1UY1A

Binding sub-site dissection of a family 6 carbohydrate-binding module by x-ray crystallography and isothermal titration calorimetry
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
132
structure length
132
Chain Sequence
SPIRRDAFSIIEAEEYNSTNSSTLQVIGTPNNGRGIGYIENGNTVTYSNIDFGSGATGFSATVATEVNTSIQIRSDSPTGTLLGTLYVSSTGSWNTYNTVSTNISKITGVHDIVLVFSGPVNVDNFIFSRSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding Sub-Site Dissection of a Carbohydrate-Binding Module Reveals the Contribution of Entropy to Oligosaccharide Recognition at "Non-Primary" Binding Subsites.
pubmed doi rcsb
source organism Clostridium stercorarium
molecule tags Carbohydrate-binding module
molecule keywords ENDO-1,4-BETA-XYLANASE A
total genus 32
structure length 132
sequence length 132
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2004-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1uy1A00
3LEIA 1XNTA 2X05A 4XUPA 3IAPA 3LQCA 5DQ0A 3E1F1 2QQNA 4MGSA 3P1IA 1NUKA 2CDOA 2WO2A 4AG4A 4A44A 1UYYA 3I97A 2VMCA 4LQRA 4D0QA 2Y6KA 2W91A 3WF3A 4OYUA 1SG3A 2KD7A 3FL7A 1WKYA 3DYOA 4XUTA 1SDDB 2VZVA 4QX2A 4QB6A 4JKKA 1DP0A 1P8JA 3IAQA 4E8DA 1JZ2A 1JZ5A 2VC9A 1GOHA 4ZZ8A 1CZVA 3LE0A 2E31A 2VZUA 3DYMA 4KMQA 1JZ6A 3PUIA 3WF2A 3WNNA 1UYZA 3VD4A 4QDQA 2DCJA 2XHNA 2LW8A 5JXIA 4P00B 2WAOA 4XUOA 4M4RA 1SHWB 5LA2A 1L7QA 2WYSA 2W87A 3I2GA 2J1RA 1YQ2A 3CDZB 2RJ2A 3P6BA 3F2ZA 2OKXA 4FI9A 4MO3M 1PMHX 3GXUA 4W50A 2B9VA 4QX3A 1JI6A 5B4XA 2RVAA 3ABZA 3MV01 4PF1A 1DYOA 4OMCA 2ID4A 3WQBA 2VTFA 1CZTA 4JX0A 1GUIA 3C7HA 3CQOA 3I2IA 5IFTA 5JXHA 3T2QA 3NRUA 2YG0A 4AAXA 3I3DA 5FUIA 2QQKA 5CZKA 2W47A 4D8MA 5JMOA 1K42A 1UY2A 5LCWL 1GU3A 3WNKA 1BHGA 4CUAA 3OEAA 4A6OA 3WNPA 3MBWA 1TG7A 2VMEA 5I0DA 1UMIA 1JYXA 4KI5M 2XONA 1H6YA 2V4VA 5IJRA 3HOBA 2VJXA 4YPJA 2E26A 1UYXA 5EIYB 3C8XA 1W99A 2QQJA 3OBAA 2WO3A 3I2FA 2RV9A 3J7HA 5JXGA 1PMJX 2XOMA 1XPWA 2J1UA 3WF4A 3VD5A 1NKGA 4TXWA 1O8PA 4L0PA 3WNOA 3IDAA 3IB3A 4XUQA 4JKLA 3VDAA 1RYYA 2WUHA 2Y6HA 1PX3A 4DUVA 3AC0A 5EJ1B 3T2PA 3CMGA 3VDBA 5JXJA 3A22A 2ORXA 1JU3A 1JYNA 2W1WA 2DCKA 3FHAA 1I5PA 4GWJA 1OH4A 1W9SA 3MUZ1 3K4ZA 2R7EB 1CZSA 3BN6A 4DXRA 3VDCA 5DPNA 3ACIA 3A21A 2C4XA 1UY1A 4BK4A 4HG6B 1JZ7A 2J1SA 1NAEA 2BERA 3K4AA 2VO5A 2VZ1A 1W8OA 1NX9A 4A42A 2J7MA 4W8JA 4XURA 3WEZA 4JKMA 4CUCA 2EIDA 4GWIA 3K75B 4PT6A 2Y8KA 3SKJE 4ZZ5A 2W92A 2VCCA 4QX0A 3VD3A 4QAWA 3NJVA 3VD7A 4QB1A 5G04L 2WZ8A 5C70A 3LPGA 4A41A 5B4NA 2WABA 2QBXA 3T2OA 5LA1A 4QDSA 2VZPA 1XNAA 2YC4A 4RN5A 2W1UA 1KEXA 4ZY9A 5DMYA 3ECQA 4LHSA 3UESA 3WNLA 2BGPA 1UX7A 3I3BA 4DEQA 3K4DA 4DUXA 5IFPA 1UWWA 1UY3A 3CZJA 3HEIA 5J1XA 2V72A 1UXXX 5HXMA 3NNGA 1JZ8A 2WO1A 2C26A 3FN9A 1JYVA 3W5NA 2C9KA 1KGYA 3GGLA 3GM8A 3WF0A 5LA0A 2Y6JA 2YFZA 4XUNA 2W94A 3SKVA 2X09A 2YC2A 3MUY1 1OT5A 4ET7A 4PQQA 2QQLA 3DECA 5IYYA 2ZEWA 3C7OA 3CIHA 3OGSA 2VCBA 2JD9A 3EYPA 3K46A 3PUHA 4OZOA 2VZOA 4ARYA 1LNSA 1MPXA 2QQMA 2WZEA 2VZTA 1WCQA 3I3EA 4MGQA 3I2JA 3UETA 1GOFA 3EB7A 4KWUA 4QB2A 3T0BA 2WN2A 3JXSA 4DXSA 3CKHA 2W3JA 1W0NA 1UZ0A 1JU4A 2YFUA 2X10A 4LKSA 4TTGA 2EIBA 1O8SA 1K12A 2VZSA 4OUEA 3LPFA 5C7GA 1UY4A 3THCA 4W4ZA 1GNYA 3DYPA 1GMMA 2WBKA 3CZUA 1US2A 5IHRA 3OGRA 1PX4A 1W9WA 3HNBM 3SEEA 2BZDA 2EICA 1JZ3A 1K3IA 2VR4A 2J1AA 5A1AA 3T08A 1F4AA 2VCAA 2J1VA 2ZEZA 4LPLA 3THDA 3W5MA 1UXZA 4CU7A 4E8CA 1TVGA 4MOAA 3ACGA 1US3A 4DXTA 5JUVA 2ZXQA 4Z2AA 2WN3A 3C7GA 2LS6A 4QDRA 2E33A 4CU9A 2ORZA 3OEBA 3T0AA 3A23A 3LEGA 2CDPA 4QPWA 4MADA 5F7UA 2WAAA 1EUTA 1JHJA 5HPOA 1F4HA 2VZQA 1W9TA 3ZM8A 2Y6GA 4UI9L 2J1TA 2J1EA 2YB7A 2VL4A 2BBAA 1J84A 1UY0A 3NJXA 3A7QA 4UAPA 3WSOA 1HN1A 2VQTA 2VZ3A 2QQOA 3HNYM 4M4PA 1GOGA 2BGOA 5CYYA 3HPNA 2W95A 2PQSA 1H6XA 2J22A 1J83A 3UNPA 4P02B 4ARXA 2Y6LA 4OMDA 5EJZB 3SEPA 1CX1A 5G05L 2QQIA 3ETPA 1ULOA 1K45A 4CVUA 3LEKA 1IQDC 4A4AA 1D7PM 3NQHA 2XQXA 2V5DA 1W8NA 4UOJA 3T09A 3WF1A 2JKXA 3BGAA 2B4KA 1UMHA 2ZEYA 3FHQA 4IUGA 3MO4A 1R64A 1OD3A 4DEVA 3VD9A 2VOTA 3GDBA 2Y64A 3ACFA 3C7EA 3IIIA 2HYXA 2VMDA 4DUWA 1CIYA 4CUBA 3HNMA 3K77A 4BK5A 4CU8A 2JE8A 4GZ9A 1T2XA 2W1QA 4CU6A 2W1SA 4XZUG 2E32A 3WNMA 4XVHA 2VM9A 2Z4FA 2L9LA 3U37A 4QX1A 3HJRA 3I2HA 4P08A 2VMFA 1GQPA 4ZXEA 3OG2A 3OB8A 4JHZA 2EIEA 3ACHA 5DN2A 5JR2A 1DLCA 1OF4A 4A45A 1ULPA 3T0DA 4BJ0A 2WDBA 2ZEXA 2HLEA 3MV11 2JDAA 1JYWA 1XC6A 3OGVA 2VZRA 2W46A 3HN3A 4BDVB 2W9XA 2W5FA 4BXSV 4RYDA 1OF3A 3D3AA 1L7RA 2DDUA 2WQ8A 2VQUA 5C71A 1O59A 4A3ZA 3I2KA 3C7FA 1JZ4A 1EUUA 4P5YA
chains in the Genus database with same CATH superfamily
4G3YC 5FYTA 4MZUA 1X82A 3PJYA 3NKTA 2X05A 1RUOA 2WSVA 3IAPA 1JOBA 2DTYA 5M0TA 4LA2A 1WW5A 2QQNA 4MGSA 3NAPA 4YRDA 3P1IA 1ND2C 2OS2A 3VKOA 1HRV2 4H7MA 4RL7A 4BQWA 4A7YA 3VBRB 5GKAC 3WZ1A 3CJIC 2D43A 3U11A 3I97A 5FMOS 4D0QA 4YW2A 3SH3A 4B4PA 2W91A 1YLLA 1VAVA 4HOOA 2ENRA 1FXZA 1SG3A 2WT1A 3O0XA 3PU8A 4BLIA 1MVQA 1DZTA 3OUJA 4QPGB 1UOBA 1EPWA 1C8NA 2RDRA 2ZGQA 3DYOA 1BBT3 1F5JA 1Q56A 3A4UA 1UOGA 3AP7A 4XFCA 2ZAHA 4JKKA 3WHUA 4BH9A 1DP0A 4CZSA 2GALA 2FDKA 3P3NA 4FPKA 5FYCA 1I9RA 1RUC3 2RS51 5EV7A 1JZ2A 1JZ5A 2V09A 3BODA 4UXAA 4GULA 4ZZ8A 3IM0A 3AZVA 5GJ6A 5J96B 1CZVA 5FZ7A 4HZFA 1O5LA 2E31A 2VG9A 4CDWC 2BGCA 2W52A 4D94A 4KMQA 1V6NA 3NNJA 1KITA 3QD6A 4PBOA 2YPJA 4V2WA 3MHZA 4K7JA 2LW8A 2JB4A 1EAH2 2PHWA 4BHPA 5JXIA 2WAOA 3PL0A 2E53A 5FK7A 1VRH1 3ZDVA 3ZXKA 4CDUA 4LHNA 3BVCA 1VIWB 2R16A 3I2GA 1YQ2A 2WO7A 1R1A3 3F2ZA 4FI9A 4CCEA 4XAAA 1HB1A 3HIFA 4IV1A 2O14A 3GXUA 1HIXA 3E5XA 4B29A 1H9PA 4QX7A 4EV0A 2RDQA 1RUC1 2RS53 1RUG3 5LY2A 1YHFA 5BNNB 2VOXA 4K8FA 2MEV1 3MIHA 3KT7A 3VV1A 2HWF2 4IEXA 2JJ6A 4HSJA 1LOCA 4UW5A 5C3SA 1RITA 1ZRCA 1HW5A 4PF1A 2IWGB 3DCQA 3LKJA 2Z5WA 3MIFA 3WQBA 3AYAA 3RPQA 4CP1A 3LOIA 4AEDB 3C7HA 5FMOL 1B09A 2OW4A 3OF1A 5DUXA 1ZBE2 3DEMA 5IFTA 3O1UA 3S5QA 4ZHNA 1ENXA 4RQPC 5H9QA 1H1MA 4CEWA 4E4DX 4WM7B 1PGL1 2EAAA 2YG0A 3N7KA 3I3DA 5K7PA 5IAXA 5FUIA 1QJY1 2ZTNA 4UYBA 5GZFA 5BNOA 1QJY3 4UW4A 3N7MA 1OOPA 4D8MA 1S0BA 4A7KA 5JMOA 5FXWA 3BU0A 2G9ZA 4ONUA 2MEV3 5F3EA 3WNKA 4FTSA 1AUYA 2R063 3OEAA 4U2AA 3AX4A 3ZYJB 1LR5A 3ZYGA 2H6BA 3BPZA 4KI5M 3BTAA 3FLRA 2FCUA 5TSWA 5LBEA 1UPSA 2GH2A 4Q4X1 4ZPIA 1AYN1 2JG8A 3VKLA 4XMAA 2WFF3 2E26A 1UYXA 4YYOA 4ZS3A 1XOYA 2QQJA 2XWBB 1ZZ9A 1MZFA 3T2TA 3ZR6A 5JXGA 1H9WA 2FHRA 3FLTA 2OXBA 3LD8A 2X5IC 1XPWA 1WA6X 2A3YA 4NHXA 5IK8A 3B9IA 1ALYA 2H0BA 1SPPB 2JDZA 3VD5A 1YXWA 1VBB2 5FXXA 4Y3OA 2A71A 4JGYC 3IDAA 1PZ8A 2JDPA 4PI0A 1LHNA 3KV6A 4IV3B 3ZFFC 3TEYA 5FZ6A 4LBMA 4LKFA 4B1MA 3ZSJA 3T30A 1DF0A 4CDXB 5EJ1B 1X8MA 3KD4A 3JD73 5JXJA 4ZU4A 4IEWA 3VDDA 2ORXA 3USUA 1JU3A 2CGPA 3SITA 2DCKA 1OBNA 3FHAA 3UGGA 5C9AB 2UYBA 4IERA 1OH4A 2HWE3 2ZGLA 2D97A 2R7EB 1YYNA 2WWSA 1F9KA 2XGXA 1N47A 4CEYC 1LJ7A 4DXRA 2PHFA 3NO8A 5DPNA 5K4LA 3A21A 3VBFB 2C4XA 1M4WA 1OQDA 1NE4A 2YC0A 4G9SB 4BK4A 5L9BA 5JOWA 1RUE2 3BI3A 4Q0SA 4Z07A 2VZ1A 1FV2A 1RGSA 3M3IA 4PDWA 3ZSEA 2Y0IA 4R9DA 4W65A 2R0FA 4J1WA 2I74A 5F6LB 3RZHA 3V0AA 2ZKNA 3M70A 5FZEA 5JIUA 1OLME 4FBFA 4JKMA 3ZMOA 1WMDA 2EIDA 3QH6A 3APBA 2VQAA 3K75B 5L9RA 2FDHA 1N3PA 2JB8A 4Q1PA 1C8M3 4PIZA 3WP3A 2W92A 2VCCA 4QX0A 5D8AC 3ZFEC 3MLLA 4AEDA 4Q4V2 4BU2A 4JTNA 1YJLA 2YROA 2HBTA 4LO8A 4QQ2A 1CAXA 4MGTA 1LKNA 3THPA 4QB1A 4QMAA 1RJ8A 1VALA 2AEYA 2WZ8A 4EWDA 2P3KA 4NIDA 5B4NA 1KJLA 4QKFA 4Q4W2 4FFGA 3IPVB 1XE8A 3ELNA 4DZGA 3MPPG 1A78A 4RN5A 3TOJA 3B94A 2XBO3 2XVGA 3DGTA 1KEXA 4ZY9A 1ZZ8A 3WNLA 2BGPA 2GMMA 1UN1A 1UX7A 4KU8A 4AAPA 4TSVA 4FTBA 3B3QE 1CAWA 1SFYA 3K4DA 5FZHA 2DU0A 3SQOA 4LBQA 3WG4A 5T5OA 1AX2A 1AR61 4B7KA 2WL1A 3CZJA 3HEIA 3IN9A 4XPVA 5A32A 5J1XA 1UXXX 4S2DA 4NWVA 4RFRB 3S5AA 1QXPA 3LA2A 2Y0OA 3NNGA 1NY72 4KWJA 1N1SA 1G8WA 3ZXLA 5C8CC 3ZN4A 3AMNA 5CKMA 1JZ8A 2WO1A 1LOEA 3LIHA 1YI7A 2Q5TA 4EJRA 1W2AX 2KA3A 5C6CA 4RFT0 1TNRA 2BQPA 3CNAA 2ZKLA 5GZGA 3ZFGA 2ZA9A 3FE5A 3KF3A 5JPNB 2ZCWA 4YZ5A 4FPCA 1WWYA 2XDVA 3WF0A 4EN8B 4RQPA 5LA0A 1R093 5APAA 5LBCA 4CDXC 4XUNA 2ZZQA 2W94A 2ZHNA 4RGGA 1QOOA 1YRZA 3Q8CA 4Z2WA 1AF9A 3SKVA 1YFUA 3H1WA 1GZCA 1XRUA 2GC1A 3DXTA 2D44A 5C9AA 3VBRC 3AXDA 1SMVA 3H8UA 4AFBA 2QQLA 4AI1A 5F37A 4QWNA 5J48A 5IYYA 3ACLA 2PLV1 1AXYA 2YXSA 3SXWA 3KCYA 2RE9A 3PVEA 2JD9A 2C1FA 1VBB3 2LM3A 1W6OA 1RC6A 3EYPA 3K46A 5T54A 1F5FA 2A73B 4GH4A 4XBQA 2QQMA 1GICA 5A7NA 2Q8DA 3LA7A 4M3CB 3HMYA 1S0IA 1EY2A 4PDWB 2QCSB 1QJU1 1SCRA 1FATA 1GR3A 1X8EA 3EB7A 1OUXA 3UGHA 4B4QA 3I3MA 3GCWA 2WN2A 5F5AA 1OQ1A 1PO23 5BNNA 4QU1A 1YFWA 2OA2A 2PHTA 1YJKA 1EP0A 1UAIA 1D0HA 3E5QA 1W0NA 3DL3A 5DAVA 5JSPA 1UZ0A 4JGZB 3O1MA 1RXGA 1PM4A 4C0BA 3MEPA 2YFUA 2AGSA 1ULGA 3HBKA 4LKSA 1UYPA 2EIBA 1BCXA 5BNPC 2VZSA 3BALA 1TNFA 1MEC3 3BU7A 4MHUA 3Q8AA 4PLNA 2BWAA 4Q0UA 1UU5A 4YG0A 3ZFEA 1O4YA 2X5IB 4CE8A 3V56A 3VBRA 3RGBA 1ZRIA 2D5FA 2GC3A 3AB0A 3FJSA 3TB0A 2WBKA 3AP9A 4EE2A 3VB9A 4O61A 1US2A 1Z0HA 5FOBB 3CJIA 2KR2A 1W9WA 2QVSB 4N53B 3OY8B 5FZ0A 2RM22 4Z92B 1K3IA 2UU8A 4UFJA 2HWF3 3T08A 2O8QA 1CAWB 2XB6C 2J1VA 4WM8C 1RXFA 1SLCA 4EZ4A 5L36A 5E6HA 3WP5A 1W6MA 1RUI3 5FZDA 1F31A 2R32A 2CSGA 1Q8SA 1IGOA 3OD4A 3WW3A 4GMP3 3ZPYA 2Q0AA 2ZACA 2OT7A 2YDEA 5DDJ2 2PHXA 2ZGPA 3ALQA 3BIWE 1Z7S1 5I8SA 2BEOA 1LRHA 3VDDC 4AWDA 1ASJ1 1RVF2 1JH5A 2ORZA 1EAH3 4Y24A 2UYAA 2CAVA 3S7IA 1KJRA 1BKZA 2CDPA 4YFZA 5F7UA 2VPVA 1EUTA 1S0CA 3N7LA 4AVVA 1WGPA 5L7OA 1KFUL 1RUJ1 4YZ1A 2JD4A 4XJZA 4WVMB 3WHTA 4NE9A 3IKWA 2Y6GA 4AFCA 3RZLA 1DZRA 3JBG3 3LZZA 4E2QA 5FY9A 1QGLA 2ZZJA 2VL4A 1RVF3 1DDLA 3VL9A 4CCLA 1KRIA 4WM7C 2GMPA 1BVP1 1AR81 4CP2A 5CG8A 4MV2A 4AVBA 4RS5B 2FZ2A 1UW8A 1W6OB 3WY6A 5A6YA 4RR3B 1LECA 5J36A 1H4HA 2PLV3 2BPA2 1ASJ3 2C6SA 1XYNA 4DIQA 3JB4C 3AK0A 2VVFA 3AKSA 3OPTA 1GV9A 3NVCA 1H6XA 1UL9A 4LBNA 5FBZA 3V64A 3N35A 2AACA 4YFWA 2D6MA 1GSLA 3VBUB 2Z42A 4BXFA 2YPDA 5A3MA 3IDBB 2A6YA 3SEPA 5DDJ1 1XNBA 5HCHA 2D3SA 1FPN1 3QLQA 2IXLA 1C28A 2QQIA 3PJQA 5BNOB 4YM2A 1O3RA 3H42B 4CA9A 3RI9A 4XZPA 2FDFA 1ULOA 1AYM1 3IMNA 3VBHC 4AGVA 1K45A 2ZAAA 5EPAA 4CVUA 5GZCA 3OYWA 4BISA 3C3VA 2JG9C 2Q1MA 3RDIA 3RZGA 1G9AA 1QMJA 1V6LA 2NQYA 4QHOA 2ADEA 2XQXA 4BQ2A 2PHDA 4OFGA 5JPMB 3HQRA 4B1LA 1OD5A 4YVSA 3JD72 3T09A 4YGCA 4Q27A 2R0HA 2B4KA 3OGGA 4WZFA 2J42A 1Q43A 4JC1A 5KC6A 4IUGA 4YGEA 5C8CA 1AR63 1H4GA 2WFF2 3PVNA 3CJIB 5FLJA 4NIHA 3VD9A 3O12A 4MSVA 5FJKA 3ASIA 1FYUA 4META 4Z8BA 3IIIA 4WBBA 1YFXA 4DS0A 1SPPA 4I2OA 4IEUA 5F39A 4CUBA 1DQ0A 3NSTA 3Q8EA 3RQ0A 3K77A 5GLVA 5JZGA 1POQA 4HSLA 1V0AA 2VNRA 2WFF1 3NV4A 5E16A 4BK5A 1MZ6A 3HN1A 1R083 4GZ9A 4CU6A 1OUSA 1W8HA 4WVVA 3OPWA 2C9AA 1SLIA 3BCWA 1A8MA 3B9CA 3NJZA 1NT0A 1QXJA 1MZ5A 4YVWA 1ZBA1 3WNMA 2Y26A 4LEJA 2BNOA 4Q4X2 3RYRA 1LTEA 2L9LA 2WA4A 3AYDA 3AFGA 