1UXXX

Cbm6ct from clostridium thermocellum in complex with xylopentaose
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
124
structure length
124
Chain Sequence
KIESEEYNSLKSSTIQTIGTSDGGSGIGYIESGDYLVFNKINFGNGANSFKARVASGADTPTNIQLRLGSPTGTLIGTLTVASTGGWNNYEEKSCSITNTTGQHDLYLVFSGPVNIDYFIFDSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Family 6 Carbohydrate Binding Module from Cellvibrio Mixtus Endoglucanase 5A in Complex with Oligosaccharides Reveals Two Distinct Binding Sites with Different Ligand Specificities
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Carbohydrate binding module
molecule keywords XYLANASE U
total genus 27
structure length 124
sequence length 124
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2004-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1uxxX00
2QBXA 1US3A 2W95A 2DDUA 3ACGA 2EIDA 1GOHA 4XZUG 3OEAA 5IYYA 3I3DA 3WF0A 4BJ0A 2WABA 4OMCA 4L0PA 1JU4A 5LA1A 5EIYB 3OG2A 5JXIA 1RYYA 2WN3A 3LE0A 2W1WA 2VC9A 2Y6GA 4UOJA 2YG0A 1XNTA 3T2QA 5B4XA 2ZEZA 3VDAA 3CDZB 1H6YA 2XHNA 3I3BA 5IHRA 2VZTA 3C7FA 3I2IA 4LHSA 5DMYA 5I0DA 3VD7A 3MV01 3T2PA 2W47A 2J1RA 4BXSV 4QX1A 3ECQA 1OD3A 4A6OA 4PT6A 2VOTA 4A3ZA 1XC6A 5IFPA 3ACFA 4BK5A 4DXSA 1KGYA 3A23A 3IAQA 4AG4A 4DXTA 2YC4A 3UESA 3D3AA 2VZQA 2VCBA 3HNYM 4OMDA 2J1EA 3MBWA 3OB8A 3P1IA 2W5FA 1UY0A 3I2GA 3NJXA 3W5NA 4A45A 1OF3A 1W9SA 2E32A 2WO2A 3GM8A 5J1XA 1XPWA 3P6BA 4QPWA 2QQMA 4P5YA 3I2FA 2Y6LA 5DQ0A 2VZUA 1NX9A 5IJRA 2YFUA 3PUHA 3ZM8A 4CUCA 1GUIA 2W92A 3UETA 1TVGA 4QAWA 2VL4A 4E8CA 3LEKA 4P02B 2WQ8A 4XUOA 2QQKA 2BZDA 5HXMA 1F4HA 1P8JA 3C7OA 4M4PA 4UAPA 4QB1A 3ABZA 4QX2A 1EUTA 4CU7A 5HPOA 1CZVA 2V5DA 4M4RA 1DYOA 4ARYA 2VMEA 2WAOA 3MO4A 2VJXA 3MUZ1 3OGRA 1JHJA 3K4ZA 2LS6A 2QQLA 1H6XA 2W87A 4JKMA 2WN2A 5B4NA 1UZ0A 2L9LA 3WF3A 1W9TA 3ETPA 5C7GA 4A42A 2HLEA 4XUPA 2Y8KA 4CUAA 2Z4FA 1WCQA 1O59A 5G04L 1UX7A 5JUVA 3WF4A 1SG3A 2EICA 3WNPA 1TG7A 2RVAA 1J84A 4MOAA 5JXHA 2WDBA 1YQ2A 1JI6A 2E26A 3T0DA 3HEIA 1R64A 3A7QA 2DCKA 1GQPA 2CDOA 1UYZA 4PQQA 1BHGA 4JKLA 2J7MA 3AC0A 4KI5M 2B9VA 2J1VA 3ACIA 4JHZA 5A1AA 3GXUA 1CIYA 5LCWL 1GOFA 1UYYA 1UY3A 3C7EA 3VD5A 2RV9A 1IQDC 2B4KA 1UWWA 4W50A 2ZEYA 1W9WA 2WZEA 1DP0A 3E1F1 3C7HA 4D0QA 4DEQA 2QQJA 4XVHA 4TXWA 3HNMA 3HPNA 4QDSA 2YFZA 4CUBA 2W9XA 3NNGA 2WUHA 3VD9A 2C26A 3T0AA 4A4AA 2VZOA 2XOMA 3CMGA 4A44A 5EJZB 2ORZA 4LPLA 4XUNA 3SKVA 3HN3A 1UMIA 2W3JA 3I3EA 1GU3A 1UY2A 4FI9A 2X05A 4ZZ5A 2YB7A 1NKGA 3A21A 1HN1A 4QX0A 3K4DA 3DYMA 4E8DA 1CX1A 3VD3A 1T2XA 1W8NA 3HNBM 1MPXA 3NQHA 2RJ2A 4JX0A 3WNKA 3CKHA 2ID4A 2WO3A 3SKJE 2J1SA 1OH4A 2VCCA 5LA2A 3T09A 1JZ6A 2V72A 3K77A 1J83A 4YPJA 2R7EB 4XUTA 3NJVA 2BERA 2BGOA 2VZVA 5EJ1B 4MADA 1NAEA 2WBKA 3WEZA 5IFTA 3GGLA 4DXRA 1PMJX 3FHQA 1ULOA 3JXSA 3UNPA 1O8PA 2Y6KA 2KD7A 4GZ9A 4P08A 2J1UA 2EIBA 2QQIA 4ZZ8A 3WF1A 3OGSA 2JE8A 2VQTA 3SEPA 1US2A 2XONA 2Y6HA 3MUY1 2E33A 4W4ZA 1W0NA 4AAXA 3OGVA 2C4XA 2PQSA 1GMMA 1LNSA 2Y6JA 5G05L 2VMFA 4JKKA 4QB6A 1CZSA 3I2JA 3LPGA 4CU8A 1O8SA 2ZEWA 4D8MA 3HOBA 3THDA 1PX4A 2V4VA 3LPFA 2DCJA 4CU9A 3CZJA 5DPNA 2EIEA 2OKXA 3FL7A 1GNYA 3IB3A 4OYUA 2JDAA 4MGQA 4CU6A 5CYYA 3DYOA 3BGAA 4GWIA 4UI9L 5JXGA 2J1TA 4Z2AA 1JYVA 3VD4A 2HYXA 1PMHX 2X09A 4LQRA 1JYWA 3WNNA 2W94A 4P00B 2QQOA 3WNMA 3K46A 2VCAA 3U37A 4QB2A 3HJRA 3THCA 1DLCA 4W8JA 5DN2A 1K12A 2WZ8A 3WQBA 3OEBA 1F4AA 4ZY9A 3WF2A 3T2OA 1JZ5A 3I2KA 1W8OA 4OZOA 1OT5A 5F7UA 5CZKA 4DUVA 1WKYA 2QQNA 3A22A 3EB7A 1JU3A 4DEVA 2WAAA 2JKXA 4DUXA 3F2ZA 2VZ1A 3WSOA 3WNOA 1PX3A 3CIHA 2VMCA 4XURA 2VMDA 3J7HA 4QX3A 1CZTA 5JXJA 4OUEA 3C7GA 4DUWA 3DECA 3DYPA 4LKSA 5LA0A 1W99A 4XUQA 5FUIA 2ORXA 4RN5A 1D7PM 4BK4A 1SDDB 1JZ8A 2W1UA 3OBAA 2WO1A 1SHWB 5JR2A 3NRUA 2W46A 3LEGA 2VO5A 2Y64A 4ARXA 1I5PA 3GDBA 1JZ2A 4KMQA 4A41A 4BDVB 4KWUA 2JD9A 3MV11 3CZUA 4ET7A 2VTFA 1L7QA 4MGSA 4GWJA 1JZ4A 2X10A 1UY4A 1EUUA 3WNLA 3EYPA 4RYDA 2J22A 4MO3M 1JZ7A 2WYSA 1K45A 4ZXEA 2W1QA 4QDQA 2VZRA 1JYXA 4TTGA 3I2HA 1GOGA 2LW8A 4CVUA 3IIIA 2W91A 3SEEA 3T08A 3W5MA 2VZSA 1K3IA 3FN9A 2VZ3A 3PUIA 5C70A 2J1AA 3LEIA 3BN6A 2VZPA 3K75B 2W1SA 4IUGA 5C71A 1UMHA 3I97A 2E31A 3IDAA 1JZ3A 3ACHA 2YC2A 3VDBA 1UYXA 2XQXA 2CDPA 3IAPA 1K42A 4HG6B 1OF4A 4QDRA 1KEXA 1NUKA 3K4AA 1ULPA 1UY1A 3FHAA 2VM9A 2BBAA 3T0BA 3CQOA 2C9KA 2ZXQA 5JMOA 1UXZA 2ZEXA 1L7RA 4PF1A 3C8XA 3VDCA 2BGPA 3LQCA 2VR4A 1XNAA 1JYNA 1UXXX 2VQUA
chains in the Genus database with same CATH superfamily
1R1ZA 1VBB1 2UYBA 3VKLA 3POJA 4Q0PA 2DDUA 1EAH1 4ASKA 4XZUG 2WWSA 3C3VA 4BPZA 4CP0A 2R072 4H3WA 1V6LA 2JG9A 5AC91 1ZREA 2ZHLA 3VL8A 1GANA 3H8UA 3I3MA 2ZGNA 1G8WA 2RR13 4OMCA 2GDFA 4HN1A 5FYHA 4GULA 1ENSA 1JU4A 4L0PA 4NJ4A 5FY4A 2LROA 4OHZA 1LJ7A 3NO8A 4AFCA 2Z2SB 2B7YA 2WWJA 1HQWA 1BBT3 2FMDA 4AI2A 3VDDC 1CPMA 5EFUA 2VC9A 5DUUA 1AR71 3IMMA 2P34A 3M8LA 2QQUA 5FY5A 3ZYBA 4DO0A 5KR7A 3SCHA 4PBPA 3I3QA 2AREA 4X8PA 5FY0A 1HRV2 5IAXA 1FMD1 3ZFGA 3WVJA 2ZEZA 2P4EA 1SCRA 2VXRA 1LHVA 3H8XA 4IE0A 1H6YA 2HWC1 1COV3 5JI9A 2XVLA 1W6NB 2VZTA 5IHRA 4LHSA 4UWDA 5I0DA 5E16A 4F8AA 4ZKTB 3A0NA 1LGNA 1LOAA 3K2OA 2W47A 3WQ7A 4D7YA 1OVPA 2WT0A 1BCXA 3WNXA 1Y4WA 4CEWB 2VW2A 4BXSV 1W8UA 4Q4W2 4AQSA 2RS51 1NZIA 2SLIA 3IDBB 3POYA 3ZYRA 1JMUB 4B1MA 2VOTA 4EN9B 1RC6A 1QJU3 5CA6A 1NXMA 1XC6A 2XLAA 3ACFA 3THTA 3ZMOA 4BK5A 3NV2A 1KGYA 3Q8AA 4DXSA 1CJPA 1UU5A 2RS12 3IAQA 2EIGA 3VDDB 5T3NA 1CAWA 2NMNA 2VY0A 4XF3A 5CNAA 4DXTA 4JRAA 2VH9A 5A33B 2HWB2 3ZN4A 1RUD2 3INAA 3T2TA 1AR82 2VCBA 5F5QA 4D94A 1FV3A 3GZUC 1AL0G 1JW6A 2P3JA 5D8AA 4HL0A 1OHFA 4BQWA 4EN0A 4UFJA 1WW5A 1ST8A 5CFCB 3AVSA 1W6PB 3NJXA 3VZJA 1OF3A 1URXA 2E32A 2X5IB 5FZ4A 1SLLA 1VBE3 5FPLA 1RL3A 3P6BA 3PJQA 1AJOA 2QQMA 4Q8KA 2CYFA 2R0HA 3HD8B 5DQ0A 4NROA 4QU2A 2NLRA 4CEWC 3PUHA 1UN1A 3WDVA 3NAPC 1O5LA 1Y9QA 4AYUA 4AHYA 3MIBA 1PM4A 2D97A 3NKGA 4MX3A 3DKWA 2HWC3 4R9DA 5LA1A 2OZJA 2VBBA 3LEKA 3B9CA 4P02B 4Y20B 2R6QA 2WQ8A 2VBPA 4O61A 3IWZA 4OI0A 2RS31 1F2NA 5FZIA 2BZDA 2GNTA 1S0GA 1LHUA 3M3CA 3QOPA 3ZX7A 3MYXA 1V0AA 4LMFA 2JDPA 1XOYA 2O8OA 4MLOA 3VBSA 4XQWA 1XQNA 5FZDA 2K0GA 3UK9A 2QDRA 5HPOA 2GAUA 2V5DA 2XJSA 2YU2A 4M4RA 4QKBA 3SH3A 2VMEA 3T4VA 5FXXA 2WAOA 2PAKA 3DF0A 3NV1A 2H6CA 1AF9A 3P5BA 5FY1A 5HI0A 3AKTA 2W0XA 4OZXA 3MUZ1 3K4ZA 4AL9A 2W87A 4IE6A 1CAUB 3AFGA 2KA3A 4E4ZA 3KD4A 5B4NA 1GQGA 1VBB3 1WMEA 1O4YA 1DLLA 2ZGKA 4EQVA 5IVBA 1UOBA 2P3YA 3B00A 4RHV3 5JDBA 1NA1C 3WF3A 4BCUA 2B8MA 3AP7A 1XXNA 3R05A 1EV12 3VN4A 3KVAA 5K0UC 4ISRA 1QJY3 2HLEA 4XUPA 2R0FA 4CUAA 3ACLA 5FZHA 1WCQA 1GZTA 3RYKA 3NNJA 1UOFA 5G04L 1UX7A 5JLVA 4K8RB 2XH6A 5K8SA 2Z69A 2RVAA 5FFOC 5JXHA 3D8CA 5BXXA 3RWNA 4OUSA 5KC5A 1V6OA 3RMYA 1JI6A 4K3UA 4M00A 4Q4V1 5FXWA 1OA2A 1W2OA 4PCRA 1GQPA 5A3TA 1S2BA 1UYZA 1WGPA 3DPRC 1BHGA 1CONA 3DN7A 4LA2A 4NAOA 3KT4A 4XZPA 4JKLA 4MGIE 4RQPB 4K1YA 4IXLA 4Y4YA 4BQ3A 2IWGB 2B9VA 2Q1FA 4JHZA 3TNQA 4GB31 1ZZ7A 1CIYA 4QKFA 1GOFA 3FLRA 5BNOB 1UYYA 5KXEA 4AI1A 1W9YA 4GKYA 3NNMA 3N7MA 3O5SA 1ND3B 1W3XA 4HONA 4RHV1 4HVQA 3RNSA 2B4KA 1DQ4A 1N1YA 3IIAA 2WNVC 1RVF3 4CCCA 4CEYA 1W9WA 1TNRA 4YGCA 3E1F1 2JDMA 4GH4A 1W2AX 1XSRA 2VCMA 2Q8EA 2BDRA 2VW0A 2WNEA 2JXAA 2P5BA 4XDQA 1GZWA 3GCWA 2RDQA 3VBFB 4DMIA 3VD9A 1UW8A 4GD4A 3N35A 2E63A 1HRI2 3N9PA 2XOMA 4SLIA 4YVSC 3WY6A 3WDXA 3VBHA 2YV8A 3LOIA 1H8VA 3GZEA 5LY2A 4HN0A 4XDOA 4CDWB 1GQHA 4AHZA 3HN3A 1QY4A 3I3EA 1GU3A 2YUEA 3WX5A 2GC1A 1QJFA 4YW4A 4QX0A 4AXOA 2QTWB 4B3NA 2QNKA 4F3JA 4IV1C 3VD3A 3O1RA 1CX1A 2ZA9A 3POSA 4ASLA 3NQHA 3HT2A 2QZ2A 3CKHA 1IS4A 5A3NA 3H1YA 4COUA 5C6CA 1K5JA 2J1SA 2YROA 2FCTA 1ND2A 1MZFA 4J6GA 1VBE1 1U5YA 1YC61 3K77A 5T55A 2B46X 3VHOA 2D93A 2R30A 4QMAA 1X9PA 4KG8A 3V56A 1DGRA 1TME3 1RUD1 3IZOA 4GXLA 4MADA 1NAEA 1IS3A 3HWJA 5IFTA 3V0AA 2RS11 4GJYA 4A2UA 2HWE1 3T1LA 1W2NA 2G1MA 4XETA 3FHQA 3I2OA 4BQ4A 1O8PA 2EIBA 2QQIA 5JSPA 1E5SA 4XTPA 4XPVA 4BZ4A 4M3CA 3OF1A 2YPJA 4LBNA 5GLVA 2JE8A 2CSGA 2JDYA 3POWA 5F6KA 4AQ2A 4R4XA 2FDIA 3MGUA 4OI4A 5BNQA 1AR83 1R1A3 1US2A 1JYCA 4LKFA 2XBO1 1TME1 1AX0A 4M0NA 2Q4SA 4ISQA 2E33A 4AZZA 3DPRA 1MEC1 2WS93 3POEA 4BXFA 1W0NA 1QJU1 1AR62 4CP9B 5HBAA 2VVDA 2ZGRA 2XWBB 2IXLA 2RS53 1NE4A 4CDXA 4HXCA 4Z82A 4MGYE 1UU4A 5E89A 3U10A 3ZFFB 1V6MA 4QB6A 4XABA 3I2JA 4LBQD 3AFKA 1G7YA 1OPOA 2ZEWA 4URAA 2ZMLA 4Q1RA 5DZFA 1O3SA 1UKRA 2D6OX 4RR3A 4LNVA 3MF9A 2WZPP 3TYJA 3V0BA 3OPZA 1E57A 5FKCA 2HWF3 4FCAA 2WIIB 4CU9A 2JB8A 3K48A 1JXNA 2JICA 4Q8LA 1IKPA 1UD1A 2XL7A 3FL7A 5DAWA 1OLMA 3ZLIA 4CCOA 5IT6A 1GNYA 2A7AA 2R1DA 2XUMA 3OUHA 5J7MA 4UFIA 2QKDA 2KXLA 5A3MA 3B9IA 4H7MA 4D7SA 4Y26A 2AACA 5ABJC 4GWIA 4UI9L 4WM7B 2FCUA 4QX8A 2CAUA 1HRV3 3ZIWA 5CFDB 1JYVA 1HXS1 4HSLA 4FOVA 5A7SA 2X09A 3ZXJA 5L9BA 4P00B 3WNMA 1NCRB 2WQZC 3K46A 2VCAA 4QB2A 3HJRA 1SMVA 2CTVA 4W8JA 1RVF1 2VNGA 2R073 4MXVA 2GNDA 2ZX3A 2DU0A 3M3QA 1A34A 4AVCA 4BMBA 2NN8A 3T4HB 1LCLA 4JGZC 3H50A 1XE8A 4DIQA 5FLHA 4NAMA 3QH7A 4OZOA 4ZS3A 5F7UA 4MGTA 4LBQA 4DUVA 3KV6A 2ZX4A 5A1FA 3ZFEA 4J1XA 2WKKA 3WG3A 5FZ6A 1PMIA 2G4IA 5E88A 1UZYA 4Q4X1 3F2ZA 5GLZA 5EV7A 3HN1A 2VZ1A 1TZOA 1H1MA 4BISA 1EV11 1RMU2 2OQ6A 2PHTA 4PDWB 3WSOA 4AQTA 3NJZA 1QNYA 1WW4A 1RXGA 2AENA 3ROUA 1RJ8A 5F37A 1V6JA 2TBVA 4LIVA 1MACA 1MS9A 2JB4A 1H2LA 2OVUA 2XB6C 4QX3A 3WDTA 1GZCA 1CZTA 3K3OA 3C7GA 3W9AA 1AR93 5DG1A 4BOWA 2CGNA 4FPOB 2UWBA 4TLFA 3DYPA 1IS6A 1E5RA 1REDA 2DURA 4XUQA 1V9U1 4LKDA 4I0BA 3KS7A 4RN5A 4INDA 1IGOA 1POV0 2CAVA 1C8NA 1N3PA 3OBAA 5FJKA 1ZRFA 1LECA 4ONUA 5GJ6A 4E2QA 5LASA 2PHUA 2RDSA 1ALYA 2W46A 1O4TA 4IEVA 5C9AC 3VBFC 1MZEA 4COWA 2IFRA 1WLDA 1SDWA 1JZ2A 5LATA 3VLBB 1LHWA 5I8SA 5LBEA 1SBFA 4E4SA 1HRI1 2DBNA 4KMQA 4D6SA 3KB5A 3ST7A 2KR2A 4LORA 4QX7A 4UW5A 5IUQA 3PUSA 3UL2A 5JZGA 1AR61 1W0OA 2AUYA 3AKPA 2JD9A 3ETQA 1LU1A 3WCRA 4BDVB 4TN7A 1XSQA 4ET7A 4QQ2A 4JQRA 2F17A 3HT1A 2WFF3 3J8F2 2YYOA 1S0BA 1F35A 1NQJA 1Z7S3 2BVVA 3IPVB 1QOOA 3QLQA 1LAJA 2VG9A 4EN7B 1QJZA 4NWVA 1C8M2 4TYSA 2FQPA 2OS2A 4FAGA 1CAVA 4K6BA 2EA7A 3EYPA 2ZX2A 2OYZA 5JOWA 2PELA 3AXDA 1RUC2 1Q8PA 4MO3M 5FAXA 3ZDSA 5JR7B 5A7PA 3OUIA 5AFEA 3O7OA 4JTNA 4E27A 5BNNC 1JYXA 1LHOA 2HWE2 2YGMA 5KBFA 1C3HA 5GZGA 1NE6A 5FZGA 2GZWA 1V6NA 4PBOA 3NMBA 2VNVA 1AX2A 1UO9A 4HZFA 2ARAA 2HH9A 4HPKA 2W91A 2R49A 3GF6A 3ZSEA 4EWAA 2OZ6A 5LK5A 2VZSA 4FO9A 4K21A 4Y20A 3T1MA 4LO4B 3OBTA 5FREA 3VHRA 5M0TA 2ZAAA 3Q8EA 4NVPA 5LA9A 5ACA3 2X53S 4JQTA 5ACA1 1D4M1 4Y1XA 5FP9A 5A7WA 1MQTA 2Y34A 4FPLA 4F83A 1JH5A 3K75B 1PGL1 1AYN3 1AXKA 1MZ6A 3D0JA 4IERA 2PA7A 3ZR5A 5C71A 1UMHA 3I97A 3MZHA 1UOJA 3ZIXA 1SEFA 2IXCA 3V64A 3ACHA 4IE4A 5B2GB 1IZ3A 2YC2A 4W65A 2CL2A 1JYTA 1QOSA 3RYPA 2XQXA 4PLNA 1XNDA 1O5UA 1OF4A 2AYHA 