBEB 3LKPA 4HMDA 4HT1H 5B8CA 1KCVH 1OAKH 1U93B 4GRLB 3F5WB 5LQBH 1TTUA 4R26L 3TVMB 5ISZA 1XR8B 1FE8H 4P48A 4HKXA 1FL6B 1BBDH 1DFBH 1CTNA 3DBXB 3MYJB 3VGHA 1B6UA 3B9KD 3U1SH 4MJ5A 4GAYA 1YN6A 4LSQH 4Q6IB 1ZA3A 1TPXB 3DIFB 3F58H 4LLUB 4P2OD 5CJQL 5H94A 3I02A 2H26A 1KEML 4K71B 4GAGH 4QOKE 3Q5YA 3W9EA 5CKAA 4ORGA 2DLEA 1JNNL 3KG5A 3ZL4H 1T4KA 4DW2L 3B83A 3C6LB 2BMKA 3HG1E 3WFZA 4M6OL 3IKCB 5JPNA 1KTRL 3STLA 5D1XA 1SJHA 1M6OA 4JZJC 1CXFA 1MJUH 3S88L 3ZKXB 3QISA 3T04D 3RJDA 2IPKA 3SOBH 5I17B 3C09B 1VFAA 3ME0A 2ZCHL 4E41E 4ZTOL 2CQVA 5KVDL 1RUMH 5J1SC 3L3GB 4GXVL 1BQHG 1BVLA 4G6KL 3ARBB 3LB6C 1A6AB 4OCRH 2DB8A 3QUMB 4FA8A 1NFDB 1JFMA 1HDMB 5TFSH 3MNWA 5IHUH 1PKQB 5CEZL 1INEH 5DD6A 5D5ME 4YEEA 2KQNA 5EU6B 3O6KH 3WNMA 2XQBL 1ZHBA 4GKNA 5F21B 4TUJA 2H41A 3BZ4A 1P6AB 5T3XD 2Y23A 3VH8A 1BFOB 3QUXD 4JRYD 1IGTA 4PLOB 1QSFB 5LAXA 5I19H 4CVWA 4YXKL 2MWCA 1JZ4A 2AW2A 2CXKA 4N1EA 1CYGA 3S36H 2IGFH 3GNML 1I3RA 3G04A 2CXGA 4HLZG 4W6XB 4G6AD 4RMVA 3V52L 1EEUA 2EDBA 2R9HC 1H3GA 1PYWA 3DXAE 1IILE 1TCRA 3E6FB 3PGFH 4PJ8D 5IM7B 4JGMA 1AQKL 3QHZH 1BX2B 1KCUL 4HJJH 5J3HD 3NZHL 1MPAH 1MHHB 1CG9B 1HKLL 5D9SA 1UB5A 4UAOC 3UJJL 3AB0C 3FQRA 4OFYD 4KFZC 4GBXB 4ONHB 4F80A 3MV8A 3O2VH 4P4KD 4F7TA 4ZFOA 2ITCA 2J8UA 1F11A 3N85L 5FV1L 5IW1A 1BZ9B 1Z9SA 1TLKA 4I5BA 2HRPH 3GMMB 4XNYH 1W72L 5FF6A 2YD2A 4G9DA 3DMMB 3G6AB 3QHFL 4UOW1 1OT2A 3L9RA 1FV1A 2HFGH 2NQCA 4XCNB 4S11A 2H9GA 3EJYC 1S7VA 1Q8MA 3QUZD 1W0WA 3GO1L 1S8DA 3QUYA 1EVUA 5C0GA 3U9PL 3QUMH 1A22B 2DBJA 2HT4C 1J0ZA 2GJZA 2VDOH 3KNBB 4LPYA 5EO9A 5GGVH 5F71A 1EAPA 1P84K 1X7QB 3P4MA 3BEWA 1MHCA 1Q9WA 2XKSA 3NIDE 5F9JA 3P4LA 1VHPA 2D7TL 4HUXA 4OQTA 3LRSA 3GSOA 2L7UA 1JF5A 3C9NA 4WV1C 1RMFL 1MWAL 1HWGB 1MJ7L 1GIGH 2AJVH 2NLJB 4GAFB 2OZ4L 1LO2H 1MRDL 2F54B 1G1CA 2F5BL 3RWIB 5HVHB 1MFEL 4LVEA 2CK0L 5F7YC 4ZUVA 5F9AC 2W0FA 2IH3B 3CFDA 4I0PD 1U6AH 2DWDB 1DQQB 5I15L 1NAMH 1QLEL 4YE4L 2X4RA 1VGKA 5I75B 1K8IA 3JTTA 2Y6SC 4FQHA 