1UY0A

Carbohydrate binding module (cbm6cm-2) from cellvibrio mixtus lichenase 5a in complex with glc-1,3-glc-1,4-glc-1,3-glc
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
130
structure length
130
Chain Sequence
b'MVIATIQAEDHSQQSGTQQETTTDTGGGKNVGYIDAGDWLSYAGTPVNIPSSGSYLIEYRVASQNGGGSLTFEEAGGAPVHGTIAIPATGGWQTWTTIQHTVNLSAGSHQFGIKANAGGWNLNWIRINKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULASE B
publication title The Crystal Structure of the Family 6 Carbohydrate Binding Module from Cellvibrio Mixtus Endoglucanase 5A in Complex with Oligosaccharides Reveals Two Distinct Binding Sites with Different Ligand Specificities
pubmed doi rcsb
source organism Cellvibrio mixtus
molecule tags Carbohydrate binding module
total genus 28
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1uy0A00
4DEVA 5IFPA 2ZEYA 3FL7A 2HYXA 5G04L 3MV11 1W9SA 2W92A 1WCQA 4JKMA 1UY3A 3F2ZA 1ULOA 2C9KA 5IJRA 5EIYB 4DEQA 2LW8A 2VZOA 2VCCA 2X10A 1W9WA 3IAQA 3VD9A 4BXSV 1O59A 2J1TA 3CDZB 2W87A 2W1WA 2BBAA 3C7FA 4LQRA 2QBXA 3SKJE 5I0DA 5JUVA 3ACGA 4QX3A 4UOJA 1T2XA 3MBWA 4LPLA 1GQPA 2VQUA 2VMEA 2Y64A 5JXJA 1PMHX 4XUQA 3HNYM 3I3EA 3HOBA 1W99A 5J1XA 3OGSA 2W1SA 3PUHA 5DQ0A 5JXIA 1NUKA 3JXSA 3OBAA 4QDSA 2VZRA 3SEEA 2VC9A 4P08A 2VR4A 3FHAA 3GGLA 2EICA 4E8CA 3WNPA 2VQTA 4E8DA 2RJ2A 4UI9L 4W4ZA 1KGYA 3A7QA 2DCJA 4MADA 1TVGA 3W5MA 1I5PA 1K12A 2XHNA 2W1QA 2J1UA 3T2OA 3LPFA 4CU7A 2EIBA 4FI9A 5C70A 2VMDA 2E31A 4A4AA 2QQIA 4GWIA 5LA0A 3VD3A 3VDBA 5B4NA 2V4VA 3I2HA 3ACFA 2VZSA 4DUXA 1JI6A 1SHWB 1JZ5A 4ZXEA 4QAWA 1JYWA 1K45A 4QB6A 4W50A 3ZM8A 2WAOA 3GXUA 4D0QA 2W9XA 1JZ7A 3C7GA 2WBKA 2J22A 3IDAA 3P1IA 3CKHA 3U37A 3WNLA 3MUZ1 3SKVA 3C8XA 4JKLA 4XUPA 1DYOA 2YC2A 2DDUA 1UYYA 4Z2AA 1UY1A 1PX4A 2JDAA 2BZDA 2W91A 1CZTA 5HXMA 3I3BA 1EUUA 3MUY1 2YFZA 2VZ3A 2Z4FA 1WKYA 2C26A 3A23A 5LCWL 2VMCA 4QDQA 3LEKA 1W8NA 4XZUG 3I3DA 3UETA 5C71A 4ARYA 1GU3A 1OT5A 3VD4A 3OB8A 1JZ3A 3FHQA 2WZ8A 2WQ8A 1JU3A 1UMHA 5CYYA 1CZSA 1XNTA 4PF1A 4MGQA 2PQSA 3IAPA 4XUOA 3ECQA 2E33A 2ORZA 5IHRA 2WUHA 4CUAA 2ID4A 3T0DA 1P8JA 1UY4A 1JYVA 5JXGA 3I2FA 2Y6GA 1K42A 3AC0A 4MOAA 3WNOA 4XUTA 1OF3A 4L0PA 3CMGA 4JKKA 4YPJA 4QX0A 3LPGA 3WNKA 3W5NA 2J7MA 2YC4A 2WZEA 1PMJX 1GNYA 2VZUA 4CU9A 2DCKA 1L7QA 3BGAA 4ARXA 3CZUA 3EYPA 2JD9A 1JU4A 3D3AA 4XURA 2VM9A 2J1RA 4A42A 3VD5A 4CVUA 4OMDA 1CZVA 3T2PA 2W1UA 4M4RA 4DXTA 3NQHA 1D7PM 4CUCA 4DXSA 3WNMA 3HEIA 5G05L 3C7EA 4PQQA 3I2IA 4KMQA 3DYPA 2ZEWA 3THCA 1F4HA 2E32A 3WEZA 3LEIA 1GUIA 2W46A 1H6XA 2ORXA 1J84A 4P00B 3OEBA 4P02B 2XONA 5DPNA 5A1AA 3VDAA 2ZXQA 1KEXA 2QQOA 4AG4A 1GOHA 2Y8KA 4OUEA 3OGVA 2V72A 2ZEZA 5B4XA 3T08A 1RYYA 3HN3A 1W9TA 5HPOA 4A44A 5JMOA 3NNGA 2W5FA 2VZ1A 2Y6JA 2J1VA 1JHJA 4PT6A 1GOGA 3NRUA 3WSOA 2LS6A 3WQBA 2CDOA 2E26A 2QQJA 3E1F1 2QQNA 1JZ6A 3LE0A 2J1SA 4A41A 1L7RA 4KI5M 2WDBA 4HG6B 1UYZA 3K4ZA 4JX0A 3HNBM 4RN5A 5IFTA 2ZEXA 5F7UA 3C7HA 2WO3A 4ZY9A 3UNPA 2X09A 3K4AA 2J1AA 4A6OA 3SEPA 1OD3A 1JZ4A 1XC6A 3J7HA 2VO5A 2BGOA 3LQCA 4MO3M 1CX1A 1UXZA 3DYMA 2VZTA 2VMFA 5EJZB 3WF4A 3OGRA 4MGSA 3EB7A 1XPWA 2XOMA 1XNAA 2YFUA 2YB7A 2HLEA 1GOFA 1O8PA 1US3A 3BN6A 1OH4A 4XUNA 1K3IA 4ZZ8A 2VZPA 2VCBA 2WN2A 2YG0A 1LNSA 3K46A 4D8MA 4GWJA 4CU8A 3K4DA 3MO4A 1UMIA 5DMYA 1DLCA 2R7EB 4IUGA 2C4XA 1W0NA 2WAAA 1CIYA 4DUWA 2W95A 3P6BA 4DXRA 4KWUA 3DECA 3IB3A 2VTFA 3UESA 1TG7A 4BK5A 3T2QA 3OEAA 4QPWA 1R64A 2WN3A 5DN2A 4CUBA 3GM8A 1H6YA 2VZQA 4BJ0A 1EUTA 4OMCA 1MPXA 5JR2A 1O8SA 2QQMA 4RYDA 1J83A 4QX1A 1SG3A 1SDDB 4CU6A 4QB2A 1IQDC 3WF3A 3K77A 3C7OA 3NJXA 2BERA 4BK4A 3HJRA 2B9VA 3CIHA 4DUVA 3ACHA 2JE8A 2RV9A 2CDPA 2X05A 1UXXX 2JKXA 2W94A 1JYNA 2XQXA 1UY2A 4A45A 4A3ZA 1ULPA 2W3JA 4W8JA 4P5YA 3FN9A 2WYSA 2WO2A 2V5DA 3T09A 4ET7A 3GDBA 3HPNA 1NX9A 2WO1A 2EIEA 1US2A 3A21A 3DYOA 3ACIA 1UY0A 2QQLA 1DP0A 3CZJA 2J1EA 3I2KA 3K75B 1HN1A 3LEGA 4M4PA 1JZ2A 2Y6LA 4XVHA 3I97A 3IIIA 2VL4A 1JYXA 3I2JA 3NJVA 2Y6HA 3WNNA 2RVAA 3OG2A 1UZ0A 2QQKA 1PX3A 4QB1A 1GMMA 1UYXA 3T0AA 5IYYA 5C7GA 4LKSA 2W47A 1NAEA 2L9LA 3ETPA 5JXHA 1UWWA 3A22A 1JZ8A 3MV01 4ZZ5A 1F4AA 5CZKA 2OKXA 2Y6KA 4TTGA 2BGPA 3CQOA 3WF2A 3T0BA 1NKGA 2VJXA 4JHZA 1W8OA 3I2GA 3ABZA 4GZ9A 2B4KA 4TXWA 1UX7A 4OZOA 3HNMA 4BDVB 5LA1A 1BHGA 3VDCA 4UAPA 3WF0A 2VCAA 3THDA 1OF4A 2VZVA 5EJ1B 3WF1A 3PUIA 1YQ2A 2VOTA 4OYUA 4QX2A 4QDRA 2EIDA 4AAXA 2WABA 2KD7A 5LA2A 3VD7A 5FUIA 4LHSA
chains in the Genus database with same CATH superfamily
4QPIB 5DUUA 4DEVA 2ZACA 1TMF2 2WFPA 5AVAA 1W6OA 1EPWA 2R072 1N1TA 2HYXA 2WRAA 4UFIA 4LO5B 2ILMA 3O1TA 2WZR1 1W9SA 5CFCB 3OTFA 2Q1MA 1FNYA 1NCRC 2W92A 4L2NA 3RFRA 1NLQA 1UY3A 3WQ7A 1XE7A 1WW6A 5IJRA 5EIYB 5IAVA 5LBCA 3H3LA 3MICA 4COVA 1YQ8A 5J96B 2QQPA 1NXD1 3JCIA 1AX0A 1ND2A 2ES3A 2VZOA 5FZ4A 4FPGA 2B8MA 3I8TA 4YVWB 4MXWB 1GBGA 3IAQA 5KR7A 1O59A 3CDZB 4WVVA 4CCDA 4XQWA 1BK1A 2VQAA 2BVBA 3NNMA 4IE0A 4Q5OA 5IATA 1AXZA 3WG3A 2QBXA 3SKJE 1RTVA 2NPIA 3OYWA 5JUVA 2PQQA 4I2OA 1GFF2 1EV13 1T2XA 2RR11 1GZWB 3KVBA 3MEPA 1WBLA 3U11A 4S2GA 1RITA 2H0BA 4NIIA 4PCRA 3BU0A 4IV1A 2VMEA 2OQ7A 2YU1A 5AC91 4COZA 5C4WB 5CEHA 4ONUA 3ITQA 1YQ5A 2WSUA 1UZWA 2GH2A 2XXZA 1UMZA 4BQYA 4LHNA 1J3RA 5EFUA 4D7SA 3IMNA 4TYSA 5EZWA 4QGMA 3ASIA 2PHUA 5JXIA 1NUKA 4XXPA 5T50A 5FZBA 1GNZA 2OT7A 3VKOA 5FZOA 1HDKA 2VNVA 3PIGA 5D8AB 1NY71 3HWJA 4AR2A 3MIBA 1VP6A 3WNPA 3PTYA 1DYKA 3KT7A 2F17A 2RJKA 3M8LA 5HXVA 2D98A 4E8DA 3KV6A 1KD7A 2Q4SA 4UI9L 1V9U2 3K48A 1LB2A 2C1FA 1Q8SA 3USUB 2KR2A 5ACA1 1VBD3 3AYEA 5F6LB 4KU8A 3EJKA 1H1MA 4XFIA 5C3PA 1XRUA 1SLIA 1W6OB 3OF1A 3W5MA 1S0GA 1OXCA 5FYUA 2W1QA 5GLUA 4BMBA 5J3UA 3WW2A 2UY8A 5JIAA 1GP5A 2XUEA 5FPXA 4AFMA 2XG3A 2E7TA 1VBB2 3IMMA 3ILRA 4NUBA 4EV0A 1AR61 1ND2B 3Q8CA 4FI9A 1EPZA 1N1VA 5C70A 1AHSA 4Q8LA 5KXBA 2YHJA 1MS3A 2BP6A 4FP3A 5C4WC 1LOBA 3VDBA 1QQP3 3VD3A 3IDBB 2QVSB 3P3PA 3M70A 5B4NA 2WWJA 3I2HA 1R093 1VAVA 3N9PA 1GQHA 1VBD2 1YFUA 2YBSA 2ZMLA 2X8KA 3OYWB 3T1LA 4DUXA 1X9PA 2JG8A 4QAWA 5FYMA 4NHLA 1PGW1 1SFNA 4W50A 2JD4A 3J4UH 3VUOA 5F5IA 3ATGA 4AQ6A 2DVDA 4IV1B 5D8AC 3RJ2X 3C7GA 1RHI3 1EYBA 3P1IA 3ZXFA 3GZUC 2YXSA 4I0BA 4B1LA 5CG9A 5TSWA 1RUJ1 3EQEA 3MUZ1 3GCWA 3JD72 1I3HA 4XUPA 4XTMA 1UZZA 5I93A 1Y4WA 2YC2A 1DZTA 1RUD2 2DDUA 3UJQA 2WT0A 5APAA 1UYYA 3WX5A 2N7GA 3PUSA 1DZRA 2RMU1 3NMBA 5C3RA 3N9LA 4HMZA 3FBMA 4GB31 5FZOB 2VW2A 1R092 1HLCA 5LY2A 4BLIA 3FX3A 2I45A 1C1FA 5HXMA 3H9AA 3I3BA 4Y4RA 1B35A 4B1MA 2VZ3A 3HVDA 4BXFA 5FZIA 3DCQA 3A23A 1HQWA 2VY0A 1FNZA 1PIV1 2DVBA 3RZMA 3UETA 5IK5A 2D97A 4YLZA 4UBGA 4Y5TA 2D5HA 1HB1A 3SQOA 3SITA 5A6YA 2D44A 3GJAA 5FWEA 3O1VA 2P3IA 1BJQA 4PLOA 4QGNA 5AFEA 4OHYA 3ZFGA 5A6XA 5GZEA 4CCLA 5C8CA 5E8AA 4MHRA 1HJFA 1LULA 1XNTA 4MGQA 2PQSA 4PF5A 4NO4A 2LROA 5KC6A 1FPN2 3PMEA 3VKMA 5A3OA 1W6MA 3KLSA 4LE3A 4CE8A 4BWOA 5JAXA 5JXGA 1D0HA 2Y6GA 3AFGA 5FR3A 3CEWA 2E51A 4Q0UA 5DUWA 3AC0A 5IW0A 3TEXA 1RIRA 1XE0A 3LGRA 5GLVA 4WBBA 1M4WA 1MACA 2KM2A 4Q2FA 1GKBA 4XUTA 1R081 2ZS6B 3SH3A 1AXYA 2IXCA 1C5HA 2UYBA 3DL3A 1RUI1 3WNKA 1FXZA 1LKNA 2JG8B 4CEYA 3PHMA 4QXHA 1C1LA 2BWCA 3CO2A 1GR3A 2GZWA 4KH9A 5A1FA 2EXIA 3VN4A 4GMP1 1QJU3 2DCKA 3GCXA 3FBYA 5DZEA 1LAJA 3CZUA 3EYPA 4FQ4A 1DF0A 2RM23 4W65A 4AVSA 4AVBA 4CDXA 2IXIA 2DF7A 4AEJA 2PAEA 1KS5A 4AGRA 3WCSA 2D6LX 4A42A 3VGIA 4AFCA 4PDWA 4BOWA 2WR9A 3RSJA 4RR3A 3VD5A 5GZCA 4YG3A 1UL9A 4AXOA 5LW9A 1W90A 4RFT0 4CVUA 1WA6X 4I3PA 2VMHA 2GMMA 4Q4W1 3D82A 2VCMA 3ZYHA 4QQLA 4FP2A 1QOSA 4M4RA 3PNAA 1ZZ7A 3NQHA 4GWMA 5EQUA 3RMXA 2K0GA 1DZQA 2RS52 5FP9A 3SXWA 2D40A 4C0HA 1IKPA 2PAMA 3C7EA 1C8NA 2QDNA 2OQ6A 3ZO0B 1DYPA 2WC2A 4FFFA 3LEIA 4HOOA 1B35B 1GUIA 2W46A 4NWWA 3WW3A 3O0XA 1QJU2 4KU7A 5FXZA 1AR92 3KQRA 2LTNA 3IKWA 4BLJA 5CG8A 3NJZA 4R52A 5A1AA 3AX4A 4YGEA 1CVNA 2ZXQA 4P9LA 2R1DA 3GYDA 2Y8KA 4Q27A 4X6RB 4XDQA 1MEC2 3PDQA 4ZS2A 2ZGTA 5FUPA 1WLTA 3NNLA 1LOCA 3ST7A 2UWBA 3VZNA 3UKTA 3ZFGB 3HN1A 4XDOA 4XPVA 5C8CB 1MS1A 4YNIA 1OI6A 2JDUA 3FZ3A 4XABA 1W9TA 4BHPA 4FXGB 1PO13 1YJLA 3AL6A 1JUHA 3NNGA 3ROUA 2W5FA 3ENRA 2MEV3 2Y6JA 5AVPA 2J1VA 4WM7A 3KHCA 1YO8A 2R061 1J59A 3HT1A 1W6MB 1GOGA 3RZKA 3MFAA 2LS6A 3WQBA 2E26A 1F5JA 1HRV2 3IN9A 4IGPA 2QQJA 3OBTA 4XJUA 4LR4A 5F32A 5FMDA 5BYNA 4IEUA 4EJRA 2QQNA 3NNJA 3HAGA 4RHV3 3LE0A 2J1SA 4IETA 1DQ6A 3VDDC 1I9RA 2XJRA 5J7MA 2WFF1 2XJTA 3HT2A 4LO6B 2W2IA 4XJAA 3UT0A 1UOJA 1H9WA 4CEYB 1BEV2 2OZJA 2R6QA 2JJ6A 3LIGA 3W58A 1ALYA 1AR81 4UW5A 3DEMA 5GZGA 4K8FA 5FYCA 3WG2A 4ZS3A 1UYZA 2I74A 3I4IA 3K4ZA 4JX0A 3OPTA 4HKWA 4OZXA 1UZVA 4PBPA 3ES4A 1PO12 4AGVA 4CDXB 2YPJA 5IFTA 1YCIA 3JQXA 1Y43B 3N35A 3V0AA 2MEV2 3VBUA 5BNNA 3SCGA 4GJZA 1REDA 5F7UA 4PDWB 5T52A 4RR3B 1Y9QA 4LIVA 2QE3A 1MS0A 1J1LA 4ZY9A 3ZYFA 5ABJA 5HCHA 2A70A 3O1OA 2QKDA 3LWCA 2XBO1 5JOZA 4R9AA 5IAXA 1JOJA 2A6VA 3RGBA 1GZTA 1W3XA 2J1AA 2JIGA 2K2SA 4XC9A 2VNOA 2XLGA 1S2BA 4RHV2 3J7HA 2XKPA 1VPHA 1LECA 2VO5A 1UAIA 3ZFGC 3DXUA 1QGLA 2VZTA 1DIWA 3DYMA 4KGQA 4FAGA 2P6CA 3B94A 4M01A 4J25A 5FZAA 4KBZA 1XPWA 2YFUA 5A3LA 3AMPA 2FCTA 1GP4A 4QGLA 2HLEA 1GOFA 1ZA7A 1UU5A 3ZXDA 1US3A 4P9XA 3ALQA 1W06A 3WR0A 3BN6A 1H8TA 1K3IA 4XUNA 3MIFA 4ZZ8A 3OSDA 5FY4A 3PJYA 1C4RA 4FFGA 2YG0A 3L2YA 4ZHNA 1XU2A 3V0BA 1AR72 5JDBA 2VUAA 1U5ZA 3FE5A 4CU8A 1COV3 1V6JA 5SV8A 5GKAC 2XGXA 4CEYC 2PAKA 3TNQA 1QHDA 1JYTA 2WAAA 5DDJ1 1AL22 4WM7B 5CAZA 2XHKA 2W95A 4IGOA 3DECA 4CDXC 1YIPA 2VTFA 3UESA 4DINB 1YIFA 4FT8A 4KWLA 3DGTA 1RUD1 4LOSA 2QQVA 4QPWA 4KQ7A 3RZZA 4PDWC 2WN3A 4RR3C 2XMLA 1GV9A 1ZBA1 4XCBA 4H3WA 1H6YA 4N43C 3RWNA 1UOGA 1XSRA 2RDSA 4XJWA 3TN93 2YY1A 4G9SB 1WCUA 4OHZA 2X5IA 1MPXA 4Y4YA 3O5SA 1NA1A 1JOBA 2JDNA 1TNRA 2DFCA 1JH5A 2FDIA 1V6OA 2WIIB 3E6BA 4XMIA 3AM2A 1R1A2 1COV2 2VNGA 2VMGA 1MS4A 1SDDB 1IGOA 4CU6A 3FFQA 3ZXKA 1LHVA 1MZEA 4QB2A 3WF3A 3V0AB 3VBUB 4IXLA 2BERA 4KNCA 5BNNB 3HJRA 3PVNA 2B9VA 4C8DA 3CIHA 2WT2A 5BY5A 5SV5A 4JZRA 5ABJB 3ZXLA 3LFIA 4ASMB 1UOFA 2WZR3 5FZDA 5DG2A 4LBOA 3AP6A 4LLOA 2X05A 2E7QA 2JKXA 1YI7A 3DN7A 1POV0 2W94A 4KBBA 4ORFA 5H9PA 3ZFEA 3C3VA 3WY6A 5HV4A 4XYXA 5JI9A 4E4DX 1VMHA 2HWF3 3E5UA 4BYYA 4HN1A 5ANNA 1O3RA 3OBRA 4P5YA 1XBFA 4IE4A 2V5DA 1BVVA 1FPN1 3MW4A 4XJ8A 4ET7A 2VE1A 3GDBA 1UZYA 2SBAA 2WWUA 4U36A 3ZSMA 4CCJA 5T5OA 2A6WA 1HB4A 1US2A 3DYOA 3NJYA 4FO9A 4LBNA 3VB9A 3VKLA 1W8UA 4BE3A 1UY0A 5JCTA 4K21A 4OI1A 1BMV1 2ADEA 2DUOA 3TYJA 2ZHKA 1DP0A 2CL2A 1LOFC 2R043 3W21A 1H8TB 2RR13 3FFZA 1HN1A 3LEGA 1VBC1 1QJX1 4M4PA 4MLOA 5F5QA 5FTTC 4CXYA 3VBSA 3V0BB 1GICA 2GP5A 1VBE1 2FDJA 1HRI2 5LBEA 3WV6A 1SBFA 3IIIA 3QCWA 3N4MA 4XMAA 1Z78A 3BCWA 1SZBA 3J7MA 2VUJA 4JTOA 5F3EA 4IEZA 5AC93 3B69A 3BIWE 2RVAA 3Q9OA 3GF6A 3ES1A 4HVOA 1PHMA 2QQKA 