1UY1A

Binding sub-site dissection of a family 6 carbohydrate-binding module by x-ray crystallography and isothermal titration calorimetry
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
132
structure length
132
Chain Sequence
SPIRRDAFSIIEAEEYNSTNSSTLQVIGTPNNGRGIGYIENGNTVTYSNIDFGSGATGFSATVATEVNTSIQIRSDSPTGTLLGTLYVSSTGSWNTYNTVSTNISKITGVHDIVLVFSGPVNVDNFIFSRSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding Sub-Site Dissection of a Carbohydrate-Binding Module Reveals the Contribution of Entropy to Oligosaccharide Recognition at "Non-Primary" Binding Subsites.
pubmed doi rcsb
source organism Clostridium stercorarium
molecule tags Carbohydrate-binding module
molecule keywords ENDO-1,4-BETA-XYLANASE A
total genus 32
structure length 132
sequence length 132
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2004-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1uy1A00
3VD9A 2J1RA 5EJZB 4ARXA 1GOHA 1JYNA 1CIYA 3K4AA 4JKMA 1UMIA 3OGVA 3LE0A 3I2FA 3I3BA 5B4NA 4ZZ8A 3J7HA 3SKJE 3C7OA 2W1QA 3MUY1 2C4XA 3VDBA 3WF1A 3DECA 4M4PA 3WNMA 4QB2A 2V5DA 1JHJA 3T0AA 4CU6A 3MBWA 2E26A 2WUHA 4OZOA 1I5PA 2E31A 2WQ8A 2VCAA 3NJVA 2W1UA 2YB7A 4GZ9A 4ET7A 5LCWL 3FHQA 1YQ2A 1W99A 3MV11 1CZTA 3MO4A 4ZY9A 4ZZ5A 2QQIA 2VOTA 2W3JA 3OEBA 1UY1A 2X10A 3CIHA 4Z2AA 1UXZA 1J83A 4DEQA 3VDAA 4A42A 3HOBA 3ECQA 2VR4A 2XHNA 4XUQA 4HG6B 4DXTA 2WYSA 4D8MA 4CU8A 2QQMA 1L7QA 3LEIA 3WEZA 1W9TA 2VZOA 4CUCA 5IHRA 2BERA 1XPWA 3T0DA 3C7GA 3IAPA 4L0PA 4BDVB 2YFZA 4CVUA 2EIBA 3SEEA 1ULOA 1GMMA 1BHGA 4M4RA 1OT5A 2B9VA 4P08A 3T2PA 3A23A 4QDQA 1TG7A 4W50A 4GWIA 1JYWA 2ORXA 4JHZA 1HN1A 4E8DA 3T09A 2ZXQA 5C70A 1CX1A 4A6OA 3OGSA 3ACGA 4JKKA 2Y64A 1UYXA 4UI9L 3AC0A 3GXUA 1L7RA 3NRUA 4QB6A 2L9LA 1W9WA 5EJ1B 3K46A 1P8JA 3WNNA 2Y6KA 2VL4A 3UNPA 1UXXX 4XUNA 1DP0A 4UOJA 2E33A 5G05L 1GNYA 3WF2A 1PX4A 3I2KA 4KMQA 3GGLA 3FHAA 4MGSA 2W9XA 4P00B 5EIYB 5HXMA 