2A1WL 5KJRH 4NRXB 3ALWA 4JKKA 3IDJA 1G7QB 2C4XA 3KPOA 1KENL 3QJFA 2DMBA 4HS3B 4GLRH 1QOKA 3VXOA 4PJ7F 3OHXB 4HS8L 4XNUL 5JPMA 4BSWA 4IM8A 2WANA 2EDLA 5E99H 4KJPC 8FABB 4HEPG 4AMKH 3CDGB 5M7QA 3CDYA 2BCKB 5LCVH 1I3GL 1T0NB 3OAYK 1DBAL 3SDXE 3HNVH 4K94C 5I71C 4M9OA 3A6BL 1S9WB 1I1FB 4RMQA 1U8MA 5TQ2H 1I7UA 4WHDA 2D9CA 4HBQA 4JN2B 4YR6B 2WP3T 3C5SB 4IOFC 4M03A 3FL7A 4S2SA 1XCQB 2WBJC 3EFDL 4RFEA 5HJ3B 5EUOB 1NGZB 3VU2A 4BH7A 2I5YL 3BHBA 4HXBH 2EKJA 3EFFB 2JKXA 5CJOL 2JELH 3KPPA 2DWEB 5IG7A 3QQ3B 4KJQD 2FIKA 1MSPA 1RVFH 5D6DA 1BQLL 1LHZA 3NCMA 1RFDL 3VGEA 1AGFA 4LVNB 3VA2C 4M7LL 1NC4B 4NP4H 4YFDB 1NDMB 1ACYH 4JKPH 4HH8A 4LPUA 5KVGH 5I1IH 4HGWA 3TIDB 3TWCL 4PLKC 4HWEL 1UWEL 3SDCA 4JJHA 4MA7H 1KOAA 1X5FA 2I9LA 3CXDH 4NKDA 5DJ2A 1PAMA 3VXUB 2VXSH 3HE6C 3OQ3B 5CP3A 2HMIC 4ZG1A 4N8VG 5I1DB 2NY2B 1I4FB 2WUCH 3R1GL 4HLJA 3EDKA 5IVNA 3QIUB 3W5MA 1YEGH 5HSFA 3EHBC 4LSPH 5AWNL 1HHIA 4PJ9C 1S9KC 1IAKA 5J8OA 4F9LC 5D5MF 1EJOH 4HIEA 4XNXH 1H3UA 3MLWH 4OCMC 4QRTB 1EGJL 4M8VA 1A7BA 3RY6C 4XVSL 1I7ZA 4U1HA 2LU3A 4KVCL 1A6PA 3QCUL 5E8NA 2HVKB 3B2UD 2AJUL 4GAJH 3H9SB 2L7JA 5GZND 3HUJA 4PV8A 3OKKA 5C70A 4B41A 1IRAY 2VIRB 3ARWA 5JZ7D 4GG6E 5CIPA 1JGVH 1TVDA 3IKKA 2AI0L 2E7LC 1QVOB 4XH2A 4G6FD 1JGEB 3O9WA 1Q0YH 7FABH 1N7MH 2EDQA 1V3LA 4P4RB 2WK2A 3UJTL 3GSNH 4R90H 1NMCC 3PHQA 5FGBA 5DD1H 2DICA 4FS0A 4JE4B 4XPBL 4WVRA 3M8OH 3SQOL 5HD8C 1VDGA 5DQJB 3HB3C 2OR7A 1GJIA 5F3BA 5DJDA 3BDXA 4JB9L 5DRNB 3IT8D 5DR5L 4NN5C 3KXFB 1AGEB 1JN6A 1OCWH 5IT2L 4LKXB 2FBJH 4HPOH 1I7RA 4P9MH 2R69H 3LEXB 3OKEB 3MRFA 4JFDB 1WBXB 5HPMB 4G7YH 3VFNB 1S7QA 5DWUH 3QZWB 3SJVE 4ODHL 3RFZC 4O4YH 1FNGB 4HIJA 4IRZH 3QUKA 4ZAKD 4WDIB 1TNNA 2E9BA 2DQTH 3G6JA 4X4XA 1A7OL 1T04A 4MXVF 3TBYA 1IGML 4Z8FL 2AEQH 2Z31D 4PTTA 3VFTA 5EU5A 5JHDE 3VFPB 3BP6A 4NRYB 4ZUUB 1SYSA 5DUPH 3F12A 5CINL 1YY8B 1K8DB 4UTBH 3PHSA 2VXQH 2YD4A 1W8NA 2BNQA 1KB5L 1GVIA 4MMZC 1BOGA 4GT7A 4LCWD 4K7PY 3RGVB 1FVDB 4P46B 5JOFB 