5FLHA 4AEDA 1TME1 1XXNA 5FY9A 3KSCA 4YZ4A 3M1HA 2ZKNA 2P3YA 1G8WA 3N36A 4YYOA 5IYYA 1UPIA 5A7NA 2L9LA 2RG4A 3PVEA 5FJHA 1I5ZA 4CEWA 1OVPA 4LE4A 3A22A 5BNNC 2GN7A 2X29A 3MV01 4ZZ5A 4K40A 2C0ZA 1H1AA 3G7DA 3I7DA 5FPZA 1NZCA 1IPKA 2BGPA 3WF2A 1MQTA 4Y20A 2BJSA 2RR12 1NKGA 2X5IB 2PHTA 1NA1B 3I3QA 4LBLA 4Z2WA 4OUSA 4PIXA 1QOOA 3ABZA 4PI0A 5KHIA 4YGCA 4BDVB 4LK7A 3WZ1A 4O9EA 3VDCA 4EN0A 5FZ9A 1IG3A 1S0FA 4OUMA 1QWRA 1OF4A 2W08A 3K3OA 3PUIA 4LUKA 1LOGA 1VB4A 2HWC1 2WNEA 4HVRA 1CONA 1MEC1 2O0OA 4JHTA 2OX0A 1V6IA 2Y0OA 2CY6A 1DQ0A 1ZRDA 1W2AX 4GD4A 3ZFEB 4DOUA 2VOXA 1STMA 4Y33A 1NY72 3DPRA 4IESA 4LHSA 1AR63 2VOVA 1VAMA 4D69A 1D4M1 1F15A 1O3TA 5IFPA 3EMRA 4HBNA 2DURA 2ZEYA 4ZU4A 1RUG1 4XAAA 3FL7A 1S0CA 5G04L 4WVZA 3MV11 3JBG3 1GNHA 5JOWA 2CWSA 2VVFA 1CAXA 3F2ZA 2NQYA 3ZFFC 1NCQA 1CAVA 5FREA 2WNUC 4COYA 4CRQA 2PN5A 5ACA2 4NROA 5BNPA 4DEQA 2B9UA 3POYA 4NPLA 4C0BA 3TB0A 2BTVC 2LW8A 4QKBA 1N1SA 3K3NA 1NCRA 2A5ZA 3VBSB 3VBFC 1JYCA 2QQWA 4GH4A 4KWJA 2X10A 1W9WA 3B02A 1XSQA 4BXSV 2J1TA 3DF0A 4XJ9A 1AYN2 4AQTA 2OS2A 3KT1A 4W6XA 3C7FA 1IKQA 1NA1C 1ENSA 4EZ4A 1H1IA 2PHDA 3GZTB 3D4KA 3E5QA 5I0DA 4LBQA 5JMCA 4AEDB 1LOAA 4QMAA 1OQEA 1AR62 5F9TA 2OIIA 3CJXA 4PI2A 2ETEA 4AWDA 1MVQA 2BFUL 3LOBA 2EA7A 3LSDA 4LPLA 4XFCA 4CEWB 2D6OX 3HD8B 1ENXA 5JXJA 5A6QA 2JECA 1Q56A 4GB33 4M00A 1JOPA 5LY1A 3HNYM 5E1RA 4PHZA 5J37A 3BYWA 2ZGLA 4YVSC 3BTAA 3AKPA 1MQTB 4Y20B 5J1XA 2P34A 1YFYA 1PGW2 3POBA 4L97A 4XDPA 4M3CE 3MLLA 3ZFEC 1V70A 2CYFA 3CNAA 1DBNA 4B7EA 3JXSA 5EWSA 1PIV3 5DXDA 1OH3A 1W8ZA 4P08A 1RUJ2 4FPCA 1CAUA 1RUF1 1WMEA 1Q8PA 1RXFA 1D4VB 1VR3A 2VQTA 3O1MA 2CGPA 3T30A 2RMU2 1QXPA 2E53A 1F35A 2NMNA 5FY5A 4UW3A 4GB32 2LM3A 1LGNA 4W4ZA 3MDPA 4Y26A 4YRDA 2XJSA 4D6QA 5D2AA 1L7LA 3DPRB 4NHXA 4H55A 3FJSA 2B42B 1AL21 2ZJCA 2Y26A 4MADA 1W39A 1S2KA 1YQCA 4ZONA 3UL2A 1UKGA 1JS9A 5FK7A 2XHNA 2UWCA 5E88A 1XYNA 1NT0A 4NN0A 4AEDC 1S0EA 1PIV2 2J1UA 2HWD1 1X33A 2YPDA 3AXEA 1CAXB 1R083 1NCQB 1CAVB 5BNPB 4NMIA 3S6PA 3M3IA 4CU7A 1RUI3 3RG0A 3UGGA 3ZMNA 5DAVA 4AVAA 3GHNA 4JTNA 1NCRB 2EF6A 5IUQA 5I0TA 4GH4B 1ZVFA 3J8F1 4GMP3 4YZ1A 2UYAA 4XACA 1XU1A 4A7ZA 1MQTC 5A7SA 1XJAA 1SBDA 2V4VA 2AEZA 2VXJA 3ETQA 1R1A1 4MUVA 1NZIA 4OFGA 5DAQA 4AFAA 1FATA 5FOBB 2OUHA 4FPFA 1JI6A 4LBQB 1WZXA 1ZZCA 5FZEA 4CCNA 3S57A 3ZSKA 2HWE1 1JYWA 1PM7A 3B3QE 5F3IA 4FAHA 1K45A 4QB6A 1TMF3 4D0QA 2IVIB 4E27A 2W9XA 2R073 1JZ7A 2WBKA 3H1MA 2WSVA 4IEOA 5FYHA 2WQZC 3CKHA 1R082 1Q43A 5D1IA 3GNEA 3U14A 4CDWC 3MHZA 5L9VA 3U37A 1VAKA 4XF4A 1RJ8A 4BQ3A 1OOPA 4JKLA 2XL9A 3USSA 3BOWA 3H7JA 4TSVA 4GKYA 1OFNA 2ZGQA 1M06G 3ZXEA 3DPRC 5K4LA 4R9CA 1U0AA 1OA4A 1OLMA 5FPLA 4EWDA 1H0BA 2GDFA 3WDVA 4AOCA 2HKXA 3ZN4A 2JDAA 5FZ3A 1NQDA 5A1LA 1YQ6A 2BZDA 4HZFA 2R0HA 1CAUB 4OHXA 1ENRA 2W91A 2EXJA 1EUUA 2BDRA 2YFZA 4Q4W2 1NCQC 2Z4FA 4QQ2A 5BNPC 1RGSA 2C26A 5F6KA 1WGPA 2OUJA 1N3PA 1HRI1 2VMCA 4QDQA 1HV1A 3RI8A 3BPZA 4OHWA 4JAAA 1LRHA 2D43A 4ARYA 2LUWA 4B4PA 4GH4C 1V6NA 2OW4A 3CF6E 1ULEA 3M3CA 3OB8A 1ULFA 3FHQA 2WZ8A 5KHKA 1JU3A 5F1RA 1OUXA 1PVC1 2GNBA 1UMHA 4MSVA 3VBHA 5B2GB 1S2EA 4PF1A 4XUOA 3T4VA 2Q0AA 4I0AA 4IE7A 3OUIA 4F8AA 1RMU1 2YGMA 4HSJA 1GWMA 5BNOA 2AUYA 2DYCA 2XVGA 1YUDA 4M3CA 3UJOA 4BH9A 3T0DA 1UY4A 5CFDC 1UU6A 1K42A 3O1PA 2QJVA 2AACA 4BIFA 4FPHA 4IERA 4UFMA 2VNRA 1V9U3 2P4EA 3M4FA 4MXVA 3CMGA 1LEDA 2UY9A 3IBMA 4YPJA 1ND3A 2R062 5LATA 3W5NA 1N3OA 1G9BA 1ST8A 1H4GA 1FOD1 2BRTA 5JOXA 2I2SA 3O1UA 2XBO3 1RUNA 5FZHA 2B39A 1AYM1 4KGGA 2CNAA 1L7QA 4AI1A 2EAAA 5CVRA 4CCCA 1U12A 1SCRA 3KF3A 1F31A 3T1MA 2RS12 5FMOS 2JD9A 2VECA 4FPEA 4QPYA 4XJZA 5CIRA 4CDQC 2WFF2 2YU2A 2ZPXA 5IVYA 4YFZA 4I02A 1VE0A 4LXLA 2DVFA 1OOPB 1VBB3 4LOTA 4Q0VA 4WZFA 1V6LA 2JDMA 2FDKA 1FAYA 3B00A 1CZVA 1AR82 3T2PA 4AE2A 4DXTA 3W59A 3WNMA 3HEIA 3SISA 4X8PA 1W0OA 4KMQA 3E6CC 1G9CA 2ZEWA 3KD4A 3LIHA 2XJVA 1G9DA 4RGKA 1E5IA 1C57A 3N7KA 2XBO2 3AZVA 4XEZA 2ZA9A 1H6XA 2ORXA 5FP8A 3ZIXA 5FZCA 1J84A 2O14A 4P00B 1LOEA 2QQUA 3I54A 4NRMA 1PZ7A 3ON7A 5FXVA 3WDTA 1AYN1 5DDJ3 1DG6A 1KEXA 2JB4A 3LZZA 3TNPB 1BBT1 3R0RA 4OUEA 5A3MA 1DQ1A 5FZ6A 1CPNA 4V1PA 3JD73 2C24A 4FOYA 4NHYA 3VBHB 1RUD3 1HJGA 1OKQA 3V65A 4JRAA 5BUVA 1RYYA 2JDYA 3HN3A 4TN7A 3D5OA 1ZBA3 3IWZA 1POV1 5I0UA 1A3KA 4RSUA 3CLPA 4CZSA 4ZKTB 1JHJA 5BNOB 4YW5A 4M3CB 3WSOA 3RYPA 1W28A 1RUC2 4RA0A 3ZSJA 2WS92 1Q8QA 2CDOA 2O1QA 2CAUA 2FD8A 3E1F1 4R4XA 5J36A 5FZGA 1LENA 1OOPC 1HQNA 2C6SA 4YWAA 3AKRA 1JZ6A 1DGLA 2GNDA 5DDJ2 4EYUA 1REEA 1OPOA 1ND3B 3WG4A 4YG6A 3ZPOA 4AL9A 1BCXA 1XB9A 4KI5M 1HXS1 2CHHA 2WDBA 4K9SA 2DTWA 3LOIA 4U2AA 5FY1A 3VDDA 3VZOA 3H8RA 1JTZX 1XYOA 2A3YA 1ZBA2 4RN5A 3RPQA 1QH6A 2VUDA 5HV0A 1ZM1A 3VL9A 4LNVA 3EHKA 1S0BA 4XFBA 5I8SA 3WW4A 1YI9A 5FY7A 1Z7S1 3MPBA 5EP9A 3KHBA 1FPN3 4UXAA 5J98B 1V0AA 1W8FA 2G9GA 2X09A 4AFBA 1A78A 1A34A 3SEPA 3J7NA 1W6NA 4CTEA 3TEYA 2HBTA 4CPBA 1H2MA 4J1XA 1XC6A 1MZFA 2OXBA 3J9SA 4HKOA 1W8TA 2JE9A 1CN1A 4DFSA 2BGOA 3O1RA 2ZGRA 3QACA 3UGHA 2XUMA 3VBHC 1SLLA 1ZX5A 1UXZA 1VLNA 2ZX0A 1CX1A 3DV8A 1S1AA 2VMFA 2BW8A 4CA9A 5EJZB 1Q3EA 2A3XA 3TWIA 3OPZA 4B8EA 1PO21 3UGFA 4Z8BA 1QF3A 3NKTA 2YB7A 3TBDA 2I07B 4RQPA 3WQ1A 5BNOC 2WQ4A 4Q4Y2 3S5AA 3S7IA 4NIAA 2PHWA 3E5XA 5KHJA 5EXOA 2JDPA 5C5UA 4LIUA 2DV9A 2F6BA 1TME3 1UW8A 4DY5A 4CSWA 5I8TA 1LNSA 3NAPC 3SCHA 3K4DA 3P5BA 1ND3C 3M2MA 1OVSA 4DS0A 1NYWA 1YJKA 4D6RA 1BMV2 1MVEA 1S55A 4XQ4A 2RS53 3VHPA 5I91A 3QH7A 3AP7A 5FP4A 4CPBD 3TEZA 1PK6A 1QJX2 1VBC2 2ATFA 4KWUA 1VBA1 1VBE2 4DXZA 2GP3A 1TG7A 3T2QA 3POSA 1AR93 5DN2A 1SLTA 2HEYF 5K0UC 1KS4A 5ISLA 1WMFA 2IFWA 1JMUB 2DUQA 3H1WA 5CU1A 3RMYA 4FPJA 1ZREA 1TME2 4IEVA 1QJZA 1O8SA 2HWC3 1Y3TA 1MEC3 1D2SA 1RXGA 3S5QA 3VDDB 1J83A 4E2QA 4N43A 4OVEA 5KXCA 1SG3A 2Q8EA 2BEOA 1GSLA 1NLSA 5LEJA 4YW2A 1X50A 3K77A 2FQPA 3C7OA 3AMHA 4ITCA 2ADDA 5FMCA 5H9SA 4Q1PA 2JDHA 1D4M3 4MH0E 4DUVA 1CWPA 1RUG3 2VU9A 4NPRA 1HIXA 3U4XA 3LSEA 3PJQA 1HRV3 5FKBA 1W6NB 4QXBA 5KC5A 4Q4V2 3ZDVA 1UY2A 4EWEA 3CHXA 3VZJA 4A45A 1ULPA 3H8UA 5A6ZA 4JDMA 2WWSA 3VL8A 4NIGA 4UWDA 2FMDA 4BQWA 1HV0A 2OPKA 2HWC2 3T09A 2HYKA 1BEV3 3NWKA 2AZ5A 3THTA 3FWEA 2HJIA 1QMJA 1G9FA 1D0GA 1CESA 2CV6A 4RQPB 1UPSA 3A21A 3E6DA 1E5RA 2ZZJA 1FMD1 5A3NA 3V56A 2QQLA 4LLFA 3WXPA 3I2KA 5CKMA 4K20A 5DZFA 1H2KA 1D4M2 4NJ4A 4BQ2A 1JZ2A 4XVHA 1RUG2 1SLAA 3FLTA 4HETA 3LDKA 4PLNA 5FOJB 1N1YA 1LOFA 2NMOA 4XQDA 4KG8A 5GZDA 2Y6HA 1H30A 3OG2A 2RS11 1NXMA 4E4SA 5C33A 2Q8OA 1PX3A 4QB1A 4LBKA 3JQWA 1PK6B 3T0AA 3OBZA 4NRPA 2ZZQA 5ERLA 4AFDA 2W47A 3RS6A 1NAEA 5FZ0A 3BVCA 3ETPA 5JXHA 4I0WB 1UWWA 3D6EA 3Q8EA 1JZ8A 4QU2A 5FYVA 1DGWX 1W6PA 1WD3A 2PTMA 2Y6KA 5LBFA 2B7YA 4M0HA 5F2WA 5FZMA 3U07A 1C3HA 2ZHMA 2R32A 3F95A 4Y24A 4JHZA 1W8OA 4DO0A 1RB8G 2G9ZA 4FVVA 3KGLA 4TXWA 4LMFA 3WHTA 4OZOA 5K8SA 1AR73 2NLRA 3HNMA 4N43B 4P9GA 5GZFA 5JIUA 4Q4X1 1YXWA 2CSGA 3WF0A 3THPA 2GALA 1EV11 4OHVA 2VZVA 5EJ1B 1AL23 3AB0A 4MV2A 4YM0A 4LEJA 5F2SA 3WF1A 1W2OA 3AKQA 1LTEA 4RQPC 5FY8A 3ZXAC 1CGPA 2VW0A 1LODA 3I49A 1OURA 2VBBA 2HWD3 2PA7A 1W3VA 2WABA 3A0NA 4YG0A 5C3SA 3H8XA 3VD7A 3ZIWA 3IDEA 5C6CA 3R05A 1RUF2 3QOPA 4RD7A 4GQ7A 1LR5A 3J8F3 3ZSEA 4QHOA 1RUC1 4Y5Z0 2WS91 2GMEA 4LT5A 1PK6C 1R1A3 2HBUA 4JGYA 1HW5A 4BZ4A 2C9KA 1J58A 1OKOA 3GJBA 4AI0A 4EQVA 5CNAA 2HWE3 1S0JA 2ZAHA 4XHXA 2VCCA 3I2OA 1OHFA 3ZFFA 2O8OA 2ARBA 2WNUA 1W8WA 5I8YA 1ZA4A 2HWD2 5L7OA 2W1WA 3BB6A 3OY8A 2P2KA 3VBFA 2RDQA 3KV9A 4GAZA 4V2WA 1VRH2 4QX3A 1EP0A 3AMNA 3MBWA 3J8F2 4BCUA 3H0OA 2Y33A 4Y5SA 5DAXA 2VQUA 3KMHA 2Y64A 2BPA2 2A71A 4LO8A 2J42A 3SH5A 3U75A 1W6PB 2WINB 4B4RA 3LKJA 3TRSB 5HBAA 3SNMA 3N9NA 1POQA 1Y7BA 3I3EA 1SQ4A 4EN8B 4EROA 3AKSA 3MIGA 1W99A 2HWE2 3OGSA 4DY3A 3PUHA 2R30A 4EN9B 1QQP1 4ES8A 2GU9A 1HRI3 1X82A 3OBAA 4QDSA 1DHKB 1GWKA 1Y9MA 2VZRA 2E9QA 2VC9A 4I30A 1UF2C 2WNVC 2GNTA 3AK0A 3IT8A 4OI4A 3SLIA 1KJLA 2UWAA 4Q4Y1 3FHAA 1YRZA 3APBA 5J09A 4IDZA 2BNNA 3DUIA 1PVC3 1LCLA 1FV3A 1G86A 1RHI1 2ZTNA 1O7FA 4QKDA 2RJ2A 4WM8A 3ZPYA 1ENQA 3Q8AA 5DG1A 3A7QA 3BKZA 2W0XA 3AMMA 2DCJA 1RUH1 4CP2A 4O7XA 2XJPA 2DU1A 3V64A 1X36A 3RQ0A 1YNAA 3WP6A 1C8M1 1TVGA 5T55A 1I5PA 4HSLA 1K12A 2F4LA 1DQ2A 5FZ8A 4LO7A 2RS32 3T2OA 1AL0G 4JGYB 4COUA 1Z0HA 4YW1A 3R4SA 2VULA 4L99A 3ZYBA 1F8VA 1UOBA 2EIBA 3SCFA 1IS6A 5A32A 1FOD3 1PVC2 4YM2A 3PVOA 3ZFFB 4A4AA 4ES9A 4LULA 2WNUB 4W6WA 2IXLA 4O65A 5FPUA 3UYJA 2IWGB 2QQIA 3AVSA 4COWA 1XYPA 5L7OB 4PQ9A 1WLDA 3OY8B 3ACFA 1IG0A 3VBFB 3VBRA 2VD7A 3LFMA 1LJ7A 1RMU2 4ZXEA 2P5BA 5A3TA 1RINA 1WBFA 3K2OA 1CAWA 2P37A 3BUCA 5LK5A 3IIAA 5E89A 4JQRA 5FYSA 5D21A 5LZ6A 1DFQA 1UN1A 1GLHA 5L36A 1JUIA 3H3ZA 4Q4V1 1LGCA 5DUXA 1E5HA 3WNLA 3HQRA 3L9JT 5ACA3 1RUOA 3C8XA 1FOD2 4LA2A 5CB7A 3MLJA 4LBJA 3FHIB 1AYM2 1XE8A 3LB9A 4KG0A 4Y1VA 4CDWA 4QX7A 4FCAA 4Z2AA 2GN3A 4YVSB 1UKRA 3HIFA 3ZYRA 1PX4A 1LGBA 3ZYJB 1UQXA 1AYN3 4UT5A 3N9OA 2OYZA 1RVF2 5K7PA 1BBT3 3LAGA 1CZTA 5HI0A 3PLQA 4JGYC 2QUOA 4JQTA 2HWB1 1WCDJ 2JIJA 5LCWL 2RM21 4WM8B 1WUVA 1VALA 1WW4A 2YROA 3LEKA 1W8NA 4XZUG 3I3DA 5C71A 4UF0A 5FXXA 1POV3 5C3OA 1Y9GA 2ZGKA 1A8MA 1Q5OA 5BPXA 3AL5A 2GAUA 1IPJA 4QPGA 5FYYA 2WQ8A 1YEWA 5L7OC 5I0RA 2PYTA 1WCKA 3NKGA 4FXKB 4FOWA 5CADA 1VIWB 2DBIA 4O9GA 1NG0A 4Q0QA 4X8NA 2FMYA 1PGL1 3FMGA 4QQOA 4PIZA 2ORZA 1KXGA 2CWMA 2WUHA 5IVVA 2WO7A 3ZR6A 3UKNA 5BV6A 1BBT2 3OPWA 5A32B 1RUJ3 2QTWB 5F39A 5T5JA 1P8JA 1LHOA 4Q29A 1YC61 2FHRA 2Y0IA 5F3CA 1O3SA 4AHYA 2ZOEB 4AHZA 1SACA 3WNOA 4XOGA 2RMU3 3AP4A 4L0PA 3O14A 3VBRB 5IVJA 5CFDA 4JKKA 4QX0A 1E5SA 1U5XA 1TE1B 2QCSB 4K1YA 5E16A 4DZGA 4MX3A 1CAWB 2VOKA 5A7PA 2DFBA 2VBDA 2VZUA 3MLKA 1V6MA 4OLLA 4WV8A 3BGAA 4ARXA 4YGDA 2P3KA 3AZYA 5FZKA 3INAA 1QJY1 2B46X 3M7AA 4XHBA 3UK9A 1OUSA 3D3AA 3OJBA 5FUNA 3WT3A 2J1RA 3ZN5A 1DQ5A 3PVBB 1WLWA 4WM8C 1ACCA 4OMDA 2D6KA 1HXS2 2A6YA 2XPJA 1QXRA 2XVLA 4CDWB 4CDQA 5C8WA 2JEMA 4LBMA 4Q1RA 5C9AA 4FTSA 2FBEA 2ZGUA 1JHNA 2ZKLA 3POGA 5DZGA 2FZ2A 2FCVA 1ZRCA 3NO8A 1PZ9A 4XIKA 4CXXA 4PJYA 1KFUL 4CCEA 4HKLA 2MHFA 4S2DA 1Z7S2 4YW4A 4QWNA 3THCA 1F4HA 5F5AA 2BGCA 3PU8A 3VBOC 4PIYA 2MPFA 4HFSA 2RJLA 2PHRA 5FQ0A 1XNDA 4P02B 2BU9A 4META 3OUJA 2DCZA 3FUOA 4AF9A 4UF0B 2NYYA 4W6YA 3S30A 3VDAA 5JR7B 1U5IA 3O12A 2PFWA 5C3QA 5FWJA 5JOYA 1K5MC 1O4YA 5CISA 4AG4A 4QPGB 4GKXA 5J48A 4N53C 2Q1FA 4MGZE 3OGVA 1VRH1 1XNCA 2V72A 4ISQA 1VBA3 2ZMKA 3T08A 5EV7A 1PO22 3VBRC 3LF7A 4FSJA 2FCUA 4H7MA 4QKNA 1ZRFA 4CYDA 3LDRA 1NLRA 2VZ1A 3RZJA 3OGJA 4AVCA 1WA4A 1JODA 1JBCA 2X53S 2JWPA 3B93A 3KVAA 4PT6A 1VB2A 3NRUA 2VBPA 1OLQA 2WT1A 4L8QA 4Q4W3 2IZWA 5IWFA 3JB4C 1HX6A 1T6GC 2OVUA 4ASLA 4Y1UA 4B7KA 4DIQA 1RUE2 2K9ZA 3ZOIA 4S2FA 5CFDB 2G9FA 1WW5A 2WLPA 1L7RA 3AP5A 3FUQA 4A41A 3MIHA 3WHUA 