1OA2A 1T6GC 4XF9A 4CDWA 4GB31 1SACA 3UJOA 1DHKB 3I2HA 4P08A 1S0FA 3AKRA 5CU1A 5ERLA 2D3PA 3LIGA 1JOPA 3OB8A 5J3UA 1EV12 4PQ9A 4Y5Z0 1HRI1 5FZ3A 4A6SA 1W8UA 2BUKA 3OPZA 3VBOB 2VU9A 1CX4A 1DBNA 1JW6A 4FPFA 4L2NA 3ES1A 2PHUA 5K0UC 1QWRA 3SCGA 5T5LA 3ZX7A 5D1IA 3EBRA 1BQPA 4A45A 2CTVA 2ADDA 1T6BX 1UQXA 2P17A 4HT1T 2ZEXA 2VBPA 1WCKA 3HVDA 5LRRA 3MV11 3SNMA 1LHWA 1ND3C 2JDAA 1JYWA 4BQYA 1SEFA 1RUNA 1OXCA 2W9XA 3H1YA 4P9YA 4AGRA 4AQSA 2UY8A 4ZU7A 4DRVA 4QKNA 4RYDA 1ZYBA 3KGLA 3OUHA 2I45A 2Z69A 1Q3EA 5CKNA 3JBG2 1FOD2 1PZ9A 3E6CC 1X9TA 3J8F2 4LKEA 5JDBA 4XHXA 4PCRA 4XXPA 3C7FA 4Q4Y1 1JZ4A 1OPOA 4LJHA 4UFLA 2CYFA 1LULA 3U37A 3GNEA 1PZ7A 4EYUA 1OFSA 3RS6A 1XNTA 1Y9QA 5FPVA 3GCXA 4Z1VA 4XUPA 4L9BA 4XTPA 1NCRA 4FOYA 4JZRA 5IK7A 1JMUB 1HJFA 1JN2P 1R1A2 4CDUC 3ZN5A 2GC0A 2X53S 4LK7A 1W03A 2VULA 4NVPA 1NUKA 4Q4V3 4GMP0 3AL6A 4B4RA 4V2VA 4DO0A 1UYYA 1B35A 1C5HA 1U5XA 2VMCA 4LQRA 3POSA 3POFA 4R9BA 3BB6A 1A3KA 3ZN6B 3KV5A 3WF3A 4CCJA 1UO9A 2Q8OA 3AP6A 5I0RA 1V6KA 4IE7A 1V9U3 5GALA 1SDDB 2IZWA 1QJX3 3LAGA 1HRV3 4LLFA 4LBLA 1W8WA 2IXCA 3POBA 3IAQA 1C1FA 4E8DA 3B93A 2VC9A 3UKTA 1GOHA 1JUIA 4MGIE 1W6QB 4COVA 4ZU5A 2ZBJA 1VBB1 1TE1B 4TLFA 1AX0A 1W06A 4QM8A 1VRH2 3WD5A 3ZVXA 2VXJA 2QNKA 5H9RA 3KVBA 2ARCA 2B8MA 4KWLA 1UYZA 4WV8A 1FV3A 5FLIA 3WF2A 3WX5A 5CEHA 3ZXEA 4BZ4A 4QDQA 3P5BA 4FO9A 5J7MA 1IZ3A 3GZTB 3WDTA 5EP9A 2JG9A 1N1TA 1SHWB 5EFUA 4DXZA 1RVF1 4N9IA 2ZGUA 5E89A 1NQDA 1D2QA 3CDZB 2FZ1A 2RJ2A 1V9U1 4IEVA 4XQDA 5FYVA 3WQ0A 4ITCA 1PMHX 2DBNA 4FCAA 1D0GA 1AJKA 1XU2A 2O8OA 2WA3A 1QOTA 5BUVA 2B9VA 1REEA 4QX3A 1POV3 1WLDA 3T3YA 2IC1A 5B4XA 3WDXA 5EQUA 2JENA 4Y1YA 3ABZA 2WRAA 3IZOA 4NN0A 3BTXA 3BPSA 4C8DA 3W20A 5ANNA 3CF6E 3U1XA 4N43C 4MGYE 2EA7A 4GQ7A 5GLTA 4BLJA 2XKOA 4TWTA 4XILA 5JZGC 5E88A 1VBA1 2VTFA 2XLFA 4JX0A 1GUIA 3CQOA 4MYEA 4B3NA 1IKPA 5JXHA 2AR6A 3ZFEB 4LLOA 4FQZA 4FAGA 1NE6A 5JSOA 4CCNA 5GLUA 2P5BA 1BEV2 1RUD2 3WLUA 2NN8A 3WDUA 5FY8A 2PAKA 4Y22A 1KDKA 2ARAA 2XG3A 3D4KA 5J37A 1QNWA 1HB4A 1SFPA 2IVIB 5JLVA 1K42A 4XDOA 1KD7A 5LCWL 2QZ2A 4IEOA 4NRQA 1BHGA 1D4M2 3PVOA 4XJAA 3N9QA 4CUAA 1AR92 4A6OA 2WS91 2E7QA 4EZHA 2VMEA 5I0DA 1PVC3 1UMIA 1LEDA 1VBA3 4Q1RA 4ZONA 5FYMA 5F5IA 1PO12 1H6YA 3H3UA 3AKTA 1LENA 3H7YA 1QJY2 2UURA 1X7NA 4MLOA 4KWKA 1AJOA 3VHPA 3C8XA 5EIYB 1APNA 1LB2A 5C3PA 4PLOA 3VBHA 1YQ5A 1ONAA 2RV9A 3LSDA 4AI9A 1UF2C 2OZ6A 1NKGA 5FP9A 4XXAA 4YZ3A 5FZBA 3PTRB 4L0PA 3L9JT 3IB3A 2GU9A 5L7OB 1IS6A 4S2FA 1Z7S3 1CESA 4JKLA 1TME1 4M01A 1PX3A 1H8TC 4DUVA 3AC0A 3E6BA 3TAYA 4CDQB 3CMGA 1K5MC 1YCIA 3A22A 3TN91 3BTYA 2VVDA 2XWJB 4RGAA 5A7OA 2IXJA 1OLRA 2PFWA 4XJUA 2Z79A 3GF6A 3R6SA 2JICA 3GHNA 3PIJA 2FQPA 1GZWA 4CEYB 3K4ZA 1JS9A 4Y1XA 1CZSA 4KL1A 3BN6A 2QTWB 1OOPB 5FY7A 4YVWC 4IEZA 3VDCA 4CXYA 5LBBA 4JV4A 4GWNA 3IT8A 4HG6B 3RRDA 2QUOA 4BQ3A 1JZ7A 3K4AA 1LHOA 1W0PA 3CLPA 1ZZ6A 2Z2SB 2VO5A 5FZ9A 1TME2 2DYCA 5FYSA 3ZDSA 3QCWA 1DGWX 2SBAA 2TNFA 3UYJA 4XURA 3HD8B 3PUAA 4JGYB 4RA0A 2VH9A 4BE3A 4D6RA 3G6JB 4GWIA 1ENRA 2ZS6B 1NA1B 3U10A 4PT6A 2E7TA 3ON7A 4JHTA 3PUQA 3AFKA 2GNTA 1H30A 3NJVA 1W6PB 1GQHA 4KBBA 4XACA 1DG6A 2OYZA 1BBT2 3NW4A 2VXRA 3LPGA 1N1YA 1S0DA 1XYOA 2RR11 3TN92 4QDSA 1Z78A 4CDXA 5I0SA 4RS5C 2VZPA 1W9YA 3AJZA 5ABJB 4OI4A 2W1UA 3VLBB 3N9LA 3RZKA 3VDDB 2P3YA 2A5ZA 1U5ZA 2XXZA 2JIJA 3ECQA 4FPYA 4LHSA 3MW3A 4XF4A 1KXGA 4YNIA 2A75A 4Y5TA 1Q8VA 4A2UA 3UL2A 5JOXA 4EN0A 1I1EA 4Y4YA 5IVJA 4BQ5A 2P3IA 2OQ7A 5ACA2 4DUXA 5I93A 2JG8B 1BEV1 1RUD1 1GZ9A 5AFEA 2V72A 3CU7A 1UNBA 5D2AA 1PO22 4QPIB 4Y5SA 1MQTA 1XNDA 2R061 1COV3 1BYHA 1ZM1A 3N4MA 2D5HA 1W2UA 4CSWA 4UF0A 4YVWB 4NPRA 2BV4A 3VHRA 1W6MB 3FN9A 2WZR1 2XH6A 3J7MA 1SLAA 4KGGA 1AR91 4LHLA 4Q4X3 5CIRA 5FMCA 3RI8A 1JYVA 1S2KA 1HRI2 1KGYA 2R071 3KWVA 4LO7A 2BW8A 4AE2A 3VBSC 3GM8A 3VGIA 4XBLA 5F3GA 5FPXA 1Q8PA 4Q8LA 1HKDA 1CR7A 2H0VA 2Y6JA 1R091 2BOIA 2CL2A 4XFHA 2VD7A 1UPIA 4XIOA 3USUB 4WM8B 1TZOA 2EXKA 1JYIA 3T1LA 2DCYA 2HWD3 3NWKA 1R082 2X09A 2YC2A 1SBEA 4YZ4A 5FV3A 5GZEA 4ET7A 1IS3A 3SH4A 1E57A 4FPLA 4RHV2 3WDYA 3DECA 3QACA 1NXMA 3BOWA 1LU2A 2ZEWA 5FWJA 3C7OA 3ZKUA 1V00A 3LOBA 2CWMA 4HN0A 4ARYA 4I09A 1PVXA 1MPXA 3KM5A 1L3JA 4FQ4A 2ILMA 2WZEA 1WCQA 4R8HA 2K9ZA 1CAVB 3ZYPA 4M0NA 1WW4A 4KWUA 1HDKA 3ZIXA 5EJ3A 3T0BA 4FXGB 4RS5A 4YW6A 1OHFA 4Q4V1 4V1PA 2W3JA 3GZEA 2QDRA 5FRAA 3KT1A 5LB6A 1GP4A 5FY1A 5FREA 2JDNA 1UKRA 1NA1A 4HN1A 4Q0VA 5CVRA 1XNCA 2HWD1 1JODA 4LNVA 3BKZA 1I6XA 1JU4A 2IXKA 4AI8A 2GN7A 3A0NA 2WQ4A 1VAMA 2X10A 2XJVA 3AMMA 5FPZA 1RJ7A 3OUIA 3POWA 4TTGA 5JCTA 3SISA 3WUCA 5I8YA 1O8SA 1WD3A 5IVYA 1SLTA 1I5ZA 5FY5A 3B01A 4ASKA 2D6KA 1CONA 1VBC3 5I8TA 3ITQA 3N9MA 2RMU2 3MI8A 4D7YA 1VBD1 4AEJA 4FOWA 4HL0A 1Y9MA 1LGCA 4P9XA 3WVJA 2XBO2 5EHDA 2DBIA 1B35C 1H8TB 4FPJA 4D69A 3HNBM 5FPLA 2HKXA 2A6ZA 2WKKA 1MACA 3KZ4C 2VW1A 4K20A 2RS32 4OI1A 1Q8OA 1PGW1 3SEEA 1ENQA 1JZ3A 4I02A 4E4HA 1C8M2 4Q4Y2 2HWF1 5F8PA 3AYEA 3GBWA 3PUSA 2HWC3 4CU7A 4CTEA 1PMIA 4FPGA 4ASLA 3DUIA 1RUC2 4P9LA 2RMU3 2PAEA 4LE4A 3ZYRA 1IS5A 4DXTA 1AR83 2EXHA 4K6BA 1RB8G 1Q5OA 1L7LA 2LS6A 2A3XA 2VOVA 5ANQA 1TMF3 1VBD2 2VMIA 4XBNA 3LFMA 1TME3 3IWZA 1HRV1 1DQ2A 1RUJ2 4XEZA 2DFBA 3I59B 3OEBA 4JVAA 4UFHA 3A23A 5AC92 4X6QB 2UY9A 4MADA 5FZIA 5FZCA 1DGWA 3L2YA 1YUDA 5T5PA 3KHBA 1YO8A 3PIGA 1BXHA 4XQWA 1W9TA 3LGRA 4WM8A 5A33A 3ZM8A 3HT2A 4OHWA 4UFIA 3FFZA 1JHNA 2J1TA 2JDHA 5HI0A 3JBG1 3ZO0B 4INDA 1PIV2 4R9CA 4EROA 5FXZA 3UKNA 3WP6A 3DPRA 1UY0A 4IV3C 3ZFFB 3NJXA 3A7QA 1LOFC 5CADA 1BK0A 5K0UA 4LOSA 1IPJA 1HN1A 4N53A 4PIXA 2VQTA 2WNUB 2K0GA 1CD3G 4D3WA 2CGNA 3DKWA 5A6XA 2BGOA 2C5DA 4WVWA 1IOAA 4B8EA 5KHHA 1PO13 1ZZBA 2VTXJ 2J22A 4I0AA 1VP6A 2FDIA 4LR4A 4GJZA 2DF7A 2Y6LA 2D3RA 4RHV1 4PBPA 5LATA 2AC1A 3PDQA 1CX1A 3AJYA 2PTMA 1LOGA 2YV8A 4LMFA 1QXRA 4MGKE 4YW7A 3BTZA 3SLIA 1GWMA 1AXKA 4HVRA 3LEKA 4XF0A 1EV13 1QKQA 1RUF3 4JRAA 4ES9A 5FJHA 3E97A 1D4M3 5A7WB 3U4SA 4YSFA 2CGOA 3USSA 1NLQA 3VZJA 1BLZA 1GNHA 4AVTA 3WF1A 5FZFA 4BPZA 5C33A 2ZMNA 3W21A 1YIPA 1MS5A 2B42B 4HVOA 5FZOA 4ASMB 4A7ZA 5FBJA 3MIEA 2MNGA 3M1HA 4ZKTB 1BEV3 1RUD3 2N7GA 1AZDA 1RHI3 1OD3A 4DEVA 2JECA 4AL9A 3KGZA 1HRI3 1XSQA 2E51A 5BNPA 1KFXL 3C7EA 2XJTA 1W2NA 1VBE2 1HQLA 2HYXA 3JB8A 4FPOB 3ZPOA 4E4SA 1GP6A 1SCSA 1FAYA 2OUHA 3MW4A 4DUWA 4FAHA 3KB5A 4COYA 1RUH2 5IWFA 3VZMA 4DINB 1J58A 5LY1A 1DIWA 1GFF2 3AZWA 1LODA 5SV5A 3J8F1 4NAMA 2ET7A 5FWEA 1OSGA 2VMGA 1NZCA 4SLIA 1R081 1XJAA 1IPSA 2RS52 4CDQA 1H2MA 1VRH3 1VR3A 4XZUG 4DY5A 1W05A 4BCUA 1UZYA 2XJQA 1ZBA3 5CFCA 2IFRA 3I59A 4XVHA 2VM9A 1AL0G 4GMP1 3WCSA 3BUCA 3N9NA 1BBT1 2VMFA 4BB3A 2PMWB 3KSCA 1LCLA 2RS31 3I3QA 3NV1A 1NXD1 3DV8A 3R4DB 4CEWB 1ZBE3 4AFMA 5LEJA 3ATGA 4N7UA 1ZZ7A 5DN2A 5JR2A 4NIGA 1OF4A 4HKWA 1CIWA 4R52A 4YVSB 4Y33A 1HQNA 4AOCA 4BM8A 2DFCA 1QDOA 2HWE1 3FMGA 1ZRRA 1MS4A 4BJ0A 5LW9A 1QJFA 4YG3A 1W8FA 4MVTA 2HYKA 2RR13 4P9JA 5CA6A 3N3HA 5C4WB 4AVSA 2TEPA 1HXS2 4O9EA 3WW2A 2EVXA 1F35A 5ACA1 2WNUC 2A3WA 2WNUA 3VBSA 2DVDA 4FOVA 3M3QA 4JRLA 4P5HA 4PI2A 2PLV2 3I2OA 1GQGA 2QQVA 2VZRA 2ERFA 3R4UA 5HBAA 1BMV1 3H1MA 2ARXA 4BDVB 3RSJA 4M3CF 1R1A1 3SMHA 5JMCA 3H8XA 1PK6B 3WXPA 3D3AA 3J7NA 1L7RA 4LK6A 1H2NA 4JAAA 2WQ8A 3GZAA 1M06G 3ZXFA 1ODMA 5C71A 2LALA 1LEMA 2Y34A 3RNSA 2BWCA 3I2KA 5ABJA 3IBMA 4P14A 4QM9A 4BMBA 2VNVA 2WIIB 4GD4A 4I3PA 5DDJ3 3RWNA 5FZAA 2B46X 3ETQA 5DQ0A 3S7EA 1NG0A 2C24A 1JYCA 3T4VA 2VMHA 2ZJCA 1AR93 2PN5A 4P9IA 4Y22B 1Q8QA 2CDOA 1SZBA 1REFA 4X8PA 2WQZC 2WO2A 1GP5A 3CO2A 4IV1B 3HT1A 4XDQA 1W9FA 4AG4A 4OHXA 1OH3A 3TNPB 3KCCA 5F2SA 5HCAA 2CV6A 4UF0B 3ZYBA 4OYUA 1UX6A 1W8TA 4D6QA 1GANA 5FZMA 1F2NA 2XUMA 4JCKA 4OQ8A 1J3QA 4AQ6A 5DG1A 4QX2A 4QB6A 1SLLA 5D21A 4COZA 1Y4WA 1VLNA 2GMEA 4IXLA 4Q26A 3W59A 3WOGA 5IVVA 3Q8BA 1COV1 1RUE3 4XETA 1DGLA 2DUQA 1RTVA 2GSYA 3FC0A 1GKBA 2B39A 3V0AB 4LTAA 3IDEA 3WR0A 1CAUA 5C5UA 1JZ6A 2R041 1FMD2 1LGBA 3GALA 4H7LA 5BNNC 5CFCB 1LHVA 5KXCA 4DY3A 2IXIA 1LU1A 3OBZA 1CGPA 4BMEA 4XUOA 2VAUA 1GNZA 4JDOA 5CFDB 4M4RA 5LA2A 1L7QA 2WYSA 4QHZA 4Y1ZA 4C0HA 2W87A 3FZ3A 2J1RA 4CCOA 4EN6B 2HEWF 3MGUA 1QY4A 2JG8C 2OQ6A 3TEZA 4IEYA 5I0UA 2OKXA 2ET1A 4Q5OA 1KDMA 1XE0A 3MLJA 3U0ZA 2NPIA 4GH4C 2BVVA 4HK9A 3B02A 4AFDA 4HANA 4XIKA 5T52A 1CQ9A 4NMIA 4NOTA 1AYN2 4AVCA 1RUE1 4LIUA 2ZGKA 2BYVE 4Q0QA 4QGNA 5IVFA 5LRSA 2RVAA 5C4WC 1NLRA 2WZPP 1YI9A 3OOXA 4XAEA 5AFBA 3B69A 3MV01 4LO4B 1HLCA 3POGA 1W8ZA 1S0JA 4GXLA 2YZ4A 4QQHA 3HAGA 3JU9A 1DYOA 2XLAA 3D0SA 4FPEA 5F5CA 3GBGA 2V73A 5A32B 4YARA 5J09A 3LF7A 5GZDA 5DZGA 3SCFA 3I2IA 4OVEA 1PK6C 4HLTA 1PK6A 1N3QA 4BA6A 3LSEA 4F8AA 4YGDA 1IHMA 3MYXA 4BQ4A 2LTNA 2HWC1 4M0HA 1AR62 4ATEA 1U0AA 1IS4A 1AL22 3RZJA 4R9AA 2XPJA 1SBDA 1H1AA 2R042 1DQ1A 3DXUA 4UW6A 2FDGA 3HR9A 2QQWA 2W47A 4CCCA 5JAXA 2VOWA 1UY2A 2AENA 4S2HA 2YBSA 1GU3A 3POYA 4MUVA 5IW0A 5C5TA 1VJ2A 2G9GA 3FBYA 2EF6A 3H50A 3IDCB 1FI2A 4I01A 4MX3A 1TG7A 2ZGNA 3WG3A 4AR2A 1N1VA 2EAKA 3LDRA 1JYXA 2WFPA 2XONA 3IIAA 5FLHA 4QQLA 3NNLA 3D82A 5DG2A 4YW3A 1IG0A 1AR82 2Q1FA 5IJRA 2XUEA 1PNGA 3AXEA 4CP0A 2DTWA 2HWB1 1W99A 3JZVA 2WO3A 3K48A 3Q8FA 4JDMA 3J7HA 4RD7A 4GA9A 1V9U2 1QQP1 5A7PA 1PMJX 4XMIA 1VPHA 2AUYA 2J1UA 3WF4A 4QXCA 1JBCA 4XW3A 1YIFA 4PHZA 4AI0A 2DVGA 1G9DA 4I3GA 3WNOA 2A7AA 5A7QA 5BV6A 1QH7A 2DUOA 4FT8A 1TMF1 1CAXB 2XVLA 1O4ZA 2HWB2 3KLSA 1RYYA 2WUHA 5KXEA 1PGL2 2XQRA 1VRBA 4IE4A 1K5MA 3VDBA 2VQ0A 4AQ2A 3VKMA 3OSDA 2ATFA 1ZBE1 2JKBA 4DOUA 4O65A 2W1WA 3OD0A 2XJRA 1I5PA 4GWJA 2P34A 2R043 2GN3A 4PDWC 3MUZ1 2VNOA 1S4CA 2OPKA 2QKDA 4FXKB 4URAA 1GYKA 1NA1C 1O3QA 3VBOC 3ACIA 1IQAA 1VBE3 4UWDA 1UY1A 2WSUA 1RINA 2BFUL 2VUAA 2J1SA 2R1DA 1NAEA 4D6SA 2YGLA 4Y4RA 1RUH1 1CPMA 4L92A 1W8OA 4QX5A 5LASA 3V65A 4XE9A 3P3PA 3RJRA 2J7MA 1FMD1 3AMHA 4W8JA 2BNMA 3VZOA 1R1ZA 2JIGA 3WEZA 2DV9A 3J4UH 3JQXA 2Q1ZB 5ABJC 4FSJA 1QU0A 5FYBA 2ZGOA 3CL1A 1RHI1 1W2TA 4XFIA 4AXOA 4QD2A 1RUF2 3VD3A 4LOTA 4IV1C 4QAWA 4CDWB 3VD7A 5CISA 3ZIWA 2HH9A 2IXHA 4J6GA 3MW2A 4MHRA 5G04L 5C70A 3UKVA 4FVVA 3NV2A 2A70A 2ZGTA 2QBXA 4UFKA 3T2OA 3IMMA 5LA1A 5FYUA 4AF9A 4QHBA 2P37A 1GWLA 5HXVA 3JUUA 1D4M1 1RUF1 3G7DA 4YW1A 5A1FA 5IVCA 1O4TA 3ZYIB 5DMYA 1C5IA 1LAJA 1FMD3 1ULEA 3FLPA 2WT0A 3V0BA 2D6OX 3FBMA 4LO5B 3I3BA 4GIQA 2D6PA 5SV8A 2R062 4G4FA 4WVMA 3MDPA 2ZGMA 5DUUA 3TWIA 3U78A 4YWAA 2ETEA 3LEMA 1G9CA 3M8LA 1NCQA 1AX1A 1UWWA 4QU2A 4W6WA 2CWSA 4YM1A 1H8TA 3UJQA 1W39A 3KQRA 1ND2B 4Q0PA 3O1RA 2WS93 2BP6A 5HXMA 2EALA 4NIIA 5FP7A 2DURA 4NRMA 4OHYA 4XFAA 5IK4A 3H3LA 4EQVA 2VVEA 3RYPA 4HKLA 1OPMA 1WUVA 3M3EA 4Z82A 5L19A 2C26A 4XC9A 3ZLIA 4QGLA 3W5NA 1C1LA 1WW7A 4R4XA 1S2EA 3B00A 3GGLA 4CYDA 1F15A 1G86A 4CP9A 2JWPA 1W3VA 4NRPA 5D8AB 3D6EA 4NJ4A 4GB32 1J59A 