1T66C 3PG2A 4DFIA 5I1CH 1NCCL 2Y06H 3O8XA 3RKDD 3T2NH 3WLWD 5T3ZD 2BRRL 2RFXB 1KXVC 4YUEH 3IFNL 2BVUA 4PJEE 5FYLD 2HKHL 5EBLA 4FQLH 4JDVB 4MD4A 1BLNB 1C5CH 5IBLC 5JMOC 5LXGL 3ETBF 3QXAB 2CKBA 5ISZE 1MLCA 1IKNA 1BFSA 1HE7A 2X42A 3O3DB 5D1QA 1DUYA 3EBAA 5F7FA 4M4RA 1HHJA 4TSBH 3Q0HA 3STZA 2VITB 4Y16D 4HJGA 3SGEH 3QO1A 4UTAL 1T21A 4HUKB 4MDJB 4V1DA 3WIFA 3UPRB 4QHNB 4QWWD 4WWKA 4HIHA 2KQMA 3SDYH 1QRND 3ZZ1A 4HBCL 3A6CH 3QG6B 5JUEL 3DX6B 4ZS7L 3TNMB 1JI1A 1NGXA 5FFLA 4K3EH 4QHUB 4EDXA 3MGAA 1QG3A 5H35A 1WJ3A 2D7PA 3MRJB 3QAZC 2LAGB 4S1DD 3E2HA 1A3RL 4G9FB 4JZNB 5BS0D 4HUVB 1KPVA 4MB5A 3AAZA 1V8HA 5ICXB 3U36B 2NTSP 1U2HA 3GM0A 2DYPD 4JRXB 4EOWL 3W9DA 3TPKA 1OTTD 1AXTH 5H8DA 1NANH 4W4NA 3OJDB 5ADPH 1P7KA 2XQYG 3AU1A 3D85D 5C8JB 3HC0B 2DN7A 1IEAB 3KHOA 3X3FH 4RGNC 2W92A 3RDTB 3PWLB 1Q0XH 3P77A 3E3QA 4XZUB 5D71H 3VFRA 1BGXH 5F72S 1BVKB 3PWJA 4P2RB 2DTMH 5BZDB 4BK5A 4LF3A 1YNTB 1ES0B 2G75A 4GG6F 2JIXA 5DVNA 4YAQA 4K3JL 4XRCA 5EU3B 5T33L 3FHAA 3RVWC 5LWYH 1U8JA 1ZT4A 4WI8A 1JGUH 2EECA 3VMOA 4YHYC 1WICA 3DX9B 4BZ2L 1DL7L 3T0EE 4Z7WF 2WINA 3LV3B 1NEZA 4UMGA 5FK9A 1EVTC 5EULV 3GMPA 5DQ9B 1DEEB 5HHOA 4QEGA 3MV8E 5FO8A 4Z7QE 1DQDH 5FYJU 3RY4A 2QQLH 2J8UE 1HINH 3KS0J 1T20A 4TPRL 3S5LG 3TCLA 3O4LD 1AR1D 5FIEA 8CGTA 3IXAA 1WK0A 1M7IA 3MNZA 4XVTH 2VOTA 3L3OB 2FX9L 3BVNA 5FGRA 2YZ8A 3A67L 3EDJA 4JAMA 1WBYA 3EOTL 1TQCB 3VXQA 5HI3D 4HMCA 1WWAX 5IF0A 3FAXA 3QFDA 4NHUA 5J1AA 5IQ7H 3HI5H 3MODH 2YSSB 5DUML 1MHPL 5I16B 3WN5C 2BOBA 2NCMA 1T83A 1OF2A 2DLGA 4OF8A 4G6JL 2YPLA 1DBJL 4K3GA 3PP4L 4DEPB 3UTSB 3DROA 1VFUA 3QULB 3VA6A 5IW6A 5HI4D 3G08A 1RJCA 2A0LC 4LCIL 5DVMA 4OCWL 4HULB 5M94B 4JG0H 5I1JL 3NFPA 1Y6KR 4AIZB 5DJAB 5E6ID 4F8QA 4ZUSB 4WUKH 1UQSA 1U8KA 3MRCA 3ES6B 1PQZA 4DKDC 1OAQH 1VPOH 3I9GH 3KPRA 4XMPH 2FO1A 3FRPG 4M02A 3QDGA 3IU4L 4G42B 3K8LA 4AIOA 1RURL 1M7DA 4M4PA 4PJ7B 2IF7A 2IBZY 3WFCH 1OD7A 4C4KT 1TVBA 2MCPL 2Z8WC 1YECH 3MGOA 3M17A 1UKTA 3DX7A 2W0LA 1IEHA 