1LOFA 2FZ1A 2GH8A 3JB8A 4FP3A 4E9KA 2ZS6B 2XQRA 1G9FA 1YO8A 3FE5A 2R32A 4HT1T 3K4AA 3OBZA 4IEZA 4TLGA 3RZZA 1DDLA 1PHMA 4LO6B 2NPIA 4PF5A 1LB2A 3CQOA 2RM23 2BPA2 3BIWE 4YM3A 4XJWA 1QH7A 3B7MA 2WS92 4RR3C 1PVC3 4XFAA 1AR63 1UXZA 1W8HA 3OUJA 4Z07A 1PNFA 1VRBA 3W20A 4KWKA 2VR4A 2WNOA 4LO7A 4RL7A 1R091 3PLQA 4H7LA 3Q8FA 1US3A 4NRPA 1CAVB 1FPN2 4I2OA 1MS0A 4TZDA 1HQLA 4YW2A 4NIDA 2ZKNA 4BM8A 5IK5A 4OCTA 4KGGA 3AZZA 3WF0A 1LGCA 3OBRA 2X5IC 3BTZA 1C1LA 1YQCA 1EPZA 1OLQA 4IL7A 4IV3B 3RJRA 3ZDVA 5KC6A 1ASJ2 1CAXA 1YUDA 2RR11 4JCKA 3N3HA 4GIQA 4XHBA 2BW8A 5FZMA 4GJZA 1RYYA 2WN3A 1PO21 5JZGB 5FIXA 3NSTA 5AC93 5JAXA 5BNOA 1AR72 4YFWA 3H42B 4AOCA 1SBEA 2Z5WA 4XQDA 1D4VB 1H2NA 2BQPA 2WL1A 5B4XA 4QX5A 1Q8SA 3LDRA 3VDAA 3VB9A 1RUG2 4WVMA 3IT8A 4FOQA 3CDZB 2ZMNA 2XHNA 2XBO2 4Q4Y3 1I1EA 2FZ2A 1Z0HA 3FWEA 3C7FA 3I2IA 5DMYA 2D6PA 3GZAA 1X33A 3B3QE 3JZVA 4Q4X3 5IVFA 2GMEA 2JWPA 2YGLA 5GZCA 4LLOA 2UY9A 2HEWF 3BYWA 4AHWA 5DXDA 3PURA 4AI0A 1UZZA 1WCUA 1ND2C 1S1AA 1D4M2 5FLIA 1C57A 4KWJA 5IAVA 4A3ZA 1KITA 2JIGA 3H8OA 2XVGA 1H1IA 5FY7A 5J37A 4I0AA 3ZSMA 3S5AA 1YFUA 2D6KA 1MQTB 1OKQA 4MVTA 4AVVA 5C9AA 3D3AA 3CU7A 1QJY1 2A5ZA 3Q9OA 4YVWB 4YZ5A 5AFBA 2NMOA 4AEKA 5HV4A 4Y4RA 2FDFA 2PHRA 2XR4A 2YZ4A 2IXIA 1J3QA 1KFUL 3CJIA 4N7IA 2G9FA 4O9GA 4OMDA 1ZX5A 4QQHA 3VL9A 3WDUA 2QQVA 4AEDC 4B4QA 5AC92 3CJXA 5CADA 3OB8A 2G19A 3ZSJA 2W5FA 1WBFA 4HK8A 3GJAA 3I2GA 4V2VA 1OURA 3H3ZA 3M1HA 4IDZA 2GP5A 3FC0A 1C28A 1GSLA 3ZXGA 1XE0A 4P5HA 1HB1A 3I2FA 3ILRA 2EF6A 2Y6LA 4X8NA 5DAPA 5KHHA 1BLZA 5FZLA 3M3IA 3AKQA 4GALA 1NX9A 3DGTA 1CAWB 5JI7A 1W28A 1LOEA 5T5JA 1UAIA 3KV5A 1AL22 2BOIA 2D6NA 4I30A 1GNHA 5FYBA 5BNOC 2XWJB 1CD3G 2W92A 3HQUA 4CEYC 5A3UA 1OUSA 4QAWA 4BQ1A 2ZTNA 3EMRA 2PLV3 5D8AB 1W06A 1LENA 4AVBA 4FFGA 1GWMA 1WA4A 1ZZ9A 3WP3A 2RS52 5C8WA 3AL6A 3BPZA 1VMJA 2X5IA 4QPIC 3W58A 1F4HA 3BPSA 1XRUA 3C7OA 4UAPA 4V2WA 1WLTA 2VU9A 3ABZA 3THPA 3I4IA 4HSJA 1Y9GA 4CDUB 2JG8B 1CZVA 2ZAHA 2BNMA 4N7UA 5FXZA 5HCAA 4JRLA 2BNNA 1L7LA 3LD8A 4YWAA 2F6BA 1YIPA 2RDRA 1AR81 3WP5A 4CYDA 3ZXLA 3OGRA 4IGPA 1JHJA 3E6CC 4YFZA 1WW7A 1BVP1 5D2AA 5BNNB 1OFSA 1VBA3 4JKMA 3UJOA 2WN2A 4JDOA 2O14A 4CXXA 2R043 3TAYA 4AEJA 1XJAA 1ULDA 1UZ0A 3QACA 3JCIA 5FTTC 3ZKUA 4CP2A 3V0AB 1JYIA 2L9LA 5FP3A 3ZYIB 2F4PA 4M3CE 2P3IA 5CIRA 5IVVA 4B7KA 2HWE3 1VAMA 4R9CA 2Y8KA 1MS5A 4QHOA 3RYRA 4EWDA 5JPNB 1QXRA 2NM1A 1LOFC 4WM8A 3UT0A 3O1VA 1SG3A 2EICA 3DEMA 3LIHA 3WNPA 4AGGA 1AYM2 1LU2A 3PU8A 3WD5A 5F9TA 5LEJA 2WDBA 1YQ2A 3UYJA 1UYPA 1LEDA 2H6BA 3A7QA 3PL0A 2CDOA 4XFGA 5GZFA 1WMXA 4M01A 5EWSA 2SBAA 3I54A 3ZYHA 2YY1A 2AEYA 2IZWA 2VD7A 4HOOA 1HQNA 3JBG1 3PUQA 5FQ0B 1BXHA 1CN1A 5DDJ1 2WA4A 4OUMA 5FO9B 1COV1 3RVHA 1UIJA 4LTAA 4YNIA 5I0SA 1V70A 2Z42A 4K9SA 3EQEA 5CFCA 4GMP1 3C7EA 3VD5A 1DYPA 2RV9A 4RR3B 1YYNA 2ZGUA 2B9UA 5KHIA 2VW1A 1W8WA 4W50A 4LHLA 3WQ1A 5C8CA 3RZJA 5K7PA 1AR73 1S0EA 1S4CA 3JD71 1GWKA 1YQ6A 2P1BA 4AQ6A 4TXWA 3JUUA 1ENQA 3HPNA 4CEWA 4YLZA 5FYSA 1POV1 4CUBA 1I5ZA 2YPDA 5GALA 2WUHA 4DFSA 4WV8A 4MGKE 3SLIA 1KQRA 1HB4A 3AM2A 3V65A 4PDWA 2OPKA 4BMEA 4XXPA 1GLHA 4MZUA 2C9AA 5CFDA 5F3CA 3CF6E 2FBEA 4FTBA 1GKBA 1Z7S2 3MICA 5IK7A 4A44A 5JZGC 5ERLA 2QDNA 2ORZA 5K0UB 5C33A 1Q8QA 1PO12 2OX0A 1VIWB 1UMIA 2DU1A 2W3JA 3B02A 2D40A 4N43C 5IWFA 5LBCA 3RGBA 3ZN6A 4B1LA 1ASJ3 2PHWA 2WNUA 4LK7A 5LZ6A 2P6HA 2YB7A 3POFA 4Q0UA 1VAVA 3TOJA 4D3WA 4QXBA 1ODMA 4CDUA 1A8MA 1BVVA 1QF3A 1WLWA 4L2NA 4RD7A 1G6NA 2RJ2A 5FPAA 1GP4A 4JX0A 1VAKA 5LK7B 4P9LA 2ID4A 2WO3A 3LIGA 5L7OB 1DBNA 1OUXA 1UPIA 1J83A 1LULA 2C1FA 4XUTA 1W0PA 2OUJA 4WVZA 4HVRA 4N53C 5EHDA 2BERA 1PIV3 4UW6A 3ILFA 4CUGA 5FMDA 5D21A 2VAUA 4EYUA 1LEMA 3GBFA 4QHBA 4QQOA 4XQ4A 2I45A 2B5HA 4NRQA 3ZFGC 1WLCA 4I0WB 1OC1A 2Y6KA 4GZ9A 4ASMB 2J1UA 2EXHA 4OI2A 4YVWC 3N36A 1J3PA 3ME2A 1PGW1 3WF1A 2D6MA 5FYMA 3ZFEC 3B5LB 5GZEA 3N9MA 1W90A 4GH4C 4LE4A 3AMQA 4R4ZA 2V5YA 3VGIA 2JIJA 2VQTA 1RXFA 3SEPA 4E4DX 1H9WA 4XW3A 3SHRA 4TWTA 2QQWA 4X6QB 2Y6HA 4DQAA 4K7JA 5L7OC 5E1RA 4W4ZA 4RGAA 1BEV3 1JODA 1R081 1VRH2 2C4XA 3KMHA 4AVSA 2OIIA 5JVVA 4JGYB 2LALA 2PQSA 1SPPB 5JWPA 1IPKA 1W05A 2AGSA 2RS33 4JKKA 1VP6A 2RG4A 5A80A 4RS5A 2ARXA 1DGLA 1CZSA 1ZZCA 3LPGA 5DDJ2 1O8SA 4M3CB 2PHXA 5DAXA 4FTEA 3OOXA 1XYOA 5T52A 5C8CB 2Q8DA 4LITA 4UYBA 4Z2WA 4QPIB 1C1FA 5DPNA 5BV6A 2YDEA 3VBSB 2OKXA 1D0GA 1YIFA 4QKNA 2UWAA 4IV1B 2DFCA 4FPEA 4CDUC 5I8TA 2O1QA 2RM22 5HXVA 3LA3A 4RHV2 3D6EA 2A70A 2K2SA 4IE5A 5CYYA 5E8AA 4Z2AA 4IEPA 1QDCA 3U78A 3OY8A 3BTAA 3D4KA 3H3LA 1PMHX 3ZVXA 4HPKB 5A3WA 1RUG3 2XKPA 3WNNA 1W6QA 2W94A 4I02A 3IMNA 1WBLA 2IVJA 1TE1B 1SQ4A 2GN7A 3URFA 5H9RA 3THCA 3SMHA 4CDXC 5JCTA 2C24A 4LR4A 4I01A 5LY1A 1K12A 4Y5SA 1RUJ1 1VRH3 3WQBA 2BOJA 2OA2A 1VE0A 4P14A 3LF7A 1F4AA 4HVOA 3NNFA 1XNKA 4Q4W3 2ZABA 2WZR1 2MHFA 5FP4A 1JZ5A 2H0BA 1W8OA 3KT7A 1OT5A 4Z92B 2YC0A 5FYYA 1ZBE1 4LEJA 3A22A 3GCXA 4LBKA 2ZHMA 1F5FA 1JU3A 4DEVA 5A3LA 2WAAA 2JKXA 1ULFA 5DABA 5BNPA 1CAXB 4DUXA 5FWJA 4LHNA 3ZOIA 2EAAA 1BK0A 3L9JT 3PUAA 3TNPB 2GC0A 5HCFA 3WW3A 1F31A 2VPVA 3QBQA 5A32B 3AP4A 4PLMA 2ILMA 2Q0AA 4UW3A 3FHIB 1COV2 2BYVE 4Y1UA 3VHNA 2V4AA 2VMDA 4AGVA 3H7JA 3AJYA 4GKXA 1VBE2 2QCSB 3HBKA 1QJU2 1OVSA 5ANNA 3TN92 1TMF2 3WT3A 3K3NA 3SC7X 5C3RA 3RZKA 4YGBA 4EN8B 1QJX1 3GNEA 5CVRA 4CCJA 4HK9A 5LA0A 3O1TA 3AMMA 3H3UA 1W99A 4XF9A 3T3YA 2GMPA 4DPNA 1B35A 4DINB 5CG9A 1EYBA 5L9VA 1D7PM 1A6CA 4D69A 2ADDA 2A71A 3M70A 2RE9A 4IV1A 1PGW2 2WO1A 1O3RA 1SHWB 4XYXA 4YARA 5CBLA 2QZ3A 1T6GC 3NRUA 4QQPA 3RRDA 4MXWB 1NCQC 4IV3A 2PN5A 3JQWA 4WM7A 2CGOA 2WQ4A 3KV9A 2Y0OA 3E5XA 4COYA 5J3UA 5F2WA 3USUB 1YHFA 2DVDA 2ETEA 4CDQA 1LOBA 1WMFA 4ES8A 4YVSA 4I09A 5F5IA 1ZA7A 1VBD3 4KWUA 3MV11 5IK4A 4LBJA 4OHXA 1KDKA 4R9BA 1DFQA 2OT7A 4RGKA 3VBHB 3ZKYA 1SCSA 3GHNA 3ILNA 3FMGA 4E2GA 1AX1A 1L7QA 1RMU3 1YFYA 4QM8A 5CKQA 3ZYJB 4GWJA 1JZ4A 4WVMB 2X10A 4A7YA 4EE2A 3J4UH 3AK0A 3B93A 5C3OA 4N8MA 1DYKA 1MZ5A 5AVAA 3MW3A 1PZ7A 1VBA2 2CY6A 1DCSA 2YU1A 4P9WA 4DY5A 3O1PA 1HIXA 1LESA 4XF4A 4LBQB 1W6PA 1FX5A 1AVBA 3DKQA 3OGGA 4IEYA 1W6MB 2WYSA 3M2MA 1K45A 1C5IA 3KQRA 3LAGA 4ZXEA 1A3KA 4QXHA 2ZMKA 2VZRA 4CZSA 4XIOA 5FZ9A 5DUWA 2A3XA 3I2HA 1W8FA 4ZXKA 2LW8A 4WZFA 3TB0A 4CVUA 3IIIA 3R4UA 4Q0SA 1UCXA 4XMIA 3T08A 3KHBA 1RUE1 2D3RA 1OQEA 3VDDA 3W5MA 1FPN3 1N1TA 2GP3A 5A6QA 2XLFA 4EZ4A 1DGRN 3PUIA 2Z79A 2J1AA 3LEIA 4N53A 2XJPA 3BN6A 1J59A 2WR9A 4BH9A 5JMCA 2DVFA 5KHGA 2DWRA 4K20A 1WUVA 1PZ9A 2ARCA 1H2MA 2D3PA 3BB6A 3IDAA 1FYUA 3MFAA 4P9IA 1JZ3A 4JDNA 3UGFA 3VBOB 3JD72 4XBQA 1UYXA 3LDKA 5KHJA 3VDBA 4YZ3A 4AEDA 1PK6A 1OLRA 3IAPA 4NE9A 1K42A 2WFF2 3J8F3 4AVAA 3CJIC 3MPPG 4LJHA 2FHRA 3P3PA 1EY2A 1CX4A 3PVBB 4FBFA 4N9HA 1DHKB 2VOWA 1DGWA 3TBDA 3CBNA 1UY1A 4S2FA 1NA1A 2BBAA 3UGHA 1RUC3 3IBMA 1RHI2 2XJUA 5F3GA 2VMGA 1R1A2 3T0BA 3ZN5A 4C91A 2ZXQA 1B35C 4DRVA 5FWEA 4QQLA 5F3EA 4NHKA 4FQZA 3AB0A 4DOUA 3OD0A 4ZU5A 2A6XA 4PI0A 1QQP2 3VDCA 5EP9A 4WM8B 3ZPYA 4CCNA 1OH3A 5CAZA 3B01A 3HMYA 5C4WA 1SFYA 4BA6A 1JYNA 3BUCA 2QBXA 4KGQA 3U0ZA 5FR3A 1ZZ6A 4V1PA 5L36A 4W6XA 2EIDA 1FPN1 1GOHA 4ATFA 1RUE3 1RUF1 1ZBA1 3OEAA 1AYM1 4FAHA 5IYYA 2WA3A 3VBSC 4PIYA 3LA7A 3J9SA 3ZO0B 4ZPIA 1ZYBA 3S5QA 3SH4A 3PDQA 3DCQA 1PIV1 4RSUA 2A6ZA 4BIFA 1H8TA 3GHMA 1SLAA 4YVSB 3TWIA 4R52A 1AL21 2W1WA 4LLFA 4UOJA 4Z1VA 4ZU7A 2IXJA 2YG0A 2JDHA 4FT8A 4CEYB 4KBBA 4W6WA 3RFRA 4DS0A 5A6XA 2FMYA 3BALA 5CFCC 5K9YA 2IXHA 3ZXKA 1RHI3 4YG0A 1PO13 2RJLA 1VBD1 1GP6A 4Y1VA 3WW1A 1ONAA 4EROA 3PHMA 4EWEA 3MV01 2BWCA 2VECA 4A3XA 3UKTA 3T2PA 2VNRA 1YJKA 1DZRA 1B09A 1OLME 3R0RA 1LTEA 4AI8A 4QX1A 3ECQA 3VBUC 2UWCA 2ZJCA 1UXXX 4PT6A 3RSJA 4A6OA 1XYPA 1NZCA 1WCSA 1VBC2 4XTMA 5JOZA 1OA4A 2XLGA 2CGPA 1BQPA 1RUH3 2VQAA 3A23A 4FXKB 4KG0A 1T6BX 4AG4A 4HKOA 1OMIA 1BJQA 3UESA 4LUMA 2BNOA 1EP0A 5FYIA 1HN0A 5EZWA 2K46A 5BPXA 2VQ0A 3HNYM 3TEYA 2VBDA 3VBRB 5IVEA 1BBT2 2J1EA 3MBWA 5FUNA 5JIUA 3SCGA 4RS5C 1QEXA 3MDPA 2PHDA 3LFIA 5FK7A 2ET7A 3APBA 3N7KA 3VZMA 1VB4A 3W5NA 1W9SA 4BIOA 3GM8A 5J1XA 4NO4A 1XYNA 1YI9A 3IPVA 4FOYA 4FPYA 1C5HA 4OHVA 3KSCA 4YW5A 2YBSA 2RS32 1V9U2 2K9ZA 3NJYA 4QPWA 5T54A 3UKNA 4ZS2A 4YGEA 1NXD1 5F5AA 3D82A 5DDJ3 5GLWA 2A75A 2Y38A 1PGL2 2BJSA 1QJY2 2XDVA 4LK6A 3LGRA 4IESA 1UZWA 3ZM8A 3KGLA 3LA2A 4CUCA 2GC2A 3U1XA 2IC1A 1GUIA 2MEV1 1RHI1 3UETA 1TVGA 4E8CA 2JECA 2VL4A 4Z8BA 2BUKA 4OHYA 4XILA 1VBC1 3M3EA 2YMZA 3AYDA 4XXAA 4XJZA 3WUCA 5J36A 5APAA 3PMEA 4P9JA 5HXMA 2W39A 3RDIA 4YZ2A 1YQ8A 1P8JA 4M4PA 4D6QA 3KCYA 4AWDA 1YI7A 2BGCA 1KJRA 5C5TA 5J98B 2Y33A 4MHRA 1IOAA 1DYOA 2QVSB 5LB6A 1SLTA 2JG9B 3MI8A 2BP6A 1ND2B 4QKDA 1C8M1 2ZBJA 3DPRB 3MO4A 4YW7A 3PU3A 2ZGLA 2XG3A 3ZXFA 4CP9A 2VXJA 4RQPC 4U36A 2AC1A 2DVGA 2LS6A 5C5UA 1ZM1A 3RS6A 5A7QA 3H1WA 1Q56A 1E5IA 1NCRC 1YJLA 5A7NA 2LM3A 2OUHA 2CU5A 4YM2A 2N7GA 4S2HA 1XNCA 3UV9A 5LRSA 1W9TA 3ETPA 4Q2FA 5FY9A 2GU9A 2WT2A 2PMWB 4UFHA 4MSVA 2I07B 1MVEA 3BTXA 1K5MA 1OA3A 1W04A 2R063 2WNUC 2Z4FA 3LZZA 3VBRA 3G6JB 1W8TA 1O59A 3OYWB 3MIGA 2XJTA 2ZOEB 3DXTA 4N43B 2XJQA 4Y33A 2CNAA 4EV0A 5JUVA 2ZGTA 3WOGA 4DRRA 4AI3A 1RUC1 2OXBA 1TG7A 1J84A 2JE7A 4NRMA 5AVPA 3KF5A 3VKFC 4OFGA 5FPUA 4IW3A 1ZRCA 3WG4A 3ZPOA 2E26A 2V73A 1W2TA 1LHNA 3AZYA 1H0BA 1VALA 3ON7A 4PQQA 4Y1YA 1HX6A 5CKMA 1R083 1LOGA 1RUJ2 4A6SA 4PDWC 4PHZA 2HWB1 5A70A 2GMMA 5KXBA 1KXGA 4IETA 1GZWB 4AK3A 5FOJB 5I0TA 1X50A 1VR3A 1S0FA 1RGSA 3AXEA 3EXUA 2J1VA 2PQQA 4X6RB 3O1OA 2QQPA 3WV6A 2VTXA 3KQ4B 1S2EA 3GXUA 3HIFA 4RFT0 3JU9A 1AUYA 1LRHA 5FYVA 1JOBA 4ZONA 4XE9A 1DU3D 5FDBA 1RIRA 1IG3A 3LFMA 3ZFGB 2JG8C 4RGGA 2ZEYA 3NW4A 1NG0A 1DP0A 2WZEA 3OJBA 4IQPA 1BMV1 5I91A 3C7HA 4JGZA 4BU2A 2QQJA 5F2SA 3ZFEB 1UMZA 5FYUA 4LO8A 2YFZA 2YBPA 4Y1ZA 3ZYGA 3TN91 4G3YC 4FPFA 4QXCA 1JOJA 2BV4A 4BQXA 3MIHA 3BIEA 3T0AA 4A4AA 4Y24A 4MHUA 2O0OA 1NY71 2PHLA 5A7OA 2HWD3 2ATFA 1V00A 5EJZB 1OOPB 3H9AA 4LPLA 4LIUA 1IPJA 2RR12 3RZMA 4XUNA 3VHPA 5BUVA 1FOD3 1W8ZA 4JHTA 2NYYA 1UY2A 4AF9A 1W6OB 5A33A 2FDKA 2X05A 3T30A 3X29B 1NKGA 1HN1A 1YRZA 4LBMA 3K4DA 4I3GA 2Q1ZB 3DYMA 5DG2A 1Q8OA 2VE1A 3WUDA 3B69A 2UURA 3HNBM 3ATGA 4KBZA 3MIEA 2JKBA 1VBC3 4XACA 4QT6A 5LRRA 1S0IA 4HKWA 3AP6A 4OI1A 3T09A 2C6SA 5CG8A 2V72A 3KZ4C 3POGA 1QQP1 4Q27A 2YHJA 3PVOA 1H4GA 3SITA 3RG0A 4EJRA 1JUIA 3NJVA 5IK8A 1PK6C 4NPRA 2ADEA 4QPGA 3VBUB 4AVTA 2VZVA 3VKOA 2HWF2 2W2IA 5C3PA 3I8TA 2XPJA 3WEZA 2GC3A 4QD2A 1HKDA 1IHMA 3EJKA 3GGLA 1DQ6A 1L3JA 1ENRA 1QJX3 1ZVFA 3JD73 5DAVA 3AP9A 4BYYA 4QM9A 1ULOA 1X7NA 3NVCA 3USSA 5ANQA 3GYDA 4JZRA 1DQ0A 5JIAA 4BE3A 1R093 2A3WA 3VZKA 2E6VA 3E5UA 3WR0A 1J3RA 5FZCA 3IKWA 1UZVA 4QU1A 1D2SA 4CXYA 1FATA 4P9XA 1PVC1 5FY8A 1DQ5A 3I2DA 3M4FA 4LT5A 1NQDA 5LBBA 