5FLJA 4FPYA 1WW7A 2PHFA 3D0SA 1VBA2 4CDUA 1BVP1 1V00A 1F2NA 4SLIA 2VVDA 3H7YA 3AVRA 3O0VA 1GYKA 3G6JB 3HNBM 3Q8BA 3A4UA 1I1EA 1SFYA 4M0NA 4C90A 1I6XA 4YZ5A 2IXKA 4QQHA 2ZX3A 4MGTA 3AZZA 3C7HA 3HBKA 2WO3A 4YZ2A 3UNPA 1H2NA 4TWTA 2FDGA 4GALA 3VHOA 3OCPA 2WLQA 3EBRA 4CDQB 4NPMA 3RRDA 4F83A 5C9AB 4Z07A 1OD3A 4HT1T 4QPGC 1O3QA 2BQPA 2KA3A 2RS31 1SDWA 1AUYA 1FMD3 3TN91 4AI8A 4LORA 3LQCA 3CJIA 4MO3M 2IXHA 4G4FA 2R063 4NHKA 5IK4A 5FO8B 5FQ0B 1EAH2 1XNAA 4INDA 5E6HA 1O8PA 1J3QA 2GC0A 4J1WA 4Y1YA 3PURA 1OPMA 2RS13 2WFF3 2R0FA 1F9KA 2AH2A 2Z69A 3GBGA 4LKDA 4EN7B 2VCBA 4GWNA 4V2VA 3K46A 4D8MA 3TOJA 1AXKA 4HANA 1K5JA 1AR83 2PHLA 5IT6A 5FK8A 4FPOB 1XQNA 1QOTA 1UMIA 4GXLA 5DMYA 4WVWA 4IUGA 2HWF1 4D7YA 1FMD2 1CR7A 3NAPA 1SFPA 4K1ZA 4A2UA 2P1BA 3MF9A 4IQPA 4XF1A 4EE2A 2JDZA 4A7KA 2BWAA 4Z1VA 2VOWA 4BK5A 4NR1A 2UURA 4N8MA 4LO4B 4XF3A 3OEAA 1BYHA 5EYXA 2VTXA 1A8DA 1KDKA 4CUBA 1DDLA 4Q4X3 3SC7X 2R041 4UW6A 1OD5A 1URXA 1RVF1 1EUTA 4BJ0A 5C9AC 1HN0A 2CU5A 1W05A 2VGDA 1PMIA 4RYDA 4CDUB 4ASKA 5K0UA 2Z79A 3L2HA 4K6BA 4XFFA 5A33A 5HCAA 4QX1A 5LK7B 5IVFA 5FXWA 4UBHA 3B5LB 3WG1A 4AZZA 4QU1A 5FYTA 1IQDC 3KCXA 2D3PA 2WZPP 1O4TA 1SCSA 4Q0PA 4XAEA 2A73B 2ZGOA 2QFEA 3WLUA 2Q8CA 4QX8A 3RZLA 1X8MA 1AX1A 1BZWA 1G6NA 4H7LA 2DCYA 5FY0A 4BMEA 3ACHA 3EXUA 1RUC3 2TEPA 4QPIC 2WS93 3ACLA 3WNXA 4FBFA 5FO9B 1OBNA 2RV9A 4Y1XA 2ZAAA 2Q8DA 1UXXX 3VZKA 1JYNA 2XQXA 1TZOA 4Q4X2 1JN2P 1O91A 1KDMA 2ET7A 2W3JA 1EV12 1D2QA 5H9RA 3U4SA 3KT4A 5CFCC 4URAA 3CJIB 1WMDA 3NL1A 4NE9A 3FN9A 3WDWA 3VLBB 1JW6A 2JG9A 3UKVA 1OMIA 3ZYGA 3HPNA 1IS4A 1NX9A 4QM8A 3WDUA 5FV3A 2YZ4A 5LEKA 4YVWC 3ACIA 3BI3A 2BUKA 5FZ1A 2AC1A 3NV1A 1ZZ6A 2J1EA 2ZHLA 3IPVA 3K75B 3KF5A 4J6GA 4UYBA 2XQRA 4CP1A 2BOIA 2EIGA 4B29A 3QH6A 1DU3D 2W52A 4GA9A 1CJPA 2ZGNA 3AYAA 1EY2A 1W0PA 2EVXA 4GIQA 1SMVA 1HQLA 4BISA 3WD5A 1O5LA 1JYXA 3NJVA 1G7YA 2KXLA 2A3WA 3R6SA 4CDUC 5T5LA 5A70A 3NAPB 4D6SA 1UYXA 3VKNA 4MYEA 3AZXA 3RZHA 5C7GA 4LKSA 4Q26A 1ASJ1 4Z82A 3BPSA 3JBG1 4FQZA 3MZHA 3KZ4C 4BPZA 4FTEA 2YDEA 2AGSA 1F4AA 5CZKA 4YGBA 1ZBE1 3CBNA 2OKXA 4IGQA 1UIKA 4Q4Y3 4TTGA 4YVSA 1ZZBA 3S7EA 1S4CA 2A6ZA 3NVCA 4NAOA 4YSFA 1DGRN 2GC1A 3HBZA 4FPKA 3I2GA 4AQSA 4N9HA 5K0UB 1AJKA 3M3EA 2B4KA 2ZGPA 3PU3A 4IV3A 3MIDA 4I3GA 4RS5A 4XFHA 3QD6A 5A33B 2OPWA 3CJIC 5FCCA 5LA1A 5C5TA 1IHMA 1BHGA 3M3QA 2TBVA 4UAPA 4Q8KA 2XH6A 3KM5A 2XWBB 3IZOA 2BVVA 4HLTA 2VCAA 3THDA 1RUH3 1XOYA 2BFUS 2Y34A 4FTBA 3S0MA 1YQ2A 1C8M3 1HB2A 1JXNA 1QJX3 1VBC3 2VOTA 2D7FA 2Y6FA 3R4UA 4OYUA 5GJ6A 4E4ZA 1QQP2 4QDRA 1VBE3 1BK0A 5EHDA 5LRRA 4AAXA 4GULA 3KS7A 1MS8A 2TNFA 5GM0A 4WVMA 4Z92B 4A3XA 2W39A 5FUIA 1RJ7A 3AFKA 4EZHA 1LESA 1OC1A 2JG9B 2VQ0A 1RHI2 1IQAA 2JICA 1ND2C 4XBNA 2G1MA 2IUWA 1WCQA 4JKMA 3H50A 4AEMA 2FDHA 1WCSA 1APNA 4P9IA 4YZ3A 2B5HA 4FFHA 1ULOA 4M3CF 4DRVA 1S0DA 4A7YA 1RUE1 1W2UA 1W9YA 1RUH2 3IPVB 3OD4A 3ZDSA 5JPNB 3LA3A 1BQPA 4K7JA 4RFRB 1C8M2 3J7LA 2RDRA 2C9AA 3D8CA 4BQ5A 3PMSA 1TQ5A 4I01A 5KHHA 1S0IA 4E9KA 3VD9A 1LU2A 3KCYA 1OA2A 2XJUA 2XKOA 2ZBJA 2W87A 2BBAA 2BV4A 3ZKYA 4LQRA 5JVVA 4Q4V3 4IV1C 1W04A 1MZ5A 2HH9A 3ACGA 4P14A 1CX4A 4NOTA 4UOJA 5A7OA 3JZVA 3OUHA 3RJRA 1SLCA 3LCPA 4OI0A 1UNBA 4JGZA 3ZXGA 2PLV1 2VG9A 1GQPA 3N7LA 4O61A 5T54A 1ZRRA 4ISRA 3TEWA 3BALA 3T2TA 1PMHX 4XUQA 4NVPA 3WQ0A 4NWVA 1BXHA 4BQXA 4H2AA 1KFXL 1AZDA 5IVEA 3Q8FA 2RE9A 5L73A 5FDBA 1MS5A 1MR5A 1ZZ9A 3HOBA 4PBOA 2ARAA 1QNYA 3WP4A 1AX2A 2W1SA 4D94A 1ODMA 1YYNA 2A7AA 2H6BA 4IV3B 5DQ0A 2HWB3 3HQXA 4RS5B 1N3QA 1SPPA 4C1WA 1EAH1 1QIQA 1QXJA 3J26N 2XLFA 4IE5A 3SEEA 3VV1A 2JG9C 4NIHA 1H8VA 3BTXA 1RL3A 2QDRA 2VR4A 4XF0A 3GGLA 2EICA 2VH9A 3A0KA 1LHNA 4HPKA 3ZKUA 1TMF1 3K51A 4E8CA 4XFGA 4AVTA 5JSOA 1FI2A 2R071 2WNVA 3W9AA 2K46A 2LRPA 4LJHA 2VAUA 3N9MA 4Q0SA 2EAKA 2YBKA 4WVMB 5L9RA 1KGYA 5JPMB 3NV3A 4G3YC 3H1YA 2BNOA 4XBQA 2OA2A 5DABA 3LEMA 2YC0A 2ZGSA 2HWB2 4JV4A 1BLZA 2RM22 3B9IA 3B01A 2E63A 3LPFA 3AJYA 1J1TA 3N7JA 4FFIA 1T6BX 3GALA 3JB8A 2JDKA 2ZABA 1VMJA 2VMDA 3FLPA 4CUGA 2SLIA 2ARXA 4FOVA 2E31A 4LITA 5L19A 1MS9A 4NRQA 4XIOA 5HCBA 4ZPIA 2JG8C 5HCFA 4AEKA 4GWIA 2ZMNA 5AFBA 5LA0A 1ULGA 3NV2A 1QJY3 3IM0A 1PGL2 2YBPA 4LK6A 4MGKE 1TNFA 4YARA 2LALA 2VZSA 1JZ5A 1SHWB 4IV3C 5LBBA 4RS5C 4JCKA 4NHMA 1ZZ8A 4YW7A 2D5FA 2WA3A 1RUF3 4JGZB 3ZR5A 3W20A 1Q8OA 3ZM8A 4MG2A 2WAOA 3GXUA 4CCOA 1CD3G 1UU4A 2J22A 3I59A 4L9BA 2WL1A 3PUAA 3IDAA 4AK3A 4XETA 4JVAA 4BM8A 2B45X 4YW3A 4E4HA 1LEMA 3PL0A 4YM1A 3GZEA 2R49A 3PTRB 1ZRIA 4B3NA 3SKVA 3ME2A 2YGLA 5KBFA 2GMPA 4EWAA 2YYOA 1DYOA 4HN0A 4KL1A 2EXKA 4URTA 1SPPB 1UY1A 4ATEA 3POEA 1QJY2 1V9U1 1B35C 4QHBA 1LHUA 2ZX2A 4XTPA 4TLGA 1F5FA 1W8HA 3M3OA 2A1XA 1X9TA 1WD4A 5FYIA 4HPKB 4MVTA 1VRH3 5A3PA 3RVHA 2WA4A 4MGYE 3MUY1 4LTAA 1PGSA 4UFLA 3T4HB 3DXTA 5F37A 2XL7A 2AREA 1WKYA 2WNVB 2R16A 3VHRA 3NV4A 5FZ7A 4E2SA 3C2UA 2AENA 2Q5TA 5FKCA 2NM1A 5A80A 3VZMA 1PM4A 1QJEA 5LB6A 1OA3A 2JE7A 1GU3A 1OT5A 2H0VA 5C8CC 3MYXA 1VBB1 3VD4A 3U78A 2IFRA 1JZ3A 2GSYA 3DKQA 3LDBA 1QH7A 3H42B 3U10A 2DUPA 3BODA 4C1XA 5IVCA 4QHZA 5CYYA 1CZSA 4WZCA 2F4PA 5FBJA 1C28A 3IAPA 2DTYA 1DQ4A 4XZPA 3ECQA 2E33A 2H6CA 3ZSLA 2VXRA 4JGZC 4R8HA 3RDIA 5IHRA 1J3PA 1IOAA 1VBD1 5F8PA 4HK8A 5FPAA 5FPBA 1U5YA 1QNWA 2JENA 2ID4A 2OZ6A 4GJYA 5BXXA 2JB8A 3WOGA 4CUAA 5JZGA 5FYZA 2NN8A 5FJKA 3KQ4B 1JYVA 3I2FA 1WLCA 1DGWA 2P17A 5LASA 1ULCA 4MOAA 4XF9A 2Z2SB 5I0SA 4XBLA 4X6QB 1W2TA 1W03A 1OF3A 1H2LA 1ODNA 1O6UA 1ULDA 3LPGA 2J7MA 4ZU7A 4L11A 3JD71 1HKDA 2YC4A 2WZEA 1PMJX 1YFWA 2WYFA 3BTYA 1GNYA 4AGGA 4JRLA 4CU9A 5FZLA 2AYHA 4RL7A 3TAYA 1X7NA 3I59B 1Q8VA 1GWLA 4Y22A 1WWYA 3ILFA 3BIEA 2RS33 5JSPA 1JU4A 1CJDA 4XURA 1QDOA 1R091 2VM9A 5FPVA 4N7UA 4JC1A 5F3GA 4AI2A 3OD0A 2NP0A 1QY4A 1YFXA 2JX9A 2JXAA 2XWJB 1YHFA 4AW7A 5FRAA 3ZYIB 2CAVA 2GC2A 3FLRA 3WINE 3WW1A 3KV4A 2W1UA 5CKQA 1AF9A 3MIEA 5EJ3A 5CBLA 3B9CA 3CL1A 4H14A 1D7PM 2TUNA 4CUCA 4DXSA 2Y60A 1H4HA 3AJZA 4P9YA 5G05L 4PQQA 3I2IA 3IDCB 3DYPA 1KRIA 1W6QA 3WEZA 1XNKA 2E32A 3H8OA 4IW3A 1RMU3 1QKQA 2XR4A 4OQ8A 2V73A 2ZX1A 4R4ZA 3OEBA 2XONA 2VTXJ 4K8RB 3HR9A 3HQUA 3LA2A 5DPNA 3NNFA 3VBOA 4HVQA 5FO7B 3MI8A 4DQAA 4P5HA 1NQJA 3TN92 4AHXA 2QQOA 3AKTA 5FAXA 4F7ZA 1GOHA 3PIJA 5DAWA 5A7WA 3O0WA 1AJOA 2ZEZA 1OLRA 4OI2A 5FFOC 5FMBA 3ZVXA 1DGRA 4WM7C 5B4XA 4TLFA 4CXWA 4LKFA 5IVBA 1UIJA 1AYM3 1L3JA 2WNOA 1SBEA 4OQ9A 1K5MA 1UX6A 4IEYA 4XFAA 5HPOA 4A44A 4N53A 2XDVA 4XXAA 2MNGA 4QKFA 5FIXA 5FZFA 2Z42A 3RYRA 2V5YA 4YFWA 3VZLA 5JMOA 2YUEA 5T5PA 4JDNA 1RVF3 2G19A 3ZX7A 1G9AA 5FMOL 5JZGB 1W9FA 3WDYA 2WZR2 1LU1A 5FBZA 4IEWA 2DVAA 3ILNA 1IS3A 4I09A 3AZWA 3BOPA 1ZYBA 2E6VA 2DBNA 2HWF2 2PMWB 2UU8A 5F5CA 1UCXA 3KV5A 1FX5A 4QD2A 3AYDA 4PLMA 3LA7A 2QZ2A 2IXJA 3VBUC 4DMIA 4IEXA 3WP3A 4KWKA 4HG6B 4BU2A 3BU7A 5ABJC 4LHKA 1QU0A 4RGAA 4Y22B 4FPLA 3ZN6A 4DPNA 5CA6A 1IS5A 2RS51 3MF6A 2DCTA 2D6PA 4QM9A 2R042 5LA9A 4AHWA 2EXHA 4AQ2A 5K9YA 3MGUA 2ZEXA 4UFHA 1ONAA 3B7MA 1UD1A 4IEPA 1FT9A 2D3RA 2XB6C 2PXJA 2YV8A 4MGIE 4R9BA 3H3UA 2QZ3A 4QQPA 5DUVA 4D3WA 5GLWA 1PZ8A 3K4AA 2A6XA 1QJU1 2XJQA 3POIA 4K3UA 1CPMA 1AR91 4BB3A 2WJSA 4A6OA 5AC92 3AXDA 2HEVF 4TZDA 1CQ9A 3AP9A 1JZ4A 2BYVE 4YW6A 1QDCA 2V09A 3OOXA 3POWA 3LD8A 1W6QB 1QEXA 4P9WA 3QLQA 5KHGA 3D0JA 3GHMA 2ZGMA 3PUQA 3RZGA 2CGNA 3GZAA 3OGRA 4LUMA 3R4DB 1PNGA 4MGSA 3UV9A 1MZ6A 1H8TC 2XOMA 2XVKA 3EB7A 3O7OA 4AYUA 5LRSA 3KCCA 1YWKA 2E7AA 4FOQA 4UFJA 3T3YA 3POJA 3VBOB 5JZGC 1CIWA 2GNMA 3EO6A 5A7QA 1GZCA 4ATFA 4MHUA 5JI7A 4CCMA 1OH4A 1QJFA 4S2HA 1IZ3A 2FZ1A 1O4ZA 3DKWA 2O8QA 4GMP0 5A7WB 2VZPA 2WN2A 5H9QA 1ASJ3 4D7TA 4E2GA 1OQDA 3WF4A 4GWJA 1HRV1 4SBVA 1HXS3 1UO9A 2VUCA 3MW3A 4XW3A 4CP0A 2RDNA 3WUDA 1OLME 1K5MB 2Y38A 3MO4A 5T3NA 4AAPA 5KXEA 1DLCA 3GBWA 4N53B 2R7EB 1ZBE3 3KB5A 2C4XA 1W0NA 4XILA 3WP5A 3RI9A 1E57A 1GP6A 1CIYA 5JLVA 4N7IA 4DUWA 2Z5WA 3ORJA 4HONA 3P6BA 4P9JA 3WVJA 1BEV1 1Z7S3 2YMZA 4C91A 4ZU5A 3IB3A 4AI3A 4DXRA 2VW1A 4QXCA 5EYYA 4RGGA 2D6MA 5JSRA 3POFA 5FP3A 2CTVA 2X5IC 1VJ2A 1BKZA 1YLLA 4XCAA 3U1XA 1R64A 2BBVA 2ZCWA 1O5UA 3GM8A 1PO11 2A75A 2DU0A 3CU7A 3SHRA 1REFA 4BQ1A 1KJRA 2VZQA 4QX5A 4L92A 3URFA 2MEV1 4CP9A 2RHPA 4DB5A 4HK9A 4OMCA 2IVJA 5JR2A 1PNFA 2QQMA 3NSTA 1ASJ2 4A6SA 3JBG2 2VVEA 4BIOA 4IE6A 2ENRA 1FV2A 1GZ9A 2DVGA 4BQ4A 1PO23 3JU9A 2CGOA 2ARCA 3ZN6B 5GLZA 4RHV1 5KWRA 5IK7A 1ZBE2 3ELNA 4NIDA 3NJXA 2NZ9A 4IEQA 2IC1A 4BK4A 2GH8A 5KXDA 1LHWA 2VMIA 4OCTA 3I2DA 4LA3A 5BNQA 3RWKX 1HB3A 4CCKA 4UFKA 3VKFC 3JUUA 3ZXJA 2JE8A 1NE6A 3N7MA 5M0TA 2P3JA 5GLTA 2CDPA 4LKEA 3RNSA 2PELA 4N90A 2ERFA 2QNKA 2W68A 4HL0A 1B09A 1VMFA 4A3ZA 1RUE3 4W8JA 1SLBA 2R1BA 1WMXA 4QPIA 1H9PA 3KWVA 4LBQD 4B4QA 2WYSA 1FYUA 2BOJA 2WO2A 3ZYPA 4ZXKA 1DCSA 1PVXA 1AR71 2D6NA 3MFCA 2C5DA 4LHLA 1W2NA 2ZHNA 5CFCA 4HXCA 1GQGA 2WO1A 2EIEA 3VBSC 1N47A 1OQ1A 4DNYA 2JKBA 2PHXA 5FLIA 2BNMA 1V6KA 2D3SA 3CZJA 2ZX4A 5JWPA 1KQRA 4N9IA 2Y6LA 3AMQA 3I97A 2PLV3 1UYPA 4YVWA 4MXWA 1OFSA 3GBFA 4NAMA 4MZUA 1OSGA 2VL4A 3WDXA 3I2JA 3HMYA 2VPVA 3WNNA 1GANA 2P6HA 3WUCA 2EALA 4QT6A 4CEWC 5IK8A 4UW4A 2GC3A 1A6CA 1UZ0A 3ZLIA 3VHNA 4R9DA 1GMMA 4AI9A 3WCRA 1GZWA 4OULA 1NOVA 3ZMOA 5CKNA 1NE4A 3FC0A 1AVBA 4AVVA 3P3NA 1COV1 1EAH3 5LWBA 1XNBA 2ET1A 5C4WA 2XLAA 4F3JA 4BA6A 3BTZA 2FDFA 3MW2A 5L9BA 4CP9B 5A3WA 3CQOA 3MPPG 3X29B 3U0ZA 4JDOA 3T0BA 2AR6A 3O1SA 2VJXA 2Q30A 1RC6A 3KGZA 1ZNPA 2PLV2 2Q1ZB 3I3MA 4GZ9A 1UX7A 4EN6B 5FYBA 1VRBA 4YM3A 1R1ZA 3SH4A 5A3UA 4Y3OA 5DAPA 3E97A 1RUI2 3OGGA 3N9QA 4IL7A 5D8AA 5FP7A 2WKKA 1IPSA 5ANQA 2G4IA 1DLLA 2HEWF 2D93A 4DRRA 1X8EA 1JYIA 3N3HA 2DWRA 4QX2A 5EPAA 2V4AA 3RYKA 2EIDA 2AEYA 1C5IA 1TEIA 4QXKA 4Y1ZA 5GALA 2KD7A 5LA2A 1SEFA 3AYCA 3QBQA 3SMHA 3USUA 3NW4A 1KITA 4XE9A
chains in the Genus database with same CATH topology