3QCTH 3O2DL 1V5JA 4XP1L 5I8EA 4Y1AD 1NGQH 4NFBA 5CAYB 35C8H 3LSOA 5C08D 3SE8L 2GIYA 4YNYB 3HMWL 3FT3B 2SEBB 1TZHB 3P30L 1D5MB 1FL5B 3WJLC 5FKAB 3VXRD 5HYJD 2Y5EA 1U8LA 4HH9A 3FQUA 9CGTA 3FOLB 1LILA 3CDFA 2B4CL 2QSCL 4G8IB 4KZDL 3V7AE 3TN0B 4CBPA 3IJYA 4NBZB 4NKOB 3SCMA 3N0PB 3VGFA 3ZT6A 4OAWB 3AREC 4X7SL 1R24B 4ZO8A 2X1QA 4JJ5B 1H5BB 1Q9LB 5IFAH 3DTXB 3L3HB 2GT9A 3P0VL 5IMLB 1PZ5A 3TF7A 1F4YH 3D6GA 3SKMA 3MUZ1 3HZKA 3BH9B 5L2KE 1AJ7H 4QRSB 2ITDA 3FO2B 2NY5H 2NXYB 4JGUA 1J8HD 4EXPX 4UQ3B 4NKMB 4KQ3L 1RJYA 5ID1B 3CD4A 2CSPA 1GZQB 5CHNA 4GFTB 2HN7B 1G7PB 2FWOA 1R3IH 3BRGC 5F9DC 1WZ1L 3EOAA 4YHLL 4Y4HD 5JIPA 3T1FA 15C8L 4OV5B 3BUYA 1I8MA 5GGTA 1BHGA 2ZKHL 5ALBL 4R26H 4S0SD 2VR9A 5BJTA 4J4PA 5C1MB 4GRWH 2R2EA 3C60A 2X1WL 2R29L 1KJVA 3ZE2E 4BJLA 5MEOA 1F6AB 1X5XA 4LHUG 2YHGA 2XNAB 5KSUA 5IP4A 1VGEL 4QRRB 5CJQH 2GCYB 3K46A 4V3DB 2XV6B 1A7NL 5DS8B 1TCMA 4O2EB 1S7RB 3HUJE 4JFEA 5TDPB 4EIGB 4O02H 3MRNA 5ADOL 3IU3B 2CLVA 2W38A 3MBED 4IRJB 4MXWL 4Y19D 3S88H 4GRLD 5A2IH 4HC1H 2IMMA 1IAIH 3TVMD 2OJEB 2YUVA 4HUWA 4MS8A 4LQ1A 5EN2B 1W72B 3FN0L 4Z7QF 3TH4T 5L9DL 2IBZX 1WFUA 4KJWC 3TESA 5GS2D 3LDBB 3RWHA 1AP2B 2XTLA 3WIIL 3V4VL 1BREA 5ENWA 1CU4H 1KBGL 3D2UA 4G6KH 1NCBL 4NGHL 1NCUA 4QXTB 3K81A 1ZT7B 3RPKA 1MFAL 5EZIH 2VISB 5KS9F 3EYOA 1RJLA 4E0RA 4YBHA 3C6LD 5CEZH 5CWSB 1KTDA 3EYFA 2UYLB 5D7JC 4LBEA 3ZYZA 2XQBH 1MWAB 5JNYA 3Q5OA 4G5ZH 2B20A 1OT1A 4E9LA 4F9PC 5I1LA 2VXVL 5C0IB 3G6JE 4N0FB 4YXKH 2EYSB 2WIIA 4NN7C 4WFFD 3VFOB 2D0GA 4JKLA 3WIHL 3V52H 5KSBF 4BSVA 2VN4A 3GGWB 5DC0A 4HX1B 4RNRB 4KKAD 4LVHB 3QRFM 1CLOL 3W2DL 3ARBD 3DYMA 1AQKH 1KCUH 4U1JB 4JHWH 4KK8C 4XTRD 4PG9A 2GW5A 1HKLH 1KIPA 5BVPH 2QV2A 5F1NB 4JM2C 2X05A 3CZFA 2BNQE 2WAHA 3UJJH 5EA0L 1LVEA 5BO1L 3MGTA 4LFHD 4FZEL 2R23A 1JZ3A 3OKMB 3N85H 4L3CB 5EU6D 3BOVA 3V2AR 5I76A 1EEZA 5BW7C 5INCA 1TETH 4JZJB 4CJ0A 5DVOA 3OR7B 2Z91A 4KJYB 3GSNA 1FGVL 2XT1B 1LP9B 2B1AH 2MQCA 3QHFH 2HVJA 3F65A 5CJXC 1CLCA 