2C0ZA 2XONA 1RUI1 3SXWA 3IDCB 1MS8A 2Y6FA 1I3HA 1OQ1A 3H7YA 2ZX1A 1MS3A 4AAXA 3OGVA 2DTWA 4A7ZA 3N7JA 1PO11 4FFHA 5DZGA 2Y60A 3VZNA 5FK8A 4D7TA 5FZ8A 1AYN2 1GMMA 1LNSA 1WCDJ 5G05L 5JOXA 3KCXA 4C1WA 3U14A 1UPSA 2MEV2 3MW2A 1XB9A 3AYEA 4G4FA 1DG6A 2B45X 2DFBA 2AH2A 4GA9A 4UBGA 4CU8A 3O1SA 4D8MA 1JN2P 1PX4A 2QE3A 2XKOA 1K5MC 2DUPA 1TME2 4YG3A 3THDA 1OXCA 4OLLA 3MHZA 4W6YA 5C3QA 1AL23 4JGZB 1G86A 1PM7A 1PZ8A 2GH2A 1NYWA 2DCJA 1UU6A 4CXWA 3H8RA 2QJVA 3CZJA 3N4MA 1J58A 1WCKA 2ES3A 4CDQC 5FBZA 4Q0VA 3IB3A 4E2SA 1WW6A 1C4RA 1NCQA 4IV3C 3RWKX 4CU6A 4YZ1A 1QGLA 4RQPA 1W6MA 2AZ5A 3BGAA 3TN93 2J1TA 5JXGA 4LKEA 4YW1A 3C2UA 4YRDA 1NOVA 2ENRA 5FZFA 4LQRA 1LOCA 1WD3A 1ZRIA 2YXSA 3SCFA 1JYWA 2HJIA 2QQOA 1QH6A 3U37A 1DQ1A 2JDKA 4DXZA 1RTVA 1AYM3 2Q30A 5I8YA 1DLCA 2TEPA 4XC9A 2DVAA 4Q4X2 2RMU3 5DN2A 1BEV2 4R9AA 2WZ8A 4Q0QA 1VLNA 1RUNA 4NIIA 4JVAA 1K5MB 5IVYA 2LTNA 2O8QA 5FZKA 2PLV1 3U11A 4XF1A 5BY5A 1QJEA 1HW5A 1Q3EA 4TSVA 4XBNA 4NIGA 1WKYA 2QQNA 3KVBA 4AEMA 4QGNA 1QIQA 3OPTA 1RVF2 2WSUA 1H8TB 2ZKLA 2HWB3 5SV5A 1YCIA 3AZWA 2P6CA 2CV6A 1F8VA 5FBJA 4NWWA 3U75A 4U2AA 1ZRRA 3NNLA 4CCKA 3WG1A 1PX3A 3J7LA 3B94A 4NN0A 5FPZA 2VMCA 1G9DA 4FPHA 5FZ0A 4O9EA 1CVNA 1QKQA 1BZWA 3J26N 5SV8A 3VZOA 1FV2A 1ZZ8A 3PIGA 4URTA 4DZGA 5JXJA 4DUWA 5FXVA 5CKNA 1V9U3 1KRIA 2ZHKA 4CDWA 5BYNA 4LKSA 2VUAA 3VKNA 4XJAA 2PAMA 2ORXA 2ZPXA 1X9TA 5C4WB 1JHNA 5FMOS 3P3NA 5CEHA 1SDDB 3O14A 1BMV2 1JZ8A 4XFFA 2W1UA 3SQOA 4FPCA 2A6YA 4AFBA 2WLQA 4NMIA 5H9PA 5T50A 3WW2A 3HAGA 4EZHA 2TUNA 5JR2A 4FPJA 1VB2A 3HVDA 1FMD2 2IXKA 4JC1A 2Y64A 1W3VA 2VUDA 3I59A 1YLLA 1YWKA 1GP5A 2R16A 1I5PA 1U0AA 4Q29A 4XAAA 4QGMA 4XCAA 2AR6A 3VKMA 4S2GA 1NY72 3WP6A 1U12A 5FYTA 1RMU1 1N3OA 3ZFFA 1U5IA 3VV1A 3DV8A 4CDWC 4FFFA 1H30A 5J48A 1W03A 2A73B 3DUIA 1ASJ1 2VTFA 4WBBA 5FZAA 1B35B 4GAZA 4AHXA 1VMHA 4MGSA 4QXKA 4CCEA 3S30A 1QU0A 5E6HA 1O3TA 5FOBB 3H0OA 1YQ5A 1I9RA 4WZCA 4IEWA 2B39A 2CWSA 2R071 1W9FA 1M4WA 4RYDA 1GR3A 5KWRA 2R042 1YXWA 1VBB2 3OD4A 4XEZA 2P17A 3ELNA 1TMF3 2ZGOA 4XHXA 2ET1A 1EPWA 4QDQA 5L7OA 1S0JA 4H14A 1LR5A 4FSJA 4TTGA 1V6IA 4LBLA 1HRV1 2TNFA 4WVVA 2Q8OA 1GICA 4AE2A 1S0CA 5H9QA 1X8EA 3PJYA 4O7XA 3SEEA 4QPGB 2EXIA 2JJ6A 2P37A 2DUOA 3MEPA 3S57A 2E7TA 3NAPA 3FN9A 1HV0A 2WFPA 2EAKA 4P9YA 5C70A 1H9PA 1H1AA 3KGZA 3L2HA 5EXOA 2VVEA 3N9QA 3IDEA 4K40A 4Q26A 2DCYA 4C1XA 4CPBD 2W1SA 4C0HA 4IUGA 1DZTA 2E31A 1W6NA 5F1RA 2GNMA 2BTVC 4COZA 4PJYA 3LDBA 5FKBA 3JBG3 1SFNA 2CDPA 3N9NA 2W08A 2ZGPA 5ISLA 3ZSLA 3EHKA 1TMF1 3AJZA 2HBTA 3LWCA 1KEXA 5FMOL 5DUXA 2AEZA 3WINE 4BLJA 1NUKA 3AVRA 2BFUL 2BVBA 3I59B 3R6SA 4PIXA 1MEC3 2R062 2VM9A 2WS91 4L99A 3VBHC 2XBO3 2XUEA 4LA3A 2P2KA 4Q4Y2 2C9KA 3IM0A 1R1A1 1R082 1RUJ3 1VRH1 5T5PA 4LOTA 3KLSA 4IGOA 3S7IA 3FUOA 5JMOA 3PVNA 2ZEXA 1QOTA 3OYWA 2FDHA 1SFPA 4Q4W1 5F5CA 4CA9A 2V09A 1ULCA 2VOXA 4AW7A 4HANA 5FZOA 1JS9A 2W95A 2WSVA 3O0WA 1EAH2 1O7FA 1AJKA 1YFWA 2Y26A 3ACGA 4FVVA 2ZHNA 3KCCA 1VBA1 4K1ZA 1F5JA 4QGLA 3HBZA 3CNAA 5BNPB 1PNGA 2GN3A 2RS13 2XVKA 2VMIA 3I3DA 4ATEA 1SLBA 3WDWA 4BJ0A 2WABA 2JDNA 3CHXA 3MPBA 1RUG1 1ZZBA 2XL9A 1RUD3 4NHXA 4MUVA 2DBIA 5EIYB 3OG2A 4LOSA 5A3OA 5JXIA 3TEWA 5F6LB 3LE0A 1JBCA 1DF0A 3RZHA 1ND3A 3MLLA 1W39A 3G7DA 1CGPA 2Y6GA 1RUF3 1ZBA3 5I0RA 3NAPB 4CCLA 3JQXA 1TQ5A 2GNBA 1PO22 2VMHA 3POIA 4R8HA 3RI9A 5A32A 2JE9A 3MFCA 1XNTA 3KWVA 3T2QA 4CCMA 4YYOA 2JX9A 3GALA 4P9GA 4H2AA 3WP4A 1N1VA 1G9CA 1UKGA 4PQ9A 3EBRA 5FP7A 3UKVA 4AI9A 3I3BA 4L97A 5IATA 3O1MA 3CJIB 5F32A 1SLCA 3VD7A 1HRI3 4AFAA 1OQDA 1PVC2 2CHHA 4OVEA 1N3QA 5GM0A 4GWNA 3VBOC 2VTXJ 2J1RA 5ABJA 1QJX2 3PTRB 3WG2A 5C3SA 2WT1A 1O91A 2MPFA 5K0UA 1OD3A 3RPQA 1XU2A 2FCVA 3FZ3A 1BEV1 4UT5A 1HJFA 4MH0E 5IFPA 1NA1B 2A3YA 4CSWA 3ZN6B 2I74A 2HBUA 4M3CF 4YM0A 2DF7A 1UQXA 2MNGA 3POBA 4OULA 2YC4A 3AMPA 2RMU1 3ORJA 2PXJA 3Q8BA 1QHDA 2WNUB 3FUQA 4WM8C 1SACA 5FRAA 3M7AA 2VZQA 1PIV2 3BCWA 1FAYA 4LUKA 2DCTA 1XU1A 1AR91 3CL1A 3QD6A 2WLPA 1FT9A 3LCPA 3OPWA 3ENRA 3P1IA 5T5LA 3U07A 1UY0A 1ULEA 1BKZA 4QHZA 4SBVA 4A45A 3Q8CA 2WO2A 3ZYPA 1G9AA 2E7AA 1XPWA 4ORFA 2ARBA 3DXUA 2X8KA 3PVEA 4PI2A 1KD7A 1O6UA 3ASIA 4P5YA 5JSRA 1CPNA 1C8M3 1CQ9A 2IVIB 3AZVA 2VZUA 4JGYC 5A6YA 5IJRA 2BU9A 1J1TA 2A1XA 2D6LX 2D98A 2YFUA 4FQ4A 5C9AB 3E5QA 1XBFA 3LB9A 1BK1A 3U4SA 4ZU4A 3USUA 4Q4Y1 4B7EA 2E51A 3AMHA 2VULA 5DAQA 1ND3C 1O3QA 4Q4V3 3RZGA 1FXZA 2D5FA 1AZDA 4UFLA 3BU0A 1W6OA 3BODA 4FXGB 3MIDA 4S2DA 2RJKA 1W2UA 3V0BB 4XUOA 2QQKA 4HMZA 2UY8A 1KS5A 2B42B 4XFBA 2JD4A 2MEV3 1U5ZA 4QB1A 4YZ4A 4AFMA 4KNCA 4AEDB 1GZ9A 1EUTA 4QX2A 4CU7A 1VBD2 3F95A 4IEOA 4HLTA 3KV4A 2PHFA 4C8DA 1REEA 3J7MA 4IGQA 4L11A 4O65A 4ARYA 5HV0A 4KL1A 2ZGMA 1RUI3 3OTFA 1HXS3 5A1LA 1MS4A 4XAEA 1CESA 2DTYA 2VJXA 5CB7A 3PMSA 1AXYA 4H55A 2QQLA 3CO2A 1H6XA 5EQUA 3O12A 3BI3A 2DVBA 1WWYA 1A78A 4HBNA 1NLRA 1ZRDA 4CDXB 1POV3 4YSFA 2NP0A 3ZR6A 1O4ZA 4BQYA 1KDMA 3AX4A 5A6ZA 5C7GA 1OI6A 3SISA 2WINB 4LO5B 3VBRC 3ZXAC 4A42A 3BTYA 4RS5B 3JBG2 5FP8A 1MEC2 3JB4C 3D5OA 4RFRB 4BB3A 3I49A 4DY3A 4FTSA 3AP5A 3WF4A 5KXDA 1DGWX 3FLTA 3O0VA 5IW0A 2X29A 5GLTA 3N9LA 1RUH1 3NWKA 4MOAA 4B4RA 1NT0A 1D2QA 3GJBA 4GMP3 3VZLA 3MIFA 1QQP3 3T0DA 2LRPA 3HEIA 2UU8A 4MYEA 1R64A 3FX3A 5FPXA 2DCKA 2YBKA 3SH5A 4Y22B 1PK6B 3ITQA 4YM1A 2PTMA 4N90A 5JPMB 1KJLA 1ZNPA 3MF6A 5T5OA 1DZQA 5I0UA 1UX6A 4OHWA 3S0MA 1IS5A 1W6QB 1RUE2 2J7MA 2XGXA 5FZ3A 3AC0A 4ES9A 4MG2A 1YFXA 5TSWA 4KI5M 1V6KA 3BKZA 4GQ7A 3ACIA 1A8DA 5A1AA 1HXS2 3FBMA 3FFQA 4HFSA 2PAEA 5LCWL 1FOD1 1UY3A 2DCZA 5GKAC 2WNVA 2Q8CA 1H4HA 4NHYA 4YVWA 3HQRA 4E4HA 3NKTA 1Y9MA 1IQDC 1HB3A 4OQ9A 1UWWA 2HWD1 2R041 2ZACA 3LKJA 4ITCA 2LUWA 4AAPA 2JG9C 4XOGA 1OKOA 3O1UA 4CE8A 4D0QA 4DEQA 1STMA 1DIWA 4XVHA 3FBYA 5FV3A 4NIAA 3HNMA 1AR92 4QDSA 1OD5A 3HR9A 4UXAA 3WW4A 3UGGA 3WLUA 2W9XA 3NNGA 1NCQB 2D43A 2BEOA 5JOYA 3AL5A 3FJSA 1Z78A 2HYKA 2CWMA 2C26A 5FZ1A 3KM5A 3VUOA 1AXZA 3MW4A 1F15A 4AR2A 1FI2A 2VZOA 3ZFFC 1SZBA 2UYAA 3QCWA 3OGJA 1LGBA 3CMGA 3L2YA 4CCDA 5L19A 4BWOA 1IQAA 5DUVA 3MLKA 1RB8G 4XFIA 3E6DA 3ES4A 3SKVA 1Z7S1 4NPMA 1ULGA 2C5DA 3GBWA 2E7QA 4JTOA 4FI9A 3SNMA 1VMFA 4HKLA 4ZZ5A 3LOBA 1HV1A 3A21A 1JOPA 2D44A 4N43A 3KHCA 3U4XA 4E8DA 1RUF2 1ZBA2 1FMD3 3E6BA 1T2XA 1S0DA 1W8NA 4J1WA 3WHTA 1MPXA 4L8QA 2F4LA 1OPMA 5FUPA 5FO8B 2WO7A 2KM2A 1KS4A 3WNKA 1RUOA 2Q1MA 1QMJA 3SKJE 1OH4A 2VCCA 5LA2A 3WDYA 5JSOA 1JZ6A 4CDQB 3A4UA 5CFDC 4Y22A 4YPJA 1HB2A 2R7EB 1BBT1 3J8F1 1OOPA 2G9ZA 2ZGQA 4MXWA 4EN6B 3WHUA 2BGOA 1HDKA 1Y43B 4XMAA 4IE7A 1J1LA 5EJ1B 4YG6A 4FPKA 3E97A 2XHKA 2R061 4NHLA 2EALA 2A6VA 2WBKA 4DXRA 1PMJX 5C8CC 2WJSA 1SPPA 4KWLA 2ZCWA 2WNVB 1I6XA 3JXSA 2HEYF 2VOKA 4C0BA 2ZGSA 3UNPA 4P08A 2KD7A 1BYHA 5L9RA 2BWAA 5KXCA 1REFA 5FPBA 4ZZ8A 1VJ2A 4QPYA 3OGSA 5F3IA 4Q1PA 2D5HA 2PLV2 4CTEA 5FMBA 4GB33 3J7NA 1QXJA 1AHSA 3ALQA 4F7ZA 4Y5TA 5FLJA 2JG8A 1H8TC 3CEWA 5FPVA 5LBFA 3IN9A 2HWC2 1CR7A 3MUY1 2ZX0A 5BNNA 1X82A 1GV9A 1MS1A 1KFXL 1RINA 2RMU2 3NV3A 1E5HA 4XBLA 1HJGA 1UF2C 2VOVA 1U5XA 4N53B 3FLPA 4Y5Z0 1CAUA 1X8MA 2Y6JA 5LWBA 3EO6A 2WRAA 1APNA 1Q8VA 3HQXA 2PYTA 4UBHA 2VMFA 1GBGA 2ERFA 3AYCA 3WCSA 5HCBA 1OOPC 5A3PA 2I2SA 2QFEA 5D8AC 3HOBA 1S2KA 3WQ0A 1PGSA 1NLSA 1RUI2 1SLIA 1WMDA 2V4VA 3LSDA 5A7WB 2DV9A 3H1MA 1F9KA 1ZBE2 2ZZQA 3LPFA 2G9GA 3LSEA 2VNOA 2EIEA 4MGZE 4Q4V2 3TEZA 4NIHA 4CP1A 4GH4B 4ZHNA 1GFF2 1OBNA 2WZR2 3BU7A 3VBFA 2Q5TA 4IEXA 4OYUA 2JDAA 3GZTB 3OSDA 5GZDA 4BQ5A 1XE7A 4MGQA 4YW6A 3BVCA 1WZXA 1PO23 4NR1A 3ZYFA 2BBVA 3DYOA 5EYYA 1D0HA 2JDZA 3VD4A 2HYXA 2IFWA 4DNYA 1JTZX 4GB32 3ZSKA 2WWUA 1GNZA 4XJ9A 3TRSB 2OW4A 4OQ8A 3QH6A 2HWF1 3RMXA 3LEMA 5FQ0A 2D3SA 1HLCA 1MVQA 2FDGA 5F8PA 3NL1A 4Q5OA 4QPIA 4NPLA 3AMNA 2ZZJA 4L92A 4KH9A 4NUBA 4YW3A 2RM21 5FZBA 1YNAA 1TEIA 1N1SA 5K4LA 3OEBA 4XFCA 4ZY9A 2P3KA 3FFZA 3WF2A 1FNZA 4JDMA 1DQ2A 1LKNA 1XNBA 3T2OA 3UJQA 3I2KA 1JUHA 4NHMA 4PLOA 1RUH2 1UOGA 5CZKA 3TEXA 2W68A 4I3PA 5FO7B 5H9SA 1IG0A 3EB7A 4J25A 4UFMA 4BHPA 5FYZA 2VUJA 5FMCA 4KQ7A 1S55A 4UF0B 3S6PA 1ZBE3 1QWRA 3N9OA 2H0VA 4KU8A 1QNWA 3WZ1A 4C90A 5CISA 5HCHA 3PIJA 5LEKA 4LULA 2EXKA 3WNOA 1GYKA 2WZR3 1AYN1 3CIHA 3BOPA 5D1IA 2EXJA 1H2KA 2BRTA 4XURA 3J7HA 5I93A 1QXPA 4QPGC 3K51A 4OUEA 2HEVF 1ENXA 1ODNA 4K8FA 3DECA 1M06G 2DUQA 4UW4A 4WVWA 4B8EA 2XJRA 5EPAA 5FUIA 5CU1A 5FZOB 4LE3A 3RQ0A 4IEQA 5EJ3A 1LODA 2E9QA 1FNYA 1D4M3 3N7LA 4FPGA 4BK4A 2W52A 4XCBA 2R1BA 3W21A 5FCCA 2HWD2 5ABJB 4WM7C 4QWNA 2VVFA 1UIKA 5ACA2 3LEGA 1Q5OA 1ACCA 1FOD2 4FP2A 2VO5A 3WXPA 4ARXA 1WD4A 5J96B 5FJHA 1UL9A 3GDBA 3ES1A 5KHKA 4HETA 1SBDA 2XJVA 4CRQA 4GMP0 1GWLA 1UNBA 2WYFA 3ZXDA 2NZ9A 1POQA 2JEMA 4A41A 4Y3OA 4XF0A 3CZUA 4UFKA 3VBUA 4MV2A 1MR5A 5F39A 1G9BA 2PFWA 1OFNA 2BFUS 4XJUA 1VPHA 4XDPA 3ZXEA 4BLIA 2RDNA 5EYXA 1UY4A 1EUUA 1NLQA 1X36A 4XJ8A 3R4DB 2WFF1 2EVXA 1IPSA 3WNLA 2FDJA 3AZXA 3RZLA 1WA6X 3KF3A 4FFIA 4JV4A 2XMLA 3PNAA 4JAAA 2FD8A 2J22A 1JZ7A 5FZ7A 4NOTA 1Y3TA 2W1QA 4B29A 5BNPC 2NQYA 4L9BA 3PTYA 3OCPA 4UF0A 5IVJA 3D0SA 1GOGA 1QDOA 3I7DA 3MLJA 2QUOA 2J42A 1OSGA 2XXZA 3AKRA 1K3IA 1EAH3 4G9SB 2VUCA 4COVA 2VZ3A 4LBOA 5J09A 2DYCA 4JGYA 5IVCA 1PVXA 1ZA4A 2GALA 4AFDA 4IEUA 2HKXA 3GBGA 4XIKA 5GLUA 2VZPA 1CWPA 4BQ2A 2E53A 3AKSA 3DL3A 4LHKA 2VGDA 4XFHA 1CIWA 1RITA 4N9IA 4B4PA 5LW9A 3KT1A 2OQ7A 2OPWA 4GWMA 4KU7A 2JDUA 4AGRA 3BOWA 4D6RA 2WC2A 3ZMNA 2GSYA 2Y0IA 4PIZA 2JENA 5C4WC 4HG6B 4QDRA 1IKQA 1Q43A 1TNFA 1R092 3OY8B 5FYCA 4RA0A 1EV13 4CPBA 1ULPA 3FHAA 2RHPA 5FZEA 4YGDA 3RJ2X 3CLPA 1CJDA 1YEWA 1RJ7A 4LXLA 4DB5A 5DZEA 3W59A 5L73A 3RI8A 1NCRA 3AYAA 1N47A 2IUWA 4FOWA 4A7KA 3O0XA 4META 1L7RA 2D7FA 3C8XA 4PF1A 1MQTC 2BGPA 3M3OA 1Y7BA 3LQCA 4M0HA 3S7EA 3VBOA 1XNAA 3NV4A 3R4SA 3A0KA 2A6WA 2VQUA
chains in the Genus database with same CATH topology