4DEVA 5IFPA 2ZEYA 3FL7A 2HYXA 5G04L 3MV11 1W9SA 2W92A 1WCQA 4JKMA 1UY3A 3F2ZA 1ULOA 2C9KA 5IJRA 5EIYB 4DEQA 2LW8A 2VZOA 2VCCA 2X10A 1W9WA 3IAQA 3VD9A 4BXSV 1O59A 2J1TA 3CDZB 2W87A 2W1WA 2BBAA 3C7FA 4LQRA 2QBXA 3SKJE 5I0DA 5JUVA 3ACGA 4QX3A 4UOJA 1T2XA 3MBWA 4LPLA 1GQPA 2VQUA 2VMEA 2Y64A 5JXJA 1PMHX 4XUQA 3HNYM 3I3EA 3HOBA 1W99A 5J1XA 3OGSA 2W1SA 3PUHA 5DQ0A 5JXIA 1NUKA 3JXSA 3OBAA 4QDSA 2VZRA 3SEEA 2VC9A 4P08A 2VR4A 3FHAA 3GGLA 2EICA 4E8CA 3WNPA 2VQTA 4E8DA 2RJ2A 4UI9L 4W4ZA 1KGYA 3A7QA 2DCJA 4MADA 1TVGA 3W5MA 1I5PA 1K12A 2XHNA 2W1QA 2J1UA 3T2OA 3LPFA 4CU7A 2EIBA 4FI9A 5C70A 2VMDA 2E31A 4A4AA 2QQIA 4GWIA 5LA0A 3VD3A 3VDBA 5B4NA 2V4VA 3I2HA 3ACFA 2VZSA 4DUXA 1JI6A 1SHWB 1JZ5A 4ZXEA 4QAWA 1JYWA 1K45A 4QB6A 4W50A 3ZM8A 2WAOA 3GXUA 4D0QA 2W9XA 1JZ7A 3C7GA 2WBKA 2J22A 3IDAA 3P1IA 3CKHA 3U37A 3WNLA 3MUZ1 3SKVA 3C8XA 4JKLA 4XUPA 1DYOA 2YC2A 2DDUA 1UYYA 4Z2AA 1UY1A 1PX4A 2JDAA 2BZDA 2W91A 1CZTA 5HXMA 3I3BA 1EUUA 3MUY1 2YFZA 2VZ3A 2Z4FA 1WKYA 2C26A 3A23A 5LCWL 2VMCA 4QDQA 3LEKA 1W8NA 4XZUG 3I3DA 3UETA 5C71A 4ARYA 1GU3A 1OT5A 3VD4A 3OB8A 1JZ3A 3FHQA 2WZ8A 2WQ8A 1JU3A 1UMHA 5CYYA 1CZSA 1XNTA 4PF1A 4MGQA 2PQSA 3IAPA 4XUOA 3ECQA 2E33A 2ORZA 5IHRA 2WUHA 4CUAA 2ID4A 3T0DA 1P8JA 1UY4A 1JYVA 5JXGA 3I2FA 2Y6GA 1K42A 3AC0A 4MOAA 3WNOA 4XUTA 1OF3A 4L0PA 3CMGA 4JKKA 4YPJA 4QX0A 3LPGA 3WNKA 3W5NA 2J7MA 2YC4A 2WZEA 1PMJX 1GNYA 2VZUA 4CU9A 2DCKA 1L7QA 3BGAA 4ARXA 3CZUA 3EYPA 2JD9A 1JU4A 3D3AA 4XURA 2VM9A 2J1RA 4A42A 3VD5A 4CVUA 4OMDA 1CZVA 3T2PA 2W1UA 4M4RA 4DXTA 3NQHA 1D7PM 4CUCA 4DXSA 3WNMA 3HEIA 5G05L 3C7EA 4PQQA 3I2IA 4KMQA 3DYPA 2ZEWA 3THCA 1F4HA 2E32A 3WEZA 3LEIA 1GUIA 2W46A 1H6XA 2ORXA 1J84A 4P00B 3OEBA 4P02B 2XONA 5DPNA 5A1AA 3VDAA 2ZXQA 1KEXA 2QQOA 4AG4A 1GOHA 2Y8KA 4OUEA 3OGVA 2V72A 2ZEZA 5B4XA 3T08A 1RYYA 3HN3A 1W9TA 5HPOA 4A44A 5JMOA 3NNGA 2W5FA 2VZ1A 2Y6JA 2J1VA 1JHJA 4PT6A 1GOGA 3NRUA 3WSOA 2LS6A 3WQBA 2CDOA 2E26A 2QQJA 3E1F1 2QQNA 1JZ6A 3LE0A 2J1SA 4A41A 1L7RA 4KI5M 2WDBA 4HG6B 1UYZA 3K4ZA 4JX0A 3HNBM 4RN5A 5IFTA 2ZEXA 5F7UA 3C7HA 2WO3A 4ZY9A 3UNPA 2X09A 3K4AA 2J1AA 4A6OA 3SEPA 1OD3A 1JZ4A 1XC6A 3J7HA 2VO5A 2BGOA 3LQCA 4MO3M 1CX1A 1UXZA 3DYMA 2VZTA 2VMFA 5EJZB 3WF4A 3OGRA 4MGSA 3EB7A 1XPWA 2XOMA 1XNAA 2YFUA 2YB7A 2HLEA 1GOFA 1O8PA 1US3A 3BN6A 1OH4A 4XUNA 1K3IA 4ZZ8A 2VZPA 2VCBA 2WN2A 2YG0A 1LNSA 3K46A 4D8MA 4GWJA 4CU8A 3K4DA 3MO4A 1UMIA 5DMYA 1DLCA 2R7EB 4IUGA 2C4XA 1W0NA 2WAAA 1CIYA 4DUWA 2W95A 3P6BA 4DXRA 4KWUA 3DECA 3IB3A 2VTFA 3UESA 1TG7A 4BK5A 3T2QA 3OEAA 4QPWA 1R64A 2WN3A 5DN2A 4CUBA 3GM8A 1H6YA 2VZQA 4BJ0A 1EUTA 4OMCA 1MPXA 5JR2A 1O8SA 2QQMA 4RYDA 1J83A 4QX1A 1SG3A 1SDDB 4CU6A 4QB2A 1IQDC 3WF3A 3K77A 3C7OA 3NJXA 2BERA 4BK4A 3HJRA 2B9VA 3CIHA 4DUVA 3ACHA 2JE8A 2RV9A 2CDPA 2X05A 1UXXX 2JKXA 2W94A 1JYNA 2XQXA 1UY2A 4A45A 4A3ZA 1ULPA 2W3JA 4W8JA 4P5YA 3FN9A 2WYSA 2WO2A 2V5DA 3T09A 4ET7A 3GDBA 3HPNA 1NX9A 2WO1A 2EIEA 1US2A 3A21A 3DYOA 3ACIA 1UY0A 2QQLA 1DP0A 3CZJA 2J1EA 3I2KA 3K75B 1HN1A 3LEGA 4M4PA 1JZ2A 2Y6LA 4XVHA 3I97A 3IIIA 2VL4A 1JYXA 3I2JA 3NJVA 2Y6HA 3WNNA 2RVAA 3OG2A 1UZ0A 2QQKA 1PX3A 4QB1A 1GMMA 1UYXA 3T0AA 5IYYA 5C7GA 4LKSA 2W47A 1NAEA 2L9LA 3ETPA 5JXHA 1UWWA 3A22A 1JZ8A 3MV01 4ZZ5A 1F4AA 5CZKA 2OKXA 2Y6KA 4TTGA 2BGPA 3CQOA 3WF2A 3T0BA 1NKGA 2VJXA 4JHZA 1W8OA 3I2GA 3ABZA 4GZ9A 2B4KA 4TXWA 1UX7A 4OZOA 3HNMA 4BDVB 5LA1A 1BHGA 3VDCA 4UAPA 3WF0A 2VCAA 3THDA 1OF4A 2VZVA 5EJ1B 3WF1A 3PUIA 1YQ2A 2VOTA 4OYUA 4QX2A 4QDRA 2EIDA 4AAXA 2WABA 2KD7A 5LA2A 3VD7A 5FUIA 4LHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DEV A;  5IFP A;  2ZEY A;  3FL7 A;  2HYX A;  5G04 L;  3MV1 1;  1W9S A;  2W92 A;  1WCQ A;  4JKM A;  1UY3 A;  3F2Z A;  1ULO A;  2C9K A;  5IJR A;  5EIY B;  4DEQ A;  2LW8 A;  2VZO A;  2VCC A;  2X10 A;  1W9W A;  3IAQ A;  3VD9 A;  4BXS V;  1O59 A;  2J1T A;  3CDZ B;  2W87 A;  2W1W A;  2BBA A;  3C7F A;  4LQR A;  2QBX A;  3SKJ E;  5I0D A;  5JUV A;  3ACG A;  4QX3 A;  4UOJ A;  1T2X A;  3MBW A;  4LPL A;  1GQP A;  2VQU A;  2VME A;  2Y64 A;  5JXJ A;  1PMH X;  4XUQ A;  3HNY M;  3I3E A;  3HOB A;  1W99 A;  5J1X A;  3OGS A;  2W1S A;  3PUH A;  5DQ0 A;  5JXI A;  1NUK A;  3JXS A;  3OBA A;  4QDS A;  2VZR A;  3SEE A;  2VC9 A;  4P08 A;  2VR4 A;  3FHA A;  3GGL A;  2EIC A;  4E8C A;  3WNP A;  2VQT A;  4E8D A;  2RJ2 A;  4UI9 L;  4W4Z A;  1KGY A;  3A7Q A;  2DCJ A;  4MAD A;  1TVG A;  3W5M A;  1I5P A;  1K12 A;  2XHN A;  2W1Q A;  2J1U A;  3T2O A;  3LPF A;  4CU7 A;  2EIB A;  4FI9 A;  5C70 A;  2VMD A;  2E31 A;  4A4A A;  2QQI A;  4GWI A;  5LA0 A;  3VD3 A;  3VDB A;  5B4N A;  2V4V A;  3I2H A;  3ACF A;  2VZS A;  4DUX A;  1JI6 A;  1SHW B;  1JZ5 A;  4ZXE A;  4QAW A;  1JYW A;  1K45 A;  4QB6 A;  4W50 A;  3ZM8 A;  2WAO A;  3GXU A;  4D0Q A;  2W9X A;  1JZ7 A;  3C7G A;  2WBK A;  2J22 A;  3IDA A;  3P1I A;  3CKH A;  3U37 A;  3WNL A;  3MUZ 1;  3SKV A;  3C8X A;  4JKL A;  4XUP A;  1DYO A;  2YC2 A;  2DDU A;  1UYY A;  4Z2A A;  1UY1 A;  1PX4 A;  2JDA A;  2BZD A;  2W91 A;  1CZT A;  5HXM A;  3I3B A;  1EUU A;  3MUY 1;  2YFZ A;  2VZ3 A;  2Z4F A;  1WKY A;  2C26 A;  3A23 A;  5LCW L;  2VMC A;  4QDQ A;  3LEK A;  1W8N A;  4XZU G;  3I3D A;  3UET A;  5C71 A;  4ARY A;  1GU3 A;  1OT5 A;  3VD4 A;  3OB8 A;  1JZ3 A;  3FHQ A;  2WZ8 A;  2WQ8 A;  1JU3 A;  1UMH A;  5CYY A;  1CZS A;  1XNT A;  4PF1 A;  4MGQ A;  2PQS A;  3IAP A;  4XUO A;  3ECQ A;  2E33 A;  2ORZ A;  5IHR A;  2WUH A;  4CUA A;  2ID4 A;  3T0D A;  1P8J A;  1UY4 A;  1JYV A;  5JXG A;  3I2F A;  2Y6G A;  1K42 A;  3AC0 A;  4MOA A;  3WNO A;  4XUT A;  1OF3 A;  4L0P A;  3CMG A;  4JKK A;  4YPJ A;  4QX0 A;  3LPG A;  3WNK A;  3W5N A;  2J7M A;  2YC4 A;  2WZE A;  1PMJ X;  1GNY A;  2VZU A;  4CU9 A;  2DCK A;  1L7Q A;  3BGA A;  4ARX A;  3CZU A;  3EYP A;  2JD9 A;  1JU4 A;  3D3A A;  4XUR A;  2VM9 A;  2J1R A;  4A42 A;  3VD5 A;  4CVU A;  4OMD A;  1CZV A;  3T2P A;  2W1U A;  4M4R A;  4DXT A;  3NQH A;  1D7P M;  4CUC A;  4DXS A;  3WNM A;  3HEI A;  5G05 L;  3C7E A;  4PQQ A;  3I2I A;  4KMQ A;  3DYP A;  2ZEW A;  3THC A;  1F4H A;  2E32 A;  3WEZ A;  3LEI A;  1GUI A;  2W46 A;  1H6X A;  2ORX A;  1J84 A;  4P00 B;  3OEB A;  4P02 B;  2XON A;  5DPN A;  5A1A A;  3VDA A;  2ZXQ A;  1KEX A;  2QQO A;  4AG4 A;  1GOH A;  2Y8K A;  4OUE A;  3OGV A;  2V72 A;  2ZEZ A;  5B4X A;  3T08 A;  1RYY A;  3HN3 A;  1W9T A;  5HPO A;  4A44 A;  5JMO A;  3NNG A;  2W5F A;  2VZ1 A;  2Y6J A;  2J1V A;  1JHJ A;  4PT6 A;  1GOG A;  3NRU A;  3WSO A;  2LS6 A;  3WQB A;  2CDO A;  2E26 A;  2QQJ A;  3E1F 1;  2QQN A;  1JZ6 A;  3LE0 A;  2J1S A;  4A41 A;  1L7R A;  4KI5 M;  2WDB A;  4HG6 B;  1UYZ A;  3K4Z A;  4JX0 A;  3HNB M;  4RN5 A;  5IFT A;  2ZEX A;  5F7U A;  3C7H A;  2WO3 A;  4ZY9 A;  3UNP A;  2X09 A;  3K4A A;  2J1A A;  4A6O A;  3SEP A;  1OD3 A;  1JZ4 A;  1XC6 A;  3J7H A;  2VO5 A;  2BGO A;  3LQC A;  4MO3 M;  1CX1 A;  1UXZ A;  3DYM A;  2VZT A;  2VMF A;  5EJZ B;  3WF4 A;  3OGR A;  4MGS A;  3EB7 A;  1XPW A;  2XOM A;  1XNA A;  2YFU A;  2YB7 A;  2HLE A;  1GOF A;  1O8P A;  1US3 A;  3BN6 A;  1OH4 A;  4XUN A;  1K3I A;  4ZZ8 A;  2VZP A;  2VCB A;  2WN2 A;  2YG0 A;  1LNS A;  3K46 A;  4D8M A;  4GWJ A;  4CU8 A;  3K4D A;  3MO4 A;  1UMI A;  5DMY A;  1DLC A;  2R7E B;  4IUG A;  2C4X A;  1W0N A;  2WAA A;  1CIY A;  4DUW A;  2W95 A;  3P6B A;  4DXR A;  4KWU A;  3DEC A;  3IB3 A;  2VTF A;  3UES A;  1TG7 A;  4BK5 A;  3T2Q A;  3OEA A;  4QPW A;  1R64 A;  2WN3 A;  5DN2 A;  4CUB A;  3GM8 A;  1H6Y A;  2VZQ A;  4BJ0 A;  1EUT A;  4OMC A;  1MPX A;  5JR2 A;  1O8S A;  2QQM A;  4RYD A;  1J83 A;  4QX1 A;  1SG3 A;  1SDD B;  4CU6 A;  4QB2 A;  1IQD C;  3WF3 A;  3K77 A;  3C7O A;  3NJX A;  2BER A;  4BK4 A;  3HJR A;  2B9V A;  3CIH A;  4DUV A;  3ACH A;  2JE8 A;  2RV9 A;  2CDP A;  2X05 A;  1UXX X;  2JKX A;  2W94 A;  1JYN A;  2XQX A;  1UY2 A;  4A45 A;  4A3Z A;  1ULP A;  2W3J A;  4W8J A;  4P5Y A;  3FN9 A;  2WYS A;  2WO2 A;  2V5D A;  3T09 A;  4ET7 A;  3GDB A;  3HPN A;  1NX9 A;  2WO1 A;  2EIE A;  1US2 A;  3A21 A;  3DYO A;  3ACI A;  1UY0 A;  2QQL A;  1DP0 A;  3CZJ A;  2J1E A;  3I2K A;  3K75 B;  1HN1 A;  3LEG A;  4M4P A;  1JZ2 A;  2Y6L A;  4XVH A;  3I97 A;  3III A;  2VL4 A;  1JYX A;  3I2J A;  3NJV A;  2Y6H A;  3WNN A;  2RVA A;  3OG2 A;  1UZ0 A;  2QQK A;  1PX3 A;  4QB1 A;  1GMM A;  1UYX A;  3T0A A;  5IYY A;  5C7G A;  4LKS A;  2W47 A;  1NAE A;  2L9L A;  3ETP A;  5JXH A;  1UWW A;  3A22 A;  1JZ8 A;  3MV0 1;  4ZZ5 A;  1F4A A;  5CZK A;  2OKX A;  2Y6K A;  4TTG A;  2BGP A;  3CQO A;  3WF2 A;  3T0B A;  1NKG A;  2VJX A;  4JHZ A;  1W8O A;  3I2G A;  3ABZ A;  4GZ9 A;  2B4K A;  4TXW A;  1UX7 A;  4OZO A;  3HNM A;  4BDV B;  5LA1 A;  1BHG A;  3VDC A;  4UAP A;  3WF0 A;  2VCA A;  3THD A;  1OF4 A;  2VZV A;  5EJ1 B;  3WF1 A;  3PUI A;  1YQ2 A;  2VOT A;  4OYU A;  4QX2 A;  4QDR A;  2EID A;  4AAX A;  2WAB A;  2KD7 A;  5LA2 A;  3VD7 A;  5FUI A;  4LHS A; 
#chains in the Genus database with same CATH topology
 4QPI B;  5DUU A;  4DEV A;  2ZAC A;  1TMF 2;  2WFP A;  5AVA A;  1W6O A;  1EPW A;  2R07 2;  1N1T A;  2HYX A;  2WRA A;  4UFI A;  4LO5 B;  2ILM A;  3O1T A;  2WZR 1;  1W9S A;  5CFC B;  3OTF A;  2Q1M A;  1FNY A;  1NCR C;  2W92 A;  4L2N A;  3RFR A;  1NLQ A;  1UY3 A;  3WQ7 A;  1XE7 A;  1WW6 A;  5IJR A;  5EIY B;  5IAV A;  5LBC A;  3H3L A;  3MIC A;  4COV A;  1YQ8 A;  5J96 B;  2QQP A;  1NXD 1;  3JCI A;  1AX0 A;  1ND2 A;  2ES3 A;  2VZO A;  5FZ4 A;  4FPG A;  2B8M A;  3I8T A;  4YVW B;  4MXW B;  1GBG A;  3IAQ A;  5KR7 A;  1O59 A;  3CDZ B;  4WVV A;  4CCD A;  4XQW A;  1BK1 A;  2VQA A;  2BVB A;  3NNM A;  4IE0 A;  4Q5O A;  5IAT A;  1AXZ A;  3WG3 A;  2QBX A;  3SKJ E;  1RTV A;  2NPI A;  3OYW A;  5JUV A;  2PQQ A;  4I2O A;  1GFF 2;  1EV1 3;  1T2X A;  2RR1 1;  1GZW B;  3KVB A;  3MEP A;  1WBL A;  3U11 A;  4S2G A;  1RIT A;  2H0B A;  4NII A;  4PCR A;  3BU0 A;  4IV1 A;  2VME A;  2OQ7 A;  2YU1 A;  5AC9 1;  4COZ A;  5C4W B;  5CEH A;  4ONU A;  3ITQ A;  1YQ5 A;  2WSU A;  1UZW A;  2GH2 A;  2XXZ A;  1UMZ A;  4BQY A;  4LHN A;  1J3R A;  5EFU A;  4D7S A;  3IMN A;  4TYS A;  5EZW A;  4QGM A;  3ASI A;  2PHU A;  5JXI A;  1NUK A;  4XXP A;  5T50 A;  5FZB A;  1GNZ A;  2OT7 A;  3VKO A;  5FZO A;  1HDK A;  2VNV A;  3PIG A;  5D8A B;  1NY7 1;  3HWJ A;  4AR2 A;  3MIB A;  1VP6 A;  3WNP A;  3PTY A;  1DYK A;  3KT7 A;  2F17 A;  2RJK A;  3M8L A;  5HXV A;  2D98 A;  4E8D A;  3KV6 A;  1KD7 A;  2Q4S A;  4UI9 L;  1V9U 2;  3K48 A;  1LB2 A;  2C1F A;  1Q8S A;  3USU B;  2KR2 A;  5ACA 1;  1VBD 3;  3AYE A;  5F6L B;  4KU8 A;  3EJK A;  1H1M A;  4XFI A;  5C3P A;  1XRU A;  1SLI A;  1W6O B;  3OF1 A;  3W5M A;  1S0G A;  1OXC A;  5FYU A;  2W1Q A;  5GLU A;  4BMB A;  5J3U A;  3WW2 A;  2UY8 A;  5JIA A;  1GP5 A;  2XUE A;  5FPX A;  4AFM A;  2XG3 A;  2E7T A;  1VBB 2;  3IMM A;  3ILR A;  4NUB A;  4EV0 A;  1AR6 1;  1ND2 B;  3Q8C A;  4FI9 A;  1EPZ A;  1N1V A;  5C70 A;  1AHS A;  4Q8L A;  5KXB A;  2YHJ A;  1MS3 A;  2BP6 A;  4FP3 A;  5C4W C;  1LOB A;  3VDB A;  1QQP 3;  3VD3 A;  3IDB B;  2QVS B;  3P3P A;  3M70 A;  5B4N A;  2WWJ A;  3I2H A;  1R09 3;  1VAV A;  3N9P A;  1GQH A;  1VBD 2;  1YFU A;  2YBS A;  2ZML A;  2X8K A;  3OYW B;  3T1L A;  4DUX A;  1X9P A;  2JG8 A;  4QAW A;  5FYM A;  4NHL A;  1PGW 1;  1SFN A;  4W50 A;  2JD4 A;  3J4U H;  3VUO A;  5F5I A;  3ATG A;  4AQ6 A;  2DVD A;  4IV1 B;  5D8A C;  3RJ2 X;  3C7G A;  1RHI 3;  1EYB A;  3P1I A;  3ZXF A;  3GZU C;  2YXS A;  4I0B A;  4B1L A;  5CG9 A;  5TSW A;  1RUJ 1;  3EQE A;  3MUZ 1;  3GCW A;  3JD7 2;  1I3H A;  4XUP A;  