3GHEL 3UTTD 3QYCA 4WENB 2VLME 3BSZH 3VWKA 2VO5A 2ZG1A 2AXFB 3HHRB 1KG0A 3RNKA 3WXWL 1QACA 2BVQA 4K9EC 4LSRH 4N5ED 3S3PA 5DRXA 3X11A 5ACZB 5I1HL 3LOWA 4X8JB 4F7EB 2QSVA 5GZOC 2D7TH 3GIZH 4V1DE 4FFVD 1SM3L 4GBXD 3RUGA 2HJKB 1MWAH 4YX2H 4ELMF 2G5BA 1MJ7H 3REWA 4MHHG 2OZ4H 2R0LL 3FQWB 1MRDH 1TQBB 3DPBA 1FRGH 2YC1B 4U6HA 2F5BH 3CSPA 2EC9T 3CC5B 4Y2DC 1MFEH 2CK0H 3QWRA 5JQHC 1EBAA 5KAQG 3DMMD 1V3JA 2BSRB 5I15H 1QLEH 1FFNA 2R2CA 5DD0L 1UKQA 5JOPE 3OMZA 2A1WH 4TVPL 1A1NA 5SWZB 4XCEB 1YJDL 3LKQB 3MO1B 2PW2B 1KENH 3BQUC 4HZLA 2OTWB 4TUOA 2VDNL 1Y6MR 4L4VA 3VDCA 3V5DA 4OGAC 4XNUH 5CZXD 1DLHA 3EJZC 4I3RL 3MRQA 1U8OB 2Q3AA 1QLFB 5CS7A 1AFVL 2ERJC 3VXMB 3QRGL 1UCBL 1T7ZA 1I3GH 3MLTB 4TRPL 1DBAH 2QSTA 4R8WL 4UAOB 3B9KA 4KDWA 4XXCA 1U58A 2CD0A 3AB0B 3LS4H 4NDMA 5E24E 5IMKB 4RX4A 3A6BH 1MVUB 3MRDA 1NLBL 2F54D 3ARPA 4OF6A 5DHXB 2V5TA 1E27B 1IQDB 4PGEA 5J1TC 4GKOA 4MD5A 3F7PC 1CICC 4XT1C 4XAKE 3V6ZB 1J0IA 3EFDH 1HXMB 2YK1L 3FZUD 3E3QE 3MJ9L 3IXTB 4C56B 1RZGB 2I5YH 1BWWA 5TQ0L 1KIRB 1A9EB 2DQCL 4XPFL 3KYKH 3KPNB 2VDLH 1FO0A 5DMYA 4R7NA 3VJ6A 4WFGD 4Z7WB 1BQLH 1PJ9A 4I2XA 4S1QH 3H3BC 1NC2B 1RUAL 2AKRB 1RFDH 1R3KB 1E4WL 3TO4B 4FTVA 3DUHA 2ENSA 1OM3L 4PJDA 4N8VA 3TWCH 3PE9A 2LVEA 4HWEH 3TFKC 4L9LA 4ZSOB 5SWSB 1HXYB 2JCCF 1A9BB 4OF3A 1HHHA 2JJVA 5GSRA 4WV1B 1L6ZA 1G7LB 5L88L 1P4BL 5HHOE 1YMHB 5ESVB 5F97E 3OJ2C 5EPMA 3ROLB 1AGBB 1MRFL 1NGWA 3M07A 1B0RB 2GJJA 3ZTNL 2R15A 3NPSC 3U30C 4RA0C 5AWNH 4CDGC 2R1XA 4JANA 4M1DL 3QIWA 2FRGP 2ADFH 4S0TD 3HAEB 2VDKL 4BUGA 2BHUA 2C7UA 2IQ9H 4NHUE 1QFHA 1JWMA 3RVTC 1OP3H 1ADQH 1NC4D 4XVSH 5I0ZA 2GJ6B 3ARFC 4U7MA 5ETUA 3P4OA 3QCUH 1T22A 3UDWC 3LHPL 1P4LA 1HHKB 3BD5A 2YPLE 4PP1C 2Y36L 2QKIA 4APQA 1MHEB 4CVZB 3FB8B 2VLLB 1S9YA 2W0KA 3VXUD 1NBQA 4KK9C 3VXSB 4KRLB 1VCAA 3NIFE 2FECI 1MCOL 1KB5B 3F7VB 4WU7A 1MCFA 2NY2D 4PREA 1GAFL 2WBJB 2ZOLA 1OTSD 3JV4A 4H1LH 3QIUD 3KPRE 3VG0H 4D2NA 3BESR 1LO3L 3QO0A 3UJTH 2ESVE 3PHOA 3M1BA 3HPLB 