2QBXA 1US3A 2W95A 2DDUA 3ACGA 2EIDA 1GOHA 4XZUG 3OEAA 5IYYA 3I3DA 3WF0A 4BJ0A 2WABA 4OMCA 4L0PA 1JU4A 5LA1A 5EIYB 3OG2A 5JXIA 1RYYA 2WN3A 3LE0A 2W1WA 2VC9A 2Y6GA 4UOJA 2YG0A 1XNTA 3T2QA 5B4XA 2ZEZA 3VDAA 3CDZB 1H6YA 2XHNA 3I3BA 5IHRA 2VZTA 3C7FA 3I2IA 4LHSA 5DMYA 5I0DA 3VD7A 3MV01 3T2PA 2W47A 2J1RA 4BXSV 4QX1A 3ECQA 1OD3A 4A6OA 4PT6A 2VOTA 4A3ZA 1XC6A 5IFPA 3ACFA 4BK5A 4DXSA 1KGYA 3A23A 3IAQA 4AG4A 4DXTA 2YC4A 3UESA 3D3AA 2VZQA 2VCBA 3HNYM 4OMDA 2J1EA 3MBWA 3OB8A 3P1IA 2W5FA 1UY0A 3I2GA 3NJXA 3W5NA 4A45A 1OF3A 1W9SA 2E32A 2WO2A 3GM8A 5J1XA 1XPWA 3P6BA 4QPWA 2QQMA 4P5YA 3I2FA 2Y6LA 5DQ0A 2VZUA 1NX9A 5IJRA 2YFUA 3PUHA 3ZM8A 4CUCA 1GUIA 2W92A 3UETA 1TVGA 4QAWA 2VL4A 4E8CA 3LEKA 4P02B 2WQ8A 4XUOA 2QQKA 2BZDA 5HXMA 1F4HA 1P8JA 3C7OA 4M4PA 4UAPA 4QB1A 3ABZA 4QX2A 1EUTA 4CU7A 5HPOA 1CZVA 2V5DA 4M4RA 1DYOA 4ARYA 2VMEA 2WAOA 3MO4A 2VJXA 3MUZ1 3OGRA 1JHJA 3K4ZA 2LS6A 2QQLA 1H6XA 2W87A 4JKMA 2WN2A 5B4NA 1UZ0A 2L9LA 3WF3A 1W9TA 3ETPA 5C7GA 4A42A 2HLEA 4XUPA 2Y8KA 4CUAA 2Z4FA 1WCQA 1O59A 5G04L 1UX7A 5JUVA 3WF4A 1SG3A 2EICA 3WNPA 1TG7A 2RVAA 1J84A 4MOAA 5JXHA 2WDBA 1YQ2A 1JI6A 2E26A 3T0DA 3HEIA 1R64A 3A7QA 2DCKA 1GQPA 2CDOA 1UYZA 4PQQA 1BHGA 4JKLA 2J7MA 3AC0A 4KI5M 2B9VA 2J1VA 3ACIA 4JHZA 5A1AA 3GXUA 1CIYA 5LCWL 1GOFA 1UYYA 1UY3A 3C7EA 3VD5A 2RV9A 1IQDC 2B4KA 1UWWA 4W50A 2ZEYA 1W9WA 2WZEA 1DP0A 3E1F1 3C7HA 4D0QA 4DEQA 2QQJA 4XVHA 4TXWA 3HNMA 3HPNA 4QDSA 2YFZA 4CUBA 2W9XA 3NNGA 2WUHA 3VD9A 2C26A 3T0AA 4A4AA 2VZOA 2XOMA 3CMGA 4A44A 5EJZB 2ORZA 4LPLA 4XUNA 3SKVA 3HN3A 1UMIA 2W3JA 3I3EA 1GU3A 1UY2A 4FI9A 2X05A 4ZZ5A 2YB7A 1NKGA 3A21A 1HN1A 4QX0A 3K4DA 3DYMA 4E8DA 1CX1A 3VD3A 1T2XA 1W8NA 3HNBM 1MPXA 3NQHA 2RJ2A 4JX0A 3WNKA 3CKHA 2ID4A 2WO3A 3SKJE 2J1SA 1OH4A 2VCCA 5LA2A 3T09A 1JZ6A 2V72A 3K77A 1J83A 4YPJA 2R7EB 4XUTA 3NJVA 2BERA 2BGOA 2VZVA 5EJ1B 4MADA 1NAEA 2WBKA 3WEZA 5IFTA 3GGLA 4DXRA 1PMJX 3FHQA 1ULOA 3JXSA 3UNPA 1O8PA 2Y6KA 2KD7A 4GZ9A 4P08A 2J1UA 2EIBA 2QQIA 4ZZ8A 3WF1A 3OGSA 2JE8A 2VQTA 3SEPA 1US2A 2XONA 2Y6HA 3MUY1 2E33A 4W4ZA 1W0NA 4AAXA 3OGVA 2C4XA 2PQSA 1GMMA 1LNSA 2Y6JA 5G05L 2VMFA 4JKKA 4QB6A 1CZSA 3I2JA 3LPGA 4CU8A 1O8SA 2ZEWA 4D8MA 3HOBA 3THDA 1PX4A 2V4VA 3LPFA 2DCJA 4CU9A 3CZJA 5DPNA 2EIEA 2OKXA 3FL7A 1GNYA 3IB3A 4OYUA 2JDAA 4MGQA 4CU6A 5CYYA 3DYOA 3BGAA 4GWIA 4UI9L 5JXGA 2J1TA 4Z2AA 1JYVA 3VD4A 2HYXA 1PMHX 2X09A 4LQRA 1JYWA 3WNNA 2W94A 4P00B 2QQOA 3WNMA 3K46A 2VCAA 3U37A 4QB2A 3HJRA 3THCA 1DLCA 4W8JA 5DN2A 1K12A 2WZ8A 3WQBA 3OEBA 1F4AA 4ZY9A 3WF2A 3T2OA 1JZ5A 3I2KA 1W8OA 4OZOA 1OT5A 5F7UA 5CZKA 4DUVA 1WKYA 2QQNA 3A22A 3EB7A 1JU3A 4DEVA 2WAAA 2JKXA 4DUXA 3F2ZA 2VZ1A 3WSOA 3WNOA 1PX3A 3CIHA 2VMCA 4XURA 2VMDA 3J7HA 4QX3A 1CZTA 5JXJA 4OUEA 3C7GA 4DUWA 3DECA 3DYPA 4LKSA 5LA0A 1W99A 4XUQA 5FUIA 2ORXA 4RN5A 1D7PM 4BK4A 1SDDB 1JZ8A 2W1UA 3OBAA 2WO1A 1SHWB 5JR2A 3NRUA 2W46A 3LEGA 2VO5A 2Y64A 4ARXA 1I5PA 3GDBA 1JZ2A 4KMQA 4A41A 4BDVB 4KWUA 2JD9A 3MV11 3CZUA 4ET7A 2VTFA 1L7QA 4MGSA 4GWJA 1JZ4A 2X10A 1UY4A 1EUUA 3WNLA 3EYPA 4RYDA 2J22A 4MO3M 1JZ7A 2WYSA 1K45A 4ZXEA 2W1QA 4QDQA 2VZRA 1JYXA 4TTGA 3I2HA 1GOGA 2LW8A 4CVUA 3IIIA 2W91A 3SEEA 3T08A 3W5MA 2VZSA 1K3IA 3FN9A 2VZ3A 3PUIA 5C70A 2J1AA 3LEIA 3BN6A 2VZPA 3K75B 2W1SA 4IUGA 5C71A 1UMHA 3I97A 2E31A 3IDAA 1JZ3A 3ACHA 2YC2A 3VDBA 1UYXA 2XQXA 2CDPA 3IAPA 1K42A 4HG6B 1OF4A 4QDRA 1KEXA 1NUKA 3K4AA 1ULPA 1UY1A 3FHAA 2VM9A 2BBAA 3T0BA 3CQOA 2C9KA 2ZXQA 5JMOA 1UXZA 2ZEXA 1L7RA 4PF1A 3C8XA 3VDCA 2BGPA 3LQCA 2VR4A 1XNAA 1JYNA 1UXXX 2VQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QBX A;  1US3 A;  2W95 A;  2DDU A;  3ACG A;  2EID A;  1GOH A;  4XZU G;  3OEA A;  5IYY A;  3I3D A;  3WF0 A;  4BJ0 A;  2WAB A;  4OMC A;  4L0P A;  1JU4 A;  5LA1 A;  5EIY B;  3OG2 A;  5JXI A;  1RYY A;  2WN3 A;  3LE0 A;  2W1W A;  2VC9 A;  2Y6G A;  4UOJ A;  2YG0 A;  1XNT A;  3T2Q A;  5B4X A;  2ZEZ A;  3VDA A;  3CDZ B;  1H6Y A;  2XHN A;  3I3B A;  5IHR A;  2VZT A;  3C7F A;  3I2I A;  4LHS A;  5DMY A;  5I0D A;  3VD7 A;  3MV0 1;  3T2P A;  2W47 A;  2J1R A;  4BXS V;  4QX1 A;  3ECQ A;  1OD3 A;  4A6O A;  4PT6 A;  2VOT A;  4A3Z A;  1XC6 A;  5IFP A;  3ACF A;  4BK5 A;  4DXS A;  1KGY A;  3A23 A;  3IAQ A;  4AG4 A;  4DXT A;  2YC4 A;  3UES A;  3D3A A;  2VZQ A;  2VCB A;  3HNY M;  4OMD A;  2J1E A;  3MBW A;  3OB8 A;  3P1I A;  2W5F A;  1UY0 A;  3I2G A;  3NJX A;  3W5N A;  4A45 A;  1OF3 A;  1W9S A;  2E32 A;  2WO2 A;  3GM8 A;  5J1X A;  1XPW A;  3P6B A;  4QPW A;  2QQM A;  4P5Y A;  3I2F A;  2Y6L A;  5DQ0 A;  2VZU A;  1NX9 A;  5IJR A;  2YFU A;  3PUH A;  3ZM8 A;  4CUC A;  1GUI A;  2W92 A;  3UET A;  1TVG A;  4QAW A;  2VL4 A;  4E8C A;  3LEK A;  4P02 B;  2WQ8 A;  4XUO A;  2QQK A;  2BZD A;  5HXM A;  1F4H A;  1P8J A;  3C7O A;  4M4P A;  4UAP A;  4QB1 A;  3ABZ A;  4QX2 A;  1EUT A;  4CU7 A;  5HPO A;  1CZV A;  2V5D A;  4M4R A;  1DYO A;  4ARY A;  2VME A;  2WAO A;  3MO4 A;  2VJX A;  3MUZ 1;  3OGR A;  1JHJ A;  3K4Z A;  2LS6 A;  2QQL A;  1H6X A;  2W87 A;  4JKM A;  2WN2 A;  5B4N A;  1UZ0 A;  2L9L A;  3WF3 A;  1W9T A;  3ETP A;  5C7G A;  4A42 A;  2HLE A;  4XUP A;  2Y8K A;  4CUA A;  2Z4F A;  1WCQ A;  1O59 A;  5G04 L;  1UX7 A;  5JUV A;  3WF4 A;  1SG3 A;  2EIC A;  3WNP A;  1TG7 A;  2RVA A;  1J84 A;  4MOA A;  5JXH A;  2WDB A;  1YQ2 A;  1JI6 A;  2E26 A;  3T0D A;  3HEI A;  1R64 A;  3A7Q A;  2DCK A;  1GQP A;  2CDO A;  1UYZ A;  4PQQ A;  1BHG A;  4JKL A;  2J7M A;  3AC0 A;  4KI5 M;  2B9V A;  2J1V A;  3ACI A;  4JHZ A;  5A1A A;  3GXU A;  1CIY A;  5LCW L;  1GOF A;  1UYY A;  1UY3 A;  3C7E A;  3VD5 A;  2RV9 A;  1IQD C;  2B4K A;  1UWW A;  4W50 A;  2ZEY A;  1W9W A;  2WZE A;  1DP0 A;  3E1F 1;  3C7H A;  4D0Q A;  4DEQ A;  2QQJ A;  4XVH A;  4TXW A;  3HNM A;  3HPN A;  4QDS A;  2YFZ A;  4CUB A;  2W9X A;  3NNG A;  2WUH A;  3VD9 A;  2C26 A;  3T0A A;  4A4A A;  2VZO A;  2XOM A;  3CMG A;  4A44 A;  5EJZ B;  2ORZ A;  4LPL A;  4XUN A;  3SKV A;  3HN3 A;  1UMI A;  2W3J A;  3I3E A;  1GU3 A;  1UY2 A;  4FI9 A;  2X05 A;  4ZZ5 A;  2YB7 A;  1NKG A;  3A21 A;  1HN1 A;  4QX0 A;  3K4D A;  3DYM A;  4E8D A;  1CX1 A;  3VD3 A;  1T2X A;  1W8N A;  3HNB M;  1MPX A;  3NQH A;  2RJ2 A;  4JX0 A;  3WNK A;  3CKH A;  2ID4 A;  2WO3 A;  3SKJ E;  2J1S A;  1OH4 A;  2VCC A;  5LA2 A;  3T09 A;  1JZ6 A;  2V72 A;  3K77 A;  1J83 A;  4YPJ A;  2R7E B;  4XUT A;  3NJV A;  2BER A;  2BGO A;  2VZV A;  5EJ1 B;  4MAD A;  1NAE A;  2WBK A;  3WEZ A;  5IFT A;  3GGL A;  4DXR A;  1PMJ X;  3FHQ A;  1ULO A;  3JXS A;  3UNP A;  1O8P A;  2Y6K A;  2KD7 A;  4GZ9 A;  4P08 A;  2J1U A;  2EIB A;  2QQI A;  4ZZ8 A;  3WF1 A;  3OGS A;  2JE8 A;  2VQT A;  3SEP A;  1US2 A;  2XON A;  2Y6H A;  3MUY 1;  2E33 A;  4W4Z A;  1W0N A;  4AAX A;  3OGV A;  2C4X A;  2PQS A;  1GMM A;  1LNS A;  2Y6J A;  5G05 L;  2VMF A;  4JKK A;  4QB6 A;  1CZS A;  3I2J A;  3LPG A;  4CU8 A;  1O8S A;  2ZEW A;  4D8M A;  3HOB A;  3THD A;  1PX4 A;  2V4V A;  3LPF A;  2DCJ A;  4CU9 A;  3CZJ A;  5DPN A;  2EIE A;  2OKX A;  3FL7 A;  1GNY A;  3IB3 A;  4OYU A;  2JDA A;  4MGQ A;  4CU6 A;  5CYY A;  3DYO A;  3BGA A;  4GWI A;  4UI9 L;  5JXG A;  2J1T A;  4Z2A A;  1JYV A;  3VD4 A;  2HYX A;  1PMH X;  2X09 A;  4LQR A;  1JYW A;  3WNN A;  2W94 A;  4P00 B;  2QQO A;  3WNM A;  3K46 A;  2VCA A;  3U37 A;  4QB2 A;  3HJR A;  3THC A;  1DLC A;  4W8J A;  5DN2 A;  1K12 A;  2WZ8 A;  3WQB A;  3OEB A;  1F4A A;  4ZY9 A;  3WF2 A;  3T2O A;  1JZ5 A;  3I2K A;  1W8O A;  4OZO A;  1OT5 A;  5F7U A;  5CZK A;  4DUV A;  1WKY A;  2QQN A;  3A22 A;  3EB7 A;  1JU3 A;  4DEV A;  2WAA A;  2JKX A;  4DUX A;  3F2Z A;  2VZ1 A;  3WSO A;  3WNO A;  1PX3 A;  3CIH A;  2VMC A;  4XUR A;  2VMD A;  3J7H A;  4QX3 A;  1CZT A;  5JXJ A;  4OUE A;  3C7G A;  4DUW A;  3DEC A;  3DYP A;  4LKS A;  5LA0 A;  1W99 A;  4XUQ A;  5FUI A;  2ORX A;  4RN5 A;  1D7P M;  4BK4 A;  1SDD B;  1JZ8 A;  2W1U A;  3OBA A;  2WO1 A;  1SHW B;  5JR2 A;  3NRU A;  2W46 A;  3LEG A;  2VO5 A;  2Y64 A;  4ARX A;  1I5P A;  3GDB A;  1JZ2 A;  4KMQ A;  4A41 A;  4BDV B;  4KWU A;  2JD9 A;  3MV1 1;  3CZU A;  4ET7 A;  2VTF A;  1L7Q A;  4MGS A;  4GWJ A;  1JZ4 A;  2X10 A;  1UY4 A;  1EUU A;  3WNL A;  3EYP A;  4RYD A;  2J22 A;  4MO3 M;  1JZ7 A;  2WYS A;  1K45 A;  4ZXE A;  2W1Q A;  4QDQ A;  2VZR A;  1JYX A;  4TTG A;  3I2H A;  1GOG A;  2LW8 A;  4CVU A;  3III A;  2W91 A;  3SEE A;  3T08 A;  3W5M A;  2VZS A;  1K3I A;  3FN9 A;  2VZ3 A;  3PUI A;  5C70 A;  2J1A A;  3LEI A;  3BN6 A;  2VZP A;  3K75 B;  2W1S A;  4IUG A;  5C71 A;  1UMH A;  3I97 A;  2E31 A;  3IDA A;  1JZ3 A;  3ACH A;  2YC2 A;  3VDB A;  1UYX A;  2XQX A;  2CDP A;  3IAP A;  1K42 A;  4HG6 B;  1OF4 A;  4QDR A;  1KEX A;  1NUK A;  3K4A A;  1ULP A;  1UY1 A;  3FHA A;  2VM9 A;  2BBA A;  3T0B A;  3CQO A;  2C9K A;  2ZXQ A;  5JMO A;  1UXZ A;  2ZEX A;  1L7R A;  4PF1 A;  3C8X A;  3VDC A;  2BGP A;  3LQC A;  2VR4 A;  1XNA A;  1JYN A;  1UXX X;  2VQU A; 
#chains in the Genus database with same CATH topology
 1R1Z A;  1VBB 1;  2UYB A;  3VKL A;  3POJ A;  4Q0P A;  2DDU A;  1EAH 1;  4ASK A;  4XZU G;  2WWS A;  3C3V A;  4BPZ A;  4CP0 A;  2R07 2;  4H3W A;  1V6L A;  2JG9 A;  5AC9 1;  1ZRE A;  2ZHL A;  3VL8 A;  1GAN A;  3H8U A;  3I3M A;  2ZGN A;  1G8W A;  2RR1 3;  4OMC A;  2GDF A;  4HN1 A;  5FYH A;  4GUL A;  1ENS A;  1JU4 A;  4L0P A;  4NJ4 A;  5FY4 A;  2LRO A;  4OHZ A;  1LJ7 A;  3NO8 A;  4AFC A;  2Z2S B;  2B7Y A;  2WWJ A;  1HQW A;  1BBT 3;  2FMD A;  4AI2 A;  3VDD C;  1CPM A;  5EFU A;  2VC9 A;  5DUU A;  1AR7 1;  3IMM A;  2P34 A;  3M8L A;  2QQU A;  5FY5 A;  3ZYB A;  4DO0 A;  5KR7 A;  3SCH A;  4PBP A;  3I3Q A;  2ARE A;  4X8P A;  5FY0 A;  1HRV 2;  5IAX A;  1FMD 1;  3ZFG A;  3WVJ A;  2ZEZ A;  2P4E A;  1SCR A;  2VXR A;  1LHV A;  3H8X A;  4IE0 A;  1H6Y A;  2HWC 1;  1COV 3;  5JI9 A;  2XVL A;  1W6N B;  2VZT A;  5IHR A;  4LHS A;  4UWD A;  5I0D A;  5E16 A;  4F8A A;  4ZKT B;  3A0N A;  1LGN A;  1LOA A;  3K2O A;  2W47 A;  3WQ7 A;  4D7Y A;  1OVP A;  2WT0 A;  1BCX A;  3WNX A;  1Y4W A;  4CEW B;  2VW2 A;  4BXS V;  1W8U A;  4Q4W 2;  4AQS A;  2RS5 1;  1NZI A;  2SLI A;  3IDB B;  3POY A;  3ZYR A;  1JMU B;  4B1M A;  2VOT A;  4EN9 B;  1RC6 A;  1QJU 3;  5CA6 A;  1NXM A;  1XC6 A;  2XLA A;  3ACF A;  3THT A;  3ZMO A;  4BK5 A;  3NV2 A;  1KGY A;  3Q8A A;  4DXS A;  1CJP A;  1UU5 A;  2RS1 2;  3IAQ A;  2EIG A;  3VDD B;  5T3N A;  1CAW A;  2NMN A;  2VY0 A;  4XF3 A;  5CNA A;  4DXT A;  4JRA A;  2VH9 A;  5A33 B;  2HWB 2;  3ZN4 A;  1RUD 2;  3INA A;  3T2T A;  1AR8 2;  2VCB A;  5F5Q A;  4D94 A;  1FV3 A;  3GZU C;  1AL0 G;  1JW6 A;  2P3J A;  5D8A A;  4HL0 A;  1OHF A;  4BQW A;  4EN0 A;  4UFJ A;  1WW5 A;  1ST8 A;  5CFC B;  3AVS A;  1W6P B;  3NJX A;  3VZJ A;  1OF3 A;  1URX A;  2E32 A;  2X5I B;  5FZ4 A;  1SLL A;  1VBE 3;  5FPL A;  1RL3 A;  3P6B A;  3PJQ A;  1AJO A;  2QQM A;  4Q8K A;  2CYF A;  2R0H A;  3HD8 B;  5DQ0 A;  4NRO A;  4QU2 A;  2NLR A;  4CEW C;  3PUH A;  1UN1 A;  3WDV A;  3NAP C;  1O5L A;  1Y9Q A;  4AYU A;  4AHY A;  3MIB A;  1PM4 A;  2D97 A;  3NKG A;  4MX3 A;  3DKW A;  2HWC 3;  4R9D A;  5LA1 A;  2OZJ A;  2VBB A;  3LEK A;  3B9C A;  4P02 B;  4Y20 B;  2R6Q A;  2WQ8 A;  2VBP A;  4O61 A;  3IWZ A;  4OI0 A;  2RS3 1;  1F2N A;  5FZI A;  2BZD A;  2GNT A;  1S0G A;  1LHU A;  3M3C A;  3QOP A;  3ZX7 A;  3MYX A;  1V0A A;  4LMF A;  2JDP A;  1XOY A;  2O8O A;  4MLO A;  3VBS A;  4XQW A;  1XQN A;  5FZD A;  2K0G A;  3UK9 A;  2QDR A;  5HPO A;  2GAU A;  2V5D A;  2XJS A;  2YU2 A;  4M4R A;  4QKB A;  3SH3 A;  2VME A;  3T4V A;  5FXX A;  2WAO A;  2PAK A;  