3N9PA 1QOSA 2E63A 4IE6A 1W28A 2NZ9A 1PHMA 2YFZA 5IUQA 1W04A 5CB7A 5GLWA 2R072 4RSUA 5EXOA 5C3RA 3AMPA 3VHOA 3MUY1 2WNVB 4JTOA 1OT5A 5JI9A 1VMFA 1B35B 2Y33A 5BY5A 1KS4A 3ZYHA 1NYWA 4OCTA 5C4WA 4CXWA 2F4PA 1W0OA 2GNMA 1OMIA 2WNOA 3ME2A 3HBZA 3RWKX 3OY8A 2W08A 3NNMA 2VCBA 4OZOA 1NCQC 1I3HA 3PUHA 1UOFA 2VZOA 3J9SA 4LUKA 5LK5A 4AW7A 2P3JA 2F17A 5FZLA 4LHKA 4LO6B 4MGQA 1XB9A 3DPRB 2B5HA 3I2JA 3Q9OA 4HETA 1OKQA 1AHSA 2Y6FA 4QB2A 2YUEA 4W6YA 1OLMA 2XLGA 2XKPA 5L73A 2JX9A 1XNKA 2I07B 3JXSA 2NM1A 4DXSA 3CKHA 5FYIA 3HQXA 3J7LA 4HBNA 2P1BA 5F6KA 1ULFA 2RR12 3WQ1A 4HFSA 4IGPA 3S0MA 2IVJA 4LBOA 4XABA 1K12A 4YW4A 1HXS1 2YBPA 4L11A 1RUG1 1BK1A 4I0BA 4QXKA 4OUEA 3LPFA 1UY4A 1C57A 2DCZA 3GJBA 3O0WA 3THCA 4EWEA 2PQQA 4W4ZA 1XYPA 5FQ0B 1AR71 1QJZA 5DAQA 5A3PA 5C9AC 5KWRA 3S57A 1AL23 4Y1VA 1O3SA 4C91A 2P4EA 1Z7S2 5FAXA 3CZUA 4YVSC 4OQ9A 2XJSA 4CDUB 5IHRA 3OGRA 1YFYA 3I2DA 3WQ7A 5DXDA 2FDJA 2BZDA 2EICA 2VR4A 3AZZA 3DPRC 4FFIA 5A1AA 1WA4A 3VBOA 1ND3A 5FZOB 1F4AA 3W5MA 3VUOA 3TEWA 1UXZA 2ZX2A 2PYTA 2FBEA 1SFNA 1PVC2 1H2KA 2PELA 4N8MA 1PGW2 3ES4A 2WS92 3ACGA 5IT6A 1DLLA 4YLZA 3OBRA 2LRPA 3I54A 5J98B 3LDKA 5KHIA 5FYZA 3KV9A 4CCKA 4Z2AA 5I91A 2YYOA 3C7GA 4Y20A 2DWRA 2WJSA 5FIXA 4TZDA 4QDRA 3PMEA 2E33A 4JGZA 4Y26A 1O6UA 3POIA 1XXNA 3LEGA 4CP9B 3OGJA 1JOJA 2WLQA 3VHNA 1E5HA 1E5IA 4QPWA 2JDKA 5CNAA 2WAAA 3NNFA 2D7FA 3O14A 4XCBA 4WM7A 2RJLA 2K2SA 1J1LA 2X5IA 2ZX1A 5HPOA 5KXDA 2MEV2 1F4HA 3VL8A 3A0KA 1VAKA 4NHYA 1REDA 3MLKA 2HWD2 4IGQA 4UI9L 2J1EA 4KG8A 2YB7A 1COV2 4HXCA 1VB4A 2XVKA 4IE5A 2ZGRA 1EV11 5L7OC 3I7DA 3GBFA 3WSOA 1RL3A 5FO8B 3BOPA 2RDNA 5KHGA 3N7JA 4X6RB 2W0XA 5IAVA 4XFFA 2VZ3A 3HNYM 3MF9A 1GOGA 5CYYA 1FNYA 3AP5A 3HPNA 3MICA 4F3JA 2W95A 5C3OA 1POV1 2YY1A 5EWSA 1JXNA 1J83A 3K51A 1H0BA 4AYUA 2DVBA 4OLLA 5HV4A 1OOPC 4OMDA 3I49A 3KCXA 3NL1A 5EJZB 2OVUA 1WW6A 1YEWA 2OZJA 3AMQA 3M3CA 3MIDA 1OFNA 2LROA 4YM0A 3ETPA 4W6XA 4DRRA 4HKOA 2BVBA 2YBKA 3H0OA 4A4AA 2BBVA 1D7PM 3R05A 5JIAA 1J3RA 4LT5A 1QF3A 2V5DA 1W8NA 2OPWA 4MXWB 1PNFA 3AZXA 2RDSA 2G1MA 3ILFA 4OI2A 4UOJA 5FKCA 1MZEA 2VGDA 4QPGC 1STMA 1J3PA 4WZCA 3BGAA 2ZOEB 1QNYA 3ILRA 2ZEYA 4UBGA 5H9SA 1X9PA 3MZHA 3MO4A 3WW1A 1O7FA 3J26N 1FX5A 2W39A 1VBC1 2YU2A 3EHKA 5GLZA 4Q29A 5HCBA 3D8CA 3PURA 1WLTA 3ACFA 4LORA 1EAH1 3C2UA 5FP3A 2QDNA 3ZFFA 1J1TA 1UZZA 2WINB 2VMDA 1CIYA 4O7XA 4S2GA 4N43B 3HNMA 5KXBA 2VNGA 1ASJ2 1DCSA 4URTA 1OI6A 4YG6A 1Y3TA 1VBC2 4R4ZA 3VBUA 2HWB3 1LOAA 3VBUC 5FYHA 1AR72 5FY4A 3J8F3 4NUBA 2W1QA 5FZKA 4NIAA 3X29B 3TBDA 4ORFA 2B9UA 1XQNA 4FP2A 4KH9A 4QXBA 2E32A 3KS7A 3K3NA 1XBFA 1CJDA 2JE9A 2WR9A 2Z4FA 2Q30A 3RYKA 1JUHA 4RR3C 4QX1A 2CU5A 2BJSA 1TEIA 1WD4A 5A33B 1AVBA 3H9AA 4JHZA 3RG0A 2EIEA 1OLQA 3NMBA 5A7WA 1ODNA 1V6IA 2TUNA 4OUMA 5C8WA 1W3XA 2D40A 4P9WA 4ZXKA 1LOFA 2GNDA 2NMOA 4NO4A 4AK3A 2RG4A 2P6CA 1WMXA 1ULPA 4N53C 3T0DA 4QKDA 2JXAA 1BZWA 1OC1A 4AFAA 5CKQA 3KMHA 4AVAA 3ZXJA 4OZXA 4LBQB 4UW3A 3ST7A 3WT3A 1WCDJ 3EXUA 5AVAA 3O1PA 2HWE2 4IL7A 1XC6A 4XHBA 2CY6A 2W46A 4QPIC 2Q8EA 4Q8KA 3BIEA 5JZGB 4GAZA 2UWAA 3U4XA 5LZ6A 1OURA 1DYPA 2OX0A 4HONA 4LA3A 3O7OA 4D7TA 5T5JA 1W6QA 1OF3A 2GZWA 5DUVA 2HJIA 2DDUA 2DVFA 2UWCA 3H7JA 1RUI2 4AHXA 2PHLA 4BQ1A 1SBFA 4A3ZA 4XF3A 4NPLA 4P5YA 3LEIA 3GJAA 5FY0A 3UGFA 1UZVA 4LE3A 4E9KA 5LEKA 1AL21 5DZFA 5FPUA 4BOWA 1G7YA 2QQUA 1A34A 4H2AA 3V0BB 2WWJA 3E6DA 3LQCA 3W58A 3WINE 4IGOA 4P9GA 3E1F1 4OHZA 2A6WA 3WW4A 5FO9B 4FPHA 4JQTA 1RMU3 3LWCA 1NCQB 2AREA 2JDUA 1U5IA 4A44A 2JEMA 3U14A 2FMYA 2NLRA 1HX6A 3M7AA 3PLQA 3ENRA 2Y6KA 3WG1A 3RJ2X 1OA3A 1FT9A 2DCTA 4JQRA 2KD7A 1MEC1 3FL7A 1WKYA 4BYYA 4EN7B 4QGMA 2VUCA 2CNAA 4XUTA 3RFRA 2VZVA 1S1AA 4RGKA 1ZA7A 2GNBA 3HWJA 1GBGA 4M3CA 3QOPA 4NWWA 3TRSB 3KF5A 2XR4A 1P8JA 3TN93 3FX3A 1S2BA 3FFQA 3JD71 5CG9A 2G19A 3RZMA 2R1BA 1WMEA 3LE0A 4K1YA 2VZUA 4F83A 3DYMA 4U36A 4LUMA 3SH5A 1NOVA 1VB2A 2WZR3 1W90A 3PUIA 3TNQA 3WNNA 3AKPA 3O5SA 5T50A 2ZHLA 5A7SA 2BDRA 3VD4A 2IFWA 4M3CE 4I0WB 2DCJA 1RUG2 2XHNA 3HQUA 5DZEA 2AH2A 4IEPA 4OI0A 2IUWA 3GZUC 5FUNA 4P00B 5ACA3 5C8CB 4N90A 3NAPC 1NCRB 2I2SA 5I0TA 5BXXA 1URXA 1K5MB 3ZXGA 5F5QA 1U5YA 4IETA 4XF1A 4FTEA 3VZNA 1GLHA 1V6OA 2QZ3A 5FP8A 3P6BA 3WG2A 4AEMA 4ATFA 3OBTA 4MO3M 1OVSA 1NQJA 1MS0A 3EQEA 4W50A 2AEZA 2FD8A 2WWUA 3ZN6A 3WCRA 4QQPA 1MVEA 1CPNA 3ZR5A 1CJPA 5A6ZA 1JI6A 4MG2A 2D6NA 4DQAA 1C8M1 1WZXA 2WYFA 5F2WA 3RMXA 1MR5A 5F3IA 1POV0 1TMF2 1VBD3 1EPZA 1PIV1 4OMCA 2ID4A 3OCPA 1WLWA 1CZTA 5HV0A 1AYM3 3T4HB 5AC93 1WMFA 1V6MA 1QIQA 2WNVC 3T2QA 5FDBA 1IPKA 3NKGA 3WNXA 4KU7A 4Q4W3 3NRUA 4XQ4A 4AAXA 2ARBA 1F8VA 2QQKA 5LA9A 5CZKA 3I8TA 4PF5A 3JCIA 5JSRA 4Y1UA 2WT2A 1HXS3 5A3TA 4AI2A 3K2OA 5CFDC 5JOYA 1QJX1 3MF6A 3VBFA 4YM3A 5DAXA 2VTXA 4Q4Y3 5K0UB 4BIOA 3AL5A 3WNPA 1W6NA 3PTYA 4I30A 1WBLA 1ULCA 1WLCA 2JDMA 3MBWA 5A3UA 5BNOC 1YNAA 5FMDA 5FZ8A 4LITA 3UK9A 1BMV2 5H9PA 2V4VA 1UIKA 3ORJA 2VJXA 3HOBA 4YPJA 1ZBA2 2DU1A 1UKGA 4LULA 4C1XA 4NHLA 4MXVA 4CDQC 3H8OA 3OBAA 1UOJA 4DFSA 3I2FA 1SDWA 3AYCA 2VUDA 2XBO1 2XOMA 1UZWA 1QQP3 2NYYA 2RS11 1ND2A 4AHYA 2RM23 4FOQA 4TXWA 3QH7A 1V6JA 1DGRA 1RUH3 2RMU1 3FHIB 1CAVA 4QPYA 2YMZA 4KQ7A 1O8PA 2VOKA 1ZRFA 1VBA2 4GB33 4ISQA 2X29A 5LWBA 3MIGA 2XL9A 4XUQA 1CWPA 1RMU2 2ZPXA 3VDAA 4LXLA 2BNNA 2Y6HA 3AVSA 3T2PA 1DZQA 3DN7A 1OVPA 1PO11 1VE0A 2Y60A 1NLSA 1H2LA 2YGMA 2Q4SA 4ZS2A 1SLBA 4QT6A 5CFDA 1QHDA 3OYWB 1JYNA 2VECA 2D98A 1KQRA 1ZNPA 1W9SA 4RHV3 4IESA 3LDBA 4K8RB 1WCSA 1DFQA 3AZYA 4OUSA 5A3OA 4BWOA 3MFCA 5E1RA 3ZOIA 3VZKA 4CUGA 5FMBA 2EXIA 3D0JA 3PU3A 2WNVA 3ZSMA 4DNYA 2YHJA 2BERA 1PO21 3NJYA 1ZVFA 1NX9A 1C4RA 2OIIA 3POEA 4M00A 5FTTC 4A42A 1UMZA 3MPBA 4E4ZA 4L8QA 1PM7A 2XHKA 1BVVA 2ZMLA 5F1RA 1QJEA 4LBQD 1NCRC 1FPN2 4JDNA 4IW3A 3VBHB 2XMLA 4IE0A 5L9VA 4CUCA 3TEXA 3ZFGB 1OA4A 4H14A 1UU4A 3VKFC 3SKJE 2Y8KA 3EO6A 5K8SA 3CBNA 5ISLA 3KVAA 4ZZ5A 4RQPB 2FCTA 4GWMA 1PIV3 1PVC1 4GKYA 2R6QA 1NZIA 4XJ9A 4AHWA 4NR1A 4A41A 2D6LX 2WABA 3NV3A 4Q2FA 5JVVA 4BQXA 2VY0A 1XNAA 2YC4A 2V4AA 4B7EA 5C3QA 4CEWC 1XE7A 2A6XA 1RMU1 2ZX4A 4C1WA 1GZWB 1ZA4A 2JDYA 3ZSKA 3ZFGC 4CEYA 4DB5A 5DAWA 2MHFA 2HEVF 4XFBA 5DAPA 3UESA 4CCDA 2NP0A 1S0GA 4GH4B 4NHMA 5A3LA 1NY71 1W6NB 4DEQA 4IDZA 3VBSB 5E8AA 3WUDA 4HVQA 5IFPA 3VBFC 1Y9GA 3DF0A 5FFOC 1UY3A 1GWKA 2FCVA 3KQ4B 1HV1A 3OTFA 4TN7A 1QH6A 1G9BA 5FO7B 1MS3A 3VN4A 2XL7A 4XTMA 1ND3B 4YZ2A 1E5RA 1DQ6A 3R0RA 4N7IA 1EYBA 3D5OA 4JGYA 4TYSA 5GM0A 2VBBA 4PIYA 3WV6A 2BU9A 1DGRN 2W2IA 1S55A 2YU1A 1VMJA 2NMNA 5EYYA 3ZXAC 5A70A 1RUJ3 2C9KA 3ZMNA 2V5YA 1WCUA 4IQPA 3ZSLA 4X8NA 3DKQA 1G6NA 3PHMA 1W6PA 1A6CA 4O9GA 4XOGA 5HCFA 3WP4A 5JWPA 5FXVA 1ZZCA 4AHZA 4K21A 1DQ5A 3SCHA 1RUI1 3FWEA 4FFFA 2A6VA 4HMZA 1VMHA 1AYM2 1LHUA 4AQTA 2WLPA 3RMYA 3AP4A 3I4IA 1OQEA 2UWBA 4K3UA 1FNZA 4PQQA 2RS33 4NHKA 4UBHA 1HV0A 3CIHA 3OGSA 3EMRA 3GHMA 4CPBA 4DMIA 5BPXA 1JYTA 1AR73 1LNSA 1YQ8A 2P6HA 3AM2A 4E2SA 5KHJA 5CFCC 2VZTA 3I3EA 4AGGA 3CEWA 4BIFA 3AKQA 3OJBA 4LBKA 1O91A 3UETA 5IVBA 1K5JA 4QPIA 1GOFA 3PNAA 5FPAA 4CXXA 5F9TA 2O1QA 1FOD1 2CAUA 2Y38A 3ZYFA 4E27A 1FOD3 1JTZX 1LGNA 3THTA 4IEQA 5EZWA 3KV4A 1RHI2 5LK7B 3B5LB 3FUOA 1YQCA 2KM2A 1CAUB 3SHRA 3K3OA 4L99A 4L97A 3INAA 3WDVA 1CVNA 3KT4A 1MS8A 3MFAA 4Q4W1 3ZKYA 5CAZA 1CN1A 2PA7A 4OHVA 4EN9B 4K40A 1YQ6A 5IVEA 1DYKA 1Y7BA 5C7GA 2E9QA 4QXHA 4K1ZA 2D93A 4GJYA 4WVZA 1GNYA 5KHKA 2E6VA 4CCMA 1O3TA 3GYDA 3DYPA 4KG0A 2OUJA 1GMMA 1GZTA 1O5UA 1X50A 3JQWA 4PJYA 1FPN3 2PAMA 3T1MA 5FP4A 1QJU3 1YWKA 3U75A 1Y43B 4MXWA 1AYN3 1PX4A 1ENSA 2GC2A 2GH8A 4UT5A 2J1AA 2RJKA 3N9OA 3BYWA 4LBJA 3ZXDA 2VCAA 2ZEZA 4LPLA 1XU1A 3THDA 2WC2A 4EWAA 1ZRDA 5BYNA 4J1XA 5A3WA 5A6QA 2AYHA 2K46A 3O0VA 4E8CA 1ULDA 1TVGA 2VE1A 5JR7B 3M2MA 5BNQA 4MOAA 1ST8A 1US3A 1A8DA 4QQOA 2ZGSA 2VBDA 5JUVA 1HJGA 2ZXQA 1IKQA 1W2OA 2WN3A 3M3OA 5B2GB 1D4VB 1MQTC 1SQ4A 2HEYF 2BOJA 5AVPA 5KBFA 2EIGA 2LUWA 2RS12 2DUPA 2F6BA 5DUWA 1C3HA 5LBFA 4CU9A 1QQP2 4J25A 2QFEA 3T0AA 2DVAA 3UV9A 3H8RA 1HB2A 2SLIA 4KBZA 1JHJA 2GP5A 1R092 4IV3A 3TYJA 3B7MA 5JI7A 2VZQA 3H3ZA 3LCPA 2XJPA 1MS1A 3POJA 1S0EA 2VCMA 5FZ4A 2WNEA 3VZLA 3LB9A 5F3CA 1QEXA 2BBAA 2G4IA 2QE3A 2ZABA 1J84A 2PHRA 4HPKA 1QJX2 1ACCA 4UAPA 2GDFA 5T55A 4DPNA 4K9SA 2R49A 5EYXA 2BTVC 4NROA 3O1VA 3KHCA 4XJWA 4OULA 4D7SA 5DABA 2ES3A 2GAUA 2QQOA 5IK5A 5FUPA 4M4PA 4GALA 2RHPA 5KR7A 5KC5A 1D2SA 2HWC2 1DQ4A 1RIRA 2PQSA 3N36A 2C0ZA 3CJXA 3S6PA 4TLGA 4P02B 3RZZA 4XJ8A 4ARXA 3UNPA 4F7ZA 1BJQA 2ZX3A 4PLMA 1H8VA 2FMDA 5FYYA 4FP3A 1U12A 2KXLA 2CHHA 4H3WA 5G05L 4AEKA 1YC61 5FCCA 2PXJA 1QDCA 2BFUS 2ZMKA 2R30A 5AC91 1V70A 4LKDA 1IQDC 4KNCA 5F32A 1UU6A 3CHXA 3NQHA 5FQ0A 2F4LA 2E7AA 3QBQA 2AZ5A 3NAPB 4COWA 2JKXA 2RM21 2TBVA 5IATA 3IPVA 1UIJA 1UMHA 2VUJA 3VKNA 2QQPA 3FHQA 3PMSA 4ES8A 3AVRA 1E5SA 4C90A 1R64A 4JGZC 4XYXA 2VOTA 1ZX5A 3GDBA 4XFGA 2O0OA 3MIBA 5K9YA 2Y64A 4QPGA 4MGZE 4A3XA 4LIVA 3S30A 2GP3A 4NPMA 4H55A 1HN0A 5FKBA 3L2HA 2R073 4KGQA 4Y20B 4XDPA 3LFIA 5A3NA 4AI3A 1X33A 5FOJB 4CU8A 4GKXA 5A80A 1LOBA 3ROUA 2JE8A 1T2XA 4N9HA 4QX8A 1HB3A 2H6CA 1TQ5A 2HBUA 2W1SA 3WDWA 4AZZA 3U07A 2WZR2 4QKBA 4UFMA 2RS13 3R4SA 2VW0A 1X36A 5FR3A 4YW5A 4COUA 4MH0E 2ZHKA 3HJRA 4XCAA 3RVHA 3SC7X 3O1SA 3UT0A 1GQPA 3PVBB 5FZGA 3OG2A 4ZXEA 5JOZA 2JE7A 4HK8A 3ACHA 1G9FA 1WBFA 1H1IA 2VW2A 4FFHA 2XJUA 2BRTA 1DLCA 2B45X 3M4FA 1DU3D 1LESA 4RR3A 3FUQA 1MEC2 1OKOA 3EJKA 1UD1A 1HQWA 1PGSA 1UCXA 4HPKB 2WDBA 3W9AA 1XSRA 5BNPB 3URFA 1KS5A 2HLEA 5A1LA 1MS9A 3O1TA 5T3NA 1VBE1 3F95A 2P2KA 2ZHMA 1ZREA 3OGVA 4E2GA 2ZX0A 2QJVA 4ISRA 2A1XA 3HN3A 2EXJA 1N3OA 2B7YA 3E5UA 3ILNA 4YGBA 5FPBA 5CBLA 4SBVA 3O1OA 1AXZA 1MQTB 2W5FA 4N43A 4BXSV 4NAOA 5D8AA 2Q8CA 4AEDC 5FK8A 2G9FA 1IG3A 2VQUA 3LA3A 4CRQA 1QJU2 1O59A 4CPBD 2JG9B 5FZ1A 2W68A 2MPFA 1EUUA 2X8KA
chains in the Genus database with same CATH topology