3TO2A 12E8H 3IDGB 1QPPA 3G5XA 3DX8B 2D4DA 1FFPB 3OXRA 1PFCA 3DSFH 6FABL 1EH9A 4D9QD 4YHZL 4XPBH 3QWOB 5EO1A 5AZEH 4ETQB 1BJ8A 5C0BB 3SQOH 4M6NL 3U6RA 2WNGA 2G60L 2OTPA 3OAZK 4OM1H 5KBNC 3H9SD 4U1IA 2VLJB 5IT2H 3CLEL 3O3EB 4ODSH 1CGVA 1I8LC 2F74B 1XH3B 3ARXA 3GKWL 4G6ML 4ZTPH 3TA3C 4ODHH 5CGMA 4UDUB 2ZNXA 5DRWA 4TTGA 1FYTD 5CILH 5M95B 4PJGB 1JHTB 5L7XL 4PY7A 4J23A 4Y4FC 3QEUB 1GGIL 1I7TB 5IVZA 3EO0B 1IGMH 4OI8A 4Z8FH 3ILPA 2NTFB 2HJFB 4DWHA 2JJTA 4PJ9B 5CZKA 4FN0A 1QA9B 3CH1B 3V4PL 4DGVH 4W70A 4ZOAA 3MV9E 4KH2A 1BZ7B 2UZIH 43CAA 4ZNEA 1SHMA 4PJIF 4MNGB 4YO0A 1MI5B 5BXFB 3HE7A 4I0CC 5F7WC 4BFIA 1IMHC 5EZLB 3KXFD 3DRTB 3R8BB 4EI6B 2UUDK 1S7XB 2X6MA 3S35L 3UTPD 4JFDD 4LLDA 5IMMA 3RTQC 1T7VA 4CMMB 2H1PH 1NCCH 3O3BA 2OK0H 1ZSDB 1CK0L 5ICYA 5DJ8B 5HI5C 1RULL 3TZVB 5C0ND 4HGMA 2NY7L 3S6CA 1SJEB 5MEPB 3QDJA 1OGAB 3UAJD 3WV0A 1HSAB 4PGCA 4B7IA 5F9WC 1YPZB 2UZXB 3RWFB 3FRUA 1NMCB 2FO4A 4PRHA 3QNXB 2VLRB 3W11D 3QDMB 2Y7QB 3C5JA 1MCDA 5FM5M 2J3SA 5FYJE 2PTVA 4G8GB 4H5SA 4PRPD 2DM2A 1PGRB 5SX4I 4UTAH 1CF8H 3PABB 5FO9A 1UJ3C 4NO3B 4NN5B 2CUHA 2LABA 4QRQB 1XZ0A 2AQ2A 4P46D 3GJFB 4HBCH 4JFEE 1ETZB 4P5TC 3BGFC 2OL3L 3S35X 1CD1A 5CBEB 5E00A 3MJ8A 1HQ4A 3FB7B 2ADJA 4P9HH 1T89A 1A3RH 4R4ND 1PSKL 5J6HB 3KLSA 4JO4L 2QTEA 2A73B 3WFBL 5IR1A 1E28A 2KUTA 1C7TA 1CGSL 2P48B 2P8PB 1FZMB 4HG4K 5KS9B 2X4QB 1YEFL 2W65B 2W59A 3FO1B 3TIEB 1BM3L 3SDAA 5E0QA 3QDHA 4OI7A 5I2IA 3MLYL 2EYTA 2H8PB 4LRNL 4M9PA 4J1UA 2FB4L 5MHSD 4FFZH 5EBWA 3BGMB 4JM2F 4FQCL 4P5MB 2IPUK 2IANB 2FH6A 3CSBA 3TV3L 2IAMC 3KPSB 2JE8A 3PWUB 1AXSB 5B22A 3RU8L 5MEND 4OI9A 3GB7A 5KSBB 1JMXA 4GRMB 4X5WB 1J10A 2APBA 1Y18A 4LNRB 5HDQL 1YYML 3LKOA 2XFXB 4NQVA 5B38B 4HKBB 4ZS6D 1WITA 4MWFA 4RQQB 1J5OL 2AXJA 4K3JH 4R9HA 5T33H 1OAZH 4JRXD 3WKNA 5F1IB 4LKCB 3I6GB 4HCRL 3TPUB 3FO9A 3MFGB 3HKFA 5C09E 1CDHA 4NWTL 3QUXC 1DL7H 2BSSA 1O0VA 3OR6A 3WFEH 1HYRC 4QYOA 3MJ7B 5KG9A 3QWQB 4XHJD 4I1NB 4LIQE 1JYNA 5IIEA 4YGAB 