3DF0 A;  3NV1 A;  2H6C A;  1AF9 A;  3P5B A;  5FY1 A;  5HI0 A;  3AKT A;  2W0X A;  4OZX A;  3MUZ 1;  3K4Z A;  4AL9 A;  2W87 A;  4IE6 A;  1CAU B;  3AFG A;  2KA3 A;  4E4Z A;  3KD4 A;  5B4N A;  1GQG A;  1VBB 3;  1WME A;  1O4Y A;  1DLL A;  2ZGK A;  4EQV A;  5IVB A;  1UOB A;  2P3Y A;  3B00 A;  4RHV 3;  5JDB A;  1NA1 C;  3WF3 A;  4BCU A;  2B8M A;  3AP7 A;  1XXN A;  3R05 A;  1EV1 2;  3VN4 A;  3KVA A;  5K0U C;  4ISR A;  1QJY 3;  2HLE A;  4XUP A;  2R0F A;  4CUA A;  3ACL A;  5FZH A;  1WCQ A;  1GZT A;  3RYK A;  3NNJ A;  1UOF A;  5G04 L;  1UX7 A;  5JLV A;  4K8R B;  2XH6 A;  5K8S A;  2Z69 A;  2RVA A;  5FFO C;  5JXH A;  3D8C A;  5BXX A;  3RWN A;  4OUS A;  5KC5 A;  1V6O A;  3RMY A;  1JI6 A;  4K3U A;  4M00 A;  4Q4V 1;  5FXW A;  1OA2 A;  1W2O A;  4PCR A;  1GQP A;  5A3T A;  1S2B A;  1UYZ A;  1WGP A;  3DPR C;  1BHG A;  1CON A;  3DN7 A;  4LA2 A;  4NAO A;  3KT4 A;  4XZP A;  4JKL A;  4MGI E;  4RQP B;  4K1Y A;  4IXL A;  4Y4Y A;  4BQ3 A;  2IWG B;  2B9V A;  2Q1F A;  4JHZ A;  3TNQ A;  4GB3 1;  1ZZ7 A;  1CIY A;  4QKF A;  1GOF A;  3FLR A;  5BNO B;  1UYY A;  5KXE A;  4AI1 A;  1W9Y A;  4GKY A;  3NNM A;  3N7M A;  3O5S A;  1ND3 B;  1W3X A;  4HON A;  4RHV 1;  4HVQ A;  3RNS A;  2B4K A;  1DQ4 A;  1N1Y A;  3IIA A;  2WNV C;  1RVF 3;  4CCC A;  4CEY A;  1W9W A;  1TNR A;  4YGC A;  3E1F 1;  2JDM A;  4GH4 A;  1W2A X;  1XSR A;  2VCM A;  2Q8E A;  2BDR A;  2VW0 A;  2WNE A;  2JXA A;  2P5B A;  4XDQ A;  1GZW A;  3GCW A;  2RDQ A;  3VBF B;  4DMI A;  3VD9 A;  1UW8 A;  4GD4 A;  3N35 A;  2E63 A;  1HRI 2;  3N9P A;  2XOM A;  4SLI A;  4YVS C;  3WY6 A;  3WDX A;  3VBH A;  2YV8 A;  3LOI A;  1H8V A;  3GZE A;  5LY2 A;  4HN0 A;  4XDO A;  4CDW B;  1GQH A;  4AHZ A;  3HN3 A;  1QY4 A;  3I3E A;  1GU3 A;  2YUE A;  3WX5 A;  2GC1 A;  1QJF A;  4YW4 A;  4QX0 A;  4AXO A;  2QTW B;  4B3N A;  2QNK A;  4F3J A;  4IV1 C;  3VD3 A;  3O1R A;  1CX1 A;  2ZA9 A;  3POS A;  4ASL A;  3NQH A;  3HT2 A;  2QZ2 A;  3CKH A;  1IS4 A;  5A3N A;  3H1Y A;  4COU A;  5C6C A;  1K5J A;  2J1S A;  2YRO A;  2FCT A;  1ND2 A;  1MZF A;  4J6G A;  1VBE 1;  1U5Y A;  1YC6 1;  3K77 A;  5T55 A;  2B46 X;  3VHO A;  2D93 A;  2R30 A;  4QMA A;  1X9P A;  4KG8 A;  3V56 A;  1DGR A;  1TME 3;  1RUD 1;  3IZO A;  4GXL A;  4MAD A;  1NAE A;  1IS3 A;  3HWJ A;  5IFT A;  3V0A A;  2RS1 1;  4GJY A;  4A2U A;  2HWE 1;  3T1L A;  1W2N A;  2G1M A;  4XET A;  3FHQ A;  3I2O A;  4BQ4 A;  1O8P A;  2EIB A;  2QQI A;  5JSP A;  1E5S A;  4XTP A;  4XPV A;  4BZ4 A;  4M3C A;  3OF1 A;  2YPJ A;  4LBN A;  5GLV A;  2JE8 A;  2CSG A;  2JDY A;  3POW A;  5F6K A;  4AQ2 A;  4R4X A;  2FDI A;  3MGU A;  4OI4 A;  5BNQ A;  1AR8 3;  1R1A 3;  1US2 A;  1JYC A;  4LKF A;  2XBO 1;  1TME 1;  1AX0 A;  4M0N A;  2Q4S A;  4ISQ A;  2E33 A;  4AZZ A;  3DPR A;  1MEC 1;  2WS9 3;  3POE A;  4BXF A;  1W0N A;  1QJU 1;  1AR6 2;  4CP9 B;  5HBA A;  2VVD A;  2ZGR A;  2XWB B;  2IXL A;  2RS5 3;  1NE4 A;  4CDX A;  4HXC A;  4Z82 A;  4MGY E;  1UU4 A;  5E89 A;  3U10 A;  3ZFF B;  1V6M A;  4QB6 A;  4XAB A;  3I2J A;  4LBQ D;  3AFK A;  1G7Y A;  1OPO A;  2ZEW A;  4URA A;  2ZML A;  4Q1R A;  5DZF A;  1O3S A;  1UKR A;  2D6O X;  4RR3 A;  4LNV A;  3MF9 A;  2WZP P;  3TYJ A;  3V0B A;  3OPZ A;  1E57 A;  5FKC A;  2HWF 3;  4FCA A;  2WII B;  4CU9 A;  2JB8 A;  3K48 A;  1JXN A;  2JIC A;  4Q8L A;  1IKP A;  1UD1 A;  2XL7 A;  3FL7 A;  5DAW A;  1OLM A;  3ZLI A;  4CCO A;  5IT6 A;  1GNY A;  2A7A A;  2R1D A;  2XUM A;  3OUH A;  5J7M A;  4UFI A;  2QKD A;  2KXL A;  5A3M A;  3B9I A;  4H7M A;  4D7S A;  4Y26 A;  2AAC A;  5ABJ C;  4GWI A;  4UI9 L;  4WM7 B;  2FCU A;  4QX8 A;  2CAU A;  1HRV 3;  3ZIW A;  5CFD B;  1JYV A;  1HXS 1;  4HSL A;  4FOV A;  5A7S A;  2X09 A;  3ZXJ A;  5L9B A;  4P00 B;  3WNM A;  1NCR B;  2WQZ C;  3K46 A;  2VCA A;  4QB2 A;  3HJR A;  1SMV A;  2CTV A;  4W8J A;  1RVF 1;  2VNG A;  2R07 3;  4MXV A;  2GND A;  2ZX3 A;  2DU0 A;  3M3Q A;  1A34 A;  4AVC A;  4BMB A;  2NN8 A;  3T4H B;  1LCL A;  4JGZ C;  3H50 A;  1XE8 A;  4DIQ A;  5FLH A;  4NAM A;  3QH7 A;  4OZO A;  4ZS3 A;  5F7U A;  4MGT A;  4LBQ A;  4DUV A;  3KV6 A;  2ZX4 A;  5A1F A;  3ZFE A;  4J1X A;  2WKK A;  3WG3 A;  5FZ6 A;  1PMI A;  2G4I A;  5E88 A;  1UZY A;  4Q4X 1;  3F2Z A;  5GLZ A;  5EV7 A;  3HN1 A;  2VZ1 A;  1TZO A;  1H1M A;  4BIS A;  1EV1 1;  1RMU 2;  2OQ6 A;  2PHT A;  4PDW B;  3WSO A;  4AQT A;  3NJZ A;  1QNY A;  1WW4 A;  1RXG A;  2AEN A;  3ROU A;  1RJ8 A;  5F37 A;  1V6J A;  2TBV A;  4LIV A;  1MAC A;  1MS9 A;  2JB4 A;  1H2L A;  2OVU A;  2XB6 C;  4QX3 A;  3WDT A;  1GZC A;  1CZT A;  3K3O A;  3C7G A;  3W9A A;  1AR9 3;  5DG1 A;  4BOW A;  2CGN A;  4FPO B;  2UWB A;  4TLF A;  3DYP A;  1IS6 A;  1E5R A;  1RED A;  2DUR A;  4XUQ A;  1V9U 1;  4LKD A;  4I0B A;  3KS7 A;  4RN5 A;  4IND A;  1IGO A;  1POV 0;  2CAV A;  1C8N A;  1N3P A;  3OBA A;  5FJK A;  1ZRF A;  1LEC A;  4ONU A;  5GJ6 A;  4E2Q A;  5LAS A;  2PHU A;  2RDS A;  1ALY A;  2W46 A;  1O4T A;  4IEV A;  5C9A C;  3VBF C;  1MZE A;  4COW A;  2IFR A;  1WLD A;  1SDW A;  1JZ2 A;  5LAT A;  3VLB B;  1LHW A;  5I8S A;  5LBE A;  1SBF A;  4E4S A;  1HRI 1;  2DBN A;  4KMQ A;  4D6S A;  3KB5 A;  3ST7 A;  2KR2 A;  4LOR A;  4QX7 A;  4UW5 A;  5IUQ A;  3PUS A;  3UL2 A;  5JZG A;  1AR6 1;  1W0O A;  2AUY A;  3AKP A;  2JD9 A;  3ETQ A;  1LU1 A;  3WCR A;  4BDV B;  4TN7 A;  1XSQ A;  4ET7 A;  4QQ2 A;  4JQR A;  2F17 A;  3HT1 A;  2WFF 3;  3J8F 2;  2YYO A;  1S0B A;  1F35 A;  1NQJ A;  1Z7S 3;  2BVV A;  3IPV B;  1QOO A;  3QLQ A;  1LAJ A;  2VG9 A;  4EN7 B;  1QJZ A;  4NWV A;  1C8M 2;  4TYS A;  2FQP A;  2OS2 A;  4FAG A;  1CAV A;  4K6B A;  2EA7 A;  3EYP A;  2ZX2 A;  2OYZ A;  5JOW A;  2PEL A;  3AXD A;  1RUC 2;  1Q8P A;  4MO3 M;  5FAX A;  3ZDS A;  5JR7 B;  5A7P A;  3OUI A;  5AFE A;  3O7O A;  4JTN A;  4E27 A;  5BNN C;  1JYX A;  1LHO A;  2HWE 2;  2YGM A;  5KBF A;  1C3H A;  5GZG A;  1NE6 A;  5FZG A;  2GZW A;  1V6N A;  4PBO A;  3NMB A;  2VNV A;  1AX2 A;  1UO9 A;  4HZF A;  2ARA A;  2HH9 A;  4HPK A;  2W91 A;  2R49 A;  3GF6 A;  3ZSE A;  4EWA A;  2OZ6 A;  5LK5 A;  2VZS A;  4FO9 A;  4K21 A;  4Y20 A;  3T1M A;  4LO4 B;  3OBT A;  5FRE A;  3VHR A;  5M0T A;  2ZAA A;  3Q8E A;  4NVP A;  5LA9 A;  5ACA 3;  2X53 S;  4JQT A;  5ACA 1;  1D4M 1;  4Y1X A;  5FP9 A;  5A7W A;  1MQT A;  2Y34 A;  4FPL A;  4F83 A;  1JH5 A;  3K75 B;  1PGL 1;  1AYN 3;  1AXK A;  1MZ6 A;  3D0J A;  4IER A;  2PA7 A;  3ZR5 A;  5C71 A;  1UMH A;  3I97 A;  3MZH A;  1UOJ A;  3ZIX A;  1SEF A;  2IXC A;  3V64 A;  3ACH A;  4IE4 A;  5B2G B;  1IZ3 A;  2YC2 A;  4W65 A;  2CL2 A;  1JYT A;  1QOS A;  3RYP A;  2XQX A;  4PLN A;  1XND A;  1O5U A;  1OF4 A;  2AYH A;  1LOF A;  2FZ1 A;  2GH8 A;  3JB8 A;  4FP3 A;  4E9K A;  2ZS6 B;  2XQR A;  1G9F A;  1YO8 A;  3FE5 A;  2R32 A;  4HT1 T;  3K4A A;  3OBZ A;  4IEZ A;  4TLG A;  3RZZ A;  1DDL A;  1PHM A;  4LO6 B;  2NPI A;  4PF5 A;  1LB2 A;  3CQO A;  2RM2 3;  2BPA 2;  3BIW E;  4YM3 A;  4XJW A;  1QH7 A;  3B7M A;  2WS9 2;  4RR3 C;  1PVC 3;  4XFA A;  1AR6 3;  1UXZ A;  1W8H A;  3OUJ A;  4Z07 A;  1PNF A;  1VRB A;  3W20 A;  4KWK A;  2VR4 A;  2WNO A;  4LO7 A;  4RL7 A;  1R09 1;  3PLQ A;  4H7L A;  3Q8F A;  1US3 A;  4NRP A;  1CAV B;  1FPN 2;  4I2O A;  1MS0 A;  4TZD A;  1HQL A;  4YW2 A;  4NID A;  2ZKN A;  4BM8 A;  5IK5 A;  4OCT A;  4KGG A;  3AZZ A;  3WF0 A;  1LGC A;  3OBR A;  2X5I C;  3BTZ A;  1C1L A;  1YQC A;  1EPZ A;  1OLQ A;  4IL7 A;  4IV3 B;  3RJR A;  3ZDV A;  5KC6 A;  1ASJ 2;  1CAX A;  1YUD A;  2RR1 1;  4JCK A;  3N3H A;  4GIQ A;  4XHB A;  2BW8 A;  5FZM A;  4GJZ A;  1RYY A;  2WN3 A;  1PO2 1;  5JZG B;  5FIX A;  3NST A;  5AC9 3;  5JAX A;  5BNO A;  1AR7 2;  4YFW A;  3H42 B;  4AOC A;  1SBE A;  2Z5W A;  4XQD A;  1D4V B;  1H2N A;  2BQP A;  2WL1 A;  5B4X A;  4QX5 A;  1Q8S A;  3LDR A;  3VDA A;  3VB9 A;  1RUG 2;  4WVM A;  3IT8 A;  4FOQ A;  3CDZ B;  2ZMN A;  2XHN A;  2XBO 2;  4Q4Y 3;  1I1E A;  2FZ2 A;  1Z0H A;  3FWE A;  3C7F A;  3I2I A;  5DMY A;  2D6P A;  3GZA A;  1X33 A;  3B3Q E;  3JZV A;  4Q4X 3;  5IVF A;  2GME A;  2JWP A;  2YGL A;  5GZC A;  4LLO A;  2UY9 A;  2HEW F;  3BYW A;  4AHW A;  5DXD A;  3PUR A;  4AI0 A;  1UZZ A;  1WCU A;  1ND2 C;  1S1A A;  1D4M 2;  5FLI A;  1C57 A;  4KWJ A;  5IAV A;  4A3Z A;  1KIT A;  2JIG A;  3H8O A;  2XVG A;  1H1I A;  5FY7 A;  5J37 A;  4I0A A;  3ZSM A;  3S5A A;  1YFU A;  2D6K A;  1MQT B;  1OKQ A;  4MVT A;  4AVV A;  5C9A A;  3D3A A;  3CU7 A;  1QJY 1;  2A5Z A;  3Q9O A;  4YVW B;  4YZ5 A;  5AFB A;  2NMO A;  4AEK A;  5HV4 A;  4Y4R A;  2FDF A;  2PHR A;  2XR4 A;  2YZ4 A;  2IXI A;  1J3Q A;  1KFU L;  3CJI A;  4N7I A;  2G9F A;  4O9G A;  4OMD A;  1ZX5 A;  4QQH A;  3VL9 A;  3WDU A;  2QQV A;  4AED C;  4B4Q A;  5AC9 2;  3CJX A;  5CAD A;  3OB8 A;  2G19 A;  3ZSJ A;  2W5F A;  1WBF A;  4HK8 A;  3GJA A;  3I2G A;  4V2V A;  1OUR A;  3H3Z A;  3M1H A;  4IDZ A;  2GP5 A;  3FC0 A;  1C28 A;  1GSL A;  3ZXG A;  1XE0 A;  4P5H A;  1HB1 A;  3I2F A;  3ILR A;  2EF6 A;  2Y6L A;  4X8N A;  5DAP A;  5KHH A;  1BLZ A;  5FZL A;  3M3I A;  3AKQ A;  4GAL A;  1NX9 A;  3DGT A;  1CAW B;  5JI7 A;  1W28 A;  1LOE A;  5T5J A;  1UAI A;  3KV5 A;  1AL2 2;  2BOI A;  2D6N A;  4I30 A;  1GNH A;  5FYB A;  5BNO C;  2XWJ B;  1CD3 G;  2W92 A;  3HQU A;  4CEY C;  5A3U A;  1OUS A;  4QAW A;  4BQ1 A;  2ZTN A;  3EMR A;  2PLV 3;  5D8A B;  1W06 A;  1LEN A;  4AVB A;  4FFG A;  1GWM A;  1WA4 A;  1ZZ9 A;  3WP3 A;  2RS5 2;  5C8W A;  3AL6 A;  3BPZ A;  1VMJ A;  2X5I A;  4QPI C;  3W58 A;  1F4H A;  3BPS A;  1XRU A;  3C7O A;  4UAP A;  4V2W A;  1WLT A;  2VU9 A;  3ABZ A;  3THP A;  3I4I A;  4HSJ A;  1Y9G A;  4CDU B;  2JG8 B;  1CZV A;  2ZAH A;  2BNM A;  4N7U A;  5FXZ A;  5HCA A;  4JRL A;  2BNN A;  1L7L A;  3LD8 A;  4YWA A;  2F6B A;  1YIP A;  2RDR A;  1AR8 1;  3WP5 A;  4CYD A;  3ZXL A;  3OGR A;  4IGP A;  1JHJ A;  3E6C C;  4YFZ A;  1WW7 A;  1BVP 1;  5D2A A;  5BNN B;  1OFS A;  1VBA 3;  4JKM A;  3UJO A;  2WN2 A;  4JDO A;  2O14 A;  4CXX A;  2R04 3;  3TAY A;  4AEJ A;  1XJA A;  1ULD A;  1UZ0 A;  3QAC A;  3JCI A;  5FTT C;  3ZKU A;  4CP2 A;  3V0A B;  1JYI A;  2L9L A;  5FP3 A;  3ZYI B;  2F4P A;  4M3C E;  2P3I A;  5CIR A;  5IVV A;  4B7K A;  2HWE 3;  1VAM A;  4R9C A;  2Y8K A;  1MS5 A;  4QHO A;  3RYR A;  4EWD A;  5JPN B;  1QXR A;  2NM1 A;  1LOF C;  4WM8 A;  3UT0 A;  3O1V A;  1SG3 A;  2EIC A;  3DEM A;  3LIH A;  3WNP A;  4AGG A;  1AYM 2;  1LU2 A;  3PU8 A;  3WD5 A;  5F9T A;  5LEJ A;  2WDB A;  1YQ2 A;  3UYJ A;  1UYP A;  1LED A;  2H6B A;  3A7Q A;  3PL0 A;  2CDO A;  4XFG A;  5GZF A;  1WMX A;  4M01 A;  5EWS A;  2SBA A;  3I54 A;  3ZYH A;  2YY1 A;  2AEY A;  2IZW A;  