4MO3M 2J1UA 4W8JA 2Z4FA 1NX9A 2QQKA 1UMHA 2XONA 3OBAA 1F4HA 4OMCA 2WABA 2VMCA 1O8PA 3FL7A 2VCBA 1DLCA 2E32A 2BGOA 2W1SA 3DYOA 2XOMA 4XUOA 3WQBA 2YC2A 3W5NA 1NAEA 3T08A 1UY4A 2BBAA 1DYOA 2V72A 1JU4A 5IFPA 5JXGA 1K3IA 1W8NA 4DUVA 2VZPA 3F2ZA 3I3DA 3ACIA 3HN3A 1GU3A 2QBXA 3C7FA 3IIIA 2R7EB 1T2XA 5J1XA 2OKXA 2VM9A 3CDZB 3I97A 4MGQA 1PMJX 3ACFA 1K45A 3ZM8A 4AAXA 1MPXA 1H6YA 2VMEA 2J1EA 2LS6A 1OF4A 3K4DA 4UAPA 4A4AA 2Y6HA 3WF0A 3WNPA 4LQRA 5G04L 4LKSA 3C7EA 1NUKA 3U37A 4PQQA 4RYDA 4RN5A 4OMDA 4E8CA 1XNAA 4A41A 2C9KA 1UZ0A 2DCJA 3THCA 2VZVA 1EUUA 2WO1A 5JR2A 1UYYA 2VZ1A 2Y6JA 5IFTA 3BN6A 4QX3A 1R64A 3HNYM 3LQCA 2W46A 2ZEWA 1UX7A 2J7MA 3VD7A 2C26A 2W47A 2RVAA 3OGRA 2QQJA 4XUTA 4QDSA 4XVHA 2BZDA 3CKHA 3K77A 5IJRA 2RJ2A 2ZEXA 3HEIA 4DUXA 4DXRA 2QQNA 3PUIA 2JD9A 1UYZA 1J84A 3A7QA 1KEXA 2VZ3A 3LEGA 3T2QA 2VTFA 2JKXA 3I2IA 2WBKA 4PT6A 1UY3A 2YC4A 3OEAA 2ZEYA 3HJRA 1UWWA 2CDOA 3PUHA 4PF1A 5C71A 5DQ0A 4IUGA 2VZTA 2VMDA 3W5MA 2PQSA 5DMYA 2J1AA 5I0DA 2X05A 1JZ6A 3P1IA 3OG2A 1UY0A 2X09A 1K12A 2B4KA 5JMOA 1JU3A 5B4XA 2VCCA 2ID4A 5HPOA 5DPNA 3OB8A 5A1AA 1SDDB 3LPGA 3UETA 2VZUA 1XC6A 1H6XA 3CZUA 2JE8A 2VZSA 2J1SA 1OF3A 1OH4A 4MADA 4YPJA 3I2HA 4XURA 1W0NA 5JUVA 1EUTA 3NJXA 1IQDC 1WKYA 1LNSA 2LW8A 3IB3A 4QX2A 4TTGA 2VC9A 5FUIA 3HNMA 1PX3A 3E1F1 4QAWA 3T2OA 3MUZ1 2W5FA 3CMGA 2VQTA 4QDRA 3WNOA 5JXJA 1JZ2A 3MV01 2WZEA 2EIDA 1CZSA 3HNBM 4QX1A 4BK5A 3UESA 3P6BA 1XNTA 5DN2A 4QPWA 2WO3A 1O59A 3SEPA 3FN9A 4OYUA 5C7GA 2V4VA 2W95A 4ZXEA 3LPFA 1UY2A 3C8XA 2EIEA 4CU7A 3I3EA 4DUWA 5IYYA 1JZ8A 1WCQA 2VZRA 1OD3A 3WF3A 1D7PM 3GM8A 2KD7A 4JKLA 5LA1A 4QB1A 3ACHA 2Y6GA 2YFUA 2W91A 3NQHA 3JXSA 4CU9A 2YG0A 4W4ZA 4OUEA 4XZUG 4CUAA 4KWUA 2RV9A 2VZQA 3CQOA 2WAAA 4MOAA 2VJXA 2WZ8A 4FI9A 3EB7A 2QQLA 3IDAA 2W87A 3I2GA 2WDBA 4A3ZA 2QQOA 3HPNA 4A44A 2HLEA 2WO2A 4AG4A 2ORZA 2WAOA 5F7UA 3D3AA 2VO5A 4P02B 2DCKA 1GQPA 4TXWA 2ZEZA 1SHWB 4P5YA 3VD3A 3WNKA 3IAQA 4BJ0A 