4XTM A;  1UZZ A;  5I93 A;  1Y4W A;  2YC2 A;  1DZT A;  1RUD 2;  2DDU A;  3UJQ A;  2WT0 A;  5APA A;  1UYY A;  3WX5 A;  2N7G A;  3PUS A;  1DZR A;  2RMU 1;  3NMB A;  5C3R A;  3N9L A;  4HMZ A;  3FBM A;  4GB3 1;  5FZO B;  2VW2 A;  1R09 2;  1HLC A;  5LY2 A;  4BLI A;  3FX3 A;  2I45 A;  1C1F A;  5HXM A;  3H9A A;  3I3B A;  4Y4R A;  1B35 A;  4B1M A;  2VZ3 A;  3HVD A;  4BXF A;  5FZI A;  3DCQ A;  3A23 A;  1HQW A;  2VY0 A;  1FNZ A;  1PIV 1;  2DVB A;  3RZM A;  3UET A;  5IK5 A;  2D97 A;  4YLZ A;  4UBG A;  4Y5T A;  2D5H A;  1HB1 A;  3SQO A;  3SIT A;  5A6Y A;  2D44 A;  3GJA A;  5FWE A;  3O1V A;  2P3I A;  1BJQ A;  4PLO A;  4QGN A;  5AFE A;  4OHY A;  3ZFG A;  5A6X A;  5GZE A;  4CCL A;  5C8C A;  5E8A A;  4MHR A;  1HJF A;  1LUL A;  1XNT A;  4MGQ A;  2PQS A;  4PF5 A;  4NO4 A;  2LRO A;  5KC6 A;  1FPN 2;  3PME A;  3VKM A;  5A3O A;  1W6M A;  3KLS A;  4LE3 A;  4CE8 A;  4BWO A;  5JAX A;  5JXG A;  1D0H A;  2Y6G A;  3AFG A;  5FR3 A;  3CEW A;  2E51 A;  4Q0U A;  5DUW A;  3AC0 A;  5IW0 A;  3TEX A;  1RIR A;  1XE0 A;  3LGR A;  5GLV A;  4WBB A;  1M4W A;  1MAC A;  2KM2 A;  4Q2F A;  1GKB A;  4XUT A;  1R08 1;  2ZS6 B;  3SH3 A;  1AXY A;  2IXC A;  1C5H A;  2UYB A;  3DL3 A;  1RUI 1;  3WNK A;  1FXZ A;  1LKN A;  2JG8 B;  4CEY A;  3PHM A;  4QXH A;  1C1L A;  2BWC A;  3CO2 A;  1GR3 A;  2GZW A;  4KH9 A;  5A1F A;  2EXI A;  3VN4 A;  4GMP 1;  1QJU 3;  2DCK A;  3GCX A;  3FBY A;  5DZE A;  1LAJ A;  3CZU A;  3EYP A;  4FQ4 A;  1DF0 A;  2RM2 3;  4W65 A;  4AVS A;  4AVB A;  4CDX A;  2IXI A;  2DF7 A;  4AEJ A;  2PAE A;  1KS5 A;  4AGR A;  3WCS A;  2D6L X;  4A42 A;  3VGI A;  4AFC A;  4PDW A;  4BOW A;  2WR9 A;  3RSJ A;  4RR3 A;  3VD5 A;  5GZC A;  4YG3 A;  1UL9 A;  4AXO A;  5LW9 A;  1W90 A;  4RFT 0;  4CVU A;  1WA6 X;  4I3P A;  2VMH A;  2GMM A;  4Q4W 1;  3D82 A;  2VCM A;  3ZYH A;  4QQL A;  4FP2 A;  1QOS A;  4M4R A;  3PNA A;  1ZZ7 A;  3NQH A;  4GWM A;  5EQU A;  3RMX A;  2K0G A;  1DZQ A;  2RS5 2;  5FP9 A;  3SXW A;  2D40 A;  4C0H A;  1IKP A;  2PAM A;  3C7E A;  1C8N A;  2QDN A;  2OQ6 A;  3ZO0 B;  1DYP A;  2WC2 A;  4FFF A;  3LEI A;  4HOO A;  1B35 B;  1GUI A;  2W46 A;  4NWW A;  3WW3 A;  3O0X A;  1QJU 2;  4KU7 A;  5FXZ A;  1AR9 2;  3KQR A;  2LTN A;  3IKW A;  4BLJ A;  5CG8 A;  3NJZ A;  4R52 A;  5A1A A;  3AX4 A;  4YGE A;  1CVN A;  2ZXQ A;  4P9L A;  2R1D A;  3GYD A;  2Y8K A;  4Q27 A;  4X6R B;  4XDQ A;  1MEC 2;  3PDQ A;  4ZS2 A;  2ZGT A;  5FUP A;  1WLT A;  3NNL A;  1LOC A;  3ST7 A;  2UWB A;  3VZN A;  3UKT A;  3ZFG B;  3HN1 A;  4XDO A;  4XPV A;  5C8C B;  1MS1 A;  4YNI A;  1OI6 A;  2JDU A;  3FZ3 A;  4XAB A;  1W9T A;  4BHP A;  4FXG B;  1PO1 3;  1YJL A;  3AL6 A;  1JUH A;  3NNG A;  3ROU A;  2W5F A;  3ENR A;  2MEV 3;  2Y6J A;  5AVP A;  2J1V A;  4WM7 A;  3KHC A;  1YO8 A;  2R06 1;  1J59 A;  3HT1 A;  1W6M B;  1GOG A;  3RZK A;  3MFA A;  2LS6 A;  3WQB A;  2E26 A;  1F5J A;  1HRV 2;  3IN9 A;  4IGP A;  2QQJ A;  3OBT A;  4XJU A;  4LR4 A;  5F32 A;  5FMD A;  5BYN A;  4IEU A;  4EJR A;  2QQN A;  3NNJ A;  3HAG A;  4RHV 3;  3LE0 A;  2J1S A;  4IET A;  1DQ6 A;  3VDD C;  1I9R A;  2XJR A;  5J7M A;  2WFF 1;  2XJT A;  3HT2 A;  4LO6 B;  2W2I A;  4XJA A;  3UT0 A;  1UOJ A;  1H9W A;  4CEY B;  1BEV 2;  2OZJ A;  2R6Q A;  2JJ6 A;  3LIG A;  3W58 A;  1ALY A;  1AR8 1;  4UW5 A;  3DEM A;  5GZG A;  4K8F A;  5FYC A;  3WG2 A;  4ZS3 A;  1UYZ A;  2I74 A;  3I4I A;  3K4Z A;  4JX0 A;  3OPT A;  4HKW A;  4OZX A;  1UZV A;  4PBP A;  3ES4 A;  1PO1 2;  4AGV A;  4CDX B;  2YPJ A;  5IFT A;  1YCI A;  3JQX A;  1Y43 B;  3N35 A;  3V0A A;  2MEV 2;  3VBU A;  5BNN A;  3SCG A;  4GJZ A;  1RED A;  5F7U A;  4PDW B;  5T52 A;  4RR3 B;  1Y9Q A;  4LIV A;  2QE3 A;  1MS0 A;  1J1L A;  4ZY9 A;  3ZYF A;  5ABJ A;  5HCH A;  2A70 A;  3O1O A;  2QKD A;  3LWC A;  2XBO 1;  5JOZ A;  4R9A A;  5IAX A;  1JOJ A;  2A6V A;  3RGB A;  1GZT A;  1W3X A;  2J1A A;  2JIG A;  2K2S A;  4XC9 A;  2VNO A;  2XLG A;  1S2B A;  4RHV 2;  3J7H A;  2XKP A;  1VPH A;  1LEC A;  2VO5 A;  1UAI A;  3ZFG C;  3DXU A;  1QGL A;  2VZT A;  1DIW A;  3DYM A;  4KGQ A;  4FAG A;  2P6C A;  3B94 A;  4M01 A;  4J25 A;  5FZA A;  4KBZ A;  1XPW A;  2YFU A;  5A3L A;  3AMP A;  2FCT A;  1GP4 A;  4QGL A;  2HLE A;  1GOF A;  1ZA7 A;  1UU5 A;  3ZXD A;  1US3 A;  4P9X A;  3ALQ A;  1W06 A;  3WR0 A;  3BN6 A;  1H8T A;  1K3I A;  4XUN A;  3MIF A;  4ZZ8 A;  3OSD A;  5FY4 A;  3PJY A;  1C4R A;  4FFG A;  2YG0 A;  3L2Y A;  4ZHN A;  1XU2 A;  3V0B A;  1AR7 2;  5JDB A;  2VUA A;  1U5Z A;  3FE5 A;  4CU8 A;  1COV 3;  1V6J A;  5SV8 A;  5GKA C;  2XGX A;  4CEY C;  2PAK A;  3TNQ A;  1QHD A;  1JYT A;  2WAA A;  5DDJ 1;  1AL2 2;  4WM7 B;  5CAZ A;  2XHK A;  2W95 A;  4IGO A;  3DEC A;  4CDX C;  1YIP A;  2VTF A;  3UES A;  4DIN B;  1YIF A;  4FT8 A;  4KWL A;  3DGT A;  1RUD 1;  4LOS A;  2QQV A;  4QPW A;  4KQ7 A;  3RZZ A;  4PDW C;  2WN3 A;  4RR3 C;  2XML A;  1GV9 A;  1ZBA 1;  4XCB A;  4H3W A;  1H6Y A;  4N43 C;  3RWN A;  1UOG A;  1XSR A;  2RDS A;  4XJW A;  3TN9 3;  2YY1 A;  4G9S B;  1WCU A;  4OHZ A;  2X5I A;  1MPX A;  4Y4Y A;  3O5S A;  1NA1 A;  1JOB A;  2JDN A;  1TNR A;  2DFC A;  1JH5 A;  2FDI A;  1V6O A;  2WII B;  3E6B A;  4XMI A;  3AM2 A;  1R1A 2;  1COV 2;  2VNG A;  2VMG A;  1MS4 A;  1SDD B;  1IGO A;  4CU6 A;  3FFQ A;  3ZXK A;  1LHV A;  1MZE A;  4QB2 A;  3WF3 A;  3V0A B;  3VBU B;  4IXL A;  2BER A;  4KNC A;  5BNN B;  3HJR A;  3PVN A;  2B9V A;  4C8D A;  3CIH A;  2WT2 A;  5BY5 A;  5SV5 A;  4JZR A;  5ABJ B;  3ZXL A;  3LFI A;  4ASM B;  1UOF A;  2WZR 3;  5FZD A;  5DG2 A;  4LBO A;  3AP6 A;  4LLO A;  2X05 A;  2E7Q A;  2JKX A;  1YI7 A;  3DN7 A;  1POV 0;  2W94 A;  4KBB A;  4ORF A;  5H9P A;  3ZFE A;  3C3V A;  3WY6 A;  5HV4 A;  4XYX A;  5JI9 A;  4E4D X;  1VMH A;  2HWF 3;  3E5U A;  4BYY A;  4HN1 A;  5ANN A;  1O3R A;  3OBR A;  4P5Y A;  1XBF A;  4IE4 A;  2V5D A;  1BVV A;  1FPN 1;  3MW4 A;  4XJ8 A;  4ET7 A;  2VE1 A;  3GDB A;  1UZY A;  2SBA A;  2WWU A;  4U36 A;  3ZSM A;  4CCJ A;  5T5O A;  2A6W A;  1HB4 A;  1US2 A;  3DYO A;  3NJY A;  4FO9 A;  4LBN A;  3VB9 A;  3VKL A;  1W8U A;  4BE3 A;  1UY0 A;  5JCT A;  4K21 A;  4OI1 A;  1BMV 1;  2ADE A;  2DUO A;  3TYJ A;  2ZHK A;  1DP0 A;  2CL2 A;  1LOF C;  2R04 3;  3W21 A;  1H8T B;  2RR1 3;  3FFZ A;  1HN1 A;  3LEG A;  1VBC 1;  1QJX 1;  4M4P A;  4MLO A;  5F5Q A;  5FTT C;  4CXY A;  3VBS A;  3V0B B;  1GIC A;  2GP5 A;  1VBE 1;  2FDJ A;  1HRI 2;  5LBE A;  3WV6 A;  1SBF A;  3III A;  3QCW A;  3N4M A;  4XMA A;  1Z78 A;  3BCW A;  1SZB A;  3J7M A;  2VUJ A;  4JTO A;  5F3E A;  4IEZ A;  5AC9 3;  3B69 A;  3BIW E;  2RVA A;  3Q9O A;  3GF6 A;  3ES1 A;  4HVO A;  1PHM A;  2QQK A;  5FLH A;  4AED A;  1TME 1;  1XXN A;  5FY9 A;  3KSC A;  4YZ4 A;  3M1H A;  2ZKN A;  2P3Y A;  1G8W A;  3N36 A;  4YYO A;  5IYY A;  1UPI A;  5A7N A;  2L9L A;  2RG4 A;  3PVE A;  5FJH A;  1I5Z A;  4CEW A;  1OVP A;  4LE4 A;  3A22 A;  5BNN C;  2GN7 A;  2X29 A;  3MV0 1;  4ZZ5 A;  4K40 A;  2C0Z A;  1H1A A;  3G7D A;  3I7D A;  5FPZ A;  1NZC A;  1IPK A;  2BGP A;  3WF2 A;  1MQT A;  4Y20 A;  2BJS A;  2RR1 2;  1NKG A;  2X5I B;  2PHT A;  1NA1 B;  3I3Q A;  4LBL A;  4Z2W A;  4OUS A;  4PIX A;  1QOO A;  3ABZ A;  4PI0 A;  5KHI A;  4YGC A;  4BDV B;  4LK7 A;  3WZ1 A;  4O9E A;  3VDC A;  4EN0 A;  5FZ9 A;  1IG3 A;  1S0F A;  4OUM A;  1QWR A;  1OF4 A;  2W08 A;  3K3O A;  3PUI A;  4LUK A;  1LOG A;  1VB4 A;  2HWC 1;  2WNE A;  4HVR A;  1CON A;  1MEC 1;  2O0O A;  4JHT A;  2OX0 A;  1V6I A;  2Y0O A;  2CY6 A;  1DQ0 A;  1ZRD A;  1W2A X;  4GD4 A;  3ZFE B;  4DOU A;  2VOX A;  1STM A;  4Y33 A;  1NY7 2;  3DPR A;  4IES A;  4LHS A;  1AR6 3;  2VOV A;  1VAM A;  4D69 A;  1D4M 1;  1F15 A;  1O3T A;  5IFP A;  3EMR A;  4HBN A;  2DUR A;  2ZEY A;  4ZU4 A;  1RUG 1;  4XAA A;  3FL7 A;  1S0C A;  5G04 L;  4WVZ A;  3MV1 1;  3JBG 3;  1GNH A;  5JOW A;  2CWS A;  2VVF A;  1CAX A;  3F2Z A;  2NQY A;  3ZFF C;  1NCQ A;  1CAV A;  5FRE A;  2WNU C;  4COY A;  4CRQ A;  2PN5 A;  5ACA 2;  4NRO A;  5BNP A;  4DEQ A;  2B9U A;  3POY A;  4NPL A;  4C0B A;  3TB0 A;  2BTV C;  2LW8 A;  4QKB A;  1N1S A;  3K3N A;  1NCR A;  2A5Z A;  3VBS B;  3VBF C;  1JYC A;  2QQW A;  4GH4 A;  4KWJ A;  2X10 A;  1W9W A;  3B02 A;  1XSQ A;  4BXS V;  2J1T A;  3DF0 A;  4XJ9 A;  1AYN 2;  4AQT A;  2OS2 A;  3KT1 A;  4W6X A;  3C7F A;  1IKQ A;  1NA1 C;  1ENS A;  4EZ4 A;  1H1I A;  2PHD A;  3GZT B;  3D4K A;  3E5Q A;  5I0D A;  4LBQ A;  5JMC A;  4AED B;  1LOA A;  4QMA A;  1OQE A;  1AR6 2;  5F9T A;  2OII A;  3CJX A;  4PI2 A;  2ETE A;  4AWD A;  1MVQ A;  2BFU L;  3LOB A;  2EA7 A;  3LSD A;  4LPL A;  4XFC A;  4CEW B;  2D6O X;  3HD8 B;  1ENX A;  5JXJ A;  5A6Q A;  2JEC A;  1Q56 A;  4GB3 3;  4M00 A;  1JOP A;  5LY1 A;  3HNY M;  5E1R A;  4PHZ A;  5J37 A;  3BYW A;  2ZGL A;  4YVS C;  3BTA A;  3AKP A;  1MQT B;  4Y20 B;  5J1X A;  2P34 A;  1YFY A;  1PGW 2;  3POB A;  4L97 A;  4XDP A;  4M3C E;  3MLL A;  3ZFE C;  1V70 A;  2CYF A;  3CNA A;  1DBN A;  4B7E A;  3JXS A;  5EWS A;  1PIV 3;  5DXD A;  1OH3 A;  1W8Z A;  4P08 A;  1RUJ 2;  4FPC A;  1CAU A;  1RUF 1;  1WME A;  1Q8P A;  1RXF A;  1D4V B;  1VR3 A;  2VQT A;  3O1M A;  2CGP A;  3T30 A;  2RMU 2;  1QXP A;  2E53 A;  1F35 A;  2NMN A;  5FY5 A;  4UW3 A;  4GB3 2;  2LM3 A;  1LGN A;  4W4Z A;  3MDP A;  4Y26 A;  4YRD A;  2XJS A;  4D6Q A;  5D2A A;  1L7L A;  3DPR B;  4NHX A;  4H55 A;  3FJS A;  2B42 B;  1AL2 1;  2ZJC A;  2Y26 A;  4MAD A;  1W39 A;  1S2K A;  1YQC A;  4ZON A;  3UL2 A;  1UKG A;  1JS9 A;  5FK7 A;  2XHN A;  2UWC A;  5E88 A;  1XYN A;  1NT0 A;  4NN0 A;  4AED C;  1S0E A;  1PIV 2;  2J1U A;  2HWD 1;  1X33 A;  2YPD A;  3AXE A;  1CAX B;  1R08 3;  1NCQ B;  1CAV B;  5BNP B;  4NMI A;  3S6P A;  3M3I A;  4CU7 A;  1RUI 3;  3RG0 A;  3UGG A;  3ZMN A;  5DAV A;  4AVA A;  3GHN A;  4JTN A;  1NCR B;  2EF6 A;  5IUQ A;  5I0T A;  4GH4 B;  1ZVF A;  3J8F 1;  4GMP 3;  4YZ1 A;  2UYA A;  4XAC A;  1XU1 A;  4A7Z A;  1MQT C;  5A7S A;  1XJA A;  1SBD A;  2V4V A;  2AEZ A;  2VXJ A;  3ETQ A;  1R1A 1;  4MUV A;  1NZI A;  4OFG A;  5DAQ A;  4AFA A;  1FAT A;  5FOB B;  2OUH A;  4FPF A;  1JI6 A;  4LBQ B;  1WZX A;  1ZZC A;  5FZE A;  4CCN A;  3S57 A;  3ZSK A;  2HWE 1;  1JYW A;  1PM7 A;  3B3Q E;  5F3I A;  4FAH A;  1K45 A;  4QB6 A;  1TMF 3;  4D0Q A;  2IVI B;  4E27 A;  2W9X A;  2R07 3;  1JZ7 A;  2WBK A;  3H1M A;  2WSV A;  4IEO A;  5FYH A;  2WQZ C;  3CKH A;  1R08 2;  1Q43 A;  5D1I A;  3GNE A;  3U14 A;  4CDW C;  3MHZ A;  5L9V A;  3U37 A;  1VAK A;  4XF4 A;  1RJ8 A;  4BQ3 A;  1OOP A;  4JKL A;  2XL9 A;  3USS A;  3BOW A;  3H7J A;  4TSV A;  4GKY A;  1OFN A;  2ZGQ A;  1M06 G;  3ZXE A;  3DPR C;  