2VD7 A;  4HOO A;  1HQN A;  3JBG 1;  3PUQ A;  5FQ0 B;  1BXH A;  1CN1 A;  5DDJ 1;  2WA4 A;  4OUM A;  5FO9 B;  1COV 1;  3RVH A;  1UIJ A;  4LTA A;  4YNI A;  5I0S A;  1V70 A;  2Z42 A;  4K9S A;  3EQE A;  5CFC A;  4GMP 1;  3C7E A;  3VD5 A;  1DYP A;  2RV9 A;  4RR3 B;  1YYN A;  2ZGU A;  2B9U A;  5KHI A;  2VW1 A;  1W8W A;  4W50 A;  4LHL A;  3WQ1 A;  5C8C A;  3RZJ A;  5K7P A;  1AR7 3;  1S0E A;  1S4C A;  3JD7 1;  1GWK A;  1YQ6 A;  2P1B A;  4AQ6 A;  4TXW A;  3JUU A;  1ENQ A;  3HPN A;  4CEW A;  4YLZ A;  5FYS A;  1POV 1;  4CUB A;  1I5Z A;  2YPD A;  5GAL A;  2WUH A;  4DFS A;  4WV8 A;  4MGK E;  3SLI A;  1KQR A;  1HB4 A;  3AM2 A;  3V65 A;  4PDW A;  2OPK A;  4BME A;  4XXP A;  1GLH A;  4MZU A;  2C9A A;  5CFD A;  5F3C A;  3CF6 E;  2FBE A;  4FTB A;  1GKB A;  1Z7S 2;  3MIC A;  5IK7 A;  4A44 A;  5JZG C;  5ERL A;  2QDN A;  2ORZ A;  5K0U B;  5C33 A;  1Q8Q A;  1PO1 2;  2OX0 A;  1VIW B;  1UMI A;  2DU1 A;  2W3J A;  3B02 A;  2D40 A;  4N43 C;  5IWF A;  5LBC A;  3RGB A;  3ZN6 A;  4B1L A;  1ASJ 3;  2PHW A;  2WNU A;  4LK7 A;  5LZ6 A;  2P6H A;  2YB7 A;  3POF A;  4Q0U A;  1VAV A;  3TOJ A;  4D3W A;  4QXB A;  1ODM A;  4CDU A;  1A8M A;  1BVV A;  1QF3 A;  1WLW A;  4L2N A;  4RD7 A;  1G6N A;  2RJ2 A;  5FPA A;  1GP4 A;  4JX0 A;  1VAK A;  5LK7 B;  4P9L A;  2ID4 A;  2WO3 A;  3LIG A;  5L7O B;  1DBN A;  1OUX A;  1UPI A;  1J83 A;  1LUL A;  2C1F A;  4XUT A;  1W0P A;  2OUJ A;  4WVZ A;  4HVR A;  4N53 C;  5EHD A;  2BER A;  1PIV 3;  4UW6 A;  3ILF A;  4CUG A;  5FMD A;  5D21 A;  2VAU A;  4EYU A;  1LEM A;  3GBF A;  4QHB A;  4QQO A;  4XQ4 A;  2I45 A;  2B5H A;  4NRQ A;  3ZFG C;  1WLC A;  4I0W B;  1OC1 A;  2Y6K A;  4GZ9 A;  4ASM B;  2J1U A;  2EXH A;  4OI2 A;  4YVW C;  3N36 A;  1J3P A;  3ME2 A;  1PGW 1;  3WF1 A;  2D6M A;  5FYM A;  3ZFE C;  3B5L B;  5GZE A;  3N9M A;  1W90 A;  4GH4 C;  4LE4 A;  3AMQ A;  4R4Z A;  2V5Y A;  3VGI A;  2JIJ A;  2VQT A;  1RXF A;  3SEP A;  4E4D X;  1H9W A;  4XW3 A;  3SHR A;  4TWT A;  2QQW A;  4X6Q B;  2Y6H A;  4DQA A;  4K7J A;  5L7O C;  5E1R A;  4W4Z A;  4RGA A;  1BEV 3;  1JOD A;  1R08 1;  1VRH 2;  2C4X A;  3KMH A;  4AVS A;  2OII A;  5JVV A;  4JGY B;  2LAL A;  2PQS A;  1SPP B;  5JWP A;  1IPK A;  1W05 A;  2AGS A;  2RS3 3;  4JKK A;  1VP6 A;  2RG4 A;  5A80 A;  4RS5 A;  2ARX A;  1DGL A;  1CZS A;  1ZZC A;  3LPG A;  5DDJ 2;  1O8S A;  4M3C B;  2PHX A;  5DAX A;  4FTE A;  3OOX A;  1XYO A;  5T52 A;  5C8C B;  2Q8D A;  4LIT A;  4UYB A;  4Z2W A;  4QPI B;  1C1F A;  5DPN A;  5BV6 A;  2YDE A;  3VBS B;  2OKX A;  1D0G A;  1YIF A;  4QKN A;  2UWA A;  4IV1 B;  2DFC A;  4FPE A;  4CDU C;  5I8T A;  2O1Q A;  2RM2 2;  5HXV A;  3LA3 A;  4RHV 2;  3D6E A;  2A70 A;  2K2S A;  4IE5 A;  5CYY A;  5E8A A;  4Z2A A;  4IEP A;  1QDC A;  3U78 A;  3OY8 A;  3BTA A;  3D4K A;  3H3L A;  1PMH X;  3ZVX A;  4HPK B;  5A3W A;  1RUG 3;  2XKP A;  3WNN A;  1W6Q A;  2W94 A;  4I02 A;  3IMN A;  1WBL A;  2IVJ A;  1TE1 B;  1SQ4 A;  2GN7 A;  3URF A;  5H9R A;  3THC A;  3SMH A;  4CDX C;  5JCT A;  2C24 A;  4LR4 A;  4I01 A;  5LY1 A;  1K12 A;  4Y5S A;  1RUJ 1;  1VRH 3;  3WQB A;  2BOJ A;  2OA2 A;  1VE0 A;  4P14 A;  3LF7 A;  1F4A A;  4HVO A;  3NNF A;  1XNK A;  4Q4W 3;  2ZAB A;  2WZR 1;  2MHF A;  5FP4 A;  1JZ5 A;  2H0B A;  1W8O A;  3KT7 A;  1OT5 A;  4Z92 B;  2YC0 A;  5FYY A;  1ZBE 1;  4LEJ A;  3A22 A;  3GCX A;  4LBK A;  2ZHM A;  1F5F A;  1JU3 A;  4DEV A;  5A3L A;  2WAA A;  2JKX A;  1ULF A;  5DAB A;  5BNP A;  1CAX B;  4DUX A;  5FWJ A;  4LHN A;  3ZOI A;  2EAA A;  1BK0 A;  3L9J T;  3PUA A;  3TNP B;  2GC0 A;  5HCF A;  3WW3 A;  1F31 A;  2VPV A;  3QBQ A;  5A32 B;  3AP4 A;  4PLM A;  2ILM A;  2Q0A A;  4UW3 A;  3FHI B;  1COV 2;  2BYV E;  4Y1U A;  3VHN A;  2V4A A;  2VMD A;  4AGV A;  3H7J A;  3AJY A;  4GKX A;  1VBE 2;  2QCS B;  3HBK A;  1QJU 2;  1OVS A;  5ANN A;  3TN9 2;  1TMF 2;  3WT3 A;  3K3N A;  3SC7 X;  5C3R A;  3RZK A;  4YGB A;  4EN8 B;  1QJX 1;  3GNE A;  5CVR A;  4CCJ A;  4HK9 A;  5LA0 A;  3O1T A;  3AMM A;  3H3U A;  1W99 A;  4XF9 A;  3T3Y A;  2GMP A;  4DPN A;  1B35 A;  4DIN B;  5CG9 A;  1EYB A;  5L9V A;  1D7P M;  1A6C A;  4D69 A;  2ADD A;  2A71 A;  3M70 A;  2RE9 A;  4IV1 A;  1PGW 2;  2WO1 A;  1O3R A;  1SHW B;  4XYX A;  4YAR A;  5CBL A;  2QZ3 A;  1T6G C;  3NRU A;  4QQP A;  3RRD A;  4MXW B;  1NCQ C;  4IV3 A;  2PN5 A;  3JQW A;  4WM7 A;  2CGO A;  2WQ4 A;  3KV9 A;  2Y0O A;  3E5X A;  4COY A;  5J3U A;  5F2W A;  3USU B;  1YHF A;  2DVD A;  2ETE A;  4CDQ A;  1LOB A;  1WMF A;  4ES8 A;  4YVS A;  4I09 A;  5F5I A;  1ZA7 A;  1VBD 3;  4KWU A;  3MV1 1;  5IK4 A;  4LBJ A;  4OHX A;  1KDK A;  4R9B A;  1DFQ A;  2OT7 A;  4RGK A;  3VBH B;  3ZKY A;  1SCS A;  3GHN A;  3ILN A;  3FMG A;  4E2G A;  1AX1 A;  1L7Q A;  1RMU 3;  1YFY A;  4QM8 A;  5CKQ A;  3ZYJ B;  4GWJ A;  1JZ4 A;  4WVM B;  2X10 A;  4A7Y A;  4EE2 A;  3J4U H;  3AK0 A;  3B93 A;  5C3O A;  4N8M A;  1DYK A;  1MZ5 A;  5AVA A;  3MW3 A;  1PZ7 A;  1VBA 2;  2CY6 A;  1DCS A;  2YU1 A;  4P9W A;  4DY5 A;  3O1P A;  1HIX A;  1LES A;  4XF4 A;  4LBQ B;  1W6P A;  1FX5 A;  1AVB A;  3DKQ A;  3OGG A;  4IEY A;  1W6M B;  2WYS A;  3M2M A;  1K45 A;  1C5I A;  3KQR A;  3LAG A;  4ZXE A;  1A3K A;  4QXH A;  2ZMK A;  2VZR A;  4CZS A;  4XIO A;  5FZ9 A;  5DUW A;  2A3X A;  3I2H A;  1W8F A;  4ZXK A;  2LW8 A;  4WZF A;  3TB0 A;  4CVU A;  3III A;  3R4U A;  4Q0S A;  1UCX A;  4XMI A;  3T08 A;  3KHB A;  1RUE 1;  2D3R A;  1OQE A;  3VDD A;  3W5M A;  1FPN 3;  1N1T A;  2GP3 A;  5A6Q A;  2XLF A;  4EZ4 A;  1DGR N;  3PUI A;  2Z79 A;  2J1A A;  3LEI A;  4N53 A;  2XJP A;  3BN6 A;  1J59 A;  2WR9 A;  4BH9 A;  5JMC A;  2DVF A;  5KHG A;  2DWR A;  4K20 A;  1WUV A;  1PZ9 A;  2ARC A;  1H2M A;  2D3P A;  3BB6 A;  3IDA A;  1FYU A;  3MFA A;  4P9I A;  1JZ3 A;  4JDN A;  3UGF A;  3VBO B;  3JD7 2;  4XBQ A;  1UYX A;  3LDK A;  5KHJ A;  3VDB A;  4YZ3 A;  4AED A;  1PK6 A;  1OLR A;  3IAP A;  4NE9 A;  1K42 A;  2WFF 2;  3J8F 3;  4AVA A;  3CJI C;  3MPP G;  4LJH A;  2FHR A;  3P3P A;  1EY2 A;  1CX4 A;  3PVB B;  4FBF A;  4N9H A;  1DHK B;  2VOW A;  1DGW A;  3TBD A;  3CBN A;  1UY1 A;  4S2F A;  1NA1 A;  2BBA A;  3UGH A;  1RUC 3;  3IBM A;  1RHI 2;  2XJU A;  5F3G A;  2VMG A;  1R1A 2;  3T0B A;  3ZN5 A;  4C91 A;  2ZXQ A;  1B35 C;  4DRV A;  5FWE A;  4QQL A;  5F3E A;  4NHK A;  4FQZ A;  3AB0 A;  4DOU A;  3OD0 A;  4ZU5 A;  2A6X A;  4PI0 A;  1QQP 2;  3VDC A;  5EP9 A;  4WM8 B;  3ZPY A;  4CCN A;  1OH3 A;  5CAZ A;  3B01 A;  3HMY A;  5C4W A;  1SFY A;  4BA6 A;  1JYN A;  3BUC A;  2QBX A;  4KGQ A;  3U0Z A;  5FR3 A;  1ZZ6 A;  4V1P A;  5L36 A;  4W6X A;  2EID A;  1FPN 1;  1GOH A;  4ATF A;  1RUE 3;  1RUF 1;  1ZBA 1;  3OEA A;  1AYM 1;  4FAH A;  5IYY A;  2WA3 A;  3VBS C;  4PIY A;  3LA7 A;  3J9S A;  3ZO0 B;  4ZPI A;  1ZYB A;  3S5Q A;  3SH4 A;  3PDQ A;  3DCQ A;  1PIV 1;  4RSU A;  2A6Z A;  4BIF A;  1H8T A;  3GHM A;  1SLA A;  4YVS B;  3TWI A;  4R52 A;  1AL2 1;  2W1W A;  4LLF A;  4UOJ A;  4Z1V A;  4ZU7 A;  2IXJ A;  2YG0 A;  2JDH A;  4FT8 A;  4CEY B;  4KBB A;  4W6W A;  3RFR A;  4DS0 A;  5A6X A;  2FMY A;  3BAL A;  5CFC C;  5K9Y A;  2IXH A;  3ZXK A;  1RHI 3;  4YG0 A;  1PO1 3;  2RJL A;  1VBD 1;  1GP6 A;  4Y1V A;  3WW1 A;  1ONA A;  4ERO A;  3PHM A;  4EWE A;  3MV0 1;  2BWC A;  2VEC A;  4A3X A;  3UKT A;  3T2P A;  2VNR A;  1YJK A;  1DZR A;  1B09 A;  1OLM E;  3R0R A;  1LTE A;  4AI8 A;  4QX1 A;  3ECQ A;  3VBU C;  2UWC A;  2ZJC A;  1UXX X;  4PT6 A;  3RSJ A;  4A6O A;  1XYP A;  1NZC A;  1WCS A;  1VBC 2;  4XTM A;  5JOZ A;  1OA4 A;  2XLG A;  2CGP A;  1BQP A;  1RUH 3;  2VQA A;  3A23 A;  4FXK B;  4KG0 A;  1T6B X;  4AG4 A;  4HKO A;  1OMI A;  1BJQ A;  3UES A;  4LUM A;  2BNO A;  1EP0 A;  5FYI A;  1HN0 A;  5EZW A;  2K46 A;  5BPX A;  2VQ0 A;  3HNY M;  3TEY A;  2VBD A;  3VBR B;  5IVE A;  1BBT 2;  2J1E A;  3MBW A;  5FUN A;  5JIU A;  3SCG A;  4RS5 C;  1QEX A;  3MDP A;  2PHD A;  3LFI A;  5FK7 A;  2ET7 A;  3APB A;  3N7K A;  3VZM A;  1VB4 A;  3W5N A;  1W9S A;  4BIO A;  3GM8 A;  5J1X A;  4NO4 A;  1XYN A;  1YI9 A;  3IPV A;  4FOY A;  4FPY A;  1C5H A;  4OHV A;  3KSC A;  4YW5 A;  2YBS A;  2RS3 2;  1V9U 2;  2K9Z A;  3NJY A;  4QPW A;  5T54 A;  3UKN A;  4ZS2 A;  4YGE A;  1NXD 1;  5F5A A;  3D82 A;  5DDJ 3;  5GLW A;  2A75 A;  2Y38 A;  1PGL 2;  2BJS A;  1QJY 2;  2XDV A;  4LK6 A;  3LGR A;  4IES A;  1UZW A;  3ZM8 A;  3KGL A;  3LA2 A;  4CUC A;  2GC2 A;  3U1X A;  2IC1 A;  1GUI A;  2MEV 1;  1RHI 1;  3UET A;  1TVG A;  4E8C A;  2JEC A;  2VL4 A;  4Z8B A;  2BUK A;  4OHY A;  4XIL A;  1VBC 1;  3M3E A;  2YMZ A;  3AYD A;  4XXA A;  4XJZ A;  3WUC A;  5J36 A;  5APA A;  3PME A;  4P9J A;  5HXM A;  2W39 A;  3RDI A;  4YZ2 A;  1YQ8 A;  1P8J A;  4M4P A;  4D6Q A;  3KCY A;  4AWD A;  1YI7 A;  2BGC A;  1KJR A;  5C5T A;  5J98 B;  2Y33 A;  4MHR A;  1IOA A;  1DYO A;  2QVS B;  5LB6 A;  1SLT A;  2JG9 B;  3MI8 A;  2BP6 A;  1ND2 B;  4QKD A;  1C8M 1;  2ZBJ A;  3DPR B;  3MO4 A;  4YW7 A;  3PU3 A;  2ZGL A;  2XG3 A;  3ZXF A;  4CP9 A;  2VXJ A;  4RQP C;  4U36 A;  2AC1 A;  2DVG A;  2LS6 A;  5C5U A;  1ZM1 A;  3RS6 A;  5A7Q A;  3H1W A;  1Q56 A;  1E5I A;  1NCR C;  1YJL A;  5A7N A;  2LM3 A;  2OUH A;  2CU5 A;  4YM2 A;  2N7G A;  4S2H A;  1XNC A;  3UV9 A;  5LRS A;  1W9T A;  3ETP A;  4Q2F A;  5FY9 A;  2GU9 A;  2WT2 A;  2PMW B;  4UFH A;  4MSV A;  2I07 B;  1MVE A;  3BTX A;  1K5M A;  1OA3 A;  1W04 A;  2R06 3;  2WNU C;  2Z4F A;  3LZZ A;  3VBR A;  3G6J B;  1W8T A;  1O59 A;  3OYW B;  3MIG A;  2XJT A;  2ZOE B;  3DXT A;  4N43 B;  2XJQ A;  4Y33 A;  2CNA A;  4EV0 A;  5JUV A;  2ZGT A;  3WOG A;  4DRR A;  4AI3 A;  1RUC 1;  2OXB A;  1TG7 A;  1J84 A;  2JE7 A;  4NRM A;  5AVP A;  3KF5 A;  3VKF C;  4OFG A;  5FPU A;  4IW3 A;  1ZRC A;  3WG4 A;  3ZPO A;  2E26 A;  2V73 A;  1W2T A;  1LHN A;  3AZY A;  1H0B A;  1VAL A;  3ON7 A;  4PQQ A;  4Y1Y A;  1HX6 A;  5CKM A;  1R08 3;  1LOG A;  1RUJ 2;  4A6S A;  4PDW C;  4PHZ A;  2HWB 1;  5A70 A;  2GMM A;  5KXB A;  1KXG A;  4IET A;  1GZW B;  4AK3 A;  5FOJ B;  5I0T A;  1X50 A;  1VR3 A;  1S0F A;  1RGS A;  3AXE A;  3EXU A;  2J1V A;  2PQQ A;  4X6R B;  3O1O A;  2QQP A;  3WV6 A;  2VTX A;  3KQ4 B;  1S2E A;  3GXU A;  3HIF A;  4RFT 0;  3JU9 A;  1AUY A;  1LRH A;  5FYV A;  1JOB A;  4ZON A;  4XE9 A;  1DU3 D;  5FDB A;  1RIR A;  1IG3 A;  3LFM A;  3ZFG B;  2JG8 C;  4RGG A;  2ZEY A;  3NW4 A;  1NG0 A;  1DP0 A;  2WZE A;  3OJB A;  4IQP A;  1BMV 1;  5I91 A;  3C7H A;  4JGZ A;  4BU2 A;  2QQJ A;  5F2S A;  3ZFE B;  1UMZ A;  5FYU A;  4LO8 A;  2YFZ A;  2YBP A;  4Y1Z A;  3ZYG A;  3TN9 1;  4G3Y C;  4FPF A;  4QXC A;  1JOJ A;  2BV4 A;  4BQX A;  3MIH A;  3BIE