3LEIA 1XNTA 2X05A 4XUPA 3IAPA 3LQCA 5DQ0A 3E1F1 2QQNA 4MGSA 3P1IA 1NUKA 2CDOA 2WO2A 4AG4A 4A44A 1UYYA 3I97A 2VMCA 4LQRA 4D0QA 2Y6KA 2W91A 3WF3A 4OYUA 1SG3A 2KD7A 3FL7A 1WKYA 3DYOA 4XUTA 1SDDB 2VZVA 4QX2A 4QB6A 4JKKA 1DP0A 1P8JA 3IAQA 4E8DA 1JZ2A 1JZ5A 2VC9A 1GOHA 4ZZ8A 1CZVA 3LE0A 2E31A 2VZUA 3DYMA 4KMQA 1JZ6A 3PUIA 3WF2A 3WNNA 1UYZA 3VD4A 4QDQA 2DCJA 2XHNA 2LW8A 5JXIA 4P00B 2WAOA 4XUOA 4M4RA 1SHWB 5LA2A 1L7QA 2WYSA 2W87A 3I2GA 2J1RA 1YQ2A 3CDZB 2RJ2A 3P6BA 3F2ZA 2OKXA 4FI9A 4MO3M 1PMHX 3GXUA 4W50A 2B9VA 4QX3A 1JI6A 5B4XA 2RVAA 3ABZA 3MV01 4PF1A 1DYOA 4OMCA 2ID4A 3WQBA 2VTFA 1CZTA 4JX0A 1GUIA 3C7HA 3CQOA 3I2IA 5IFTA 5JXHA 3T2QA 3NRUA 2YG0A 4AAXA 3I3DA 5FUIA 2QQKA 5CZKA 2W47A 4D8MA 5JMOA 1K42A 1UY2A 5LCWL 1GU3A 3WNKA 1BHGA 4CUAA 3OEAA 4A6OA 3WNPA 3MBWA 1TG7A 2VMEA 5I0DA 1UMIA 1JYXA 4KI5M 2XONA 1H6YA 2V4VA 5IJRA 3HOBA 2VJXA 4YPJA 2E26A 1UYXA 5EIYB 3C8XA 1W99A 2QQJA 3OBAA 2WO3A 3I2FA 2RV9A 3J7HA 5JXGA 1PMJX 2XOMA 1XPWA 2J1UA 3WF4A 3VD5A 1NKGA 4TXWA 1O8PA 4L0PA 3WNOA 3IDAA 3IB3A 4XUQA 4JKLA 3VDAA 1RYYA 2WUHA 2Y6HA 1PX3A 4DUVA 3AC0A 5EJ1B 3T2PA 3CMGA 3VDBA 5JXJA 3A22A 2ORXA 1JU3A 1JYNA 2W1WA 2DCKA 3FHAA 1I5PA 4GWJA 1OH4A 1W9SA 3MUZ1 3K4ZA 2R7EB 1CZSA 3BN6A 4DXRA 3VDCA 5DPNA 3ACIA 3A21A 2C4XA 1UY1A 4BK4A 4HG6B 1JZ7A 2J1SA 1NAEA 2BERA 3K4AA 2VO5A 2VZ1A 1W8OA 1NX9A 4A42A 2J7MA 4W8JA 4XURA 3WEZA 4JKMA 4CUCA 2EIDA 4GWIA 3K75B 4PT6A 2Y8KA 3SKJE 4ZZ5A 2W92A 2VCCA 4QX0A 3VD3A 4QAWA 3NJVA 3VD7A 4QB1A 5G04L 2WZ8A 5C70A 3LPGA 4A41A 5B4NA 2WABA 2QBXA 3T2OA 5LA1A 4QDSA 2VZPA 1XNAA 2YC4A 4RN5A 2W1UA 1KEXA 4ZY9A 5DMYA 3ECQA 4LHSA 3UESA 3WNLA 2BGPA 1UX7A 3I3BA 4DEQA 3K4DA 4DUXA 5IFPA 1UWWA 1UY3A 3CZJA 3HEIA 5J1XA 2V72A 1UXXX 5HXMA 3NNGA 1JZ8A 2WO1A 2C26A 3FN9A 1JYVA 3W5NA 2C9KA 1KGYA 3GGLA 3GM8A 3WF0A 5LA0A 2Y6JA 2YFZA 4XUNA 2W94A 3SKVA 2X09A 2YC2A 3MUY1 1OT5A 4ET7A 4PQQA 2QQLA 3DECA 5IYYA 2ZEWA 3C7OA 3CIHA 3OGSA 2VCBA 2JD9A 3EYPA 3K46A 3PUHA 4OZOA 2VZOA 4ARYA 1LNSA 1MPXA 2QQMA 2WZEA 2VZTA 1WCQA 3I3EA 4MGQA 3I2JA 3UETA 1GOFA 3EB7A 4KWUA 4QB2A 3T0BA 2WN2A 3JXSA 4DXSA 3CKHA 2W3JA 1W0NA 1UZ0A 1JU4A 2YFUA 2X10A 4LKSA 4TTGA 2EIBA 1O8SA 1K12A 2VZSA 4OUEA 3LPFA 5C7GA 1UY4A 3THCA 4W4ZA 1GNYA 3DYPA 1GMMA 2WBKA 3CZUA 1US2A 5IHRA 3OGRA 1PX4A 1W9WA 3HNBM 3SEEA 2BZDA 2EICA 1JZ3A 1K3IA 2VR4A 2J1AA 5A1AA 3T08A 1F4AA 2VCAA 2J1VA 2ZEZA 4LPLA 3THDA 3W5MA 1UXZA 4CU7A 4E8CA 1TVGA 4MOAA 3ACGA 1US3A 4DXTA 5JUVA 2ZXQA 4Z2AA 2WN3A 3C7GA 2LS6A 4QDRA 2E33A 4CU9A 2ORZA 3OEBA 3T0AA 3A23A 3LEGA 2CDPA 4QPWA 4MADA 5F7UA 2WAAA 1EUTA 1JHJA 5HPOA 1F4HA 2VZQA 1W9TA 3ZM8A 2Y6GA 4UI9L 2J1TA 2J1EA 2YB7A 2VL4A 2BBAA 1J84A 1UY0A 3NJXA 3A7QA 4UAPA 3WSOA 1HN1A 2VQTA 2VZ3A 2QQOA 3HNYM 4M4PA 1GOGA 2BGOA 5CYYA 3HPNA 2W95A 2PQSA 1H6XA 2J22A 1J83A 3UNPA 4P02B 4ARXA 2Y6LA 4OMDA 5EJZB 3SEPA 1CX1A 5G05L 2QQIA 3ETPA 1ULOA 1K45A 4CVUA 3LEKA 1IQDC 4A4AA 1D7PM 3NQHA 2XQXA 2V5DA 1W8NA 4UOJA 3T09A 3WF1A 2JKXA 3BGAA 2B4KA 1UMHA 2ZEYA 3FHQA 4IUGA 3MO4A 1R64A 1OD3A 4DEVA 3VD9A 2VOTA 3GDBA 2Y64A 3ACFA 3C7EA 3IIIA 2HYXA 2VMDA 4DUWA 1CIYA 4CUBA 3HNMA 3K77A 4BK5A 4CU8A 2JE8A 4GZ9A 1T2XA 2W1QA 4CU6A 2W1SA 4XZUG 2E32A 3WNMA 4XVHA 2VM9A 2Z4FA 2L9LA 3U37A 4QX1A 3HJRA 3I2HA 4P08A 2VMFA 1GQPA 4ZXEA 3OG2A 3OB8A 4JHZA 2EIEA 3ACHA 5DN2A 5JR2A 1DLCA 1OF4A 4A45A 1ULPA 3T0DA 4BJ0A 2WDBA 2ZEXA 2HLEA 3MV11 2JDAA 1JYWA 1XC6A 3OGVA 2VZRA 2W46A 3HN3A 4BDVB 2W9XA 2W5FA 4BXSV 4RYDA 1OF3A 3D3AA 1L7RA 2DDUA 2WQ8A 2VQUA 5C71A 1O59A 4A3ZA 3I2KA 3C7FA 1JZ4A 1EUUA 4P5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LEI A;  1XNT A;  2X05 A;  4XUP A;  3IAP A;  3LQC A;  5DQ0 A;  3E1F 1;  2QQN A;  4MGS A;  3P1I A;  1NUK A;  2CDO A;  2WO2 A;  4AG4 A;  4A44 A;  1UYY A;  3I97 A;  2VMC A;  4LQR A;  4D0Q A;  2Y6K A;  2W91 A;  3WF3 A;  4OYU A;  1SG3 A;  2KD7 A;  3FL7 A;  1WKY A;  3DYO A;  4XUT A;  1SDD B;  2VZV A;  4QX2 A;  4QB6 A;  4JKK A;  1DP0 A;  1P8J A;  3IAQ A;  4E8D A;  1JZ2 A;  1JZ5 A;  2VC9 A;  1GOH A;  4ZZ8 A;  1CZV A;  3LE0 A;  2E31 A;  2VZU A;  3DYM A;  4KMQ A;  1JZ6 A;  3PUI A;  3WF2 A;  3WNN A;  1UYZ A;  3VD4 A;  4QDQ A;  2DCJ A;  2XHN A;  2LW8 A;  5JXI A;  4P00 B;  2WAO A;  4XUO A;  4M4R A;  1SHW B;  5LA2 A;  1L7Q A;  2WYS A;  2W87 A;  3I2G A;  2J1R A;  1YQ2 A;  3CDZ B;  2RJ2 A;  3P6B A;  3F2Z A;  2OKX A;  4FI9 A;  4MO3 M;  1PMH X;  3GXU A;  4W50 A;  2B9V A;  4QX3 A;  1JI6 A;  5B4X A;  2RVA A;  3ABZ A;  3MV0 1;  4PF1 A;  1DYO A;  4OMC A;  2ID4 A;  3WQB A;  2VTF A;  1CZT A;  4JX0 A;  1GUI A;  3C7H A;  3CQO A;  3I2I A;  5IFT A;  5JXH A;  3T2Q A;  3NRU A;  2YG0 A;  4AAX A;  3I3D A;  5FUI A;  2QQK A;  5CZK A;  2W47 A;  4D8M A;  5JMO A;  1K42 A;  1UY2 A;  5LCW L;  1GU3 A;  3WNK A;  1BHG A;  4CUA A;  3OEA A;  4A6O A;  3WNP A;  3MBW A;  1TG7 A;  2VME A;  5I0D A;  1UMI A;  1JYX A;  4KI5 M;  2XON A;  1H6Y A;  2V4V A;  5IJR A;  3HOB A;  2VJX A;  4YPJ A;  2E26 A;  1UYX A;  5EIY B;  3C8X A;  1W99 A;  2QQJ A;  3OBA A;  2WO3 A;  3I2F A;  2RV9 A;  3J7H A;  5JXG A;  1PMJ X;  2XOM A;  1XPW A;  2J1U A;  3WF4 A;  3VD5 A;  1NKG A;  4TXW A;  1O8P A;  4L0P A;  3WNO A;  3IDA A;  3IB3 A;  4XUQ A;  4JKL A;  3VDA A;  1RYY A;  2WUH A;  2Y6H A;  1PX3 A;  4DUV A;  3AC0 A;  5EJ1 B;  3T2P A;  3CMG A;  3VDB A;  5JXJ A;  3A22 A;  2ORX A;  1JU3 A;  1JYN A;  2W1W A;  2DCK A;  3FHA A;  1I5P A;  4GWJ A;  1OH4 A;  1W9S A;  3MUZ 1;  3K4Z A;  2R7E B;  1CZS A;  3BN6 A;  4DXR A;  3VDC A;  5DPN A;  3ACI A;  3A21 A;  2C4X A;  1UY1 A;  4BK4 A;  4HG6 B;  1JZ7 A;  2J1S A;  1NAE A;  2BER A;  3K4A A;  2VO5 A;  2VZ1 A;  1W8O A;  1NX9 A;  4A42 A;  2J7M A;  4W8J A;  4XUR A;  3WEZ A;  4JKM A;  4CUC A;  2EID A;  4GWI A;  3K75 B;  4PT6 A;  2Y8K A;  3SKJ E;  4ZZ5 A;  2W92 A;  2VCC A;  4QX0 A;  3VD3 A;  4QAW A;  3NJV A;  3VD7 A;  4QB1 A;  5G04 L;  2WZ8 A;  5C70 A;  3LPG A;  4A41 A;  5B4N A;  2WAB A;  2QBX A;  3T2O A;  5LA1 A;  4QDS A;  2VZP A;  1XNA A;  2YC4 A;  4RN5 A;  2W1U A;  1KEX A;  4ZY9 A;  5DMY A;  3ECQ A;  4LHS A;  3UES A;  3WNL A;  2BGP A;  1UX7 A;  3I3B A;  4DEQ A;  3K4D A;  4DUX A;  5IFP A;  1UWW A;  1UY3 A;  3CZJ A;  3HEI A;  5J1X A;  2V72 A;  1UXX X;  5HXM A;  3NNG A;  1JZ8 A;  2WO1 A;  2C26 A;  3FN9 A;  1JYV A;  3W5N A;  2C9K A;  1KGY A;  3GGL A;  3GM8 A;  3WF0 A;  5LA0 A;  2Y6J A;  2YFZ A;  4XUN A;  2W94 A;  3SKV A;  2X09 A;  2YC2 A;  3MUY 1;  1OT5 A;  4ET7 A;  4PQQ A;  2QQL A;  3DEC A;  5IYY A;  2ZEW A;  3C7O A;  3CIH A;  3OGS A;  2VCB A;  2JD9 A;  3EYP A;  3K46 A;  3PUH A;  4OZO A;  2VZO A;  4ARY A;  1LNS A;  1MPX A;  2QQM A;  2WZE A;  2VZT A;  1WCQ A;  3I3E A;  4MGQ A;  3I2J A;  3UET A;  1GOF A;  3EB7 A;  4KWU A;  4QB2 A;  3T0B A;  2WN2 A;  3JXS A;  4DXS A;  3CKH A;  2W3J A;  1W0N A;  1UZ0 A;  1JU4 A;  2YFU A;  2X10 A;  4LKS A;  4TTG A;  2EIB A;  1O8S A;  1K12 A;  2VZS A;  4OUE A;  3LPF A;  5C7G A;  1UY4 A;  3THC A;  4W4Z A;  1GNY A;  3DYP A;  1GMM A;  2WBK A;  3CZU A;  1US2 A;  5IHR A;  3OGR A;  1PX4 A;  1W9W A;  3HNB M;  3SEE A;  2BZD A;  2EIC A;  1JZ3 A;  1K3I A;  2VR4 A;  2J1A A;  5A1A A;  3T08 A;  1F4A A;  2VCA A;  2J1V A;  2ZEZ A;  4LPL A;  3THD A;  3W5M A;  1UXZ A;  4CU7 A;  4E8C A;  1TVG A;  4MOA A;  3ACG A;  1US3 A;  4DXT A;  5JUV A;  2ZXQ A;  4Z2A A;  2WN3 A;  3C7G A;  2LS6 A;  4QDR A;  2E33 A;  4CU9 A;  2ORZ A;  3OEB A;  3T0A A;  3A23 A;  3LEG A;  2CDP A;  4QPW A;  4MAD A;  5F7U A;  2WAA A;  1EUT A;  1JHJ A;  5HPO A;  1F4H A;  2VZQ A;  1W9T A;  3ZM8 A;  2Y6G A;  4UI9 L;  2J1T A;  2J1E A;  2YB7 A;  2VL4 A;  2BBA A;  1J84 A;  1UY0 A;  3NJX A;  3A7Q A;  4UAP A;  3WSO A;  1HN1 A;  2VQT A;  2VZ3 A;  2QQO A;  3HNY M;  4M4P A;  1GOG A;  2BGO A;  5CYY A;  3HPN A;  2W95 A;  2PQS A;  1H6X A;  2J22 A;  1J83 A;  3UNP A;  4P02 B;  4ARX A;  2Y6L A;  4OMD A;  5EJZ B;  3SEP A;  1CX1 A;  5G05 L;  2QQI A;  3ETP A;  1ULO A;  1K45 A;  4CVU A;  3LEK A;  1IQD C;  4A4A A;  1D7P M;  3NQH A;  2XQX A;  2V5D A;  1W8N A;  4UOJ A;  3T09 A;  3WF1 A;  2JKX A;  3BGA A;  2B4K A;  1UMH A;  2ZEY A;  3FHQ A;  4IUG A;  3MO4 A;  1R64 A;  1OD3 A;  4DEV A;  3VD9 A;  2VOT A;  3GDB A;  2Y64 A;  3ACF A;  3C7E A;  3III A;  2HYX A;  2VMD A;  4DUW A;  1CIY A;  4CUB A;  3HNM A;  3K77 A;  4BK5 A;  4CU8 A;  2JE8 A;  4GZ9 A;  1T2X A;  2W1Q A;  4CU6 A;  2W1S A;  4XZU G;  2E32 A;  3WNM A;  4XVH A;  2VM9 A;  2Z4F A;  2L9L A;  3U37 A;  4QX1 A;  3HJR A;  3I2H A;  4P08 A;  2VMF A;  1GQP A;  4ZXE A;  3OG2 A;  3OB8 A;  4JHZ A;  2EIE A;  3ACH A;  5DN2 A;  5JR2 A;  1DLC A;  1OF4 A;  4A45 A;  1ULP A;  3T0D A;  4BJ0 A;  2WDB A;  2ZEX A;  2HLE A;  3MV1 1;  2JDA A;  1JYW A;  1XC6 A;  3OGV A;  2VZR A;  2W46 A;  3HN3 A;  4BDV B;  2W9X A;  2W5F A;  4BXS V;  4RYD A;  1OF3 A;  3D3A A;  1L7R A;  2DDU A;  2WQ8 A;  2VQU A;  5C71 A;  1O59 A;  4A3Z A;  3I2K A;  3C7F A;  1JZ4 A;  1EUU A;  4P5Y A; 
#chains in the Genus database with same CATH topology
 4G3Y C;  5FYT A;  4MZU A;  1X82 A;  3PJY A;  3NKT A;  2X05 A;  1RUO A;  2WSV A;  3IAP A;  1JOB A;  2DTY A;  5M0T A;  4LA2 A;  1WW5 A;  2QQN A;  4MGS A;  3NAP A;  4YRD A;  3P1I A;  1ND2 C;  2OS2 A;  3VKO A;  1HRV 2;  4H7M A;  4RL7 A;  4BQW A;  4A7Y A;  3VBR B;  5GKA C;  3WZ1 A;  3CJI C;  2D43 A;  3U11 A;  3I97 A;  5FMO S;  4D0Q A;  4YW2 A;  3SH3 A;  4B4P A;  2W91 A;  1YLL A;  1VAV A;  4HOO A;  2ENR A;  1FXZ A;  1SG3 A;  2WT1 A;  3O0X A;  3PU8 A;  4BLI A;  1MVQ A;  1DZT A;  3OUJ A;  4QPG B;  1UOB A;  1EPW A;  1C8N A;  2RDR A;  2ZGQ A;  3DYO A;  1BBT 3;  1F5J A;  1Q56 A;  3A4U A;  1UOG A;  3AP7 A;  4XFC A;  2ZAH A;  4JKK A;  3WHU A;  4BH9 A;  1DP0 A;  4CZS A;  2GAL A;  2FDK A;  3P3N A;  4FPK A;  5FYC A;  1I9R A;  1RUC 3;  2RS5 1;  5EV7 A;  1JZ2 A;  1JZ5 A;  2V09 A;  3BOD A;  4UXA A;  4GUL A;  4ZZ8 A;  3IM0 A;  3AZV A;  5GJ6 A;  5J96 B;  1CZV A;  5FZ7 A;  4HZF A;  1O5L A;  2E31 A;  2VG9 A;  4CDW C;  2BGC A;  2W52 A;  4D94 A;  4KMQ A;  1V6N A;  3NNJ A;  1KIT A;  3QD6 A;  4PBO A;  2YPJ A;  4V2W A;  3MHZ A;  4K7J A;  2LW8 A;  2JB4 A;  1EAH 2;  2PHW A;  4BHP A;  5JXI A;  2WAO A;  3PL0 A;  2E53 A;  5FK7 A;  1VRH 1;  3ZDV A;  3ZXK A;  4CDU A;  4LHN A;  3BVC A;  1VIW B;  2R16 A;  3I2G A;  1YQ2 A;  2WO7 A;  1R1A 3;  3F2Z A;  4FI9 A;  4CCE A;  4XAA A;  1HB1 A;  3HIF A;  4IV1 A;  2O14 A;  3GXU A;  1HIX A;  3E5X A;  4B29 A;  1H9P A;  4QX7 A;  4EV0 A;  2RDQ A;  1RUC 1;  2RS5 3;  1RUG 3;  5LY2 A;  1YHF A;  5BNN B;  2VOX A;  4K8F A;  2MEV 1;  3MIH A;  3KT7 A;  3VV1 A;  2HWF 2;  4IEX A;  2JJ6 A;  4HSJ A;  1LOC A;  4UW5 A;  5C3S A;  1RIT A;  1ZRC A;  1HW5 A;  4PF1 A;  2IWG B;  3DCQ A;  3LKJ A;  2Z5W A;  3MIF A;  3WQB A;  3AYA A;  3RPQ A;  4CP1 A;  3LOI A;  4AED B;  3C7H A;  5FMO L;  1B09 A;  2OW4 A;  3OF1 A;  5DUX A;  1ZBE 2;  3DEM A;  5IFT A;  3O1U A;  3S5Q A;  4ZHN A;  1ENX A;  4RQP C;  5H9Q A;  1H1M A;  4CEW A;  4E4D X;  4WM7 B;  1PGL 1;  2EAA A;  2YG0 A;  3N7K A;  3I3D A;  5K7P A;  5IAX A;  5FUI A;  1QJY 1;  2ZTN A;  4UYB A;  5GZF A;  5BNO A;  1QJY 3;  4UW4 A;  3N7M A;  1OOP A;  4D8M A;  1S0B A;  4A7K A;  5JMO A;  5FXW A;  3BU0 A;  2G9Z A;  4ONU A;  2MEV 3;  5F3E A;  3WNK A;  4FTS A;  1AUY A;  2R06 3;  3OEA A;  4U2A A;  3AX4 A;  3ZYJ B;  1LR5 A;  3ZYG A;  2H6B A;  3BPZ A;  4KI5 M;  3BTA A;  3FLR A;  2FCU A;  5TSW A;  5LBE A;  1UPS A;  2GH2 A;  4Q4X 1;  4ZPI A;  1AYN 1;  2JG8 A;  3VKL A;  4XMA A;  2WFF 3;  2E26 A;  1UYX A;  4YYO A;  4ZS3 A;  1XOY A;  