4B7LA 2IQAB 3T8XB 2B0SL 2F58L 4LGRB 3RDTD 4HC1A 4NQSB 1DUZB 2X4OB 4X6BA 3NTCL 4RBPK 4PJ8C 4LPCA 1T1ZB 2EDNA 3FFCB 4OB5H 2FX9H 4MYWB 5J3HC 5ERWB 2H2SD 4JQXA 4P2RD 3QAZB 3A67H 3TGXA 5L2JA 3EOTH 4YHIB 3N1GC 3L5WA 3RRQA 5FA4B 1R5WA 4Z0BL 5ID0A 4PB0L 1MHPH 3UP1A 1BWMA 4WWID 4PGZA 2F8VA 2C26A 4R0LA 4G6JH 4YC2C 2XZAL 1DBJH 1QR1B 2E9IA 5DJZB 5ICZA 5FYKU 3FRPA 2X10A 3OF6A 1EZVX 2FCBA 1YUHA 3MCKB 1DBBL 4RGNB 3RUGE 2XXMB 4TUKH 2ADIB 4O2FA 4WCYH 5I1JH 4WFHE 3MSPA 4M3KB 1JPSL 4BUHA 5AG9A 1RZFL 5CZVH 4LCWA 4M1CD 3IU4H 3RI5K 1RJZA 4DOHB 3CVHL 3RAJL 4TN9A 4OD1L 3EOYG 1C1EH 3NBNA 3CFKB 2MCPH 4I13B 1A4JB 2QR0A 3EGSB 3P40A 4OT1L 5TDNA 5BZWB 4L4VE 2VABA 3DRQA 1U8PA 3BZFA 3ILQD 3RL2A 4RAUB 3QZWG 4Z0XB 3C08L 4JY6B 3HMWH 3UTSD 4EXKA 5HHMA 3P30H 3VGGA 4Y4KA 3WS3B 5K9JH 3K8KA 3N50A 3T77B 3GMQA 3LEYL 1IARB 3E8UH 4ZUTB 3DV6A 4JY4B 5EOTA 3VRIA 3MNVA 5D1XC 2B4CH 2EH7L 1I3UA 1V3MA 3V6OC 3VXPB 3U2SB 3DO7A 4KZDH 1Q9OA 3VE0A 5DD3L 1KUMA 4PJAF 2C1OA 1GGUA 1YZZA 4TNVK 1IT9H 1NL0L 3ROOB 4BQCA 3GKZA 5E5MB 5A43C 1KF9B 2A74B 1EK3A 1G6RB 4NYLA 4B0MM 2X4NB 3FOMB 3I50L 5J13C 1WBZB 5E2UH 1F4HA 3RVXC 4PDCE 3RZCA 2JCCB 3P0VH 1G6VK 4I2XE 4KI5E 3WN5B 2EDJA 5BS0A 5E1HB 3RIFK 4FTVE 4E42B 1WT5A 4Z5RA 2RAMA 4P2QB 4J8RB 2P8MB 5HHPB 5C0JA 3MRIA 3ZKSD 4ZFGL 5JA8B 5HDBE 5FB8B 1ZT1B 1WZ1H 1YMMB 3BE1L 3TN0D 15C8H 1UZ6F 4RIRB 4UQ2B 1XAUA 3QG7H 4LHUA 4XAWL 1OSZA 2ZKHH 2DKUA 3HMXL 4X80L 4NRZB 2DLFH 3U7YH 1RZJC 4DVBA 3SBWA 5MERA 1HEZB 1RUPL 5JXED 5GQBA 3WHE0 1PZUB 1MIEL 3DETD 5F7KC 5GS0C 2EIBA 3ZTJG 4JRYE 1ORSA 4QXUL 3NN8A 1JRHI 1U8IB 1HSBB 5IK3B 3VXNB 3BKCL 1CT8A 3INUL 5DTFA 1IL1A 1VGEH 4XMLL 4F7MA 3ULUC 1P5UA 3ULSB 1K3IA 4S0UC 3ARTA 1ONQA 1S7WB 1MH5B 3BD4A 1ZANL 4JFOB 5DURB 4X4ZA 1AD0A 3WEXB 1QQDB 5E6ZA 1U8QB 2VSCA 2DI9A 5ADOH 3O41A 1ZLSL 4C57C 4NC2B 4KHXH 4MXWH 1G7JB 5CEZD 5F6IC 2BVPA 1EFXA 3WO4C 1CFVL 4F37K 2AK1L 4L5FL 4FQ2L 1JV5B 3WXVL 1FGNH 1N4XL 3QUYC 5GZNC 4NNXB 3FN0H 1HWHB 5INDA 2ARWA 