A;  3T0A A;  4A4A A;  4Y24 A;  4MHU A;  2O0O A;  1NY7 1;  2PHL A;  5A7O A;  2HWD 3;  2ATF A;  1V00 A;  5EJZ B;  1OOP B;  3H9A A;  4LPL A;  4LIU A;  1IPJ A;  2RR1 2;  3RZM A;  4XUN A;  3VHP A;  5BUV A;  1FOD 3;  1W8Z A;  4JHT A;  2NYY A;  1UY2 A;  4AF9 A;  1W6O B;  5A33 A;  2FDK A;  2X05 A;  3T30 A;  3X29 B;  1NKG A;  1HN1 A;  1YRZ A;  4LBM A;  3K4D A;  4I3G A;  2Q1Z B;  3DYM A;  5DG2 A;  1Q8O A;  2VE1 A;  3WUD A;  3B69 A;  2UUR A;  3HNB M;  3ATG A;  4KBZ A;  3MIE A;  2JKB A;  1VBC 3;  4XAC A;  4QT6 A;  5LRR A;  1S0I A;  4HKW A;  3AP6 A;  4OI1 A;  3T09 A;  2C6S A;  5CG8 A;  2V72 A;  3KZ4 C;  3POG A;  1QQP 1;  4Q27 A;  2YHJ A;  3PVO A;  1H4G A;  3SIT A;  3RG0 A;  4EJR A;  1JUI A;  3NJV A;  5IK8 A;  1PK6 C;  4NPR A;  2ADE A;  4QPG A;  3VBU B;  4AVT A;  2VZV A;  3VKO A;  2HWF 2;  2W2I A;  5C3P A;  3I8T A;  2XPJ A;  3WEZ A;  2GC3 A;  4QD2 A;  1HKD A;  1IHM A;  3EJK A;  3GGL A;  1DQ6 A;  1L3J A;  1ENR A;  1QJX 3;  1ZVF A;  3JD7 3;  5DAV A;  3AP9 A;  4BYY A;  4QM9 A;  1ULO A;  1X7N A;  3NVC A;  3USS A;  5ANQ A;  3GYD A;  4JZR A;  1DQ0 A;  5JIA A;  4BE3 A;  1R09 3;  2A3W A;  3VZK A;  2E6V A;  3E5U A;  3WR0 A;  1J3R A;  5FZC A;  3IKW A;  1UZV A;  4QU1 A;  1D2S A;  4CXY A;  1FAT A;  4P9X A;  1PVC 1;  5FY8 A;  1DQ5 A;  3I2D A;  3M4F A;  4LT5 A;  1NQD A;  5LBB A;  2C0Z A;  2XON A;  1RUI 1;  3SXW A;  3IDC B;  1MS8 A;  2Y6F A;  1I3H A;  1OQ1 A;  3H7Y A;  2ZX1 A;  1MS3 A;  4AAX A;  3OGV A;  2DTW A;  4A7Z A;  3N7J A;  1PO1 1;  4FFH A;  5DZG A;  2Y60 A;  3VZN A;  5FK8 A;  4D7T A;  5FZ8 A;  1AYN 2;  1GMM A;  1LNS A;  1WCD J;  5G05 L;  5JOX A;  3KCX A;  4C1W A;  3U14 A;  1UPS A;  2MEV 2;  3MW2 A;  1XB9 A;  3AYE A;  4G4F A;  1DG6 A;  2B45 X;  2DFB A;  2AH2 A;  4GA9 A;  4UBG A;  4CU8 A;  3O1S A;  4D8M A;  1JN2 P;  1PX4 A;  2QE3 A;  2XKO A;  1K5M C;  2DUP A;  1TME 2;  4YG3 A;  3THD A;  1OXC A;  4OLL A;  3MHZ A;  4W6Y A;  5C3Q A;  1AL2 3;  4JGZ B;  1G86 A;  1PM7 A;  1PZ8 A;  2GH2 A;  1NYW A;  2DCJ A;  1UU6 A;  4CXW A;  3H8R A;  2QJV A;  3CZJ A;  3N4M A;  1J58 A;  1WCK A;  2ES3 A;  4CDQ C;  5FBZ A;  4Q0V A;  3IB3 A;  4E2S A;  1WW6 A;  1C4R A;  1NCQ A;  4IV3 C;  3RWK X;  4CU6 A;  4YZ1 A;  1QGL A;  4RQP A;  1W6M A;  2AZ5 A;  3BGA A;  3TN9 3;  2J1T A;  5JXG A;  4LKE A;  4YW1 A;  3C2U A;  4YRD A;  1NOV A;  2ENR A;  5FZF A;  4LQR A;  1LOC A;  1WD3 A;  1ZRI A;  2YXS A;  3SCF A;  1JYW A;  2HJI A;  2QQO A;  1QH6 A;  3U37 A;  1DQ1 A;  2JDK A;  4DXZ A;  1RTV A;  1AYM 3;  2Q30 A;  5I8Y A;  1DLC A;  2TEP A;  4XC9 A;  2DVA A;  4Q4X 2;  2RMU 3;  5DN2 A;  1BEV 2;  4R9A A;  2WZ8 A;  4Q0Q A;  1VLN A;  1RUN A;  4NII A;  4JVA A;  1K5M B;  5IVY A;  2LTN A;  2O8Q A;  5FZK A;  2PLV 1;  3U11 A;  4XF1 A;  5BY5 A;  1QJE A;  1HW5 A;  1Q3E A;  4TSV A;  4XBN A;  4NIG A;  1WKY A;  2QQN A;  3KVB A;  4AEM A;  4QGN A;  1QIQ A;  3OPT A;  1RVF 2;  2WSU A;  1H8T B;  2ZKL A;  2HWB 3;  5SV5 A;  1YCI A;  3AZW A;  2P6C A;  2CV6 A;  1F8V A;  5FBJ A;  4NWW A;  3U75 A;  4U2A A;  1ZRR A;  3NNL A;  4CCK A;  3WG1 A;  1PX3 A;  3J7L A;  3B94 A;  4NN0 A;  5FPZ A;  2VMC A;  1G9D A;  4FPH A;  5FZ0 A;  4O9E A;  1CVN A;  1QKQ A;  1BZW A;  3J26 N;  5SV8 A;  3VZO A;  1FV2 A;  1ZZ8 A;  3PIG A;  4URT A;  4DZG A;  5JXJ A;  4DUW A;  5FXV A;  5CKN A;  1V9U 3;  1KRI A;  2ZHK A;  4CDW A;  5BYN A;  4LKS A;  2VUA A;  3VKN A;  4XJA A;  2PAM A;  2ORX A;  2ZPX A;  1X9T A;  5C4W B;  1JHN A;  5FMO S;  3P3N A;  5CEH A;  1SDD B;  3O14 A;  1BMV 2;  1JZ8 A;  4XFF A;  2W1U A;  3SQO A;  4FPC A;  2A6Y A;  4AFB A;  2WLQ A;  4NMI A;  5H9P A;  5T50 A;  3WW2 A;  3HAG A;  4EZH A;  2TUN A;  5JR2 A;  4FPJ A;  1VB2 A;  3HVD A;  1FMD 2;  2IXK A;  4JC1 A;  2Y64 A;  1W3V A;  2VUD A;  3I59 A;  1YLL A;  1YWK A;  1GP5 A;  2R16 A;  1I5P A;  1U0A A;  4Q29 A;  4XAA A;  4QGM A;  4XCA A;  2AR6 A;  3VKM A;  4S2G A;  1NY7 2;  3WP6 A;  1U12 A;  5FYT A;  1RMU 1;  1N3O A;  3ZFF A;  1U5I A;  3VV1 A;  3DV8 A;  4CDW C;  4FFF A;  1H30 A;  5J48 A;  1W03 A;  2A73 B;  3DUI A;  1ASJ 1;  2VTF A;  4WBB A;  5FZA A;  1B35 B;  4GAZ A;  4AHX A;  1VMH A;  4MGS A;  4QXK A;  4CCE A;  3S30 A;  1QU0 A;  5E6H A;  1O3T A;  5FOB B;  3H0O A;  1YQ5 A;  1I9R A;  4WZC A;  4IEW A;  2B39 A;  2CWS A;  2R07 1;  1W9F A;  1M4W A;  4RYD A;  1GR3 A;  5KWR A;  2R04 2;  1YXW A;  1VBB 2;  3OD4 A;  4XEZ A;  2P17 A;  3ELN A;  1TMF 3;  2ZGO A;  4XHX A;  2ET1 A;  1EPW A;  4QDQ A;  5L7O A;  1S0J A;  4H14 A;  1LR5 A;  4FSJ A;  4TTG A;  1V6I A;  4LBL A;  1HRV 1;  2TNF A;  4WVV A;  2Q8O A;  1GIC A;  4AE2 A;  1S0C A;  5H9Q A;  1X8E A;  3PJY A;  4O7X A;  3SEE A;  4QPG B;  2EXI A;  2JJ6 A;  2P37 A;  2DUO A;  3MEP A;  3S57 A;  2E7T A;  3NAP A;  3FN9 A;  1HV0 A;  2WFP A;  2EAK A;  4P9Y A;  5C70 A;  1H9P A;  1H1A A;  3KGZ A;  3L2H A;  5EXO A;  2VVE A;  3N9Q A;  3IDE A;  4K40 A;  4Q26 A;  2DCY A;  4C1X A;  4CPB D;  2W1S A;  4C0H A;  4IUG A;  1DZT A;  2E31 A;  1W6N A;  5F1R A;  2GNM A;  2BTV C;  4COZ A;  4PJY A;  3LDB A;  5FKB A;  3JBG 3;  1SFN A;  2CDP A;  3N9N A;  2W08 A;  2ZGP A;  5ISL A;  3ZSL A;  3EHK A;  1TMF 1;  3AJZ A;  2HBT A;  3LWC A;  1KEX A;  5FMO L;  5DUX A;  2AEZ A;  3WIN E;  4BLJ A;  1NUK A;  3AVR A;  2BFU L;  2BVB A;  3I59 B;  3R6S A;  4PIX A;  1MEC 3;  2R06 2;  2VM9 A;  2WS9 1;  4L99 A;  3VBH C;  2XBO 3;  2XUE A;  4LA3 A;  2P2K A;  4Q4Y 2;  2C9K A;  3IM0 A;  1R1A 1;  1R08 2;  1RUJ 3;  1VRH 1;  5T5P A;  4LOT A;  3KLS A;  4IGO A;  3S7I A;  3FUO A;  5JMO A;  3PVN A;  2ZEX A;  1QOT A;  3OYW A;  2FDH A;  1SFP A;  4Q4W 1;  5F5C A;  4CA9 A;  2V09 A;  1ULC A;  2VOX A;  4AW7 A;  4HAN A;  5FZO A;  1JS9 A;  2W95 A;  2WSV A;  3O0W A;  1EAH 2;  1O7F A;  1AJK A;  1YFW A;  2Y26 A;  3ACG A;  4FVV A;  2ZHN A;  3KCC A;  1VBA 1;  4K1Z A;  1F5J A;  4QGL A;  3HBZ A;  3CNA A;  5BNP B;  1PNG A;  2GN3 A;  2RS1 3;  2XVK A;  2VMI A;  3I3D A;  4ATE A;  1SLB A;  3WDW A;  4BJ0 A;  2WAB A;  2JDN A;  3CHX A;  3MPB A;  1RUG 1;  1ZZB A;  2XL9 A;  1RUD 3;  4NHX A;  4MUV A;  2DBI A;  5EIY B;  3OG2 A;  4LOS A;  5A3O A;  5JXI A;  3TEW A;  5F6L B;  3LE0 A;  1JBC A;  1DF0 A;  3RZH A;  1ND3 A;  3MLL A;  1W39 A;  3G7D A;  1CGP A;  2Y6G A;  1RUF 3;  1ZBA 3;  5I0R A;  3NAP B;  4CCL A;  3JQX A;  1TQ5 A;  2GNB A;  1PO2 2;  2VMH A;  3POI A;  4R8H A;  3RI9 A;  5A32 A;  2JE9 A;  3MFC A;  1XNT A;  3KWV A;  3T2Q A;  4CCM A;  4YYO A;  2JX9 A;  3GAL A;  4P9G A;  4H2A A;  3WP4 A;  1N1V A;  1G9C A;  1UKG A;  4PQ9 A;  3EBR A;  5FP7 A;  3UKV A;  4AI9 A;  3I3B A;  4L97 A;  5IAT A;  3O1M A;  3CJI B;  5F32 A;  1SLC A;  3VD7 A;  1HRI 3;  4AFA A;  1OQD A;  1PVC 2;  2CHH A;  4OVE A;  1N3Q A;  5GM0 A;  4GWN A;  3VBO C;  2VTX J;  2J1R A;  5ABJ A;  1QJX 2;  3PTR B;  3WG2 A;  5C3S A;  2WT1 A;  1O91 A;  2MPF A;  5K0U A;  1OD3 A;  3RPQ A;  1XU2 A;  2FCV A;  3FZ3 A;  1BEV 1;  4UT5 A;  1HJF A;  4MH0 E;  5IFP A;  1NA1 B;  2A3Y A;  4CSW A;  3ZN6 B;  2I74 A;  2HBU A;  4M3C F;  4YM0 A;  2DF7 A;  1UQX A;  2MNG A;  3POB A;  4OUL A;  2YC4 A;  3AMP A;  2RMU 1;  3ORJ A;  2PXJ A;  3Q8B A;  1QHD A;  2WNU B;  3FUQ A;  4WM8 C;  1SAC A;  5FRA A;  3M7A A;  2VZQ A;  1PIV 2;  3BCW A;  1FAY A;  4LUK A;  2DCT A;  1XU1 A;  1AR9 1;  3CL1 A;  3QD6 A;  2WLP A;  1FT9 A;  3LCP A;  3OPW A;  3ENR A;  3P1I A;  5T5L A;  3U07 A;  1UY0 A;  1ULE A;  1BKZ A;  4QHZ A;  4SBV A;  4A45 A;  3Q8C A;  2WO2 A;  3ZYP A;  1G9A A;  2E7A A;  1XPW A;  4ORF A;  2ARB A;  3DXU A;  2X8K A;  3PVE A;  4PI2 A;  1KD7 A;  1O6U A;  3ASI A;  4P5Y A;  5JSR A;  1CPN A;  1C8M 3;  1CQ9 A;  2IVI B;  3AZV A;  2VZU A;  4JGY C;  5A6Y A;  5IJR A;  2BU9 A;  1J1T A;  2A1X A;  2D6L X;  2D98 A;  2YFU A;  4FQ4 A;  5C9A B;  3E5Q A;  1XBF A;  3LB9 A;  1BK1 A;  3U4S A;  4ZU4 A;  3USU A;  4Q4Y 1;  4B7E A;  2E51 A;  3AMH A;  2VUL A;  5DAQ A;  1ND3 C;  1O3Q A;  4Q4V 3;  3RZG A;  1FXZ A;  2D5F A;  1AZD A;  4UFL A;  3BU0 A;  1W6O A;  3BOD A;  4FXG B;  3MID A;  4S2D A;  2RJK A;  1W2U A;  3V0B B;  4XUO A;  2QQK A;  4HMZ A;  2UY8 A;  1KS5 A;  2B42 B;  4XFB A;  2JD4 A;  2MEV 3;  1U5Z A;  4QB1 A;  4YZ4 A;  4AFM A;  4KNC A;  4AED B;  1GZ9 A;  1EUT A;  4QX2 A;  4CU7 A;  1VBD 2;  3F95 A;  4IEO A;  4HLT A;  3KV4 A;  2PHF A;  4C8D A;  1REE A;  3J7M A;  4IGQ A;  4L11 A;  4O65 A;  4ARY A;  5HV0 A;  4KL1 A;  2ZGM A;  1RUI 3;  3OTF A;  1HXS 3;  5A1L A;  1MS4 A;  4XAE A;  1CES A;  2DTY A;  2VJX A;  5CB7 A;  3PMS A;  1AXY A;  4H55 A;  2QQL A;  3CO2 A;  1H6X A;  5EQU A;  3O12 A;  3BI3 A;  2DVB A;  1WWY A;  1A78 A;  4HBN A;  1NLR A;  1ZRD A;  4CDX B;  1POV 3;  4YSF A;  2NP0 A;  3ZR6 A;  1O4Z A;  4BQY A;  1KDM A;  3AX4 A;  5A6Z A;  5C7G A;  1OI6 A;  3SIS A;  2WIN B;  4LO5 B;  3VBR C;  3ZXA C;  4A42 A;  3BTY A;  4RS5 B;  3JBG 2;  5FP8 A;  1MEC 2;  3JB4 C;  3D5O A;  4RFR B;  4BB3 A;  3I49 A;  4DY3 A;  4FTS A;  3AP5 A;  3WF4 A;  5KXD A;  1DGW X;  3FLT A;  3O0V A;  5IW0 A;  2X29 A;  5GLT A;  3N9L A;  1RUH 1;  3NWK A;  4MOA A;  4B4R A;  1NT0 A;  1D2Q A;  3GJB A;  4GMP 3;  3VZL A;  3MIF A;  1QQP 3;  3T0D A;  2LRP A;  3HEI A;  2UU8 A;  4MYE A;  1R64 A;  3FX3 A;  5FPX A;  2DCK A;  2YBK A;  3SH5 A;  4Y22 B;  1PK6 B;  3ITQ A;  4YM1 A;  2PTM A;  4N90 A;  5JPM B;  1KJL A;  1ZNP A;  3MF6 A;  5T5O A;  1DZQ A;  5I0U A;  1UX6 A;  4OHW A;  3S0M A;  1IS5 A;  1W6Q B;  1RUE 2;  2J7M A;  2XGX A;  5FZ3 A;  3AC0 A;  4ES9 A;  4MG2 A;  1YFX A;  5TSW A;  4KI5 M;  1V6K A;  3BKZ A;  4GQ7 A;  3ACI A;  1A8D A;  5A1A A;  1HXS 2;  3FBM A;  3FFQ A;  4HFS A;  2PAE A;  5LCW L;  1FOD 1;  1UY3 A;  2DCZ A;  5GKA C;  2WNV A;  2Q8C A;  1H4H A;  4NHY A;  4YVW A;  3HQR A;  4E4H A;  3NKT A;  1Y9M A;  1IQD C;  1HB3 A;  4OQ9 A;  1UWW A;  2HWD 1;  2R04 1;  2ZAC A;  3LKJ A;  4ITC A;  2LUW A;  4AAP A;  2JG9 C;  4XOG A;  1OKO A;  3O1U A;  4CE8 A;  4D0Q A;  4DEQ A;  1STM A;  1DIW A;  4XVH A;  3FBY A;  5FV3 A;  4NIA A;  3HNM A;  1AR9 2;  4QDS A;  1OD5 A;  3HR9 A;  4UXA A;  3WW4 A;  3UGG A;  3WLU A;  2W9X A;  3NNG A;  1NCQ B;  2D43 A;  2BEO A;  5JOY A;  3AL5 A;  3FJS A;  1Z78 A;  2HYK A;  2CWM A;  2C26 A;  5FZ1 A;  3KM5 A;  3VUO A;  1AXZ A;  3MW4 A;  1F15 A;  4AR2 A;  1FI2 A;  2VZO A;  3ZFF C;  1SZB A;  2UYA A;  3QCW A;  3OGJ A;  1LGB A;  3CMG A;  3L2Y A;  4CCD A;  5L19 A;  4BWO A;  1IQA A;  5DUV A;  3MLK A;  1RB8 G;  4XFI A;  3E6D A;  3ES4 A;  3SKV A;  1Z7S 1;  4NPM A;  1ULG A;  2C5D A;  3GBW A;  2E7Q A;  4JTO A;  4FI9 A;  3SNM A;  1VMF A;  4HKL A;  4ZZ5 A;  3LOB A;  1HV1 A;  3A21 A;  1JOP A;  2D44 A;  4N43 A;  3KHC A;  3U4X A;  4E8D A;  1RUF 2;  1ZBA 