2QQJ A;  2XWB B;  1ZZ9 A;  1MZF A;  3T2T A;  3ZR6 A;  5JXG A;  1H9W A;  2FHR A;  3FLT A;  2OXB A;  3LD8 A;  2X5I C;  1XPW A;  1WA6 X;  2A3Y A;  4NHX A;  5IK8 A;  3B9I A;  1ALY A;  2H0B A;  1SPP B;  2JDZ A;  3VD5 A;  1YXW A;  1VBB 2;  5FXX A;  4Y3O A;  2A71 A;  4JGY C;  3IDA A;  1PZ8 A;  2JDP A;  4PI0 A;  1LHN A;  3KV6 A;  4IV3 B;  3ZFF C;  3TEY A;  5FZ6 A;  4LBM A;  4LKF A;  4B1M A;  3ZSJ A;  3T30 A;  1DF0 A;  4CDX B;  5EJ1 B;  1X8M A;  3KD4 A;  3JD7 3;  5JXJ A;  4ZU4 A;  4IEW A;  3VDD A;  2ORX A;  3USU A;  1JU3 A;  2CGP A;  3SIT A;  2DCK A;  1OBN A;  3FHA A;  3UGG A;  5C9A B;  2UYB A;  4IER A;  1OH4 A;  2HWE 3;  2ZGL A;  2D97 A;  2R7E B;  1YYN A;  2WWS A;  1F9K A;  2XGX A;  1N47 A;  4CEY C;  1LJ7 A;  4DXR A;  2PHF A;  3NO8 A;  5DPN A;  5K4L A;  3A21 A;  3VBF B;  2C4X A;  1M4W A;  1OQD A;  1NE4 A;  2YC0 A;  4G9S B;  4BK4 A;  5L9B A;  5JOW A;  1RUE 2;  3BI3 A;  4Q0S A;  4Z07 A;  2VZ1 A;  1FV2 A;  1RGS A;  3M3I A;  4PDW A;  3ZSE A;  2Y0I A;  4R9D A;  4W65 A;  2R0F A;  4J1W A;  2I74 A;  5F6L B;  3RZH A;  3V0A A;  2ZKN A;  3M70 A;  5FZE A;  5JIU A;  1OLM E;  4FBF A;  4JKM A;  3ZMO A;  1WMD A;  2EID A;  3QH6 A;  3APB A;  2VQA A;  3K75 B;  5L9R A;  2FDH A;  1N3P A;  2JB8 A;  4Q1P A;  1C8M 3;  4PIZ A;  3WP3 A;  2W92 A;  2VCC A;  4QX0 A;  5D8A C;  3ZFE C;  3MLL A;  4AED A;  4Q4V 2;  4BU2 A;  4JTN A;  1YJL A;  2YRO A;  2HBT A;  4LO8 A;  4QQ2 A;  1CAX A;  4MGT A;  1LKN A;  3THP A;  4QB1 A;  4QMA A;  1RJ8 A;  1VAL A;  2AEY A;  2WZ8 A;  4EWD A;  2P3K A;  4NID A;  5B4N A;  1KJL A;  4QKF A;  4Q4W 2;  4FFG A;  3IPV B;  1XE8 A;  3ELN A;  4DZG A;  3MPP G;  1A78 A;  4RN5 A;  3TOJ A;  3B94 A;  2XBO 3;  2XVG A;  3DGT A;  1KEX A;  4ZY9 A;  1ZZ8 A;  3WNL A;  2BGP A;  2GMM A;  1UN1 A;  1UX7 A;  4KU8 A;  4AAP A;  4TSV A;  4FTB A;  3B3Q E;  1CAW A;  1SFY A;  3K4D A;  5FZH A;  2DU0 A;  3SQO A;  4LBQ A;  3WG4 A;  5T5O A;  1AX2 A;  1AR6 1;  4B7K A;  2WL1 A;  3CZJ A;  3HEI A;  3IN9 A;  4XPV A;  5A32 A;  5J1X A;  1UXX X;  4S2D A;  4NWV A;  4RFR B;  3S5A A;  1QXP A;  3LA2 A;  2Y0O A;  3NNG A;  1NY7 2;  4KWJ A;  1N1S A;  1G8W A;  3ZXL A;  5C8C C;  3ZN4 A;  3AMN A;  5CKM A;  1JZ8 A;  2WO1 A;  1LOE A;  3LIH A;  1YI7 A;  2Q5T A;  4EJR A;  1W2A X;  2KA3 A;  5C6C A;  4RFT 0;  1TNR A;  2BQP A;  3CNA A;  2ZKL A;  5GZG A;  3ZFG A;  2ZA9 A;  3FE5 A;  3KF3 A;  5JPN B;  2ZCW A;  4YZ5 A;  4FPC A;  1WWY A;  2XDV A;  3WF0 A;  4EN8 B;  4RQP A;  5LA0 A;  1R09 3;  5APA A;  5LBC A;  4CDX C;  4XUN A;  2ZZQ A;  2W94 A;  2ZHN A;  4RGG A;  1QOO A;  1YRZ A;  3Q8C A;  4Z2W A;  1AF9 A;  3SKV A;  1YFU A;  3H1W A;  1GZC A;  1XRU A;  2GC1 A;  3DXT A;  2D44 A;  5C9A A;  3VBR C;  3AXD A;  1SMV A;  3H8U A;  4AFB A;  2QQL A;  4AI1 A;  5F37 A;  4QWN A;  5J48 A;  5IYY A;  3ACL A;  2PLV 1;  1AXY A;  2YXS A;  3SXW A;  3KCY A;  2RE9 A;  3PVE A;  2JD9 A;  2C1F A;  1VBB 3;  2LM3 A;  1W6O A;  1RC6 A;  3EYP A;  3K46 A;  5T54 A;  1F5F A;  2A73 B;  4GH4 A;  4XBQ A;  2QQM A;  1GIC A;  5A7N A;  2Q8D A;  3LA7 A;  4M3C B;  3HMY A;  1S0I A;  1EY2 A;  4PDW B;  2QCS B;  1QJU 1;  1SCR A;  1FAT A;  1GR3 A;  1X8E A;  3EB7 A;  1OUX A;  3UGH A;  4B4Q A;  3I3M A;  3GCW A;  2WN2 A;  5F5A A;  1OQ1 A;  1PO2 3;  5BNN A;  4QU1 A;  1YFW A;  2OA2 A;  2PHT A;  1YJK A;  1EP0 A;  1UAI A;  1D0H A;  3E5Q A;  1W0N A;  3DL3 A;  5DAV A;  5JSP A;  1UZ0 A;  4JGZ B;  3O1M A;  1RXG A;  1PM4 A;  4C0B A;  3MEP A;  2YFU A;  2AGS A;  1ULG A;  3HBK A;  4LKS A;  1UYP A;  2EIB A;  1BCX A;  5BNP C;  2VZS A;  3BAL A;  1TNF A;  1MEC 3;  3BU7 A;  4MHU A;  3Q8A A;  4PLN A;  2BWA A;  4Q0U A;  1UU5 A;  4YG0 A;  3ZFE A;  1O4Y A;  2X5I B;  4CE8 A;  3V56 A;  3VBR A;  3RGB A;  1ZRI A;  2D5F A;  2GC3 A;  3AB0 A;  3FJS A;  3TB0 A;  2WBK A;  3AP9 A;  4EE2 A;  3VB9 A;  4O61 A;  1US2 A;  1Z0H A;  5FOB B;  3CJI A;  2KR2 A;  1W9W A;  2QVS B;  4N53 B;  3OY8 B;  5FZ0 A;  2RM2 2;  4Z92 B;  1K3I A;  2UU8 A;  4UFJ A;  2HWF 3;  3T08 A;  2O8Q A;  1CAW B;  2XB6 C;  2J1V A;  4WM8 C;  1RXF A;  1SLC A;  4EZ4 A;  5L36 A;  5E6H A;  3WP5 A;  1W6M A;  1RUI 3;  5FZD A;  1F31 A;  2R32 A;  2CSG A;  1Q8S A;  1IGO A;  3OD4 A;  3WW3 A;  4GMP 3;  3ZPY A;  2Q0A A;  2ZAC A;  2OT7 A;  2YDE A;  5DDJ 2;  2PHX A;  2ZGP A;  3ALQ A;  3BIW E;  1Z7S 1;  5I8S A;  2BEO A;  1LRH A;  3VDD C;  4AWD A;  1ASJ 1;  1RVF 2;  1JH5 A;  2ORZ A;  1EAH 3;  4Y24 A;  2UYA A;  2CAV A;  3S7I A;  1KJR A;  1BKZ A;  2CDP A;  4YFZ A;  5F7U A;  2VPV A;  1EUT A;  1S0C A;  3N7L A;  4AVV A;  1WGP A;  5L7O A;  1KFU L;  1RUJ 1;  4YZ1 A;  2JD4 A;  4XJZ A;  4WVM B;  3WHT A;  4NE9 A;  3IKW A;  2Y6G A;  4AFC A;  3RZL A;  1DZR A;  3JBG 3;  3LZZ A;  4E2Q A;  5FY9 A;  1QGL A;  2ZZJ A;  2VL4 A;  1RVF 3;  1DDL A;  3VL9 A;  4CCL A;  1KRI A;  4WM7 C;  2GMP A;  1BVP 1;  1AR8 1;  4CP2 A;  5CG8 A;  4MV2 A;  4AVB A;  4RS5 B;  2FZ2 A;  1UW8 A;  1W6O B;  3WY6 A;  5A6Y A;  4RR3 B;  1LEC A;  5J36 A;  1H4H A;  2PLV 3;  2BPA 2;  1ASJ 3;  2C6S A;  1XYN A;  4DIQ A;  3JB4 C;  3AK0 A;  2VVF A;  3AKS A;  3OPT A;  1GV9 A;  3NVC A;  1H6X A;  1UL9 A;  4LBN A;  5FBZ A;  3V64 A;  3N35 A;  2AAC A;  4YFW A;  2D6M A;  1GSL A;  3VBU B;  2Z42 A;  4BXF A;  2YPD A;  5A3M A;  3IDB B;  2A6Y A;  3SEP A;  5DDJ 1;  1XNB A;  5HCH A;  2D3S A;  1FPN 1;  3QLQ A;  2IXL A;  1C28 A;  2QQI A;  3PJQ A;  5BNO B;  4YM2 A;  1O3R A;  3H42 B;  4CA9 A;  3RI9 A;  4XZP A;  2FDF A;  1ULO A;  1AYM 1;  3IMN A;  3VBH C;  4AGV A;  1K45 A;  2ZAA A;  5EPA A;  4CVU A;  5GZC A;  3OYW A;  4BIS A;  3C3V A;  2JG9 C;  2Q1M A;  3RDI A;  3RZG A;  1G9A A;  1QMJ A;  1V6L A;  2NQY A;  4QHO A;  2ADE A;  2XQX A;  4BQ2 A;  2PHD A;  4OFG A;  5JPM B;  3HQR A;  4B1L A;  1OD5 A;  4YVS A;  3JD7 2;  3T09 A;  4YGC A;  4Q27 A;  2R0H A;  2B4K A;  3OGG A;  4WZF A;  2J42 A;  1Q43 A;  4JC1 A;  5KC6 A;  4IUG A;  4YGE A;  5C8C A;  1AR6 3;  1H4G A;  2WFF 2;  3PVN A;  3CJI B;  5FLJ A;  4NIH A;  3VD9 A;  3O12 A;  4MSV A;  5FJK A;  3ASI A;  1FYU A;  4MET A;  4Z8B A;  3III A;  4WBB A;  1YFX A;  4DS0 A;  1SPP A;  4I2O A;  4IEU A;  5F39 A;  4CUB A;  1DQ0 A;  3NST A;  3Q8E A;  3RQ0 A;  3K77 A;  5GLV A;  5JZG A;  1POQ A;  4HSL A;  1V0A A;  2VNR A;  2WFF 1;  3NV4 A;  5E16 A;  4BK5 A;  1MZ6 A;  3HN1 A;  1R08 3;  4GZ9 A;  4CU6 A;  1OUS A;  1W8H A;  4WVV A;  3OPW A;  2C9A A;  1SLI A;  3BCW A;  1A8M A;  3B9C A;  3NJZ A;  1NT0 A;  1QXJ A;  1MZ5 A;  4YVW A;  1ZBA 1;  3WNM A;  2Y26 A;  4LEJ A;  2BNO A;  4Q4X 2;  3RYR A;  1LTE A;  2L9L A;  2WA4 A;  3AYD A;  3AFG A;  1OA2 A;  1T6G C;  4XF9 A;  4CDW A;  4GB3 1;  1SAC A;  3UJO A;  1DHK B;  3I2H A;  4P08 A;  1S0F A;  3AKR A;  5CU1 A;  5ERL A;  2D3P A;  3LIG A;  1JOP A;  3OB8 A;  5J3U A;  1EV1 2;  4PQ9 A;  4Y5Z 0;  1HRI 1;  5FZ3 A;  4A6S A;  1W8U A;  2BUK A;  3OPZ A;  3VBO B;  2VU9 A;  1CX4 A;  1DBN A;  1JW6 A;  4FPF A;  4L2N A;  3ES1 A;  2PHU A;  5K0U C;  1QWR A;  3SCG A;  5T5L A;  3ZX7 A;  5D1I A;  3EBR A;  1BQP A;  4A45 A;  2CTV A;  2ADD A;  1T6B X;  1UQX A;  2P17 A;  4HT1 T;  2ZEX A;  2VBP A;  1WCK A;  3HVD A;  5LRR A;  3MV1 1;  3SNM A;  1LHW A;  1ND3 C;  2JDA A;  1JYW A;  4BQY A;  1SEF A;  1RUN A;  1OXC A;  2W9X A;  3H1Y A;  4P9Y A;  4AGR A;  4AQS A;  2UY8 A;  4ZU7 A;  4DRV A;  4QKN A;  4RYD A;  1ZYB A;  3KGL A;  3OUH A;  2I45 A;  2Z69 A;  1Q3E A;  5CKN A;  3JBG 2;  1FOD 2;  1PZ9 A;  3E6C C;  1X9T A;  3J8F 2;  4LKE A;  5JDB A;  4XHX A;  4PCR A;  4XXP A;  3C7F A;  4Q4Y 1;  1JZ4 A;  1OPO A;  4LJH A;  4UFL A;  2CYF A;  1LUL A;  3U37 A;  3GNE A;  1PZ7 A;  4EYU A;  1OFS A;  3RS6 A;  1XNT A;  1Y9Q A;  5FPV A;  3GCX A;  4Z1V A;  4XUP A;  4L9B A;  4XTP A;  1NCR A;  4FOY A;  4JZR A;  5IK7 A;  1JMU B;  1HJF A;  1JN2 P;  1R1A 2;  4CDU C;  3ZN5 A;  2GC0 A;  2X53 S;  4LK7 A;  1W03 A;  2VUL A;  4NVP A;  1NUK A;  4Q4V 3;  4GMP 0;  3AL6 A;  4B4R A;  4V2V A;  4DO0 A;  1UYY A;  1B35 A;  1C5H A;  1U5X A;  2VMC A;  4LQR A;  3POS A;  3POF A;  4R9B A;  3BB6 A;  1A3K A;  3ZN6 B;  3KV5 A;  3WF3 A;  4CCJ A;  1UO9 A;  2Q8O A;  3AP6 A;  5I0R A;  1V6K A;  4IE7 A;  1V9U 3;  5GAL A;  1SDD B;  2IZW A;  1QJX 3;  3LAG A;  1HRV 3;  4LLF A;  4LBL A;  1W8W A;  2IXC A;  3POB A;  3IAQ A;  1C1F A;  4E8D A;  3B93 A;  2VC9 A;  3UKT A;  1GOH A;  1JUI A;  4MGI E;  1W6Q B;  4COV A;  4ZU5 A;  2ZBJ A;  1VBB 1;  1TE1 B;  4TLF A;  1AX0 A;  1W06 A;  4QM8 A;  1VRH 2;  3WD5 A;  3ZVX A;  2VXJ A;  2QNK A;  5H9R A;  3KVB A;  2ARC A;  2B8M A;  4KWL A;  1UYZ A;  4WV8 A;  1FV3 A;  5FLI A;  3WF2 A;  3WX5 A;  5CEH A;  3ZXE A;  4BZ4 A;  4QDQ A;  3P5B A;  4FO9 A;  5J7M A;  1IZ3 A;  3GZT B;  3WDT A;  5EP9 A;  2JG9 A;  1N1T A;  1SHW B;  5EFU A;  4DXZ A;  1RVF 1;  4N9I A;  2ZGU A;  5E89 A;  1NQD A;  1D2Q A;  3CDZ B;  2FZ1 A;  2RJ2 A;  1V9U 1;  4IEV A;  4XQD A;  5FYV A;  3WQ0 A;  4ITC A;  1PMH X;  2DBN A;  4FCA A;  1D0G A;  1AJK A;  1XU2 A;  2O8O A;  2WA3 A;  1QOT A;  5BUV A;  2B9V A;  1REE A;  4QX3 A;  1POV 3;  1WLD A;  3T3Y A;  2IC1 A;  5B4X A;  3WDX A;  5EQU A;  2JEN A;  4Y1Y A;  3ABZ A;  2WRA A;  3IZO A;  4NN0 A;  3BTX A;  3BPS A;  4C8D A;  3W20 A;  5ANN A;  3CF6 E;  3U1X A;  4N43 C;  4MGY E;  2EA7 A;  4GQ7 A;  5GLT A;  4BLJ A;  2XKO A;  4TWT A;  4XIL A;  5JZG C;  5E88 A;  1VBA 1;  2VTF A;  2XLF A;  4JX0 A;  1GUI A;  3CQO A;  4MYE A;  4B3N A;  1IKP A;  5JXH A;  2AR6 A;  3ZFE B;  4LLO A;  4FQZ A;  4FAG A;  1NE6 A;  5JSO A;  4CCN A;  5GLU A;  2P5B A;  1BEV 2;  1RUD 2;  3WLU A;  2NN8 A;  3WDU A;  5FY8 A;  2PAK A;  4Y22 A;  1KDK A;  2ARA A;  2XG3 A;  3D4K A;  5J37 A;  1QNW A;  1HB4 A;  1SFP A;  2IVI B;  5JLV A;  1K42 A;  4XDO A;  1KD7 A;  5LCW L;  2QZ2 A;  4IEO A;  4NRQ A;  1BHG A;  1D4M 2;  3PVO A;  4XJA A;  3N9Q A;  4CUA A;  1AR9 2;  4A6O A;  2WS9 1;  2E7Q A;  4EZH A;  2VME A;  5I0D A;  1PVC 3;  1UMI A;  1LED A;  1VBA 3;  4Q1R A;  4ZON A;  5FYM A;  5F5I A;  1PO1 2;  1H6Y A;  3H3U A;  3AKT A;  1LEN A;  3H7Y A;  1QJY 2;  2UUR A;  1X7N A;  4MLO A;  4KWK A;  1AJO A;  3VHP A;  3C8X A;  5EIY B;  1APN A;  1LB2 A;  5C3P A;  4PLO A;  3VBH A;  1YQ5 A;  1ONA A;  2RV9 A;  3LSD A;  4AI9 A;  1UF2 C;  2OZ6 A;  1NKG A;  5FP9 A;  4XXA A;  4YZ3 A;  5FZB A;  3PTR B;  4L0P A;  3L9J T;  3IB3 A;  2GU9 A;  5L7O B;  1IS6 A;  4S2F A;  1Z7S 3;  1CES A;  4JKL A;  1TME 1;  4M01 A;  1PX3 A;  1H8T C;  4DUV A;  3AC0 A;  3E6B A;  3TAY A;  4CDQ B;  3CMG A;  1K5M C;  1YCI A;  3A22 A;  3TN9 1;  3BTY A;  2VVD A;  2XWJ B;  4RGA A;  5A7O A;  2IXJ A;  1OLR A;  2PFW A;  4XJU A;  2Z79 A;  3GF6 A;  3R6S A;  2JIC A;  3GHN A;  3PIJ A;  2FQP A;  1GZW