5K4L A;  4R9C A;  1U0A A;  1OA4 A;  1OLM A;  5FPL A;  4EWD A;  1H0B A;  2GDF A;  3WDV A;  4AOC A;  2HKX A;  3ZN4 A;  2JDA A;  5FZ3 A;  1NQD A;  5A1L A;  1YQ6 A;  2BZD A;  4HZF A;  2R0H A;  1CAU B;  4OHX A;  1ENR A;  2W91 A;  2EXJ A;  1EUU A;  2BDR A;  2YFZ A;  4Q4W 2;  1NCQ C;  2Z4F A;  4QQ2 A;  5BNP C;  1RGS A;  2C26 A;  5F6K A;  1WGP A;  2OUJ A;  1N3P A;  1HRI 1;  2VMC A;  4QDQ A;  1HV1 A;  3RI8 A;  3BPZ A;  4OHW A;  4JAA A;  1LRH A;  2D43 A;  4ARY A;  2LUW A;  4B4P A;  4GH4 C;  1V6N A;  2OW4 A;  3CF6 E;  1ULE A;  3M3C A;  3OB8 A;  1ULF A;  3FHQ A;  2WZ8 A;  5KHK A;  1JU3 A;  5F1R A;  1OUX A;  1PVC 1;  2GNB A;  1UMH A;  4MSV A;  3VBH A;  5B2G B;  1S2E A;  4PF1 A;  4XUO A;  3T4V A;  2Q0A A;  4I0A A;  4IE7 A;  3OUI A;  4F8A A;  1RMU 1;  2YGM A;  4HSJ A;  1GWM A;  5BNO A;  2AUY A;  2DYC A;  2XVG A;  1YUD A;  4M3C A;  3UJO A;  4BH9 A;  3T0D A;  1UY4 A;  5CFD C;  1UU6 A;  1K42 A;  3O1P A;  2QJV A;  2AAC A;  4BIF A;  4FPH A;  4IER A;  4UFM A;  2VNR A;  1V9U 3;  2P4E A;  3M4F A;  4MXV A;  3CMG A;  1LED A;  2UY9 A;  3IBM A;  4YPJ A;  1ND3 A;  2R06 2;  5LAT A;  3W5N A;  1N3O A;  1G9B A;  1ST8 A;  1H4G A;  1FOD 1;  2BRT A;  5JOX A;  2I2S A;  3O1U A;  2XBO 3;  1RUN A;  5FZH A;  2B39 A;  1AYM 1;  4KGG A;  2CNA A;  1L7Q A;  4AI1 A;  2EAA A;  5CVR A;  4CCC A;  1U12 A;  1SCR A;  3KF3 A;  1F31 A;  3T1M A;  2RS1 2;  5FMO S;  2JD9 A;  2VEC A;  4FPE A;  4QPY A;  4XJZ A;  5CIR A;  4CDQ C;  2WFF 2;  2YU2 A;  2ZPX A;  5IVY A;  4YFZ A;  4I02 A;  1VE0 A;  4LXL A;  2DVF A;  1OOP B;  1VBB 3;  4LOT A;  4Q0V A;  4WZF A;  1V6L A;  2JDM A;  2FDK A;  1FAY A;  3B00 A;  1CZV A;  1AR8 2;  3T2P A;  4AE2 A;  4DXT A;  3W59 A;  3WNM A;  3HEI A;  3SIS A;  4X8P A;  1W0O A;  4KMQ A;  3E6C C;  1G9C A;  2ZEW A;  3KD4 A;  3LIH A;  2XJV A;  1G9D A;  4RGK A;  1E5I A;  1C57 A;  3N7K A;  2XBO 2;  3AZV A;  4XEZ A;  2ZA9 A;  1H6X A;  2ORX A;  5FP8 A;  3ZIX A;  5FZC A;  1J84 A;  2O14 A;  4P00 B;  1LOE A;  2QQU A;  3I54 A;  4NRM A;  1PZ7 A;  3ON7 A;  5FXV A;  3WDT A;  1AYN 1;  5DDJ 3;  1DG6 A;  1KEX A;  2JB4 A;  3LZZ A;  3TNP B;  1BBT 1;  3R0R A;  4OUE A;  5A3M A;  1DQ1 A;  5FZ6 A;  1CPN A;  4V1P A;  3JD7 3;  2C24 A;  4FOY A;  4NHY A;  3VBH B;  1RUD 3;  1HJG A;  1OKQ A;  3V65 A;  4JRA A;  5BUV A;  1RYY A;  2JDY A;  3HN3 A;  4TN7 A;  3D5O A;  1ZBA 3;  3IWZ A;  1POV 1;  5I0U A;  1A3K A;  4RSU A;  3CLP A;  4CZS A;  4ZKT B;  1JHJ A;  5BNO B;  4YW5 A;  4M3C B;  3WSO A;  3RYP A;  1W28 A;  1RUC 2;  4RA0 A;  3ZSJ A;  2WS9 2;  1Q8Q A;  2CDO A;  2O1Q A;  2CAU A;  2FD8 A;  3E1F 1;  4R4X A;  5J36 A;  5FZG A;  1LEN A;  1OOP C;  1HQN A;  2C6S A;  4YWA A;  3AKR A;  1JZ6 A;  1DGL A;  2GND A;  5DDJ 2;  4EYU A;  1REE A;  1OPO A;  1ND3 B;  3WG4 A;  4YG6 A;  3ZPO A;  4AL9 A;  1BCX A;  1XB9 A;  4KI5 M;  1HXS 1;  2CHH A;  2WDB A;  4K9S A;  2DTW A;  3LOI A;  4U2A A;  5FY1 A;  3VDD A;  3VZO A;  3H8R A;  1JTZ X;  1XYO A;  2A3Y A;  1ZBA 2;  4RN5 A;  3RPQ A;  1QH6 A;  2VUD A;  5HV0 A;  1ZM1 A;  3VL9 A;  4LNV A;  3EHK A;  1S0B A;  4XFB A;  5I8S A;  3WW4 A;  1YI9 A;  5FY7 A;  1Z7S 1;  3MPB A;  5EP9 A;  3KHB A;  1FPN 3;  4UXA A;  5J98 B;  1V0A A;  1W8F A;  2G9G A;  2X09 A;  4AFB A;  1A78 A;  1A34 A;  3SEP A;  3J7N A;  1W6N A;  4CTE A;  3TEY A;  2HBT A;  4CPB A;  1H2M A;  4J1X A;  1XC6 A;  1MZF A;  2OXB A;  3J9S A;  4HKO A;  1W8T A;  2JE9 A;  1CN1 A;  4DFS A;  2BGO A;  3O1R A;  2ZGR A;  3QAC A;  3UGH A;  2XUM A;  3VBH C;  1SLL A;  1ZX5 A;  1UXZ A;  1VLN A;  2ZX0 A;  1CX1 A;  3DV8 A;  1S1A A;  2VMF A;  2BW8 A;  4CA9 A;  5EJZ B;  1Q3E A;  2A3X A;  3TWI A;  3OPZ A;  4B8E A;  1PO2 1;  3UGF A;  4Z8B A;  1QF3 A;  3NKT A;  2YB7 A;  3TBD A;  2I07 B;  4RQP A;  3WQ1 A;  5BNO C;  2WQ4 A;  4Q4Y 2;  3S5A A;  3S7I A;  4NIA A;  2PHW A;  3E5X A;  5KHJ A;  5EXO A;  2JDP A;  5C5U A;  4LIU A;  2DV9 A;  2F6B A;  1TME 3;  1UW8 A;  4DY5 A;  4CSW A;  5I8T A;  1LNS A;  3NAP C;  3SCH A;  3K4D A;  3P5B A;  1ND3 C;  3M2M A;  1OVS A;  4DS0 A;  1NYW A;  1YJK A;  4D6R A;  1BMV 2;  1MVE A;  1S55 A;  4XQ4 A;  2RS5 3;  3VHP A;  5I91 A;  3QH7 A;  3AP7 A;  5FP4 A;  4CPB D;  3TEZ A;  1PK6 A;  1QJX 2;  1VBC 2;  2ATF A;  4KWU A;  1VBA 1;  1VBE 2;  4DXZ A;  2GP3 A;  1TG7 A;  3T2Q A;  3POS A;  1AR9 3;  5DN2 A;  1SLT A;  2HEY F;  5K0U C;  1KS4 A;  5ISL A;  1WMF A;  2IFW A;  1JMU B;  2DUQ A;  3H1W A;  5CU1 A;  3RMY A;  4FPJ A;  1ZRE A;  1TME 2;  4IEV A;  1QJZ A;  1O8S A;  2HWC 3;  1Y3T A;  1MEC 3;  1D2S A;  1RXG A;  3S5Q A;  3VDD B;  1J83 A;  4E2Q A;  4N43 A;  4OVE A;  5KXC A;  1SG3 A;  2Q8E A;  2BEO A;  1GSL A;  1NLS A;  5LEJ A;  4YW2 A;  1X50 A;  3K77 A;  2FQP A;  3C7O A;  3AMH A;  4ITC A;  2ADD A;  5FMC A;  5H9S A;  4Q1P A;  2JDH A;  1D4M 3;  4MH0 E;  4DUV A;  1CWP A;  1RUG 3;  2VU9 A;  4NPR A;  1HIX A;  3U4X A;  3LSE A;  3PJQ A;  1HRV 3;  5FKB A;  1W6N B;  4QXB A;  5KC5 A;  4Q4V 2;  3ZDV A;  1UY2 A;  4EWE A;  3CHX A;  3VZJ A;  4A45 A;  1ULP A;  3H8U A;  5A6Z A;  4JDM A;  2WWS A;  3VL8 A;  4NIG A;  4UWD A;  2FMD A;  4BQW A;  1HV0 A;  2OPK A;  2HWC 2;  3T09 A;  2HYK A;  1BEV 3;  3NWK A;  2AZ5 A;  3THT A;  3FWE A;  2HJI A;  1QMJ A;  1G9F A;  1D0G A;  1CES A;  2CV6 A;  4RQP B;  1UPS A;  3A21 A;  3E6D A;  1E5R A;  2ZZJ A;  1FMD 1;  5A3N A;  3V56 A;  2QQL A;  4LLF A;  3WXP A;  3I2K A;  5CKM A;  4K20 A;  5DZF A;  1H2K A;  1D4M 2;  4NJ4 A;  4BQ2 A;  1JZ2 A;  4XVH A;  1RUG 2;  1SLA A;  3FLT A;  4HET A;  3LDK A;  4PLN A;  5FOJ B;  1N1Y A;  1LOF A;  2NMO A;  4XQD A;  4KG8 A;  5GZD A;  2Y6H A;  1H30 A;  3OG2 A;  2RS1 1;  1NXM A;  4E4S A;  5C33 A;  2Q8O A;  1PX3 A;  4QB1 A;  4LBK A;  3JQW A;  1PK6 B;  3T0A A;  3OBZ A;  4NRP A;  2ZZQ A;  5ERL A;  4AFD A;  2W47 A;  3RS6 A;  1NAE A;  5FZ0 A;  3BVC A;  3ETP A;  5JXH A;  4I0W B;  1UWW A;  3D6E A;  3Q8E A;  1JZ8 A;  4QU2 A;  5FYV A;  1DGW X;  1W6P A;  1WD3 A;  2PTM A;  2Y6K A;  5LBF A;  2B7Y A;  4M0H A;  5F2W A;  5FZM A;  3U07 A;  1C3H A;  2ZHM A;  2R32 A;  3F95 A;  4Y24 A;  4JHZ A;  1W8O A;  4DO0 A;  1RB8 G;  2G9Z A;  4FVV A;  3KGL A;  4TXW A;  4LMF A;  3WHT A;  4OZO A;  5K8S A;  1AR7 3;  2NLR A;  3HNM A;  4N43 B;  4P9G A;  5GZF A;  5JIU A;  4Q4X 1;  1YXW A;  2CSG A;  3WF0 A;  3THP A;  2GAL A;  1EV1 1;  4OHV A;  2VZV A;  5EJ1 B;  1AL2 3;  3AB0 A;  4MV2 A;  4YM0 A;  4LEJ A;  5F2S A;  3WF1 A;  1W2O A;  3AKQ A;  1LTE A;  4RQP C;  5FY8 A;  3ZXA C;  1CGP A;  2VW0 A;  1LOD A;  3I49 A;  1OUR A;  2VBB A;  2HWD 3;  2PA7 A;  1W3V A;  2WAB A;  3A0N A;  4YG0 A;  5C3S A;  3H8X A;  3VD7 A;  3ZIW A;  3IDE A;  5C6C A;  3R05 A;  1RUF 2;  3QOP A;  4RD7 A;  4GQ7 A;  1LR5 A;  3J8F 3;  3ZSE A;  4QHO A;  1RUC 1;  4Y5Z 0;  2WS9 1;  2GME A;  4LT5 A;  1PK6 C;  1R1A 3;  2HBU A;  4JGY A;  1HW5 A;  4BZ4 A;  2C9K A;  1J58 A;  1OKO A;  3GJB A;  4AI0 A;  4EQV A;  5CNA A;  2HWE 3;  1S0J A;  2ZAH A;  4XHX A;  2VCC A;  3I2O A;  1OHF A;  3ZFF A;  2O8O A;  2ARB A;  2WNU A;  1W8W A;  5I8Y A;  1ZA4 A;  2HWD 2;  5L7O A;  2W1W A;  3BB6 A;  3OY8 A;  2P2K A;  3VBF A;  2RDQ A;  3KV9 A;  4GAZ A;  4V2W A;  1VRH 2;  4QX3 A;  1EP0 A;  3AMN A;  3MBW A;  3J8F 2;  4BCU A;  3H0O A;  2Y33 A;  4Y5S A;  5DAX A;  2VQU A;  3KMH A;  2Y64 A;  2BPA 2;  2A71 A;  4LO8 A;  2J42 A;  3SH5 A;  3U75 A;  1W6P B;  2WIN B;  4B4R A;  3LKJ A;  3TRS B;  5HBA A;  3SNM A;  3N9N A;  1POQ A;  1Y7B A;  3I3E A;  1SQ4 A;  4EN8 B;  4ERO A;  3AKS A;  3MIG A;  1W99 A;  2HWE 2;  3OGS A;  4DY3 A;  3PUH A;  2R30 A;  4EN9 B;  1QQP 1;  4ES8 A;  2GU9 A;  1HRI 3;  1X82 A;  3OBA A;  4QDS A;  1DHK B;  1GWK A;  1Y9M A;  2VZR A;  2E9Q A;  2VC9 A;  4I30 A;  1UF2 C;  2WNV C;  2GNT A;  3AK0 A;  3IT8 A;  4OI4 A;  3SLI A;  1KJL A;  2UWA A;  4Q4Y 1;  3FHA A;  1YRZ A;  3APB A;  5J09 A;  4IDZ A;  2BNN A;  3DUI A;  1PVC 3;  1LCL A;  1FV3 A;  1G86 A;  1RHI 1;  2ZTN A;  1O7F A;  4QKD A;  2RJ2 A;  4WM8 A;  3ZPY A;  1ENQ A;  3Q8A A;  5DG1 A;  3A7Q A;  3BKZ A;  2W0X A;  3AMM A;  2DCJ A;  1RUH 1;  4CP2 A;  4O7X A;  2XJP A;  2DU1 A;  3V64 A;  1X36 A;  3RQ0 A;  1YNA A;  3WP6 A;  1C8M 1;  1TVG A;  5T55 A;  1I5P A;  4HSL A;  1K12 A;  2F4L A;  1DQ2 A;  5FZ8 A;  4LO7 A;  2RS3 2;  3T2O A;  1AL0 G;  4JGY B;  4COU A;  1Z0H A;  4YW1 A;  3R4S A;  2VUL A;  4L99 A;  3ZYB A;  1F8V A;  1UOB A;  2EIB A;  3SCF A;  1IS6 A;  5A32 A;  1FOD 3;  1PVC 2;  4YM2 A;  3PVO A;  3ZFF B;  4A4A A;  4ES9 A;  4LUL A;  2WNU B;  4W6W A;  2IXL A;  4O65 A;  5FPU A;  3UYJ A;  2IWG B;  2QQI A;  3AVS A;  4COW A;  1XYP A;  5L7O B;  4PQ9 A;  1WLD A;  3OY8 B;  3ACF A;  1IG0 A;  3VBF B;  3VBR A;  2VD7 A;  3LFM A;  1LJ7 A;  1RMU 2;  4ZXE A;  2P5B A;  5A3T A;  1RIN A;  1WBF A;  3K2O A;  1CAW A;  2P37 A;  3BUC A;  5LK5 A;  3IIA A;  5E89 A;  4JQR A;  5FYS A;  5D21 A;  5LZ6 A;  1DFQ A;  1UN1 A;  1GLH A;  5L36 A;  1JUI A;  3H3Z A;  4Q4V 1;  1LGC A;  5DUX A;  1E5H A;  3WNL A;  3HQR A;  3L9J T;  5ACA 3;  1RUO A;  3C8X A;  1FOD 2;  4LA2 A;  5CB7 A;  3MLJ A;  4LBJ A;  3FHI B;  1AYM 2;  1XE8 A;  3LB9 A;  4KG0 A;  4Y1V A;  4CDW A;  4QX7 A;  4FCA A;  4Z2A A;  2GN3 A;  4YVS B;  1UKR A;  3HIF A;  3ZYR A;  1PX4 A;  1LGB A;  3ZYJ B;  1UQX A;  1AYN 3;  4UT5 A;  3N9O A;  2OYZ A;  1RVF 2;  5K7P A;  1BBT 3;  3LAG A;  1CZT A;  5HI0 A;  3PLQ A;  4JGY C;  2QUO A;  4JQT A;  2HWB 1;  1WCD J;  2JIJ A;  5LCW L;  2RM2 1;  4WM8 B;  1WUV A;  1VAL A;  1WW4 A;  2YRO A;  3LEK A;  1W8N A;  4XZU G;  3I3D A;  5C71 A;  4UF0 A;  5FXX A;  1POV 3;  5C3O A;  1Y9G A;  2ZGK A;  1A8M A;  1Q5O A;  5BPX A;  3AL5 A;  2GAU A;  1IPJ A;  4QPG A;  5FYY A;  2WQ8 A;  1YEW A;  5L7O C;  5I0R A;  2PYT A;  1WCK A;  3NKG A;  4FXK B;  4FOW A;  5CAD A;  1VIW B;  2DBI A;  4O9G A;  1NG0 A;  4Q0Q A;  4X8N A;  2FMY A;  1PGL 1;  3FMG A;  4QQO A;  4PIZ A;  2ORZ A;  1KXG A;  2CWM A;  2WUH A;  5IVV A;  2WO7 A;  3ZR6 A;  3UKN A;  5BV6 A;  1BBT 2;  3OPW A;  5A32 B;  1RUJ 3;  2QTW B;  5F39 A;  5T5J A;  1P8J A;  1LHO A;  4Q29 A;  1YC6 1;  2FHR A;  2Y0I A;  5F3C A;  1O3S A;  4AHY A;  2ZOE B;  4AHZ A;  1SAC A;  3WNO A;  4XOG A;  2RMU 3;  3AP4 A;  4L0P A;  3O14 A;  3VBR B;  5IVJ A;  5CFD A;  4JKK A;  4QX0 A;  1E5S A;  1U5X A;  1TE1 B;  2QCS B;  4K1Y A;  5E16 A;  4DZG A;  4MX3 A;  1CAW B;  2VOK A;  5A7P A;  2DFB A;  2VBD A;  2VZU A;  3MLK A;  1V6M A;  4OLL A;  4WV8 A;  3BGA A;  4ARX A;  4YGD A;  2P3K A;  3AZY A;  5FZK A;  3INA A;  1QJY 1;  2B46 X;  3M7A A;  4XHB A;  3UK9 A;  1OUS A;  3D3A A;  3OJB A;  5FUN A;  3WT3 A;  2J1R A;  3ZN5 A;  1DQ5 A;  3PVB B;  1WLW A;  4WM8 C;  1ACC A;  4OMD A;  