3DYMA 3C7HA 3SKVA 3WSOA 1US2A 1F4AA 1JZ7A 5CZKA 3T0BA 3K75B 5JXIA 1US3A 3VD4A 3WF4A 2W1WA 4A45A 1JZ5A 3DYPA 4XUPA 4LHSA 3ABZA 3ETPA 3WNLA 2Y6LA 1GUIA 2BGPA 2WN2A 2W92A 1JI6A 2DDUA 2J22A 3GDBA 4ARYA 1JYVA 1W8OA 3CZJA 5CYYA 3A22A 5JXHA 4LPLA 1RYYA 3NNGA 3EYPA 1W9SA 4KI5M 4DEVA 1GOGA 4JX0A 1CZVA 2VQUA 1NKGA 3LEKA 1K42A 1ULPA 2HYXA 2Y8KA 5LA2A 1JYXA 4CUBA 4BXSV 3BGAA 4QX0A 2EICA 5LA0A 2W94A 4D0QA 2VMFA 1O8SA 2CDPA 1TVGA 2XQXA 1GOFA 3A21A 3I2JA 3VD5A 2J1VA 1SG3A 2J1TA 2JDAA 4GWJA 1PMHX 3VDCA 4DXSA 3K4ZA 1JZ3A 1KGYA 4BK4A 1JZ4A 2WN3A 3THDA
chains in the Genus database with same CATH superfamily
3VD9A 3D5OA 2J1RA 1J1LA 1V6IA 4Q4Y1 1EAH3 1JYNA 5A6YA 1VBB3 1CIYA 3GZEA 1PZ7A 2QTWB 3OGVA 2RS51 3LE0A 3OGGA 3I2FA 3I3BA 4RS5B 3AZYA 4AVCA 1WLDA 4QPIA 3J7HA 1OQEA 5FY4A 2WNVB 1PIV1 3MW3A 4COVA 3MUY1 3VHPA 1RUD3 5FJHA 4GB33 4JQTA 1RL3A 2QNKA 4YZ2A 3S57A 1H2NA 1AXZA 1LODA 1SQ4A 3RSJA 3DECA 1RUI2 1VBE2 4Q4W2 3WNMA 1UOFA 1VJ2A 1TQ5A 2EF6A 2GN3A 4NPRA 4LA3A 2PHLA 4RQPC 4Y5SA 3IPVA 3MBWA 3T0AA 5BNOB 1I6XA 3GHNA 5EJ3A 1H9WA 4LITA 2WUHA 3WDYA 2PQQA 2OZ6A 2AENA 4YGCA 4C0BA 2P4EA 1H1IA 1I5PA 3U11A 2PHRA 2H6BA 2WSVA 5FZHA 4AL9A 1L3JA 3U78A 2ZX1A 5BNNB 5CFCB 1MS8A 1U5IA 3AMHA 5BYNA 1YQ2A 3O1UA 4RQPB 4ZY9A 1GICA 4IERA 3LB9A 1H8VA 2UU8A 4R9CA 2VOTA 4BQ1A 4CEYA 4K3UA 3K51A 2KM2A 4AR2A 1NA1B 4Q4W1 5JSOA 5H9RA 1RB8G 2EAKA 5FOJB 1J83A 1DQ1A 2Z79A 4A42A 2EXKA 5GZGA 3FZ3A 4QXKA 3NNMA 5BXXA 1TNFA 4BISA 4DXTA 1S0EA 2PAMA 2WYSA 2IUWA 4CU8A 3VHRA 4COYA 4QU2A 2A70A 5JIAA 2CL2A 1NCQC 4ZS2A 4AVVA 3WOGA 4GKYA 5FUPA 3IDBB 2BERA 1D0GA 1XPWA 3I4IA 3ZMNA 5E16A 4B7EA 1OA2A 1NT0A 1NCRC 1KDKA 4L0PA 4XJAA 5CFDA 2YFZA 2ZMLA 2EIBA 2O1QA 4AEDB 3H8XA 1DZQA 5AVPA 4LLFA 2XBO2 1G9BA 3UYJA 3B5LB 1DCSA 1TEIA 1RUD1 1MQTA 5FY7A 1O4TA 5FZCA 2B9VA 2K0GA 1KS4A 3LWCA 4BQWA 3A23A 2JDZA 5CAZA 1XNBA 4XQWA 2X29A 4LMFA 1DGWA 2BOJA 3JD71 5C6CA 1VE0A 1AXYA 4E8DA 3E5QA 3T09A 1O3QA 