A;  4CEY B;  3K4Z A;  1JS9 A;  4Y1X A;  1CZS A;  4KL1 A;  3BN6 A;  2QTW B;  1OOP B;  5FY7 A;  4YVW C;  4IEZ A;  3VDC A;  4CXY A;  5LBB A;  4JV4 A;  4GWN A;  3IT8 A;  4HG6 B;  3RRD A;  2QUO A;  4BQ3 A;  1JZ7 A;  3K4A A;  1LHO A;  1W0P A;  3CLP A;  1ZZ6 A;  2Z2S B;  2VO5 A;  5FZ9 A;  1TME 2;  2DYC A;  5FYS A;  3ZDS A;  3QCW A;  1DGW X;  2SBA A;  2TNF A;  3UYJ A;  4XUR A;  3HD8 B;  3PUA A;  4JGY B;  4RA0 A;  2VH9 A;  4BE3 A;  4D6R A;  3G6J B;  4GWI A;  1ENR A;  2ZS6 B;  1NA1 B;  3U10 A;  4PT6 A;  2E7T A;  3ON7 A;  4JHT A;  3PUQ A;  3AFK A;  2GNT A;  1H30 A;  3NJV A;  1W6P B;  1GQH A;  4KBB A;  4XAC A;  1DG6 A;  2OYZ A;  1BBT 2;  3NW4 A;  2VXR A;  3LPG A;  1N1Y A;  1S0D A;  1XYO A;  2RR1 1;  3TN9 2;  4QDS A;  1Z78 A;  4CDX A;  5I0S A;  4RS5 C;  2VZP A;  1W9Y A;  3AJZ A;  5ABJ B;  4OI4 A;  2W1U A;  3VLB B;  3N9L A;  3RZK A;  3VDD B;  2P3Y A;  2A5Z A;  1U5Z A;  2XXZ A;  2JIJ A;  3ECQ A;  4FPY A;  4LHS A;  3MW3 A;  4XF4 A;  1KXG A;  4YNI A;  2A75 A;  4Y5T A;  1Q8V A;  4A2U A;  3UL2 A;  5JOX A;  4EN0 A;  1I1E A;  4Y4Y A;  5IVJ A;  4BQ5 A;  2P3I A;  2OQ7 A;  5ACA 2;  4DUX A;  5I93 A;  2JG8 B;  1BEV 1;  1RUD 1;  1GZ9 A;  5AFE A;  2V72 A;  3CU7 A;  1UNB A;  5D2A A;  1PO2 2;  4QPI B;  4Y5S A;  1MQT A;  1XND A;  2R06 1;  1COV 3;  1BYH A;  1ZM1 A;  3N4M A;  2D5H A;  1W2U A;  4CSW A;  4UF0 A;  4YVW B;  4NPR A;  2BV4 A;  3VHR A;  1W6M B;  3FN9 A;  2WZR 1;  2XH6 A;  3J7M A;  1SLA A;  4KGG A;  1AR9 1;  4LHL A;  4Q4X 3;  5CIR A;  5FMC A;  3RI8 A;  1JYV A;  1S2K A;  1HRI 2;  1KGY A;  2R07 1;  3KWV A;  4LO7 A;  2BW8 A;  4AE2 A;  3VBS C;  3GM8 A;  3VGI A;  4XBL A;  5F3G A;  5FPX A;  1Q8P A;  4Q8L A;  1HKD A;  1CR7 A;  2H0V A;  2Y6J A;  1R09 1;  2BOI A;  2CL2 A;  4XFH A;  2VD7 A;  1UPI A;  4XIO A;  3USU B;  4WM8 B;  1TZO A;  2EXK A;  1JYI A;  3T1L A;  2DCY A;  2HWD 3;  3NWK A;  1R08 2;  2X09 A;  2YC2 A;  1SBE A;  4YZ4 A;  5FV3 A;  5GZE A;  4ET7 A;  1IS3 A;  3SH4 A;  1E57 A;  4FPL A;  4RHV 2;  3WDY A;  3DEC A;  3QAC A;  1NXM A;  3BOW A;  1LU2 A;  2ZEW A;  5FWJ A;  3C7O A;  3ZKU A;  1V00 A;  3LOB A;  2CWM A;  4HN0 A;  4ARY A;  4I09 A;  1PVX A;  1MPX A;  3KM5 A;  1L3J A;  4FQ4 A;  2ILM A;  2WZE A;  1WCQ A;  4R8H A;  2K9Z A;  1CAV B;  3ZYP A;  4M0N A;  1WW4 A;  4KWU A;  1HDK A;  3ZIX A;  5EJ3 A;  3T0B A;  4FXG B;  4RS5 A;  4YW6 A;  1OHF A;  4Q4V 1;  4V1P A;  2W3J A;  3GZE A;  2QDR A;  5FRA A;  3KT1 A;  5LB6 A;  1GP4 A;  5FY1 A;  5FRE A;  2JDN A;  1UKR A;  1NA1 A;  4HN1 A;  4Q0V A;  5CVR A;  1XNC A;  2HWD 1;  1JOD A;  4LNV A;  3BKZ A;  1I6X A;  1JU4 A;  2IXK A;  4AI8 A;  2GN7 A;  3A0N A;  2WQ4 A;  1VAM A;  2X10 A;  2XJV A;  3AMM A;  5FPZ A;  1RJ7 A;  3OUI A;  3POW A;  4TTG A;  5JCT A;  3SIS A;  3WUC A;  5I8Y A;  1O8S A;  1WD3 A;  5IVY A;  1SLT A;  1I5Z A;  5FY5 A;  3B01 A;  4ASK A;  2D6K A;  1CON A;  1VBC 3;  5I8T A;  3ITQ A;  3N9M A;  2RMU 2;  3MI8 A;  4D7Y A;  1VBD 1;  4AEJ A;  4FOW A;  4HL0 A;  1Y9M A;  1LGC A;  4P9X A;  3WVJ A;  2XBO 2;  5EHD A;  2DBI A;  1B35 C;  1H8T B;  4FPJ A;  4D69 A;  3HNB M;  5FPL A;  2HKX A;  2A6Z A;  2WKK A;  1MAC A;  3KZ4 C;  2VW1 A;  4K20 A;  2RS3 2;  4OI1 A;  1Q8O A;  1PGW 1;  3SEE A;  1ENQ A;  1JZ3 A;  4I02 A;  4E4H A;  1C8M 2;  4Q4Y 2;  2HWF 1;  5F8P A;  3AYE A;  3GBW A;  3PUS A;  2HWC 3;  4CU7 A;  4CTE A;  1PMI A;  4FPG A;  4ASL A;  3DUI A;  1RUC 2;  4P9L A;  2RMU 3;  2PAE A;  4LE4 A;  3ZYR A;  1IS5 A;  4DXT A;  1AR8 3;  2EXH A;  4K6B A;  1RB8 G;  1Q5O A;  1L7L A;  2LS6 A;  2A3X A;  2VOV A;  5ANQ A;  1TMF 3;  1VBD 2;  2VMI A;  4XBN A;  3LFM A;  1TME 3;  3IWZ A;  1HRV 1;  1DQ2 A;  1RUJ 2;  4XEZ A;  2DFB A;  3I59 B;  3OEB A;  4JVA A;  4UFH A;  3A23 A;  5AC9 2;  4X6Q B;  2UY9 A;  4MAD A;  5FZI A;  5FZC A;  1DGW A;  3L2Y A;  1YUD A;  5T5P A;  3KHB A;  1YO8 A;  3PIG A;  1BXH A;  4XQW A;  1W9T A;  3LGR A;  4WM8 A;  5A33 A;  3ZM8 A;  3HT2 A;  4OHW A;  4UFI A;  3FFZ A;  1JHN A;  2J1T A;  2JDH A;  5HI0 A;  3JBG 1;  3ZO0 B;  4IND A;  1PIV 2;  4R9C A;  4ERO A;  5FXZ A;  3UKN A;  3WP6 A;  3DPR A;  1UY0 A;  4IV3 C;  3ZFF B;  3NJX A;  3A7Q A;  1LOF C;  5CAD A;  1BK0 A;  5K0U A;  4LOS A;  1IPJ A;  1HN1 A;  4N53 A;  4PIX A;  2VQT A;  2WNU B;  2K0G A;  1CD3 G;  4D3W A;  2CGN A;  3DKW A;  5A6X A;  2BGO A;  2C5D A;  4WVW A;  1IOA A;  4B8E A;  5KHH A;  1PO1 3;  1ZZB A;  2VTX J;  2J22 A;  4I0A A;  1VP6 A;  2FDI A;  4LR4 A;  4GJZ A;  2DF7 A;  2Y6L A;  2D3R A;  4RHV 1;  4PBP A;  5LAT A;  2AC1 A;  3PDQ A;  1CX1 A;  3AJY A;  2PTM A;  1LOG A;  2YV8 A;  4LMF A;  1QXR A;  4MGK E;  4YW7 A;  3BTZ A;  3SLI A;  1GWM A;  1AXK A;  4HVR A;  3LEK A;  4XF0 A;  1EV1 3;  1QKQ A;  1RUF 3;  4JRA A;  4ES9 A;  5FJH A;  3E97 A;  1D4M 3;  5A7W B;  3U4S A;  4YSF A;  2CGO A;  3USS A;  1NLQ A;  3VZJ A;  1BLZ A;  1GNH A;  4AVT A;  3WF1 A;  5FZF A;  4BPZ A;  5C33 A;  2ZMN A;  3W21 A;  1YIP A;  1MS5 A;  2B42 B;  4HVO A;  5FZO A;  4ASM B;  4A7Z A;  5FBJ A;  3MIE A;  2MNG A;  3M1H A;  4ZKT B;  1BEV 3;  1RUD 3;  2N7G A;  1AZD A;  1RHI 3;  1OD3 A;  4DEV A;  2JEC A;  4AL9 A;  3KGZ A;  1HRI 3;  1XSQ A;  2E51 A;  5BNP A;  1KFX L;  3C7E A;  2XJT A;  1W2N A;  1VBE 2;  1HQL A;  2HYX A;  3JB8 A;  4FPO B;  3ZPO A;  4E4S A;  1GP6 A;  1SCS A;  1FAY A;  2OUH A;  3MW4 A;  4DUW A;  4FAH A;  3KB5 A;  4COY A;  1RUH 2;  5IWF A;  3VZM A;  4DIN B;  1J58 A;  5LY1 A;  1DIW A;  1GFF 2;  3AZW A;  1LOD A;  5SV5 A;  3J8F 1;  4NAM A;  2ET7 A;  5FWE A;  1OSG A;  2VMG A;  1NZC A;  4SLI A;  1R08 1;  1XJA A;  1IPS A;  2RS5 2;  4CDQ A;  1H2M A;  1VRH 3;  1VR3 A;  4XZU G;  4DY5 A;  1W05 A;  4BCU A;  1UZY A;  2XJQ A;  1ZBA 3;  5CFC A;  2IFR A;  3I59 A;  4XVH A;  2VM9 A;  1AL0 G;  4GMP 1;  3WCS A;  3BUC A;  3N9N A;  1BBT 1;  2VMF A;  4BB3 A;  2PMW B;  3KSC A;  1LCL A;  2RS3 1;  3I3Q A;  3NV1 A;  1NXD 1;  3DV8 A;  3R4D B;  4CEW B;  1ZBE 3;  4AFM A;  5LEJ A;  3ATG A;  4N7U A;  1ZZ7 A;  5DN2 A;  5JR2 A;  4NIG A;  1OF4 A;  4HKW A;  1CIW A;  4R52 A;  4YVS B;  4Y33 A;  1HQN A;  4AOC A;  4BM8 A;  2DFC A;  1QDO A;  2HWE 1;  3FMG A;  1ZRR A;  1MS4 A;  4BJ0 A;  5LW9 A;  1QJF A;  4YG3 A;  1W8F A;  4MVT A;  2HYK A;  2RR1 3;  4P9J A;  5CA6 A;  3N3H A;  5C4W B;  4AVS A;  2TEP A;  1HXS 2;  4O9E A;  3WW2 A;  2EVX A;  1F35 A;  5ACA 1;  2WNU C;  2A3W A;  2WNU A;  3VBS A;  2DVD A;  4FOV A;  3M3Q A;  4JRL A;  4P5H A;  4PI2 A;  2PLV 2;  3I2O A;  1GQG A;  2QQV A;  2VZR A;  2ERF A;  3R4U A;  5HBA A;  1BMV 1;  3H1M A;  2ARX A;  4BDV B;  3RSJ A;  4M3C F;  1R1A 1;  3SMH A;  5JMC A;  3H8X A;  1PK6 B;  3WXP A;  3D3A A;  3J7N A;  1L7R A;  4LK6 A;  1H2N A;  4JAA A;  2WQ8 A;  3GZA A;  1M06 G;  3ZXF A;  1ODM A;  5C71 A;  2LAL A;  1LEM A;  2Y34 A;  3RNS A;  2BWC A;  3I2K A;  5ABJ A;  3IBM A;  4P14 A;  4QM9 A;  4BMB A;  2VNV A;  2WII B;  4GD4 A;  4I3P A;  5DDJ 3;  3RWN A;  5FZA A;  2B46 X;  3ETQ A;  5DQ0 A;  3S7E A;  1NG0 A;  2C24 A;  1JYC A;  3T4V A;  2VMH A;  2ZJC A;  1AR9 3;  2PN5 A;  4P9I A;  4Y22 B;  1Q8Q A;  2CDO A;  1SZB A;  1REF A;  4X8P A;  2WQZ C;  2WO2 A;  1GP5 A;  3CO2 A;  4IV1 B;  3HT1 A;  4XDQ A;  1W9F A;  4AG4 A;  4OHX A;  1OH3 A;  3TNP B;  3KCC A;  5F2S A;  5HCA A;  2CV6 A;  4UF0 B;  3ZYB A;  4OYU A;  1UX6 A;  1W8T A;  4D6Q A;  1GAN A;  5FZM A;  1F2N A;  2XUM A;  4JCK A;  4OQ8 A;  1J3Q A;  4AQ6 A;  5DG1 A;  4QX2 A;  4QB6 A;  1SLL A;  5D21 A;  4COZ A;  1Y4W A;  1VLN A;  2GME A;  4IXL A;  4Q26 A;  3W59 A;  3WOG A;  5IVV A;  3Q8B A;  1COV 1;  1RUE 3;  4XET A;  1DGL A;  2DUQ A;  1RTV A;  2GSY A;  3FC0 A;  1GKB A;  2B39 A;  3V0A B;  4LTA A;  3IDE A;  3WR0 A;  1CAU A;  5C5U A;  1JZ6 A;  2R04 1;  1FMD 2;  1LGB A;  3GAL A;  4H7L A;  5BNN C;  5CFC B;  1LHV A;  5KXC A;  4DY3 A;  2IXI A;  1LU1 A;  3OBZ A;  1CGP A;  4BME A;  4XUO A;  2VAU A;  1GNZ A;  4JDO A;  5CFD B;  4M4R A;  5LA2 A;  1L7Q A;  2WYS A;  4QHZ A;  4Y1Z A;  4C0H A;  2W87 A;  3FZ3 A;  2J1R A;  4CCO A;  4EN6 B;  2HEW F;  3MGU A;  1QY4 A;  2JG8 C;  2OQ6 A;  3TEZ A;  4IEY A;  5I0U A;  2OKX A;  2ET1 A;  4Q5O A;  1KDM A;  1XE0 A;  3MLJ A;  3U0Z A;  2NPI A;  4GH4 C;  2BVV A;  4HK9 A;  3B02 A;  4AFD A;  4HAN A;  4XIK A;  5T52 A;  1CQ9 A;  4NMI A;  4NOT A;  1AYN 2;  4AVC A;  1RUE 1;  4LIU A;  2ZGK A;  2BYV E;  4Q0Q A;  4QGN A;  5IVF A;  5LRS A;  2RVA A;  5C4W C;  1NLR A;  2WZP P;  1YI9 A;  3OOX A;  4XAE A;  5AFB A;  3B69 A;  3MV0 1;  4LO4 B;  1HLC A;  3POG A;  1W8Z A;  1S0J A;  4GXL A;  2YZ4 A;  4QQH A;  3HAG A;  3JU9 A;  1DYO A;  2XLA A;  3D0S A;  4FPE A;  5F5C A;  3GBG A;  2V73 A;  5A32 B;  4YAR A;  5J09 A;  3LF7 A;  5GZD A;  5DZG A;  3SCF A;  3I2I A;  4OVE A;  1PK6 C;  4HLT A;  1PK6 A;  1N3Q A;  4BA6 A;  3LSE A;  4F8A A;  4YGD A;  1IHM A;  3MYX A;  4BQ4 A;  2LTN A;  2HWC 1;  4M0H A;  1AR6 2;  4ATE A;  1U0A A;  1IS4 A;  1AL2 2;  3RZJ A;  4R9A A;  2XPJ A;  1SBD A;  1H1A A;  2R04 2;  1DQ1 A;  3DXU A;  4UW6 A;  2FDG A;  3HR9 A;  2QQW A;  2W47 A;  4CCC A;  5JAX A;  2VOW A;  1UY2 A;  2AEN A;  4S2H A;  2YBS A;  1GU3 A;  3POY A;  4MUV A;  5IW0 A;  5C5T A;  1VJ2 A;  2G9G A;  3FBY A;  2EF6 A;  3H50 A;  3IDC B;  1FI2 A;  4I01 A;  4MX3 A;  1TG7 A;  2ZGN A;  3WG3 A;  4AR2 A;  1N1V A;  2EAK A;  3LDR A;  1JYX A;  2WFP A;  2XON A;  3IIA A;  5FLH A;  4QQL A;  3NNL A;  3D82 A;  5DG2 A;  4YW3 A;  1IG0 A;  1AR8 2;  2Q1F A;  5IJR A;  2XUE A;  1PNG A;  3AXE A;  4CP0 A;  2DTW A;  2HWB 1;  1W99 A;  3JZV A;  2WO3 A;  3K48 A;  3Q8F A;  4JDM A;  3J7H A;  4RD7 A;  4GA9 A;  1V9U 2;  1QQP 1;  5A7P A;  1PMJ X;  4XMI A;  1VPH A;  2AUY A;  2J1U A;  3WF4 A;  4QXC A;  1JBC A;  4XW3 A;  1YIF A;  4PHZ A;  4AI0 A;  2DVG A;  1G9D A;  4I3G A;  3WNO A;  2A7A A;  5A7Q A;  5BV6 A;  1QH7 A;  2DUO A;  4FT8 A;  1TMF 1;  1CAX B;  2XVL A;  1O4Z A;  2HWB 2;  3KLS A;  1RYY A;  2WUH A;  5KXE A;  1PGL 2;  2XQR A;  1VRB A;  4IE4 A;  1K5M A;  3VDB A;  2VQ0 A;  4AQ2 A;  3VKM A;  3OSD A;  2ATF A;  1ZBE 1;  2JKB A;  4DOU A;  4O65 A;  2W1W A;  3OD0 A;  2XJR A;  1I5P A;  4GWJ A;  2P34 A;  2R04 3;  2GN3 A;  4PDW C;  3MUZ 1;  2VNO A;  1S4C A;  2OPK A;  2QKD A;  4FXK B;  4URA A;  1GYK A;  1NA1 C;  1O3Q A;  3VBO C;  3ACI A;  1IQA A;  1VBE 3;  4UWD A;  1UY1 A;  2WSU A;  1RIN A;  2BFU L;  2VUA A;  2J1S A;  2R1D A;  1NAE A;  4D6S A;  2YGL A;  4Y4R A;  1RUH 1;  1CPM A;  4L92 A;  1W8O A;  4QX5 A;  5LAS A;  3V65 A;  4XE9 A;  3P3P A;  3RJR A;  2J7M A;  1FMD 1;  3AMH A;  4W8J A;  2BNM A;  3VZO A;  1R1Z A;  2JIG A;  3WEZ A;  2DV9 A;  3J4U H;  3JQX A;  2Q1Z B;  5ABJ C;  4FSJ A;  1QU0 A;  5FYB A;  2ZGO A;  3CL1 