3FT4A 4IOIB 5L9DH 1UM5L 1VACA 1BP3B 3VW3L 3CPLB 2Y4SA 1AQDB 3VCLA 3SGJC 4QRRD 3KR3H 1KBGH 4Q58C 3A0OA 5HGDA 3LN4A 4NGHH 1N5AB 3MRGB 5IB3A 4FZ8L 3SEPA 1NCAL 4JKWA 3IFOA 4X0KA 4X8XA 5IOPB 4BFEA 5JOEA 1S7SB 3MRPB 4IRJD 4WI3A 5I0DA 4HV8A 4N5UA 4R2GC 5C0CB 1ZHNA 5DJYA 4P3DB 2Z8RA 4IHOB 3CLFH 2VXVH 1ZWIB 1NCTA 5AAMA 2GSGB 1OHQA 3OAUL 1GGCL 3MLSL 4HWBH 5LGJA 1MIML 1XR9B 3LKRB 4PJIB 1ADQA 1NBYA 3IRPX 3WIHH 5CMAA 5B4MC 2DJ4A 1IM9B 4NO5B 1U3YA 1BIIA 3TLRA 4WHCA 1CE1H 2DDQL 4OZIF 3BPNC 3MJGX 4ZAKC 2NX5B 4KMQA 2BOCA 5F1KC 2KH2B 4O5LL 3DGGA 1O7SA 1QBLL 1LNUB 4Y1AA 5EORL 3BWAB 2Z31C 4P23C 1JPGB 4X6CE 4D0BB 3LEVL 4BQBA 1T1YB 1JYVA 3RWGA 4XNQB 4Q9RL 1AGCA 3PNWA 2NW3B 5HYJA 5T1LB 5DMIH 1FGVH 3ARGA 3T65B 5AD0A 1F58L 1NBVL 2DBLL 4K8RL 2Q76B 4UBDC 3QNZA 3VFUA 4XXDA 4RZCB 1XF1A 3FFDA 4S1SL 3IVKA 3ZKMD 3IFPB 3WD5L 3RKDC 2G9HB 5F88A 3WXWH 4NQCA 4KPHH 3MPCA 3QXDB 4A6YA 4ETYA 5H37G 1LE5B 5I1HH 4KV5F 4MVBA 4OLYL 3ULVC 1ZS8B 2FJHA 4KC3B 4PJ5A 5E7BA 2I07A 1MJJB 4Z18A 1SM3H 3Q3GB 4P3CH 4GQ9H 4NBXB 4TSCL 2ZZUT 2OI9A 2R0LH 4U1LA 5IB2B 4PRAA 3MFFA 2VUYA 4GG8B 4AK1A 2OJZH 3H7BA 3UPAA 5CGYC 1RZJL 5ITFB 3C87A 5JTWA 4X98B 2OTUB 3PGCA 1UZ8A 4Y16C 1UM4L 1XF5B 2CJUL 4X83A 2CDEA 5GS0L 4UT6L 2X89D 1M71A 5DD0H 1X4XA 4I77L 1P6FA 4WUUA 4NN7B 1KELH 4D0DB 4TVPH 1YJDH 3VMNA 1S3KL 2W0PA 1PEZA 3ULUL 1XGQB 5T1MB 4NBYB 2ZUUA 3RA7L 5B39B 4JFYB 4NOFA 4ZFOL 3DVIA 2CIKB 3D25A 5DHVB 1K4CB 3LB6D 1F2QA 4M7KL 4WO4D 4CNIA 1UCBH 1A7RL 1IFHL 2ZSVB 4TRPH 4JM2B 1QZ1A 4S1DC 1ZAGA 2HFFA 2O26U 5E5UB 1A1MB 3HRZB 5E08L 4HIIB 2NYYD 4LK4A 3VRJA 3UX9B 1AO7A 5EH1A 3NABH 3QCVL 3CFIC 3O9WC 4WHTA 5ABDE 5HVWA 4HK0A 2YK1H 5K9KB 3RL1A 1KFAL 1N3NB 4LLYA 5TQ0H 1JF6A 3GI8L 2DQCH 5SWZD 4XPFH 1I85C 3UYRL 4OQTL 1U93A 1RPQA 1U95B 3F5WA 1D5IL 1GOHA 2X44D 4MCZB 4CKVX 1E4WH 4X7CC 5CGTA 1FL6A 1YA5A 1E4XH 2V7NA 1E4JA 5D7LD 3FB5B 4URTB 5IV2B 1KGCD 5GGUB 4RCAA 3OKYA 1J05B 4WHYH 4Q6IA 2CLZA 4LLUA 5I8CB 1P4BH 4RFOH 2WY3A 3CIQA