3OPTA 4A6OA 4I09A 5ABJB 4Y1XA 3OGSA 1G8WA 5A6XA 3UGHA 4IEUA 2VH9A 4GJZA 5FZIA 4MXWA 2BJSA 4NHMA 3WDVA 2VVFA 2DVDA 1FATA 3AC0A 3GXUA 1NZIA 1SFPA 2WA4A 3GZTB 3NRUA 4QB6A 1QJU1 5M0TA 4Y1UA 1H1AA 3K46A 4N53C 1OUXA 3TN91 4F3JA 1P8JA 2RS13 3FBYA 4CEYC 1OH3A 2VL4A 3B9IA 1B35A 4BE3A 3TEWA 1DZTA 1R1ZA 4NE9A 1JYXA 1CVNA 5FY8A 1DP0A 3THPA 2YHJA 1Y43B 1KDMA 1OKOA 1ZBE3 2UYBA 4BH9A 2CGNA 1NQJA 1RMU2 1RUF1 2CTVA 2X5IA 3I2KA 3POEA 4XFIA 4KWJA 5FZ9A 4CXWA 2JECA 2W9XA 4JGZA 1JXNA 1MS1A 4Q0VA 3SQOA 4YYOA 4QPGC 2QDNA 3ZXDA 2YU1A 1GWLA 4HPKA 4CP9A 1NX9A 2O0OA 4NUBA 3UGFA 1YIFA 3HQUA 4WM7A 4ASLA 2YC0A 4GB31 1RTVA 4PDWA 1GP4A 2VW1A 1XNKA 1UZWA 3NJYA 4DY5A 3OBAA 4D6RA 1B35C 1HRI3 2B39A 3O5SA 4OMCA 1IZ3A 4BQ4A 2CWSA 1O8PA 2VQ0A 1UZZA 2QDRA 4YW1A 1R1A2 2VCBA 4INDA 1DLCA 2BVBA 2R1BA 3ZYPA 5A7WB 3V0BB 3VZKA 1DIWA 3AM2A 4Q4V2 1OMIA 2Y38A 4META 1UU6A 4N9IA 1Q8QA 4OHWA 5IVYA 2XOMA 4HL0A 4ZHNA 3N7JA 3VDDB 1APNA 4QPGA 1GZCA 2Q1ZB 4V2WA 5FK7A 3ZVXA 3KV5A 4BYYA 4ISQA 2BWAA 4OI0A 2VBBA 1UL9A 2RS33 4N7UA 4FVVA 2Q1FA 2RM23 5IVVA 5IFPA 2WZPP 1NXD1 2VW0A 2GMPA 3VKOA 5JXGA 1ZRDA 1S2KA 3RI9A 4F83A 1JHNA 2VZPA 3I3DA 2RJKA 3MGUA 1TME3 3TEXA 4CDXA 2QBXA 4TYSA 4OFGA 2VW2A 4PIXA 1OQ1A 3O1TA 1WLCA 3WDWA 1C57A 4UF0A 4AXOA 2ADDA 4ZS3A 2OKXA 4DNYA 3WX5A 4OQ8A 5J36A 4CEWB 2VD7A 3ACFA 4CCCA 2HWF2 5JOWA 5A3OA 1JUHA 2D6MA 2Q5TA 1MPXA 4X8NA 1RUF3 4BMEA 2LS6A 1WW4A 2BNOA 1OPOA 2HBTA 3KSCA 4M3CA 3IKWA 4MGKE 4O9GA 1RHI1 4AHWA 3VUOA 3M1HA 1PO13 1POV1 3ELNA 5FV3A 5G04L 2D6PA 5KC6A 2GDFA 4ZONA 4N7IA 3WCRA 5A3NA 4PQQA 4RN5A 1X8MA 1MS9A 3SCGA 3NV4A 3FFQA 3MHZA 4URAA 1XNAA 3LDKA 3THTA 1IPJA 4NIDA 4LORA 1BCXA 1UZ0A 3THCA 1EUUA 1PGL2 2BDRA 3ACLA 3POGA 1VB4A 5JR2A 4JQRA 3GJBA 1GFF2 4LOTA 2Y6JA 3ZDVA 4AEDA 2P37A 2RS31 4OULA 2AC1A 3RYPA 1POQA 5F39A 3ZSEA 4YZ5A 5IT6A 3HNYM 3LQCA 4EN0A 4A2UA 2CY6A 4GIQA 1JYCA 1REEA 2J7MA 3SITA 1DBNA 4P9JA 5ERLA 1AL21 1ZREA 3KV9A 2ZTNA 1YCIA 1NLSA 