A;  1RHI 1;  1W2T A;  4XFI A;  4AXO A;  4QD2 A;  1RUF 2;  3VD3 A;  4LOT A;  4IV1 C;  4QAW A;  4CDW B;  3VD7 A;  5CIS A;  3ZIW A;  2HH9 A;  2IXH A;  4J6G A;  3MW2 A;  4MHR A;  5G04 L;  5C70 A;  3UKV A;  4FVV A;  3NV2 A;  2A70 A;  2ZGT A;  2QBX A;  4UFK A;  3T2O A;  3IMM A;  5LA1 A;  5FYU A;  4AF9 A;  4QHB A;  2P37 A;  1GWL A;  5HXV A;  3JUU A;  1D4M 1;  1RUF 1;  3G7D A;  4YW1 A;  5A1F A;  5IVC A;  1O4T A;  3ZYI B;  5DMY A;  1C5I A;  1LAJ A;  1FMD 3;  1ULE A;  3FLP A;  2WT0 A;  3V0B A;  2D6O X;  3FBM A;  4LO5 B;  3I3B A;  4GIQ A;  2D6P A;  5SV8 A;  2R06 2;  4G4F A;  4WVM A;  3MDP A;  2ZGM A;  5DUU A;  3TWI A;  3U78 A;  4YWA A;  2ETE A;  3LEM A;  1G9C A;  3M8L A;  1NCQ A;  1AX1 A;  1UWW A;  4QU2 A;  4W6W A;  2CWS A;  4YM1 A;  1H8T A;  3UJQ A;  1W39 A;  3KQR A;  1ND2 B;  4Q0P A;  3O1R A;  2WS9 3;  2BP6 A;  5HXM A;  2EAL A;  4NII A;  5FP7 A;  2DUR A;  4NRM A;  4OHY A;  4XFA A;  5IK4 A;  3H3L A;  4EQV A;  2VVE A;  3RYP A;  4HKL A;  1OPM A;  1WUV A;  3M3E A;  4Z82 A;  5L19 A;  2C26 A;  4XC9 A;  3ZLI A;  4QGL A;  3W5N A;  1C1L A;  1WW7 A;  4R4X A;  1S2E A;  3B00 A;  3GGL A;  4CYD A;  1F15 A;  1G86 A;  4CP9 A;  2JWP A;  1W3V A;  4NRP A;  5D8A B;  3D6E A;  4NJ4 A;  4GB3 2;  1J59 A;  3N9P A;  1QOS A;  2E63 A;  4IE6 A;  1W28 A;  2NZ9 A;  1PHM A;  2YFZ A;  5IUQ A;  1W04 A;  5CB7 A;  5GLW A;  2R07 2;  4RSU A;  5EXO A;  5C3R A;  3AMP A;  3VHO A;  3MUY 1;  2WNV B;  4JTO A;  1OT5 A;  5JI9 A;  1VMF A;  1B35 B;  2Y33 A;  5BY5 A;  1KS4 A;  3ZYH A;  1NYW A;  4OCT A;  5C4W A;  4CXW A;  2F4P A;  1W0O A;  2GNM A;  1OMI A;  2WNO A;  3ME2 A;  3HBZ A;  3RWK X;  3OY8 A;  2W08 A;  3NNM A;  2VCB A;  4OZO A;  1NCQ C;  1I3H A;  3PUH A;  1UOF A;  2VZO A;  3J9S A;  4LUK A;  5LK5 A;  4AW7 A;  2P3J A;  2F17 A;  5FZL A;  4LHK A;  4LO6 B;  4MGQ A;  1XB9 A;  3DPR B;  2B5H A;  3I2J A;  3Q9O A;  4HET A;  1OKQ A;  1AHS A;  2Y6F A;  4QB2 A;  2YUE A;  4W6Y A;  1OLM A;  2XLG A;  2XKP A;  5L73 A;  2JX9 A;  1XNK A;  2I07 B;  3JXS A;  2NM1 A;  4DXS A;  3CKH A;  5FYI A;  3HQX A;  3J7L A;  4HBN A;  2P1B A;  5F6K A;  1ULF A;  2RR1 2;  3WQ1 A;  4HFS A;  4IGP A;  3S0M A;  2IVJ A;  4LBO A;  4XAB A;  1K12 A;  4YW4 A;  1HXS 1;  2YBP A;  4L11 A;  1RUG 1;  1BK1 A;  4I0B A;  4QXK A;  4OUE A;  3LPF A;  1UY4 A;  1C57 A;  2DCZ A;  3GJB A;  3O0W A;  3THC A;  4EWE A;  2PQQ A;  4W4Z A;  1XYP A;  5FQ0 B;  1AR7 1;  1QJZ A;  5DAQ A;  5A3P A;  5C9A C;  5KWR A;  3S57 A;  1AL2 3;  4Y1V A;  1O3S A;  4C91 A;  2P4E A;  1Z7S 2;  5FAX A;  3CZU A;  4YVS C;  4OQ9 A;  2XJS A;  4CDU B;  5IHR A;  3OGR A;  1YFY A;  3I2D A;  3WQ7 A;  5DXD A;  2FDJ A;  2BZD A;  2EIC A;  2VR4 A;  3AZZ A;  3DPR C;  4FFI A;  5A1A A;  1WA4 A;  3VBO A;  1ND3 A;  5FZO B;  1F4A A;  3W5M A;  3VUO A;  3TEW A;  1UXZ A;  2ZX2 A;  2PYT A;  2FBE A;  1SFN A;  1PVC 2;  1H2K A;  2PEL A;  4N8M A;  1PGW 2;  3ES4 A;  2WS9 2;  3ACG A;  5IT6 A;  1DLL A;  4YLZ A;  3OBR A;  2LRP A;  3I54 A;  5J98 B;  3LDK A;  5KHI A;  5FYZ A;  3KV9 A;  4CCK A;  4Z2A A;  5I91 A;  2YYO A;  3C7G A;  4Y20 A;  2DWR A;  2WJS A;  5FIX A;  4TZD A;  4QDR A;  3PME A;  2E33 A;  4JGZ A;  4Y26 A;  1O6U A;  3POI A;  1XXN A;  3LEG A;  4CP9 B;  3OGJ A;  1JOJ A;  2WLQ A;  3VHN A;  1E5H A;  1E5I A;  4QPW A;  2JDK A;  5CNA A;  2WAA A;  3NNF A;  2D7F A;  3O14 A;  4XCB A;  4WM7 A;  2RJL A;  2K2S A;  1J1L A;  2X5I A;  2ZX1 A;  5HPO A;  5KXD A;  2MEV 2;  1F4H A;  3VL8 A;  3A0K A;  1VAK A;  4NHY A;  1RED A;  3MLK A;  2HWD 2;  4IGQ A;  4UI9 L;  2J1E A;  4KG8 A;  2YB7 A;  1COV 2;  4HXC A;  1VB4 A;  2XVK A;  4IE5 A;  2ZGR A;  1EV1 1;  5L7O C;  3I7D A;  3GBF A;  3WSO A;  1RL3 A;  5FO8 B;  3BOP A;  2RDN A;  5KHG A;  3N7J A;  4X6R B;  2W0X A;  5IAV A;  4XFF A;  2VZ3 A;  3HNY M;  3MF9 A;  1GOG A;  5CYY A;  1FNY A;  3AP5 A;  3HPN A;  3MIC A;  4F3J A;  2W95 A;  5C3O A;  1POV 1;  2YY1 A;  5EWS A;  1JXN A;  1J83 A;  3K51 A;  1H0B A;  4AYU A;  2DVB A;  4OLL A;  5HV4 A;  1OOP C;  4OMD A;  3I49 A;  3KCX A;  3NL1 A;  5EJZ B;  2OVU A;  1WW6 A;  1YEW A;  2OZJ A;  3AMQ A;  3M3C A;  3MID A;  1OFN A;  2LRO A;  4YM0 A;  3ETP A;  4W6X A;  4DRR A;  4HKO A;  2BVB A;  2YBK A;  3H0O A;  4A4A A;  2BBV A;  1D7P M;  3R05 A;  5JIA A;  1J3R A;  4LT5 A;  1QF3 A;  2V5D A;  1W8N A;  2OPW A;  4MXW B;  1PNF A;  3AZX A;  2RDS A;  2G1M A;  3ILF A;  4OI2 A;  4UOJ A;  5FKC A;  1MZE A;  2VGD A;  4QPG C;  1STM A;  1J3P A;  4WZC A;  3BGA A;  2ZOE B;  1QNY A;  3ILR A;  2ZEY A;  4UBG A;  5H9S A;  1X9P A;  3MZH A;  3MO4 A;  3WW1 A;  1O7F A;  3J26 N;  1FX5 A;  2W39 A;  1VBC 1;  2YU2 A;  3EHK A;  5GLZ A;  4Q29 A;  5HCB A;  3D8C A;  3PUR A;  1WLT A;  3ACF A;  4LOR A;  1EAH 1;  3C2U A;  5FP3 A;  2QDN A;  3ZFF A;  1J1T A;  1UZZ A;  2WIN B;  2VMD A;  1CIY A;  4O7X A;  4S2G A;  4N43 B;  3HNM A;  5KXB A;  2VNG A;  1ASJ 2;  1DCS A;  4URT A;  1OI6 A;  4YG6 A;  1Y3T A;  1VBC 2;  4R4Z A;  3VBU A;  2HWB 3;  1LOA A;  3VBU C;  5FYH A;  1AR7 2;  5FY4 A;  3J8F 3;  4NUB A;  2W1Q A;  5FZK A;  4NIA A;  3X29 B;  3TBD A;  4ORF A;  2B9U A;  1XQN A;  4FP2 A;  4KH9 A;  4QXB A;  2E32 A;  3KS7 A;  3K3N A;  1XBF A;  1CJD A;  2JE9 A;  2WR9 A;  2Z4F A;  2Q30 A;  3RYK A;  1JUH A;  4RR3 C;  4QX1 A;  2CU5 A;  2BJS A;  1TEI A;  1WD4 A;  5A33 B;  1AVB A;  3H9A A;  4JHZ A;  3RG0 A;  2EIE A;  1OLQ A;  3NMB A;  5A7W A;  1ODN A;  1V6I A;  2TUN A;  4OUM A;  5C8W A;  1W3X A;  2D40 A;  4P9W A;  4ZXK A;  1LOF A;  2GND A;  2NMO A;  4NO4 A;  4AK3 A;  2RG4 A;  2P6C A;  1WMX A;  1ULP A;  4N53 C;  3T0D A;  4QKD A;  2JXA A;  1BZW A;  1OC1 A;  4AFA A;  5CKQ A;  3KMH A;  4AVA A;  3ZXJ A;  4OZX A;  4LBQ B;  4UW3 A;  3ST7 A;  3WT3 A;  1WCD J;  3EXU A;  5AVA A;  3O1P A;  2HWE 2;  4IL7 A;  1XC6 A;  4XHB A;  2CY6 A;  2W46 A;  4QPI C;  2Q8E A;  4Q8K A;  3BIE A;  5JZG B;  4GAZ A;  2UWA A;  3U4X A;  5LZ6 A;  1OUR A;  1DYP A;  2OX0 A;  4HON A;  4LA3 A;  3O7O A;  4D7T A;  5T5J A;  1W6Q A;  1OF3 A;  2GZW A;  5DUV A;  2HJI A;  2DDU A;  2DVF A;  2UWC A;  3H7J A;  1RUI 2;  4AHX A;  2PHL A;  4BQ1 A;  1SBF A;  4A3Z A;  4XF3 A;  4NPL A;  4P5Y A;  3LEI A;  3GJA A;  5FY0 A;  3UGF A;  1UZV A;  4LE3 A;  4E9K A;  5LEK A;  1AL2 1;  5DZF A;  5FPU A;  4BOW A;  1G7Y A;  2QQU A;  1A34 A;  4H2A A;  3V0B B;  2WWJ A;  3E6D A;  3LQC A;  3W58 A;  3WIN E;  4IGO A;  4P9G A;  3E1F 1;  4OHZ A;  2A6W A;  3WW4 A;  5FO9 B;  4FPH A;  4JQT A;  1RMU 3;  3LWC A;  1NCQ B;  2ARE A;  2JDU A;  1U5I A;  4A44 A;  2JEM A;  3U14 A;  2FMY A;  2NLR A;  1HX6 A;  3M7A A;  3PLQ A;  3ENR A;  2Y6K A;  3WG1 A;  3RJ2 X;  1OA3 A;  1FT9 A;  2DCT A;  4JQR A;  2KD7 A;  1MEC 1;  3FL7 A;  1WKY A;  4BYY A;  4EN7 B;  4QGM A;  2VUC A;  2CNA A;  4XUT A;  3RFR A;  2VZV A;  1S1A A;  4RGK A;  1ZA7 A;  2GNB A;  3HWJ A;  1GBG A;  4M3C A;  3QOP A;  4NWW A;  3TRS B;  3KF5 A;  2XR4 A;  1P8J A;  3TN9 3;  3FX3 A;  1S2B A;  3FFQ A;  3JD7 1;  5CG9 A;  2G19 A;  3RZM A;  2R1B A;  1WME A;  3LE0 A;  4K1Y A;  2VZU A;  4F83 A;  3DYM A;  4U36 A;  4LUM A;  3SH5 A;  1NOV A;  1VB2 A;  2WZR 3;  1W90 A;  3PUI A;  3TNQ A;  3WNN A;  3AKP A;  3O5S A;  5T50 A;  2ZHL A;  5A7S A;  2BDR A;  3VD4 A;  2IFW A;  4M3C E;  4I0W B;  2DCJ A;  1RUG 2;  2XHN A;  3HQU A;  5DZE A;  2AH2 A;  4IEP A;  4OI0 A;  2IUW A;  3GZU C;  5FUN A;  4P00 B;  5ACA 3;  5C8C B;  4N90 A;  3NAP C;  1NCR B;  2I2S A;  5I0T A;  5BXX A;  1URX A;  1K5M B;  3ZXG A;  5F5Q A;  1U5Y A;  4IET A;  4XF1 A;  4FTE A;  3VZN A;  1GLH A;  1V6O A;  2QZ3 A;  5FP8 A;  3P6B A;  3WG2 A;  4AEM A;  4ATF A;  3OBT A;  4MO3 M;  1OVS A;  1NQJ A;  1MS0 A;  3EQE A;  4W50 A;  2AEZ A;  2FD8 A;  2WWU A;  3ZN6 A;  3WCR A;  4QQP A;  1MVE A;  1CPN A;  3ZR5 A;  1CJP A;  5A6Z A;  1JI6 A;  4MG2 A;  2D6N A;  4DQA A;  1C8M 1;  1WZX A;  2WYF A;  5F2W A;  3RMX A;  1MR5 A;  5F3I A;  1POV 0;  1TMF 2;  1VBD 3;  1EPZ A;  1PIV 1;  4OMC A;  2ID4 A;  3OCP A;  1WLW A;  1CZT A;  5HV0 A;  1AYM 3;  3T4H B;  5AC9 3;  1WMF A;  1V6M A;  1QIQ A;  2WNV C;  3T2Q A;  5FDB A;  1IPK A;  3NKG A;  3WNX A;  4KU7 A;  4Q4W 3;  3NRU A;  4XQ4 A;  4AAX A;  2ARB A;  1F8V A;  2QQK A;  5LA9 A;  5CZK A;  3I8T A;  4PF5 A;  3JCI A;  5JSR A;  4Y1U A;  2WT2 A;  1HXS 3;  5A3T A;  4AI2 A;  3K2O A;  5CFD C;  5JOY A;  1QJX 1;  3MF6 A;  3VBF A;  4YM3 A;  5DAX A;  2VTX A;  4Q4Y 3;  5K0U B;  4BIO A;  3AL5 A;  3WNP A;  1W6N A;  3PTY A;  4I30 A;  1WBL A;  1ULC A;  1WLC A;  2JDM A;  3MBW A;  5A3U A;  5BNO C;  1YNA A;  5FMD A;  5FZ8 A;  4LIT A;  3UK9 A;  1BMV 2;  5H9P A;  2V4V A;  1UIK A;  3ORJ A;  2VJX A;  3HOB A;  4YPJ A;  1ZBA 2;  2DU1 A;  1UKG A;  4LUL A;  4C1X A;  4NHL A;  4MXV A;  4CDQ C;  3H8O A;  3OBA A;  1UOJ A;  4DFS A;  3I2F A;  1SDW A;  3AYC A;  2VUD A;  2XBO 1;  2XOM A;  1UZW A;  1QQP 3;  2NYY A;  2RS1 1;  1ND2 A;  4AHY A;  2RM2 3;  4FOQ A;  4TXW A;  3QH7 A;  1V6J A;  1DGR A;  1RUH 3;  2RMU 1;  3FHI B;  1CAV A;  4QPY A;  2YMZ A;  4KQ7 A;  1O8P A;  2VOK A;  1ZRF A;  1VBA 2;  4GB3 3;  4ISQ A;  2X29 A;  5LWB A;  3MIG A;  2XL9 A;  4XUQ A;  1CWP A;  1RMU 2;  2ZPX A;  3VDA A;  4LXL A;  2BNN A;  2Y6H A;  3AVS A;  3T2P A;  1DZQ A;  3DN7 A;  1OVP A;  1PO1 1;  1VE0 A;  2Y60 A;  1NLS A;  1H2L A;  2YGM A;  2Q4S A;  4ZS2 A;  1SLB A;  4QT6 A;  5CFD A;  1QHD A;  3OYW B;  1JYN A;  2VEC A;  2D98 A;  1KQR A;  1ZNP A;  1W9S A;  4RHV 3;  4IES A;  3LDB A;  4K8R B;  1WCS A;  1DFQ A;  3AZY A;  4OUS A;  5A3O A;  4BWO A;  3MFC A;  5E1R A;  3ZOI A;  3VZK A;  4CUG A;  5FMB A;  2EXI A;  3D0J A;  3PU3 A;  2WNV A;  3ZSM A;  4DNY A;  2YHJ A;  2BER A;  1PO2 1;  3NJY A;  1ZVF A;  1NX9 A;  1C4R A;  2OII A;  3POE A;  4M00 A;  5FTT C;  4A42 A;  1UMZ A;  3MPB A;  4E4Z A;  4L8Q A;  1PM7 A;  2XHK A;  1BVV A;  2ZML A;  5F1R A;  1QJE A;  4LBQ D;  1NCR C;  1FPN 2;  4JDN A;  4IW3 A;  3VBH B;  2XML A;  4IE0 A;  5L9V A;  4CUC A;  3TEX A;  3ZFG B;  1OA4 A;  4H14 A;  1UU4 A;  3VKF C;  3SKJ E;  2Y8K A;  3EO6 A;  5K8S A;  3CBN A;  5ISL A;  3KVA A;  4ZZ5 A;  4RQP B;  2FCT A;  4GWM A;  1PIV 3;  1PVC 1;  4GKY A;  2R6Q A;  1NZI A;  4XJ9 A;  4AHW A;  4NR1 A;  4A41 A;  2D6L X;  2WAB A;  3NV3 A;  4Q2F A;  5JVV A;  4BQX A;  2VY0 A;  1XNA A;  2YC4 A;  2V4A A;  4B7E A;  5C3Q A;  4CEW C;  1XE7 A;  2A6X A;  1RMU 1;  2ZX4 A;  4C1W A;  1GZW B;  1ZA4 A;  2JDY A;  3ZSK A;  3ZFG C;  4CEY A;  4DB5 A;  5DAW A;  2MHF A;  2HEV F;  4XFB A;  5DAP A;  3UES A;  4CCD A;  2NP0 A;  1S0G A;  4GH4 B;  4NHM A;  5A3L A;  1NY7 1;  1W6N B;  4DEQ A;  4IDZ A;  3VBS B;  5E8A A;  3WUD A;  4HVQ A;  5IFP A;  3VBF C;  1Y9G A;  3DF0 A;  5FFO