2D6K A;  1HXS 2;  2A6Y A;  2XPJ A;  1QXR A;  2XVL A;  4CDW B;  4CDQ A;  5C8W A;  2JEM A;  4LBM A;  4Q1R A;  5C9A A;  4FTS A;  2FBE A;  2ZGU A;  1JHN A;  2ZKL A;  3POG A;  5DZG A;  2FZ2 A;  2FCV A;  1ZRC A;  3NO8 A;  1PZ9 A;  4XIK A;  4CXX A;  4PJY A;  1KFU L;  4CCE A;  4HKL A;  2MHF A;  4S2D A;  1Z7S 2;  4YW4 A;  4QWN A;  3THC A;  1F4H A;  5F5A A;  2BGC A;  3PU8 A;  3VBO C;  4PIY A;  2MPF A;  4HFS A;  2RJL A;  2PHR A;  5FQ0 A;  1XND A;  4P02 B;  2BU9 A;  4MET A;  3OUJ A;  2DCZ A;  3FUO A;  4AF9 A;  4UF0 B;  2NYY A;  4W6Y A;  3S30 A;  3VDA A;  5JR7 B;  1U5I A;  3O12 A;  2PFW A;  5C3Q A;  5FWJ A;  5JOY A;  1K5M C;  1O4Y A;  5CIS A;  4AG4 A;  4QPG B;  4GKX A;  5J48 A;  4N53 C;  2Q1F A;  4MGZ E;  3OGV A;  1VRH 1;  1XNC A;  2V72 A;  4ISQ A;  1VBA 3;  2ZMK A;  3T08 A;  5EV7 A;  1PO2 2;  3VBR C;  3LF7 A;  4FSJ A;  2FCU A;  4H7M A;  4QKN A;  1ZRF A;  4CYD A;  3LDR A;  1NLR A;  2VZ1 A;  3RZJ A;  3OGJ A;  4AVC A;  1WA4 A;  1JOD A;  1JBC A;  2X53 S;  2JWP A;  3B93 A;  3KVA A;  4PT6 A;  1VB2 A;  3NRU A;  2VBP A;  1OLQ A;  2WT1 A;  4L8Q A;  4Q4W 3;  2IZW A;  5IWF A;  3JB4 C;  1HX6 A;  1T6G C;  2OVU A;  4ASL A;  4Y1U A;  4B7K A;  4DIQ A;  1RUE 2;  2K9Z A;  3ZOI A;  4S2F A;  5CFD B;  2G9F A;  1WW5 A;  2WLP A;  1L7R A;  3AP5 A;  3FUQ A;  4A41 A;  3MIH A;  3WHU A;  5FLJ A;  4FPY A;  1WW7 A;  2PHF A;  3D0S A;  1VBA 2;  4CDU A;  1BVP 1;  1V00 A;  1F2N A;  4SLI A;  2VVD A;  3H7Y A;  3AVR A;  3O0V A;  1GYK A;  3G6J B;  3HNB M;  3Q8B A;  3A4U A;  1I1E A;  1SFY A;  4M0N A;  4C90 A;  1I6X A;  4YZ5 A;  2IXK A;  4QQH A;  2ZX3 A;  4MGT A;  3AZZ A;  3C7H A;  3HBK A;  2WO3 A;  4YZ2 A;  3UNP A;  1H2N A;  4TWT A;  2FDG A;  4GAL A;  3VHO A;  3OCP A;  2WLQ A;  3EBR A;  4CDQ B;  4NPM A;  3RRD A;  4F83 A;  5C9A B;  4Z07 A;  1OD3 A;  4HT1 T;  4QPG C;  1O3Q A;  2BQP A;  2KA3 A;  2RS3 1;  1SDW A;  1AUY A;  1FMD 3;  3TN9 1;  4AI8 A;  4LOR A;  3LQC A;  3CJI A;  4MO3 M;  2IXH A;  4G4F A;  2R06 3;  4NHK A;  5IK4 A;  5FO8 B;  5FQ0 B;  1EAH 2;  1XNA A;  4IND A;  5E6H A;  1O8P A;  1J3Q A;  2GC0 A;  4J1W A;  4Y1Y A;  3PUR A;  1OPM A;  2RS1 3;  2WFF 3;  2R0F A;  1F9K A;  2AH2 A;  2Z69 A;  3GBG A;  4LKD A;  4EN7 B;  2VCB A;  4GWN A;  4V2V A;  3K46 A;  4D8M A;  3TOJ A;  1AXK A;  4HAN A;  1K5J A;  1AR8 3;  2PHL A;  5IT6 A;  5FK8 A;  4FPO B;  1XQN A;  1QOT A;  1UMI A;  4GXL A;  5DMY A;  4WVW A;  4IUG A;  2HWF 1;  4D7Y A;  1FMD 2;  1CR7 A;  3NAP A;  1SFP A;  4K1Z A;  4A2U A;  2P1B A;  3MF9 A;  4IQP A;  4XF1 A;  4EE2 A;  2JDZ A;  4A7K A;  2BWA A;  4Z1V A;  2VOW A;  4BK5 A;  4NR1 A;  2UUR A;  4N8M A;  4LO4 B;  4XF3 A;  3OEA A;  1BYH A;  5EYX A;  2VTX A;  1A8D A;  1KDK A;  4CUB A;  1DDL A;  4Q4X 3;  3SC7 X;  2R04 1;  4UW6 A;  1OD5 A;  1URX A;  1RVF 1;  1EUT A;  4BJ0 A;  5C9A C;  1HN0 A;  2CU5 A;  1W05 A;  2VGD A;  1PMI A;  4RYD A;  4CDU B;  4ASK A;  5K0U A;  2Z79 A;  3L2H A;  4K6B A;  4XFF A;  5A33 A;  5HCA A;  4QX1 A;  5LK7 B;  5IVF A;  5FXW A;  4UBH A;  3B5L B;  3WG1 A;  4AZZ A;  4QU1 A;  5FYT A;  1IQD C;  3KCX A;  2D3P A;  2WZP P;  1O4T A;  1SCS A;  4Q0P A;  4XAE A;  2A73 B;  2ZGO A;  2QFE A;  3WLU A;  2Q8C A;  4QX8 A;  3RZL A;  1X8M A;  1AX1 A;  1BZW A;  1G6N A;  4H7L A;  2DCY A;  5FY0 A;  4BME A;  3ACH A;  3EXU A;  1RUC 3;  2TEP A;  4QPI C;  2WS9 3;  3ACL A;  3WNX A;  4FBF A;  5FO9 B;  1OBN A;  2RV9 A;  4Y1X A;  2ZAA A;  2Q8D A;  1UXX X;  3VZK A;  1JYN A;  2XQX A;  1TZO A;  4Q4X 2;  1JN2 P;  1O91 A;  1KDM A;  2ET7 A;  2W3J A;  1EV1 2;  1D2Q A;  5H9R A;  3U4S A;  3KT4 A;  5CFC C;  4URA A;  3CJI B;  1WMD A;  3NL1 A;  4NE9 A;  3FN9 A;  3WDW A;  3VLB B;  1JW6 A;  2JG9 A;  3UKV A;  1OMI A;  3ZYG A;  3HPN A;  1IS4 A;  1NX9 A;  4QM8 A;  3WDU A;  5FV3 A;  2YZ4 A;  5LEK A;  4YVW C;  3ACI A;  3BI3 A;  2BUK A;  5FZ1 A;  2AC1 A;  3NV1 A;  1ZZ6 A;  2J1E A;  2ZHL A;  3IPV A;  3K75 B;  3KF5 A;  4J6G A;  4UYB A;  2XQR A;  4CP1 A;  2BOI A;  2EIG A;  4B29 A;  3QH6 A;  1DU3 D;  2W52 A;  4GA9 A;  1CJP A;  2ZGN A;  3AYA A;  1EY2 A;  1W0P A;  2EVX A;  4GIQ A;  1SMV A;  1HQL A;  4BIS A;  3WD5 A;  1O5L A;  1JYX A;  3NJV A;  1G7Y A;  2KXL A;  2A3W A;  3R6S A;  4CDU C;  5T5L A;  5A70 A;  3NAP B;  4D6S A;  1UYX A;  3VKN A;  4MYE A;  3AZX A;  3RZH A;  5C7G A;  4LKS A;  4Q26 A;  1ASJ 1;  4Z82 A;  3BPS A;  3JBG 1;  4FQZ A;  3MZH A;  3KZ4 C;  4BPZ A;  4FTE A;  2YDE A;  2AGS A;  1F4A A;  5CZK A;  4YGB A;  1ZBE 1;  3CBN A;  2OKX A;  4IGQ A;  1UIK A;  4Q4Y 3;  4TTG A;  4YVS A;  1ZZB A;  3S7E A;  1S4C A;  2A6Z A;  3NVC A;  4NAO A;  4YSF A;  1DGR N;  2GC1 A;  3HBZ A;  4FPK A;  3I2G A;  4AQS A;  4N9H A;  5K0U B;  1AJK A;  3M3E A;  2B4K A;  2ZGP A;  3PU3 A;  4IV3 A;  3MID A;  4I3G A;  4RS5 A;  4XFH A;  3QD6 A;  5A33 B;  2OPW A;  3CJI C;  5FCC A;  5LA1 A;  5C5T A;  1IHM A;  1BHG A;  3M3Q A;  2TBV A;  4UAP A;  4Q8K A;  2XH6 A;  3KM5 A;  2XWB B;  3IZO A;  2BVV A;  4HLT A;  2VCA A;  3THD A;  1RUH 3;  1XOY A;  2BFU S;  2Y34 A;  4FTB A;  3S0M A;  1YQ2 A;  1C8M 3;  1HB2 A;  1JXN A;  1QJX 3;  1VBC 3;  2VOT A;  2D7F A;  2Y6F A;  3R4U A;  4OYU A;  5GJ6 A;  4E4Z A;  1QQP 2;  4QDR A;  1VBE 3;  1BK0 A;  5EHD A;  5LRR A;  4AAX A;  4GUL A;  3KS7 A;  1MS8 A;  2TNF A;  5GM0 A;  4WVM A;  4Z92 B;  4A3X A;  2W39 A;  5FUI A;  1RJ7 A;  3AFK A;  4EZH A;  1LES A;  1OC1 A;  2JG9 B;  2VQ0 A;  1RHI 2;  1IQA A;  2JIC A;  1ND2 C;  4XBN A;  2G1M A;  2IUW A;  1WCQ A;  4JKM A;  3H50 A;  4AEM A;  2FDH A;  1WCS A;  1APN A;  4P9I A;  4YZ3 A;  2B5H A;  4FFH A;  1ULO A;  4M3C F;  4DRV A;  1S0D A;  4A7Y A;  1RUE 1;  1W2U A;  1W9Y A;  1RUH 2;  3IPV B;  3OD4 A;  3ZDS A;  5JPN B;  3LA3 A;  1BQP A;  4K7J A;  4RFR B;  1C8M 2;  3J7L A;  2RDR A;  2C9A A;  3D8C A;  4BQ5 A;  3PMS A;  1TQ5 A;  4I01 A;  5KHH A;  1S0I A;  4E9K A;  3VD9 A;  1LU2 A;  3KCY A;  1OA2 A;  2XJU A;  2XKO A;  2ZBJ A;  2W87 A;  2BBA A;  2BV4 A;  3ZKY A;  4LQR A;  5JVV A;  4Q4V 3;  4IV1 C;  1W04 A;  1MZ5 A;  2HH9 A;  3ACG A;  4P14 A;  1CX4 A;  4NOT A;  4UOJ A;  5A7O A;  3JZV A;  3OUH A;  3RJR A;  1SLC A;  3LCP A;  4OI0 A;  1UNB A;  4JGZ A;  3ZXG A;  2PLV 1;  2VG9 A;  1GQP A;  3N7L A;  4O61 A;  5T54 A;  1ZRR A;  4ISR A;  3TEW A;  3BAL A;  3T2T A;  1PMH X;  4XUQ A;  4NVP A;  3WQ0 A;  4NWV A;  1BXH A;  4BQX A;  4H2A A;  1KFX L;  1AZD A;  5IVE A;  3Q8F A;  2RE9 A;  5L73 A;  5FDB A;  1MS5 A;  1MR5 A;  1ZZ9 A;  3HOB A;  4PBO A;  2ARA A;  1QNY A;  3WP4 A;  1AX2 A;  2W1S A;  4D94 A;  1ODM A;  1YYN A;  2A7A A;  2H6B A;  4IV3 B;  5DQ0 A;  2HWB 3;  3HQX A;  4RS5 B;  1N3Q A;  1SPP A;  4C1W A;  1EAH 1;  1QIQ A;  1QXJ A;  3J26 N;  2XLF A;  4IE5 A;  3SEE A;  3VV1 A;  2JG9 C;  4NIH A;  1H8V A;  3BTX A;  1RL3 A;  2QDR A;  2VR4 A;  4XF0 A;  3GGL A;  2EIC A;  2VH9 A;  3A0K A;  1LHN A;  4HPK A;  3ZKU A;  1TMF 1;  3K51 A;  4E8C A;  4XFG A;  4AVT A;  5JSO A;  1FI2 A;  2R07 1;  2WNV A;  3W9A A;  2K46 A;  2LRP A;  4LJH A;  2VAU A;  3N9M A;  4Q0S A;  2EAK A;  2YBK A;  4WVM B;  5L9R A;  1KGY A;  5JPM B;  3NV3 A;  4G3Y C;  3H1Y A;  2BNO A;  4XBQ A;  2OA2 A;  5DAB A;  3LEM A;  2YC0 A;  2ZGS A;  2HWB 2;  4JV4 A;  1BLZ A;  2RM2 2;  3B9I A;  3B01 A;  2E63 A;  3LPF A;  3AJY A;  1J1T A;  3N7J A;  4FFI A;  1T6B X;  3GAL A;  3JB8 A;  2JDK A;  2ZAB A;  1VMJ A;  2VMD A;  3FLP A;  4CUG A;  2SLI A;  2ARX A;  4FOV A;  2E31 A;  4LIT A;  5L19 A;  1MS9 A;  4NRQ A;  4XIO A;  5HCB A;  4ZPI A;  2JG8 C;  5HCF A;  4AEK A;  4GWI A;  2ZMN A;  5AFB A;  5LA0 A;  1ULG A;  3NV2 A;  1QJY 3;  3IM0 A;  1PGL 2;  2YBP A;  4LK6 A;  4MGK E;  1TNF A;  4YAR A;  2LAL A;  2VZS A;  1JZ5 A;  1SHW B;  4IV3 C;  5LBB A;  4RS5 C;  4JCK A;  4NHM A;  1ZZ8 A;  4YW7 A;  2D5F A;  2WA3 A;  1RUF 3;  4JGZ B;  3ZR5 A;  3W20 A;  1Q8O A;  3ZM8 A;  4MG2 A;  2WAO A;  3GXU A;  4CCO A;  1CD3 G;  1UU4 A;  2J22 A;  3I59 A;  4L9B A;  2WL1 A;  3PUA A;  3IDA A;  4AK3 A;  4XET A;  4JVA A;  4BM8 A;  2B45 X;  4YW3 A;  4E4H A;  1LEM A;  3PL0 A;  4YM1 A;  3GZE A;  2R49 A;  3PTR B;  1ZRI A;  4B3N A;  3SKV A;  3ME2 A;  2YGL A;  5KBF A;  2GMP A;  4EWA A;  2YYO A;  1DYO A;  4HN0 A;  4KL1 A;  2EXK A;  4URT A;  1SPP B;  1UY1 A;  4ATE A;  3POE A;  1QJY 2;  1V9U 1;  1B35 C;  4QHB A;  1LHU A;  2ZX2 A;  4XTP A;  4TLG A;  1F5F A;  1W8H A;  3M3O A;  2A1X A;  1X9T A;  1WD4 A;  5FYI A;  4HPK B;  4MVT A;  1VRH 3;  5A3P A;  3RVH A;  2WA4 A;  4MGY E;  3MUY 1;  4LTA A;  1PGS A;  4UFL A;  3T4H B;  3DXT A;  5F37 A;  2XL7 A;  2ARE A;  1WKY A;  2WNV B;  2R16 A;  3VHR A;  3NV4 A;  5FZ7 A;  4E2S A;  3C2U A;  2AEN A;  2Q5T A;  5FKC A;  2NM1 A;  5A80 A;  3VZM A;  1PM4 A;  1QJE A;  5LB6 A;  1OA3 A;  2JE7 A;  1GU3 A;  1OT5 A;  2H0V A;  5C8C C;  3MYX A;  1VBB 1;  3VD4 A;  3U78 A;  2IFR A;  1JZ3 A;  2GSY A;  3DKQ A;  3LDB A;  1QH7 A;  3H42 B;  3U10 A;  2DUP A;  3BOD A;  4C1X A;  5IVC A;  4QHZ A;  5CYY A;  1CZS A;  4WZC A;  2F4P A;  5FBJ A;  1C28 A;  3IAP A;  2DTY A;  1DQ4 A;  4XZP A;  3ECQ A;  2E33 A;  2H6C A;  3ZSL A;  2VXR A;  4JGZ C;  4R8H A;  3RDI A;  5IHR A;  1J3P A;  1IOA A;  1VBD 1;  5F8P A;  4HK8 A;  5FPA A;  5FPB A;  1U5Y A;  1QNW A;  2JEN A;  2ID4 A;  2OZ6 A;  4GJY A;  5BXX A;  2JB8 A;  3WOG A;  4CUA A;  5JZG A;  5FYZ A;  2NN8 A;  5FJK A;  3KQ4 B;  1JYV A;  3I2F A;  1WLC A;  1DGW A;  2P17 A;  5LAS A;  1ULC A;  4MOA A;  4XF9 A;  2Z2S B;  5I0S A;  4XBL A;  4X6Q B;  1W2T A;  1W03 A;  1OF3 A;  1H2L A;  1ODN A;  1O6U A;  1ULD A;  3LPG A;  2J7M A;  4ZU7 A;  4L11 A;  3JD7 1;  1HKD A;  2YC4 A;  2WZE A;  1PMJ X;  1YFW A;  2WYF A;  3BTY A;  1GNY A;  4AGG A;  4JRL A;  4CU9 A;  5FZL A;  2AYH A;  4RL7 A;  3TAY A;  1X7N A;  3I59 B;  1Q8V A;  1GWL A;  4Y22 A;  1WWY A;  3ILF A;  3BIE A;  2RS3 3;  5JSP A;  1JU4 A;  1CJD A;  4XUR A;  1QDO A;  1R09 1;  2VM9 A;  5FPV A;  4N7U A;  4JC1 A;  5F3G A;  4AI2 A;  3OD0 A;  2NP0 A;  1QY4 A;  1YFX A;  2JX9 A;  2JXA A;  2XWJ B;  1YHF A;  4AW7 A;  5FRA A;  3ZYI B;  2CAV A;  2GC2 A;  3FLR A;  3WIN E;  3WW1 A;  3KV4 A;  2W1U A;  5CKQ A;  1AF9 A;  3MIE A;  5EJ3 A;  5CBL A;  3B9C A;  3CL1 A;  4H14 A;  1D7P M;  2TUN A;  4CUC A;  4DXS A;  2Y60 A;  1H4H A;  3AJZ A;  4P9Y A;  5G05 L;  4PQQ A;  3I2I A;  3IDC B;  3DYP A;  1KRI A;  1W6Q A;  3WEZ A;  1XNK A;  2E32 A;  3H8O A;  4IW3 A;  1RMU 3;  1QKQ A;  2XR4 A;  4OQ8 A;  2V73 A;  2ZX1 A;  4R4Z A;  3OEB A;  2XON A;  2VTX J;  4K8R B;  3HR9 A;  3HQU A;  3LA2 A;  5DPN A;  3NNF A;  3VBO A;  4HVQ A;  5FO7 B;  3MI8 A;  4DQA A;  4P5H A;  1NQJ A;  3TN9 2;  4AHX A;  2QQO A;  3AKT A;  5FAX A;  4F7Z A;  1GOH