4KWLA 1W28A 5FBJA 4XVHA 3RVHA 4Y22A 2D98A 4Y26A 4FAGA 2DV9A 1V9U3 1ODNA 1FOD2 5FQ0A 4Y4RA 5T5PA 3USSA 2ZEXA 1U5ZA 4EYUA 2FCTA 1XE7A 2JD9A 4V1PA 1JOBA 3RZZA 4AQTA 4P9XA 1EAH1 4B1MA 1X82A 1UAIA 1OA4A 2E63A 2OZJA 3KS7A 2XMLA 2VOKA 4ONUA 3LEGA 4LULA 1MZFA 2P3IA 2WFF3 1FPN3 1UKRA 5FZ7A 2X8KA 4XIOA 1UY3A 1V9U1 5DZGA 5C4WA 2ZEYA 4WV8A 3R6SA 3VBSB 1UWWA 3NL1A 1YI9A 3VHNA 1PO11 4PF1A 5DQ0A 4IUGA 3VKNA 4LBMA 3N4MA 3ZXGA 4FPEA 5L9RA 3W5MA 1GP6A 2VMDA 5DMYA 1VAKA 3IM0A 3P1IA 2B4KA 1V6KA 5GLTA 2VCCA 3U0ZA 2FQPA 1QY4A 3HT2A 4KG0A 2WFF1 2VY0A 2IWGB 3B3QE 3OB8A 4MH0E 3OUHA 3RWKX 1SDDB 2XGXA 4KWKA 2BYVE 4UFMA 3LPGA 1DFQA 1LHOA 3KF3A 1G6NA 1ULDA 3O14A 5DUXA 2VZUA 2ZMKA 4KL1A 5A7SA 1GNHA 5F2WA 2P3YA 2JE8A 2PFWA 4LHLA 1VALA 3VBSC 2P6CA 4N43C 1CAXA 3SISA 5GALA 4FFIA 5T3NA 3WDUA 5JSRA 1C4RA 4S2DA 1SBEA 4XTMA 3FLTA 3ZXKA 4XBLA 3AVRA 1QH7A 3ZX7A 1CPNA 4OLLA 1W0NA 3PU3A 4GH4C 4OHVA 3K3NA 5JUVA 4RHV2 1V00A 5FPVA 2Y60A 5CB7A 3ZN6A 4CE8A 3NAPB 2MHFA 1IQDC 1WKYA 2QJVA 4COZA 1MVEA 5LWBA 2KR2A 4QD2A 1RUD2 3OBTA 4QX2A 4YM2A 1SLCA 1YQ5A 5FYCA 1IS6A 5C3OA 4EZHA 2DUPA 3T2OA 2GH8A 4UXAA 4K21A 3AKPA 2VPVA 1SBDA 1SFYA 2YXSA 4COWA 5K0UB 5LY2A 1QJX2 4LKFA 4XIKA 1C8M3 2EIDA 3BYWA 5FZLA 3HNBM 2JX9A 3OYWB 4QX1A 1ZRIA 5FYBA 2MNGA 5A32B 5FZ3A 3ZFGA 2B42B 4XF4A 2GSYA 1FV3A 1ZNPA 3IWZA 1XNTA 3ITQA 4IEQA 1ULEA 5K7PA 3NO8A 4JZRA 4SBVA 4LBJA 4CCDA 2FDIA 3LIHA 2WO3A 3MIBA 4FQ4A 5IW0A 3WR0A 4FT8A 3FN9A 4FTEA 1W2AX 1ZM1A 4OYUA 2A7AA 2XL7A 3MEPA 4TLFA 1TZOA 5A7PA 2GNMA 2W95A 4ZXEA 3ZSKA 2VE1A 5JWPA 5F5IA 2HWC3 3KT1A 4AQSA 4Q4Y2 5A70A 2A73B 4GULA 4MXVA 4AI2A 4CEWA 3VBFC 3I3EA 4FPHA 2WS93 2YV8A 3DKWA 4A7KA 4DUWA 1DHKB 2Q30A 4JGYA 5FY9A 1JZ8A 1WCQA 1X33A 2AH2A 3WF3A 3OBZA 2VU9A 4IETA 1UPIA 3POWA 4YFWA 5FREA 4P9WA 1W6NA 3B01A 3CJIB 4GA9A 2N7GA 2BUKA 1ASJ1 4XZUG 2OPKA 1GKBA 2VTXA 2A5ZA 1WGPA 2Z69A 5IWFA 1E5HA 1FXZA 4CA9A 3ZFFB 4MGZE 1OURA 4DRVA 1A78A 3O1SA 4FI9A 