C;  1UY3 A;  1GWK A;  2FCV A;  3KQ4 B;  1HV1 A;  3OTF A;  4TN7 A;  1QH6 A;  1G9B A;  5FO7 B;  1MS3 A;  3VN4 A;  2XL7 A;  4XTM A;  1ND3 B;  4YZ2 A;  1E5R A;  1DQ6 A;  3R0R A;  4N7I A;  1EYB A;  3D5O A;  4JGY A;  4TYS A;  5GM0 A;  2VBB A;  4PIY A;  3WV6 A;  2BU9 A;  1DGR N;  2W2I A;  1S55 A;  2YU1 A;  1VMJ A;  2NMN A;  5EYY A;  3ZXA C;  5A70 A;  1RUJ 3;  2C9K A;  3ZMN A;  2V5Y A;  1WCU A;  4IQP A;  3ZSL A;  4X8N A;  3DKQ A;  1G6N A;  3PHM A;  1W6P A;  1A6C A;  4O9G A;  4XOG A;  5HCF A;  3WP4 A;  5JWP A;  5FXV A;  1ZZC A;  4AHZ A;  4K21 A;  1DQ5 A;  3SCH A;  1RUI 1;  3FWE A;  4FFF A;  2A6V A;  4HMZ A;  1VMH A;  1AYM 2;  1LHU A;  4AQT A;  2WLP A;  3RMY A;  3AP4 A;  3I4I A;  1OQE A;  2UWB A;  4K3U A;  1FNZ A;  4PQQ A;  2RS3 3;  4NHK A;  4UBH A;  1HV0 A;  3CIH A;  3OGS A;  3EMR A;  3GHM A;  4CPB A;  4DMI A;  5BPX A;  1JYT A;  1AR7 3;  1LNS A;  1YQ8 A;  2P6H A;  3AM2 A;  4E2S A;  5KHJ A;  5CFC C;  2VZT A;  3I3E A;  4AGG A;  3CEW A;  4BIF A;  3AKQ A;  3OJB A;  4LBK A;  1O91 A;  3UET A;  5IVB A;  1K5J A;  4QPI A;  1GOF A;  3PNA A;  5FPA A;  4CXX A;  5F9T A;  2O1Q A;  1FOD 1;  2CAU A;  2Y38 A;  3ZYF A;  4E27 A;  1FOD 3;  1JTZ X;  1LGN A;  3THT A;  4IEQ A;  5EZW A;  3KV4 A;  1RHI 2;  5LK7 B;  3B5L B;  3FUO A;  1YQC A;  2KM2 A;  1CAU B;  3SHR A;  3K3O A;  4L99 A;  4L97 A;  3INA A;  3WDV A;  1CVN A;  3KT4 A;  1MS8 A;  3MFA A;  4Q4W 1;  3ZKY A;  5CAZ A;  1CN1 A;  2PA7 A;  4OHV A;  4EN9 B;  4K40 A;  1YQ6 A;  5IVE A;  1DYK A;  1Y7B A;  5C7G A;  2E9Q A;  4QXH A;  4K1Z A;  2D93 A;  4GJY A;  4WVZ A;  1GNY A;  5KHK A;  2E6V A;  4CCM A;  1O3T A;  3GYD A;  3DYP A;  4KG0 A;  2OUJ A;  1GMM A;  1GZT A;  1O5U A;  1X50 A;  3JQW A;  4PJY A;  1FPN 3;  2PAM A;  3T1M A;  5FP4 A;  1QJU 3;  1YWK A;  3U75 A;  1Y43 B;  4MXW A;  1AYN 3;  1PX4 A;  1ENS A;  2GC2 A;  2GH8 A;  4UT5 A;  2J1A A;  2RJK A;  3N9O A;  3BYW A;  4LBJ A;  3ZXD A;  2VCA A;  2ZEZ A;  4LPL A;  1XU1 A;  3THD A;  2WC2 A;  4EWA A;  1ZRD A;  5BYN A;  4J1X A;  5A3W A;  5A6Q A;  2AYH A;  2K46 A;  3O0V A;  4E8C A;  1ULD A;  1TVG A;  2VE1 A;  5JR7 B;  3M2M A;  5BNQ A;  4MOA A;  1ST8 A;  1US3 A;  1A8D A;  4QQO A;  2ZGS A;  2VBD A;  5JUV A;  1HJG A;  2ZXQ A;  1IKQ A;  1W2O A;  2WN3 A;  3M3O A;  5B2G B;  1D4V B;  1MQT C;  1SQ4 A;  2HEY F;  2BOJ A;  5AVP A;  5KBF A;  2EIG A;  2LUW A;  2RS1 2;  2DUP A;  2F6B A;  5DUW A;  1C3H A;  5LBF A;  4CU9 A;  1QQP 2;  4J25 A;  2QFE A;  3T0A A;  2DVA A;  3UV9 A;  3H8R A;  1HB2 A;  2SLI A;  4KBZ A;  1JHJ A;  2GP5 A;  1R09 2;  4IV3 A;  3TYJ A;  3B7M A;  5JI7 A;  2VZQ A;  3H3Z A;  3LCP A;  2XJP A;  1MS1 A;  3POJ A;  1S0E A;  2VCM A;  5FZ4 A;  2WNE A;  3VZL A;  3LB9 A;  5F3C A;  1QEX A;  2BBA A;  2G4I A;  2QE3 A;  2ZAB A;  1J84 A;  2PHR A;  4HPK A;  1QJX 2;  1ACC A;  4UAP A;  2GDF A;  5T55 A;  4DPN A;  4K9S A;  2R49 A;  5EYX A;  2BTV C;  4NRO A;  3O1V A;  3KHC A;  4XJW A;  4OUL A;  4D7S A;  5DAB A;  2ES3 A;  2GAU A;  2QQO A;  5IK5 A;  5FUP A;  4M4P A;  4GAL A;  2RHP A;  5KR7 A;  5KC5 A;  1D2S A;  2HWC 2;  1DQ4 A;  1RIR A;  2PQS A;  3N36 A;  2C0Z A;  3CJX A;  3S6P A;  4TLG A;  4P02 B;  3RZZ A;  4XJ8 A;  4ARX A;  3UNP A;  4F7Z A;  1BJQ A;  2ZX3 A;  4PLM A;  1H8V A;  2FMD A;  5FYY A;  4FP3 A;  1U12 A;  2KXL A;  2CHH A;  4H3W A;  5G05 L;  4AEK A;  1YC6 1;  5FCC A;  2PXJ A;  1QDC A;  2BFU S;  2ZMK A;  2R30 A;  5AC9 1;  1V70 A;  4LKD A;  1IQD C;  4KNC A;  5F32 A;  1UU6 A;  3CHX A;  3NQH A;  5FQ0 A;  2F4L A;  2E7A A;  3QBQ A;  2AZ5 A;  3NAP B;  4COW A;  2JKX A;  2RM2 1;  2TBV A;  5IAT A;  3IPV A;  1UIJ A;  1UMH A;  2VUJ A;  3VKN A;  2QQP A;  3FHQ A;  3PMS A;  4ES8 A;  3AVR A;  1E5S A;  4C90 A;  1R64 A;  4JGZ C;  4XYX A;  2VOT A;  1ZX5 A;  3GDB A;  4XFG A;  2O0O A;  3MIB A;  5K9Y A;  2Y64 A;  4QPG A;  4MGZ E;  4A3X A;  4LIV A;  3S30 A;  2GP3 A;  4NPM A;  4H55 A;  1HN0 A;  5FKB A;  3L2H A;  2R07 3;  4KGQ A;  4Y20 B;  4XDP A;  3LFI A;  5A3N A;  4AI3 A;  1X33 A;  5FOJ B;  4CU8 A;  4GKX A;  5A80 A;  1LOB A;  3ROU A;  2JE8 A;  1T2X A;  4N9H A;  4QX8 A;  1HB3 A;  2H6C A;  1TQ5 A;  2HBU A;  2W1S A;  3WDW A;  4AZZ A;  3U07 A;  2WZR 2;  4QKB A;  4UFM A;  2RS1 3;  3R4S A;  2VW0 A;  1X36 A;  5FR3 A;  4YW5 A;  4COU A;  4MH0 E;  2ZHK A;  3HJR A;  4XCA A;  3RVH A;  3SC7 X;  3O1S A;  3UT0 A;  1GQP A;  3PVB B;  5FZG A;  3OG2 A;  4ZXE A;  5JOZ A;  2JE7 A;  4HK8 A;  3ACH A;  1G9F A;  1WBF A;  1H1I A;  2VW2 A;  4FFH A;  2XJU A;  2BRT A;  1DLC A;  2B45 X;  3M4F A;  1DU3 D;  1LES A;  4RR3 A;  3FUQ A;  1MEC 2;  1OKO A;  3EJK A;  1UD1 A;  1HQW A;  1PGS A;  1UCX A;  4HPK B;  2WDB A;  3W9A A;  1XSR A;  5BNP B;  3URF A;  1KS5 A;  2HLE A;  5A1L A;  1MS9 A;  3O1T A;  5T3N A;  1VBE 1;  3F95 A;  2P2K A;  2ZHM A;  1ZRE A;  3OGV A;  4E2G A;  2ZX0 A;  2QJV A;  4ISR A;  2A1X A;  3HN3 A;  2EXJ A;  1N3O A;  2B7Y A;  3E5U A;  3ILN A;  4YGB A;  5FPB A;  5CBL A;  4SBV A;  3O1O A;  1AXZ A;  1MQT B;  2W5F A;  4N43 A;  4BXS V;  4NAO A;  5D8A A;  2Q8C A;  4AED C;  5FK8 A;  2G9F A;  1IG3 A;  2VQU A;  3LA3 A;  4CRQ A;  1QJU 2;  1O59 A;  4CPB D;  2JG9 B;  5FZ1 A;  2W68 A;  2MPF A;  1EUU A;  2X8K A; 
#chains in the Genus database with same CATH homology
 3LEI A;  1XNT A;  2X05 A;  4XUP A;  3IAP A;  3LQC A;  5DQ0 A;  3E1F 1;  2QQN A;  4MGS A;  3P1I A;  1NUK A;  2CDO A;  2WO2 A;  4AG4 A;  4A44 A;  1UYY A;  3I97 A;  2VMC A;  4LQR A;  4D0Q A;  2Y6K A;  2W91 A;  3WF3 A;  4OYU A;  1SG3 A;  2KD7 A;  3FL7 A;  1WKY A;  3DYO A;  4XUT A;  1SDD B;  2VZV A;  4QX2 A;  4QB6 A;  4JKK A;  1DP0 A;  1P8J A;  3IAQ A;  4E8D A;  1JZ2 A;  1JZ5 A;  2VC9 A;  1GOH A;  4ZZ8 A;  1CZV A;  3LE0 A;  2E31 A;  2VZU A;  3DYM A;  4KMQ A;  1JZ6 A;  3PUI A;  3WF2 A;  3WNN A;  1UYZ A;  3VD4 A;  4QDQ A;  2DCJ A;  2XHN A;  2LW8 A;  5JXI A;  4P00 B;  2WAO A;  4XUO A;  4M4R A;  1SHW B;  5LA2 A;  1L7Q A;  2WYS A;  2W87 A;  3I2G A;  2J1R A;  1YQ2 A;  3CDZ B;  2RJ2 A;  3P6B A;  3F2Z A;  2OKX A;  4FI9 A;  4MO3 M;  1PMH X;  3GXU A;  4W50 A;  2B9V A;  4QX3 A;  1JI6 A;  5B4X A;  2RVA A;  3ABZ A;  3MV0 1;  4PF1 A;  1DYO A;  4OMC A;  2ID4 A;  3WQB A;  2VTF A;  1CZT A;  4JX0 A;  1GUI A;  3C7H A;  3CQO A;  3I2I A;  5IFT A;  5JXH A;  3T2Q A;  3NRU A;  2YG0 A;  4AAX A;  3I3D A;  5FUI A;  2QQK A;  5CZK A;  2W47 A;  4D8M A;  5JMO A;  1K42 A;  1UY2 A;  5LCW L;  1GU3 A;  3WNK A;  1BHG A;  4CUA A;  3OEA A;  4A6O A;  3WNP A;  3MBW A;  1TG7 A;  2VME A;  5I0D A;  1UMI A;  1JYX A;  4KI5 M;  2XON A;  1H6Y A;  2V4V A;  5IJR A;  3HOB A;  2VJX A;  4YPJ A;  2E26 A;  1UYX A;  5EIY B;  3C8X A;  1W99 A;  2QQJ A;  3OBA A;  2WO3 A;  3I2F A;  2RV9 A;  3J7H A;  5JXG A;  1PMJ X;  2XOM A;  1XPW A;  2J1U A;  3WF4 A;  3VD5 A;  1NKG A;  4TXW A;  1O8P A;  4L0P A;  3WNO A;  3IDA A;  3IB3 A;  4XUQ A;  4JKL A;  3VDA A;  1RYY A;  2WUH A;  2Y6H A;  1PX3 A;  4DUV A;  3AC0 A;  5EJ1 B;  3T2P A;  3CMG A;  3VDB A;  5JXJ A;  3A22 A;  2ORX A;  1JU3 A;  1JYN A;  2W1W A;  2DCK A;  3FHA A;  1I5P A;  4GWJ A;  1OH4 A;  1W9S A;  3MUZ 1;  3K4Z A;  2R7E B;  1CZS A;  3BN6 A;  4DXR A;  3VDC A;  5DPN A;  3ACI A;  3A21 A;  2C4X A;  1UY1 A;  4BK4 A;  4HG6 B;  1JZ7 A;  2J1S A;  1NAE A;  2BER A;  3K4A A;  2VO5 A;  2VZ1 A;  1W8O A;  1NX9 A;  4A42 A;  2J7M A;  4W8J A;  4XUR A;  3WEZ A;  4JKM A;  4CUC A;  2EID A;  4GWI A;  3K75 B;  4PT6 A;  2Y8K A;  3SKJ E;  4ZZ5 A;  2W92 A;  2VCC A;  4QX0 A;  3VD3 A;  4QAW A;  3NJV A;  3VD7 A;  4QB1 A;  5G04 L;  2WZ8 A;  5C70 A;  3LPG A;  4A41 A;  5B4N A;  2WAB A;  2QBX A;  3T2O A;  5LA1 A;  4QDS A;  2VZP A;  1XNA A;  2YC4 A;  4RN5 A;  2W1U A;  1KEX A;  4ZY9 A;  5DMY A;  3ECQ A;  4LHS A;  3UES A;  3WNL A;  2BGP A;  1UX7 A;  3I3B A;  4DEQ A;  3K4D A;  4DUX A;  5IFP A;  1UWW A;  1UY3 A;  3CZJ A;  3HEI A;  5J1X A;  2V72 A;  1UXX X;  5HXM A;  3NNG A;  1JZ8 A;  2WO1 A;  2C26 A;  3FN9 A;  1JYV A;  3W5N A;  2C9K A;  1KGY A;  3GGL A;  3GM8 A;  3WF0 A;  5LA0 A;  2Y6J A;  2YFZ A;  4XUN A;  2W94 A;  3SKV A;  2X09 A;  2YC2 A;  3MUY 1;  1OT5 A;  4ET7 A;  4PQQ A;  2QQL A;  3DEC A;  5IYY A;  2ZEW A;  3C7O A;  3CIH A;  3OGS A;  2VCB A;  2JD9 A;  3EYP A;  3K46 A;  3PUH A;  4OZO A;  2VZO A;  4ARY A;  1LNS A;  1MPX A;  2QQM A;  2WZE A;  2VZT A;  1WCQ A;  3I3E A;  4MGQ A;  3I2J A;  3UET A;  1GOF A;  3EB7 A;  4KWU A;  4QB2 A;  3T0B A;  2WN2 A;  3JXS A;  4DXS A;  3CKH A;  2W3J A;  1W0N A;  1UZ0 A;  1JU4 A;  2YFU A;  2X10 A;  4LKS A;  4TTG A;  2EIB A;  1O8S A;  1K12 A;  2VZS A;  4OUE A;  3LPF A;  5C7G A;  1UY4 A;  3THC A;  4W4Z A;  1GNY A;  3DYP A;  1GMM A;  2WBK A;  3CZU A;  1US2 A;  5IHR A;  3OGR A;  1PX4 A;  1W9W A;  3HNB M;  3SEE A;  2BZD A;  2EIC A;  1JZ3 A;  1K3I A;  2VR4 A;  2J1A A;  5A1A A;  3T08 A;  1F4A A;  2VCA A;  2J1V A;  2ZEZ A;  4LPL A;  3THD A;  3W5M A;  1UXZ A;  4CU7 A;  4E8C A;  1TVG A;  4MOA A;  3ACG A;  1US3 A;  4DXT A;  5JUV A;  2ZXQ A;  4Z2A A;  2WN3 A;  3C7G A;  2LS6 A;  4QDR A;  2E33 A;  4CU9 A;  2ORZ A;  3OEB A;  3T0A A;  3A23 A;  3LEG A;  2CDP A;  4QPW A;  4MAD A;  5F7U A;  2WAA A;  1EUT A;  1JHJ A;  5HPO A;  1F4H A;  2VZQ A;  1W9T A;  3ZM8 A;  2Y6G A;  4UI9 L;  2J1T A;  2J1E A;  2YB7 A;  2VL4 A;  2BBA A;  1J84 A;  1UY0 A;  3NJX A;  3A7Q A;  4UAP A;  3WSO A;  1HN1 A;  2VQT A;  2VZ3 A;  2QQO A;  3HNY M;  4M4P A;  1GOG A;  2BGO A;  5CYY A;  3HPN A;  2W95 A;  2PQS A;  1H6X A;  2J22 A;  1J83 A;  3UNP A;  4P02 B;  4ARX A;  2Y6L A;  4OMD A;  5EJZ B;  3SEP A;  1CX1 A;  5G05 L;  2QQI A;  3ETP A;  1ULO A;  1K45 A;  4CVU A;  3LEK A;  1IQD C;  4A4A A;  1D7P M;  3NQH A;  2XQX A;  2V5D A;  1W8N A;  4UOJ A;  3T09 A;  3WF1 A;  2JKX A;  3BGA A;  2B4K A;  1UMH A;  2ZEY A;  3FHQ A;  4IUG A;  3MO4 A;  1R64 A;  1OD3 A;  4DEV A;  3VD9 A;  2VOT A;  3GDB A;  2Y64 A;  3ACF A;  3C7E A;  3III A;  2HYX A;  2VMD A;  4DUW A;  1CIY A;  4CUB A;  3HNM A;  3K77 A;  4BK5 A;  4CU8 A;  2JE8 A;  4GZ9 A;  1T2X A;  2W1Q A;  4CU6 A;  2W1S A;  4XZU G;  2E32 A;  3WNM A;  4XVH A;  2VM9 A;  2Z4F A;  2L9L A;  3U37 A;  4QX1 A;  3HJR A;  3I2H A;  4P08 A;  2VMF A;  1GQP A;  4ZXE A;  3OG2 A;  3OB8 A;  4JHZ A;  2EIE A;  3ACH A;  5DN2 A;  5JR2 A;  1DLC A;  1OF4 A;  4A45 A;  1ULP A;  3T0D A;  4BJ0 A;  2WDB A;  2ZEX A;  2HLE A;  3MV1 1;  2JDA A;  1JYW A;  1XC6 A;  3OGV A;  2VZR A;  2W46 A;  3HN3 A;  4BDV B;  2W9X A;  2W5F A;  4BXS V;  4RYD A;  1OF3 A;  3D3A A;  1L7R A;  2DDU A;  2WQ8 A;  2VQU A;  5C71 A;  1O59 A;  4A3Z A;  3I2K A;  3C7F A;  1JZ4 A;  1EUU A;  4P5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...