A;  3PIJ A;  5DAW A;  5A7W A;  3O0W A;  1AJO A;  2ZEZ A;  1OLR A;  4OI2 A;  5FFO C;  5FMB A;  3ZVX A;  1DGR A;  4WM7 C;  5B4X A;  4TLF A;  4CXW A;  4LKF A;  5IVB A;  1UIJ A;  1AYM 3;  1L3J A;  2WNO A;  1SBE A;  4OQ9 A;  1K5M A;  1UX6 A;  4IEY A;  4XFA A;  5HPO A;  4A44 A;  4N53 A;  2XDV A;  4XXA A;  2MNG A;  4QKF A;  5FIX A;  5FZF A;  2Z42 A;  3RYR A;  2V5Y A;  4YFW A;  3VZL A;  5JMO A;  2YUE A;  5T5P A;  4JDN A;  1RVF 3;  2G19 A;  3ZX7 A;  1G9A A;  5FMO L;  5JZG B;  1W9F A;  3WDY A;  2WZR 2;  1LU1 A;  5FBZ A;  4IEW A;  2DVA A;  3ILN A;  1IS3 A;  4I09 A;  3AZW A;  3BOP A;  1ZYB A;  2E6V A;  2DBN A;  2HWF 2;  2PMW B;  2UU8 A;  5F5C A;  1UCX A;  3KV5 A;  1FX5 A;  4QD2 A;  3AYD A;  4PLM A;  3LA7 A;  2QZ2 A;  2IXJ A;  3VBU C;  4DMI A;  4IEX A;  3WP3 A;  4KWK A;  4HG6 B;  4BU2 A;  3BU7 A;  5ABJ C;  4LHK A;  1QU0 A;  4RGA A;  4Y22 B;  4FPL A;  3ZN6 A;  4DPN A;  5CA6 A;  1IS5 A;  2RS5 1;  3MF6 A;  2DCT A;  2D6P A;  4QM9 A;  2R04 2;  5LA9 A;  4AHW A;  2EXH A;  4AQ2 A;  5K9Y A;  3MGU A;  2ZEX A;  4UFH A;  1ONA A;  3B7M A;  1UD1 A;  4IEP A;  1FT9 A;  2D3R A;  2XB6 C;  2PXJ A;  2YV8 A;  4MGI E;  4R9B A;  3H3U A;  2QZ3 A;  4QQP A;  5DUV A;  4D3W A;  5GLW A;  1PZ8 A;  3K4A A;  2A6X A;  1QJU 1;  2XJQ A;  3POI A;  4K3U A;  1CPM A;  1AR9 1;  4BB3 A;  2WJS A;  4A6O A;  5AC9 2;  3AXD A;  2HEV F;  4TZD A;  1CQ9 A;  3AP9 A;  1JZ4 A;  2BYV E;  4YW6 A;  1QDC A;  2V09 A;  3OOX A;  3POW A;  3LD8 A;  1W6Q B;  1QEX A;  4P9W A;  3QLQ A;  5KHG A;  3D0J A;  3GHM A;  2ZGM A;  3PUQ A;  3RZG A;  2CGN A;  3GZA A;  3OGR A;  4LUM A;  3R4D B;  1PNG A;  4MGS A;  3UV9 A;  1MZ6 A;  1H8T C;  2XOM A;  2XVK A;  3EB7 A;  3O7O A;  4AYU A;  5LRS A;  3KCC A;  1YWK A;  2E7A A;  4FOQ A;  4UFJ A;  3T3Y A;  3POJ A;  3VBO B;  5JZG C;  1CIW A;  2GNM A;  3EO6 A;  5A7Q A;  1GZC A;  4ATF A;  4MHU A;  5JI7 A;  4CCM A;  1OH4 A;  1QJF A;  4S2H A;  1IZ3 A;  2FZ1 A;  1O4Z A;  3DKW A;  2O8Q A;  4GMP 0;  5A7W B;  2VZP A;  2WN2 A;  5H9Q A;  1ASJ 3;  4D7T A;  4E2G A;  1OQD A;  3WF4 A;  4GWJ A;  1HRV 1;  4SBV A;  1HXS 3;  1UO9 A;  2VUC A;  3MW3 A;  4XW3 A;  4CP0 A;  2RDN A;  3WUD A;  1OLM E;  1K5M B;  2Y38 A;  3MO4 A;  5T3N A;  4AAP A;  5KXE A;  1DLC A;  3GBW A;  4N53 B;  2R7E B;  1ZBE 3;  3KB5 A;  2C4X A;  1W0N A;  4XIL A;  3WP5 A;  3RI9 A;  1E57 A;  1GP6 A;  1CIY A;  5JLV A;  4N7I A;  4DUW A;  2Z5W A;  3ORJ A;  4HON A;  3P6B A;  4P9J A;  3WVJ A;  1BEV 1;  1Z7S 3;  2YMZ A;  4C91 A;  4ZU5 A;  3IB3 A;  4AI3 A;  4DXR A;  2VW1 A;  4QXC A;  5EYY A;  4RGG A;  2D6M A;  5JSR A;  3POF A;  5FP3 A;  2CTV A;  2X5I C;  1VJ2 A;  1BKZ A;  1YLL A;  4XCA A;  3U1X A;  1R64 A;  2BBV A;  2ZCW A;  1O5U A;  3GM8 A;  1PO1 1;  2A75 A;  2DU0 A;  3CU7 A;  3SHR A;  1REF A;  4BQ1 A;  1KJR A;  2VZQ A;  4QX5 A;  4L92 A;  3URF A;  2MEV 1;  4CP9 A;  2RHP A;  4DB5 A;  4HK9 A;  4OMC A;  2IVJ A;  5JR2 A;  1PNF A;  2QQM A;  3NST A;  1ASJ 2;  4A6S A;  3JBG 2;  2VVE A;  4BIO A;  4IE6 A;  2ENR A;  1FV2 A;  1GZ9 A;  2DVG A;  4BQ4 A;  1PO2 3;  3JU9 A;  2CGO A;  2ARC A;  3ZN6 B;  5GLZ A;  4RHV 1;  5KWR A;  5IK7 A;  1ZBE 2;  3ELN A;  4NID A;  3NJX A;  2NZ9 A;  4IEQ A;  2IC1 A;  4BK4 A;  2GH8 A;  5KXD A;  1LHW A;  2VMI A;  4OCT A;  3I2D A;  4LA3 A;  5BNQ A;  3RWK X;  1HB3 A;  4CCK A;  4UFK A;  3VKF C;  3JUU A;  3ZXJ A;  2JE8 A;  1NE6 A;  3N7M A;  5M0T A;  2P3J A;  5GLT A;  2CDP A;  4LKE A;  3RNS A;  2PEL A;  4N90 A;  2ERF A;  2QNK A;  2W68 A;  4HL0 A;  1B09 A;  1VMF A;  4A3Z A;  1RUE 3;  4W8J A;  1SLB A;  2R1B A;  1WMX A;  4QPI A;  1H9P A;  3KWV A;  4LBQ D;  4B4Q A;  2WYS A;  1FYU A;  2BOJ A;  2WO2 A;  3ZYP A;  4ZXK A;  1DCS A;  1PVX A;  1AR7 1;  2D6N A;  3MFC A;  2C5D A;  4LHL A;  1W2N A;  2ZHN A;  5CFC A;  4HXC A;  1GQG A;  2WO1 A;  2EIE A;  3VBS C;  1N47 A;  1OQ1 A;  4DNY A;  2JKB A;  2PHX A;  5FLI A;  2BNM A;  1V6K A;  2D3S A;  3CZJ A;  2ZX4 A;  5JWP A;  1KQR A;  4N9I A;  2Y6L A;  3AMQ A;  3I97 A;  2PLV 3;  1UYP A;  4YVW A;  4MXW A;  1OFS A;  3GBF A;  4NAM A;  4MZU A;  1OSG A;  2VL4 A;  3WDX A;  3I2J A;  3HMY A;  2VPV A;  3WNN A;  1GAN A;  2P6H A;  3WUC A;  2EAL A;  4QT6 A;  4CEW C;  5IK8 A;  4UW4 A;  2GC3 A;  1A6C A;  1UZ0 A;  3ZLI A;  3VHN A;  4R9D A;  1GMM A;  4AI9 A;  3WCR A;  1GZW A;  4OUL A;  1NOV A;  3ZMO A;  5CKN A;  1NE4 A;  3FC0 A;  1AVB A;  4AVV A;  3P3N A;  1COV 1;  1EAH 3;  5LWB A;  1XNB A;  2ET1 A;  5C4W A;  2XLA A;  4F3J A;  4BA6 A;  3BTZ A;  2FDF A;  3MW2 A;  5L9B A;  4CP9 B;  5A3W A;  3CQO A;  3MPP G;  3X29 B;  3U0Z A;  4JDO A;  3T0B A;  2AR6 A;  3O1S A;  2VJX A;  2Q30 A;  1RC6 A;  3KGZ A;  1ZNP A;  2PLV 2;  2Q1Z B;  3I3M A;  4GZ9 A;  1UX7 A;  4EN6 B;  5FYB A;  1VRB A;  4YM3 A;  1R1Z A;  3SH4 A;  5A3U A;  4Y3O A;  5DAP A;  3E97 A;  1RUI 2;  3OGG A;  3N9Q A;  4IL7 A;  5D8A A;  5FP7 A;  2WKK A;  1IPS A;  5ANQ A;  2G4I A;  1DLL A;  2HEW F;  2D93 A;  4DRR A;  1X8E A;  1JYI A;  3N3H A;  2DWR A;  4QX2 A;  5EPA A;  2V4A A;  3RYK A;  2EID A;  2AEY A;  1C5I A;  1TEI A;  4QXK A;  4Y1Z A;  5GAL A;  2KD7 A;  5LA2 A;  1SEF A;  3AYC A;  3QBQ A;  3SMH A;  3USU A;  3NW4 A;  1KIT A;  4XE9 A; 
#chains in the Genus database with same CATH homology
 4DEV A;  5IFP A;  2ZEY A;  3FL7 A;  2HYX A;  5G04 L;  3MV1 1;  1W9S A;  2W92 A;  1WCQ A;  4JKM A;  1UY3 A;  3F2Z A;  1ULO A;  2C9K A;  5IJR A;  5EIY B;  4DEQ A;  2LW8 A;  2VZO A;  2VCC A;  2X10 A;  1W9W A;  3IAQ A;  3VD9 A;  4BXS V;  1O59 A;  2J1T A;  3CDZ B;  2W87 A;  2W1W A;  2BBA A;  3C7F A;  4LQR A;  2QBX A;  3SKJ E;  5I0D A;  5JUV A;  3ACG A;  4QX3 A;  4UOJ A;  1T2X A;  3MBW A;  4LPL A;  1GQP A;  2VQU A;  2VME A;  2Y64 A;  5JXJ A;  1PMH X;  4XUQ A;  3HNY M;  3I3E A;  3HOB A;  1W99 A;  5J1X A;  3OGS A;  2W1S A;  3PUH A;  5DQ0 A;  5JXI A;  1NUK A;  3JXS A;  3OBA A;  4QDS A;  2VZR A;  3SEE A;  2VC9 A;  4P08 A;  2VR4 A;  3FHA A;  3GGL A;  2EIC A;  4E8C A;  3WNP A;  2VQT A;  4E8D A;  2RJ2 A;  4UI9 L;  4W4Z A;  1KGY A;  3A7Q A;  2DCJ A;  4MAD A;  1TVG A;  3W5M A;  1I5P A;  1K12 A;  2XHN A;  2W1Q A;  2J1U A;  3T2O A;  3LPF A;  4CU7 A;  2EIB A;  4FI9 A;  5C70 A;  2VMD A;  2E31 A;  4A4A A;  2QQI A;  4GWI A;  5LA0 A;  3VD3 A;  3VDB A;  5B4N A;  2V4V A;  3I2H A;  3ACF A;  2VZS A;  4DUX A;  1JI6 A;  1SHW B;  1JZ5 A;  4ZXE A;  4QAW A;  1JYW A;  1K45 A;  4QB6 A;  4W50 A;  3ZM8 A;  2WAO A;  3GXU A;  4D0Q A;  2W9X A;  1JZ7 A;  3C7G A;  2WBK A;  2J22 A;  3IDA A;  3P1I A;  3CKH A;  3U37 A;  3WNL A;  3MUZ 1;  3SKV A;  3C8X A;  4JKL A;  4XUP A;  1DYO A;  2YC2 A;  2DDU A;  1UYY A;  4Z2A A;  1UY1 A;  1PX4 A;  2JDA A;  2BZD A;  2W91 A;  1CZT A;  5HXM A;  3I3B A;  1EUU A;  3MUY 1;  2YFZ A;  2VZ3 A;  2Z4F A;  1WKY A;  2C26 A;  3A23 A;  5LCW L;  2VMC A;  4QDQ A;  3LEK A;  1W8N A;  4XZU G;  3I3D A;  3UET A;  5C71 A;  4ARY A;  1GU3 A;  1OT5 A;  3VD4 A;  3OB8 A;  1JZ3 A;  3FHQ A;  2WZ8 A;  2WQ8 A;  1JU3 A;  1UMH A;  5CYY A;  1CZS A;  1XNT A;  4PF1 A;  4MGQ A;  2PQS A;  3IAP A;  4XUO A;  3ECQ A;  2E33 A;  2ORZ A;  5IHR A;  2WUH A;  4CUA A;  2ID4 A;  3T0D A;  1P8J A;  1UY4 A;  1JYV A;  5JXG A;  3I2F A;  2Y6G A;  1K42 A;  3AC0 A;  4MOA A;  3WNO A;  4XUT A;  1OF3 A;  4L0P A;  3CMG A;  4JKK A;  4YPJ A;  4QX0 A;  3LPG A;  3WNK A;  3W5N A;  2J7M A;  2YC4 A;  2WZE A;  1PMJ X;  1GNY A;  2VZU A;  4CU9 A;  2DCK A;  1L7Q A;  3BGA A;  4ARX A;  3CZU A;  3EYP A;  2JD9 A;  1JU4 A;  3D3A A;  4XUR A;  2VM9 A;  2J1R A;  4A42 A;  3VD5 A;  4CVU A;  4OMD A;  1CZV A;  3T2P A;  2W1U A;  4M4R A;  4DXT A;  3NQH A;  1D7P M;  4CUC A;  4DXS A;  3WNM A;  3HEI A;  5G05 L;  3C7E A;  4PQQ A;  3I2I A;  4KMQ A;  3DYP A;  2ZEW A;  3THC A;  1F4H A;  2E32 A;  3WEZ A;  3LEI A;  1GUI A;  2W46 A;  1H6X A;  2ORX A;  1J84 A;  4P00 B;  3OEB A;  4P02 B;  2XON A;  5DPN A;  5A1A A;  3VDA A;  2ZXQ A;  1KEX A;  2QQO A;  4AG4 A;  1GOH A;  2Y8K A;  4OUE A;  3OGV A;  2V72 A;  2ZEZ A;  5B4X A;  3T08 A;  1RYY A;  3HN3 A;  1W9T A;  5HPO A;  4A44 A;  5JMO A;  3NNG A;  2W5F A;  2VZ1 A;  2Y6J A;  2J1V A;  1JHJ A;  4PT6 A;  1GOG A;  3NRU A;  3WSO A;  2LS6 A;  3WQB A;  2CDO A;  2E26 A;  2QQJ A;  3E1F 1;  2QQN A;  1JZ6 A;  3LE0 A;  2J1S A;  4A41 A;  1L7R A;  4KI5 M;  2WDB A;  4HG6 B;  1UYZ A;  3K4Z A;  4JX0 A;  3HNB M;  4RN5 A;  5IFT A;  2ZEX A;  5F7U A;  3C7H A;  2WO3 A;  4ZY9 A;  3UNP A;  2X09 A;  3K4A A;  2J1A A;  4A6O A;  3SEP A;  1OD3 A;  1JZ4 A;  1XC6 A;  3J7H A;  2VO5 A;  2BGO A;  3LQC A;  4MO3 M;  1CX1 A;  1UXZ A;  3DYM A;  2VZT A;  2VMF A;  5EJZ B;  3WF4 A;  3OGR A;  4MGS A;  3EB7 A;  1XPW A;  2XOM A;  1XNA A;  2YFU A;  2YB7 A;  2HLE A;  1GOF A;  1O8P A;  1US3 A;  3BN6 A;  1OH4 A;  4XUN A;  1K3I A;  4ZZ8 A;  2VZP A;  2VCB A;  2WN2 A;  2YG0 A;  1LNS A;  3K46 A;  4D8M A;  4GWJ A;  4CU8 A;  3K4D A;  3MO4 A;  1UMI A;  5DMY A;  1DLC A;  2R7E B;  4IUG A;  2C4X A;  1W0N A;  2WAA A;  1CIY A;  4DUW A;  2W95 A;  3P6B A;  4DXR A;  4KWU A;  3DEC A;  3IB3 A;  2VTF A;  3UES A;  1TG7 A;  4BK5 A;  3T2Q A;  3OEA A;  4QPW A;  1R64 A;  2WN3 A;  5DN2 A;  4CUB A;  3GM8 A;  1H6Y A;  2VZQ A;  4BJ0 A;  1EUT A;  4OMC A;  1MPX A;  5JR2 A;  1O8S A;  2QQM A;  4RYD A;  1J83 A;  4QX1 A;  1SG3 A;  1SDD B;  4CU6 A;  4QB2 A;  1IQD C;  3WF3 A;  3K77 A;  3C7O A;  3NJX A;  2BER A;  4BK4 A;  3HJR A;  2B9V A;  3CIH A;  4DUV A;  3ACH A;  2JE8 A;  2RV9 A;  2CDP A;  2X05 A;  1UXX X;  2JKX A;  2W94 A;  1JYN A;  2XQX A;  1UY2 A;  4A45 A;  4A3Z A;  1ULP A;  2W3J A;  4W8J A;  4P5Y A;  3FN9 A;  2WYS A;  2WO2 A;  2V5D A;  3T09 A;  4ET7 A;  3GDB A;  3HPN A;  1NX9 A;  2WO1 A;  2EIE A;  1US2 A;  3A21 A;  3DYO A;  3ACI A;  1UY0 A;  2QQL A;  1DP0 A;  3CZJ A;  2J1E A;  3I2K A;  3K75 B;  1HN1 A;  3LEG A;  4M4P A;  1JZ2 A;  2Y6L A;  4XVH A;  3I97 A;  3III A;  2VL4 A;  1JYX A;  3I2J A;  3NJV A;  2Y6H A;  3WNN A;  2RVA A;  3OG2 A;  1UZ0 A;  2QQK A;  1PX3 A;  4QB1 A;  1GMM A;  1UYX A;  3T0A A;  5IYY A;  5C7G A;  4LKS A;  2W47 A;  1NAE A;  2L9L A;  3ETP A;  5JXH A;  1UWW A;  3A22 A;  1JZ8 A;  3MV0 1;  4ZZ5 A;  1F4A A;  5CZK A;  2OKX A;  2Y6K A;  4TTG A;  2BGP A;  3CQO A;  3WF2 A;  3T0B A;  1NKG A;  2VJX A;  4JHZ A;  1W8O A;  3I2G A;  3ABZ A;  4GZ9 A;  2B4K A;  4TXW A;  1UX7 A;  4OZO A;  3HNM A;  4BDV B;  5LA1 A;  1BHG A;  3VDC A;  4UAP A;  3WF0 A;  2VCA A;  3THD A;  1OF4 A;  2VZV A;  5EJ1 B;  3WF1 A;  3PUI A;  1YQ2 A;  2VOT A;  4OYU A;  4QX2 A;  4QDR A;  2EID A;  4AAX A;  2WAB A;  2KD7 A;  5LA2 A;  3VD7 A;  5FUI A;  4LHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...