1S2EA 2GMEA 1MS4A 1RUH3 5FY1A 3I2GA 4K9SA 4XOGA 3VHOA 4CXXA 1QF3A 2XL9A 4A3ZA 5EPAA 2WNEA 3W21A 3B94A 3F95A 2QUOA 2JDHA 3TYJA 1H2LA 3RYKA 4YLZA 1F15A 2HLEA 1C3HA 1CAVA 4YW4A 4EV0A 2CAUA 3BOWA 4AG4A 2WSUA 3BTZA 4CDUB 3TEYA 5GM0A 3WUCA 1Q8OA 3B7MA 4P02B 2DCKA 1GQPA 4BHPA 4TZDA 5CKQA 2ZEZA 2PMWB 1D2SA 2P3JA 4XF1A 4B4QA 5JZGB 1D4M2 1VR3A 4XFCA 3VD3A 3WNKA 1XQNA 3ZXFA 3CBNA 4Q8LA 2D6LX 5C9AB 5A7QA 1W39A 5E6HA 1C1FA 1US2A 1MQTC 1OI6A 4AHYA 2OVUA 2YROA 1JZ3A 2P2KA 1JZ7A 2YY1A 4JGYC 2PHWA 4Y33A 5CZKA 2HWE1 2IC1A 1ZZCA 2JDYA 3AZWA 4Q4V3 3K75B 1Y4WA 4YG3A 2ZGNA 1R091 2IFWA 2PAKA 3WF4A 3AYAA 2RS53 3WW3A 5FXZA 5JPMB 4GJYA 1C8NA 4O7XA 3ZOIA 4M3CE 4LHNA 3ABZA 5BPXA 5JZGC 1UKGA 1PVXA 4AOCA 3LSEA 5FMOL 4AVTA 3GDBA 2OT7A 4MZUA 3ZFFC 4EWDA 1ASJ3 4NHYA 3GCWA 4N8MA 3ZMOA 4BMBA 4NPMA 4LPLA 4HSLA 1FT9A 4W6WA 3NNGA 1ZZ9A 4YNIA 5FZ0A 5F3GA 1Q8SA 2PYTA 5IUQA 3CHXA 2XVGA 1CZVA 4NWWA 3WP6A 1W2NA 2TNFA 4Q29A 1PK6B 5F1RA 3POFA 3RZGA 4YVSC 1UU5A 5LA2A 1CAWA 1N3QA 2VMHA 3T3YA 3PVNA 2WQ4A 4GMP1 2W94A 3FBMA 4NR1A 2WR9A 3ZKUA 2QKDA 3N35A 1RUI1 1VBE1 3PUSA 4RR3C 3VKMA 1GWMA 4FPYA 1HDKA 1DGRN 4WVZA 1VBB2 1LHNA 1AYM2 2ZX2A 2ILMA 5FPUA 2FDHA 3A21A 4YVSB 1IOAA 2VOWA 2Y6FA 2D40A 4LO8A 4AVAA 2ATFA 4QKDA 1QDCA 4QXBA 2HWB1 3KGZA 1XU2A 3MIEA 3K4ZA 3N9PA 4QX5A 1X8EA 1QQP2 3NJZA 2JG8B 4I0BA 2WN3A 4JRAA 5GLWA 3IN9A 4Q4W3 4BK4A 1RHI2 5HV0A 3ZIXA 4DO0A 1LCLA 1O91A 2A6ZA 2DU0A 2VVDA 3PTYA 4Q4X3 1WBFA 5EJZB 4BB3A 5FRAA 4R9DA 1J3QA 2RE9A 1UMIA 3HIFA 4I02A 4BQXA 2Q8EA 1W3VA 3TWIA 2FMYA 2NYYA 1EPZA 2VAUA 2ZGLA 4XDQA 3I54A 2OS2A 3NMBA 4NPLA 4HMZA 4M0NA 2ADEA 5BV6A 4M01A 3C7OA 3INAA 2W1QA 1JYTA 3M4FA 4FO9A 2MPFA 2BFUS 4H2AA 1ZZBA 3RS6A 1LECA 4P9YA 3SLIA 3V0AA 3LA7A 4AQ2A 2HH9A 5K0UA 2Y0IA 1V6JA 4CU6A 2H0VA 3R0RA 3H9AA 4COUA 2C9AA 4BQ2A 3ZYRA 5FZ6A 2VBPA 1ZRCA 4GD4A 4RA0A 4FSJA 1R092 2D3SA 1PVC3 3FX3A 3H3ZA 3NJVA 4JGZB 4NAOA 1YFYA 1QMJA 2YB7A 3NSTA 4Q1PA 4HN0A 4HXCA 