2;  1FMD 3;  3E6B A;  1T2X A;  1S0D A;  1W8N A;  4J1W A;  3WHT A;  1MPX A;  4L8Q A;  2F4L A;  1OPM A;  5FUP A;  5FO8 B;  2WO7 A;  2KM2 A;  1KS4 A;  3WNK A;  1RUO A;  2Q1M A;  1QMJ A;  3SKJ E;  1OH4 A;  2VCC A;  5LA2 A;  3WDY A;  5JSO A;  1JZ6 A;  4CDQ B;  3A4U A;  5CFD C;  4Y22 A;  4YPJ A;  1HB2 A;  2R7E B;  1BBT 1;  3J8F 1;  1OOP A;  2G9Z A;  2ZGQ A;  4MXW A;  4EN6 B;  3WHU A;  2BGO A;  1HDK A;  1Y43 B;  4XMA A;  4IE7 A;  1J1L A;  5EJ1 B;  4YG6 A;  4FPK A;  3E97 A;  2XHK A;  2R06 1;  4NHL A;  2EAL A;  2A6V A;  2WBK A;  4DXR A;  1PMJ X;  5C8C C;  2WJS A;  1SPP A;  4KWL A;  2ZCW A;  2WNV B;  1I6X A;  3JXS A;  2HEY F;  2VOK A;  4C0B A;  2ZGS A;  3UNP A;  4P08 A;  2KD7 A;  1BYH A;  5L9R A;  2BWA A;  5KXC A;  1REF A;  5FPB A;  4ZZ8 A;  1VJ2 A;  4QPY A;  3OGS A;  5F3I A;  4Q1P A;  2D5H A;  2PLV 2;  4CTE A;  5FMB A;  4GB3 3;  3J7N A;  1QXJ A;  1AHS A;  3ALQ A;  4F7Z A;  4Y5T A;  5FLJ A;  2JG8 A;  1H8T C;  3CEW A;  5FPV A;  5LBF A;  3IN9 A;  2HWC 2;  1CR7 A;  3MUY 1;  2ZX0 A;  5BNN A;  1X82 A;  1GV9 A;  1MS1 A;  1KFX L;  1RIN A;  2RMU 2;  3NV3 A;  1E5H A;  4XBL A;  1HJG A;  1UF2 C;  2VOV A;  1U5X A;  4N53 B;  3FLP A;  4Y5Z 0;  1CAU A;  1X8M A;  2Y6J A;  5LWB A;  3EO6 A;  2WRA A;  1APN A;  1Q8V A;  3HQX A;  2PYT A;  4UBH A;  2VMF A;  1GBG A;  2ERF A;  3AYC A;  3WCS A;  5HCB A;  1OOP C;  5A3P A;  2I2S A;  2QFE A;  5D8A C;  3HOB A;  1S2K A;  3WQ0 A;  1PGS A;  1NLS A;  1RUI 2;  1SLI A;  1WMD A;  2V4V A;  3LSD A;  5A7W B;  2DV9 A;  3H1M A;  1F9K A;  1ZBE 2;  2ZZQ A;  3LPF A;  2G9G A;  3LSE A;  2VNO A;  2EIE A;  4MGZ E;  4Q4V 2;  3TEZ A;  4NIH A;  4CP1 A;  4GH4 B;  4ZHN A;  1GFF 2;  1OBN A;  2WZR 2;  3BU7 A;  3VBF A;  2Q5T A;  4IEX A;  4OYU A;  2JDA A;  3GZT B;  3OSD A;  5GZD A;  4BQ5 A;  1XE7 A;  4MGQ A;  4YW6 A;  3BVC A;  1WZX A;  1PO2 3;  4NR1 A;  3ZYF A;  2BBV A;  3DYO A;  5EYY A;  1D0H A;  2JDZ A;  3VD4 A;  2HYX A;  2IFW A;  4DNY A;  1JTZ X;  4GB3 2;  3ZSK A;  2WWU A;  1GNZ A;  4XJ9 A;  3TRS B;  2OW4 A;  4OQ8 A;  3QH6 A;  2HWF 1;  3RMX A;  3LEM A;  5FQ0 A;  2D3S A;  1HLC A;  1MVQ A;  2FDG A;  5F8P A;  3NL1 A;  4Q5O A;  4QPI A;  4NPL A;  3AMN A;  2ZZJ A;  4L92 A;  4KH9 A;  4NUB A;  4YW3 A;  2RM2 1;  5FZB A;  1YNA A;  1TEI A;  1N1S A;  5K4L A;  3OEB A;  4XFC A;  4ZY9 A;  2P3K A;  3FFZ A;  3WF2 A;  1FNZ A;  4JDM A;  1DQ2 A;  1LKN A;  1XNB A;  3T2O A;  3UJQ A;  3I2K A;  1JUH A;  4NHM A;  4PLO A;  1RUH 2;  1UOG A;  5CZK A;  3TEX A;  2W68 A;  4I3P A;  5FO7 B;  5H9S A;  1IG0 A;  3EB7 A;  4J25 A;  4UFM A;  4BHP A;  5FYZ A;  2VUJ A;  5FMC A;  4KQ7 A;  1S55 A;  4UF0 B;  3S6P A;  1ZBE 3;  1QWR A;  3N9O A;  2H0V A;  4KU8 A;  1QNW A;  3WZ1 A;  4C90 A;  5CIS A;  5HCH A;  3PIJ A;  5LEK A;  4LUL A;  2EXK A;  3WNO A;  1GYK A;  2WZR 3;  1AYN 1;  3CIH A;  3BOP A;  5D1I A;  2EXJ A;  1H2K A;  2BRT A;  4XUR A;  3J7H A;  5I93 A;  1QXP A;  4QPG C;  3K51 A;  4OUE A;  2HEV F;  1ENX A;  1ODN A;  4K8F A;  3DEC A;  1M06 G;  2DUQ A;  4UW4 A;  4WVW A;  4B8E A;  2XJR A;  5EPA A;  5FUI A;  5CU1 A;  5FZO B;  4LE3 A;  3RQ0 A;  4IEQ A;  5EJ3 A;  1LOD A;  2E9Q A;  1FNY A;  1D4M 3;  3N7L A;  4FPG A;  4BK4 A;  2W52 A;  4XCB A;  2R1B A;  3W21 A;  5FCC A;  2HWD 2;  5ABJ B;  4WM7 C;  4QWN A;  2VVF A;  1UIK A;  5ACA 2;  3LEG A;  1Q5O A;  1ACC A;  1FOD 2;  4FP2 A;  2VO5 A;  3WXP A;  4ARX A;  1WD4 A;  5J96 B;  5FJH A;  1UL9 A;  3GDB A;  3ES1 A;  5KHK A;  4HET A;  1SBD A;  2XJV A;  4CRQ A;  4GMP 0;  1GWL A;  1UNB A;  2WYF A;  3ZXD A;  2NZ9 A;  1POQ A;  2JEM A;  4A41 A;  4Y3O A;  4XF0 A;  3CZU A;  4UFK A;  3VBU A;  4MV2 A;  1MR5 A;  5F39 A;  1G9B A;  2PFW A;  1OFN A;  2BFU S;  4XJU A;  1VPH A;  4XDP A;  3ZXE A;  4BLI A;  2RDN A;  5EYX A;  1UY4 A;  1EUU A;  1NLQ A;  1X36 A;  4XJ8 A;  3R4D B;  2WFF 1;  2EVX A;  1IPS A;  3WNL A;  2FDJ A;  3AZX A;  3RZL A;  1WA6 X;  3KF3 A;  4FFI A;  4JV4 A;  2XML A;  3PNA A;  4JAA A;  2FD8 A;  2J22 A;  1JZ7 A;  5FZ7 A;  4NOT A;  1Y3T A;  2W1Q A;  4B29 A;  5BNP C;  2NQY A;  4L9B A;  3PTY A;  3OCP A;  4UF0 A;  5IVJ A;  3D0S A;  1GOG A;  1QDO A;  3I7D A;  3MLJ A;  2QUO A;  2J42 A;  1OSG A;  2XXZ A;  3AKR A;  1K3I A;  1EAH 3;  4G9S B;  2VUC A;  4COV A;  2VZ3 A;  4LBO A;  5J09 A;  2DYC A;  4JGY A;  5IVC A;  1PVX A;  1ZA4 A;  2GAL A;  4AFD A;  4IEU A;  2HKX A;  3GBG A;  4XIK A;  5GLU A;  2VZP A;  1CWP A;  4BQ2 A;  2E53 A;  3AKS A;  3DL3 A;  4LHK A;  2VGD A;  4XFH A;  1CIW A;  1RIT A;  4N9I A;  4B4P A;  5LW9 A;  3KT1 A;  2OQ7 A;  2OPW A;  4GWM A;  4KU7 A;  2JDU A;  4AGR A;  3BOW A;  4D6R A;  2WC2 A;  3ZMN A;  2GSY A;  2Y0I A;  4PIZ A;  2JEN A;  5C4W C;  4HG6 B;  4QDR A;  1IKQ A;  1Q43 A;  1TNF A;  1R09 2;  3OY8 B;  5FYC A;  4RA0 A;  1EV1 3;  4CPB A;  1ULP A;  3FHA A;  2RHP A;  5FZE A;  4YGD A;  3RJ2 X;  3CLP A;  1CJD A;  1YEW A;  1RJ7 A;  4LXL A;  4DB5 A;  5DZE A;  3W59 A;  5L73 A;  3RI8 A;  1NCR A;  3AYA A;  1N47 A;  2IUW A;  4FOW A;  4A7K A;  3O0X A;  4MET A;  1L7R A;  2D7F A;  3C8X A;  4PF1 A;  1MQT C;  2BGP A;  3M3O A;  1Y7B A;  3LQC A;  4M0H A;  3S7E A;  3VBO A;  1XNA A;  3NV4 A;  3R4S A;  3A0K A;  2A6W A;  2VQU A; 
#chains in the Genus database with same CATH homology
 2QBX A;  1US3 A;  2W95 A;  2DDU A;  3ACG A;  2EID A;  1GOH A;  4XZU G;  3OEA A;  5IYY A;  3I3D A;  3WF0 A;  4BJ0 A;  2WAB A;  4OMC A;  4L0P A;  1JU4 A;  5LA1 A;  5EIY B;  3OG2 A;  5JXI A;  1RYY A;  2WN3 A;  3LE0 A;  2W1W A;  2VC9 A;  2Y6G A;  4UOJ A;  2YG0 A;  1XNT A;  3T2Q A;  5B4X A;  2ZEZ A;  3VDA A;  3CDZ B;  1H6Y A;  2XHN A;  3I3B A;  5IHR A;  2VZT A;  3C7F A;  3I2I A;  4LHS A;  5DMY A;  5I0D A;  3VD7 A;  3MV0 1;  3T2P A;  2W47 A;  2J1R A;  4BXS V;  4QX1 A;  3ECQ A;  1OD3 A;  4A6O A;  4PT6 A;  2VOT A;  4A3Z A;  1XC6 A;  5IFP A;  3ACF A;  4BK5 A;  4DXS A;  1KGY A;  3A23 A;  3IAQ A;  4AG4 A;  4DXT A;  2YC4 A;  3UES A;  3D3A A;  2VZQ A;  2VCB A;  3HNY M;  4OMD A;  2J1E A;  3MBW A;  3OB8 A;  3P1I A;  2W5F A;  1UY0 A;  3I2G A;  3NJX A;  3W5N A;  4A45 A;  1OF3 A;  1W9S A;  2E32 A;  2WO2 A;  3GM8 A;  5J1X A;  1XPW A;  3P6B A;  4QPW A;  2QQM A;  4P5Y A;  3I2F A;  2Y6L A;  5DQ0 A;  2VZU A;  1NX9 A;  5IJR A;  2YFU A;  3PUH A;  3ZM8 A;  4CUC A;  1GUI A;  2W92 A;  3UET A;  1TVG A;  4QAW A;  2VL4 A;  4E8C A;  3LEK A;  4P02 B;  2WQ8 A;  4XUO A;  2QQK A;  2BZD A;  5HXM A;  1F4H A;  1P8J A;  3C7O A;  4M4P A;  4UAP A;  4QB1 A;  3ABZ A;  4QX2 A;  1EUT A;  4CU7 A;  5HPO A;  1CZV A;  2V5D A;  4M4R A;  1DYO A;  4ARY A;  2VME A;  2WAO A;  3MO4 A;  2VJX A;  3MUZ 1;  3OGR A;  1JHJ A;  3K4Z A;  2LS6 A;  2QQL A;  1H6X A;  2W87 A;  4JKM A;  2WN2 A;  5B4N A;  1UZ0 A;  2L9L A;  3WF3 A;  1W9T A;  3ETP A;  5C7G A;  4A42 A;  2HLE A;  4XUP A;  2Y8K A;  4CUA A;  2Z4F A;  1WCQ A;  1O59 A;  5G04 L;  1UX7 A;  5JUV A;  3WF4 A;  1SG3 A;  2EIC A;  3WNP A;  1TG7 A;  2RVA A;  1J84 A;  4MOA A;  5JXH A;  2WDB A;  1YQ2 A;  1JI6 A;  2E26 A;  3T0D A;  3HEI A;  1R64 A;  3A7Q A;  2DCK A;  1GQP A;  2CDO A;  1UYZ A;  4PQQ A;  1BHG A;  4JKL A;  2J7M A;  3AC0 A;  4KI5 M;  2B9V A;  2J1V A;  3ACI A;  4JHZ A;  5A1A A;  3GXU A;  1CIY A;  5LCW L;  1GOF A;  1UYY A;  1UY3 A;  3C7E A;  3VD5 A;  2RV9 A;  1IQD C;  2B4K A;  1UWW A;  4W50 A;  2ZEY A;  1W9W A;  2WZE A;  1DP0 A;  3E1F 1;  3C7H A;  4D0Q A;  4DEQ A;  2QQJ A;  4XVH A;  4TXW A;  3HNM A;  3HPN A;  4QDS A;  2YFZ A;  4CUB A;  2W9X A;  3NNG A;  2WUH A;  3VD9 A;  2C26 A;  3T0A A;  4A4A A;  2VZO A;  2XOM A;  3CMG A;  4A44 A;  5EJZ B;  2ORZ A;  4LPL A;  4XUN A;  3SKV A;  3HN3 A;  1UMI A;  2W3J A;  3I3E A;  1GU3 A;  1UY2 A;  4FI9 A;  2X05 A;  4ZZ5 A;  2YB7 A;  1NKG A;  3A21 A;  1HN1 A;  4QX0 A;  3K4D A;  3DYM A;  4E8D A;  1CX1 A;  3VD3 A;  1T2X A;  1W8N A;  3HNB M;  1MPX A;  3NQH A;  2RJ2 A;  4JX0 A;  3WNK A;  3CKH A;  2ID4 A;  2WO3 A;  3SKJ E;  2J1S A;  1OH4 A;  2VCC A;  5LA2 A;  3T09 A;  1JZ6 A;  2V72 A;  3K77 A;  1J83 A;  4YPJ A;  2R7E B;  4XUT A;  3NJV A;  2BER A;  2BGO A;  2VZV A;  5EJ1 B;  4MAD A;  1NAE A;  2WBK A;  3WEZ A;  5IFT A;  3GGL A;  4DXR A;  1PMJ X;  3FHQ A;  1ULO A;  3JXS A;  3UNP A;  1O8P A;  2Y6K A;  2KD7 A;  4GZ9 A;  4P08 A;  2J1U A;  2EIB A;  2QQI A;  4ZZ8 A;  3WF1 A;  3OGS A;  2JE8 A;  2VQT A;  3SEP A;  1US2 A;  2XON A;  2Y6H A;  3MUY 1;  2E33 A;  4W4Z A;  1W0N A;  4AAX A;  3OGV A;  2C4X A;  2PQS A;  1GMM A;  1LNS A;  2Y6J A;  5G05 L;  2VMF A;  4JKK A;  4QB6 A;  1CZS A;  3I2J A;  3LPG A;  4CU8 A;  1O8S A;  2ZEW A;  4D8M A;  3HOB A;  3THD A;  1PX4 A;  2V4V A;  3LPF A;  2DCJ A;  4CU9 A;  3CZJ A;  5DPN A;  2EIE A;  2OKX A;  3FL7 A;  1GNY A;  3IB3 A;  4OYU A;  2JDA A;  4MGQ A;  4CU6 A;  5CYY A;  3DYO A;  3BGA A;  4GWI A;  4UI9 L;  5JXG A;  2J1T A;  4Z2A A;  1JYV A;  3VD4 A;  2HYX A;  1PMH X;  2X09 A;  4LQR A;  1JYW A;  3WNN A;  2W94 A;  4P00 B;  2QQO A;  3WNM A;  3K46 A;  2VCA A;  3U37 A;  4QB2 A;  3HJR A;  3THC A;  1DLC A;  4W8J A;  5DN2 A;  1K12 A;  2WZ8 A;  3WQB A;  3OEB A;  1F4A A;  4ZY9 A;  3WF2 A;  3T2O A;  1JZ5 A;  3I2K A;  1W8O A;  4OZO A;  1OT5 A;  5F7U A;  5CZK A;  4DUV A;  1WKY A;  2QQN A;  3A22 A;  3EB7 A;  1JU3 A;  4DEV A;  2WAA A;  2JKX A;  4DUX A;  3F2Z A;  2VZ1 A;  3WSO A;  3WNO A;  1PX3 A;  3CIH A;  2VMC A;  4XUR A;  2VMD A;  3J7H A;  4QX3 A;  1CZT A;  5JXJ A;  4OUE A;  3C7G A;  4DUW A;  3DEC A;  3DYP A;  4LKS A;  5LA0 A;  1W99 A;  4XUQ A;  5FUI A;  2ORX A;  4RN5 A;  1D7P M;  4BK4 A;  1SDD B;  1JZ8 A;  2W1U A;  3OBA A;  2WO1 A;  1SHW B;  5JR2 A;  3NRU A;  2W46 A;  3LEG A;  2VO5 A;  2Y64 A;  4ARX A;  1I5P A;  3GDB A;  1JZ2 A;  4KMQ A;  4A41 A;  4BDV B;  4KWU A;  2JD9 A;  3MV1 1;  3CZU A;  4ET7 A;  2VTF A;  1L7Q A;  4MGS A;  4GWJ A;  1JZ4 A;  2X10 A;  1UY4 A;  1EUU A;  3WNL A;  3EYP A;  4RYD A;  2J22 A;  4MO3 M;  1JZ7 A;  2WYS A;  1K45 A;  4ZXE A;  2W1Q A;  4QDQ A;  2VZR A;  1JYX A;  4TTG A;  3I2H A;  1GOG A;  2LW8 A;  4CVU A;  3III A;  2W91 A;  3SEE A;  3T08 A;  3W5M A;  2VZS A;  1K3I A;  3FN9 A;  2VZ3 A;  3PUI A;  5C70 A;  2J1A A;  3LEI A;  3BN6 A;  2VZP A;  3K75 B;  2W1S A;  4IUG A;  5C71 A;  1UMH A;  3I97 A;  2E31 A;  3IDA A;  1JZ3 A;  3ACH A;  2YC2 A;  3VDB A;  1UYX A;  2XQX A;  2CDP A;  3IAP A;  1K42 A;  4HG6 B;  1OF4 A;  4QDR A;  1KEX A;  1NUK A;  3K4A A;  1ULP A;  1UY1 A;  3FHA A;  2VM9 A;  2BBA A;  3T0B A;  3CQO A;  2C9K A;  2ZXQ A;  5JMO A;  1UXZ A;  2ZEX A;  1L7R A;  4PF1 A;  3C8X A;  3VDC A;  2BGP A;  3LQC A;  2VR4 A;  1XNA A;  1JYN A;  1UXX X;  2VQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...