4CPBA 4GZ9A 4QQLA 4AGRA 1OKQA 3MV11 5FIXA 1Q43A 2X5IB 4JGZC 3ZN6B 2GNTA 3O7OA 4ZZ5A 5GZDA 4XFBA 1WMEA 2QQIA 2B45X 1CAUB 4BOWA 2ZX4A 5FP9A 4NIAA 3AYDA 2W68A 3U1XA 3OEBA 5FBZA 1OOPC 1Z7S1 2B7YA 4R52A 4GH4A 4Z2AA 1B35B 1HQWA 1WCSA 4MUVA 4Y3OA 3PIGA 5A33B 3OSDA 1UPSA 3PUAA 4YGEA 5T52A 3HOBA 2XHNA 4XUQA 2VNOA 3W58A 4IV3B 2WZR3 2HEVF 3WCSA 4XCAA 1EYBA 3HVDA 4IEZA 1YQ8A 2RM21 3MICA 4CUCA 1W9TA 5FY5A 3V64A 1E5SA 4E4SA 1AR81 3PTRB 3UV9A 2BEOA 5IHRA 4PIZA 5A3UA 3LFIA 4O9EA 3T0DA 3TNPB 4QHOA 4NRMA 1AJKA 1MS0A 3QH7A 4L92A 5FWJA 1LJ7A 4UBGA 4DINB 3N9NA 4GXLA 1ULOA 1GMMA 1UYPA 5F3CA 2RS12 5FXVA 1W90A 2D6NA 2SLIA 4RHV3 4QDQA 2IFRA 4IE0A 1AJOA 1PVC1 2WINB 1JS9A 1ZBE2 1VBC1 5EYYA 5LZ6A 1HN1A 3ZPYA 1CX1A 3LIGA 1GZTA 1RMU3 2G4IA 5ACA1 2XJSA 1WMFA 1PO22 1POV3 3ACGA 3GF6A 1GWKA 1G7YA 1XB9A 3WP4A 4UI9L 5FPXA 3I3MA 5F9TA 2KXLA 1RJ8A 2L9LA 1W9WA 5I8TA 5EJ1B 3JBG1 1FYUA 2WWSA 5FYUA 1VPHA 3WNNA 1W6PB 3AMPA 2Y6KA 2XBO1 3UNPA 1UXXX 3BTAA 4ATEA 4F8AA 4M3CB 4FPFA 5A1FA 3DF0A 4XUNA 5LA9A 4L99A 2VOXA 2AZ5A 2RMU2 3LOIA 2DVFA 3LEMA 5K4LA 1U0AA 2G9FA 3B00A 4DB5A 1H0BA 1BEV1 3AXEA 1DZRA 4ORFA 1F31A 1WW7A 4NOTA 2I07B 3AZVA 4Z07A 1QJX3 3TN93 5EIYB 1AYM1 1OBNA 4XBQA 2SBAA 2VTXJ 4QQ2A 4AEMA 5BNPC 4MO3M 5KHIA 1YYNA 5LATA 3VKLA 5LK5A 3AJYA 3OPWA 5A6QA 3UJQA 2J1UA 4LUKA 4N43A 4W8JA 1LU1A 2MEV1 3VZNA 2QQKA 4C0HA 4MHRA 1UMHA 5IK8A 1S0DA 3H3UA 2RR13 4DY3A 3EMRA 1T6GC 3GZAA 4WVWA 2J42A 5FOBB 1F4HA 1F5FA 2A75A 5FK8A 5F6LB 4LBQD 3N7KA 3ZFGC 2WABA 1UQXA 2WNUB 4PDWC 3ZYHA 2EIGA 1MEC1 4R9AA 2R062 4LUMA 4D7SA 5J09A 3VBHB 4A7YA 2GC3A 2E32A 3PJYA 4XF9A 3AJZA 4AQ6A 2W1SA 4IE7A 2FDFA 1GR3A 2GP3A 4C91A 3GHMA 5C9AA 4R4ZA 3JBG3 5KHHA 3WQBA 3W5NA 1OFSA 4XACA 2YU2A 3OYWA 4XF3A 3ZFGB 1UY4A 2BBAA 2FDJA 1DYOA 5EP9A 3B02A 3KD4A 1CJPA 5ANNA 1RUH2 3VBFB 2XLGA 1PO12 3Q9OA 4Q0UA 3VZLA 4CP9B 5AFEA 4DUVA 4YZ4A 4IXLA 4XHXA 3F2ZA 3FFZA 4OI2A 4R4XA 4LIVA 4UFJA 4D3WA 1QXPA 2NP0A 1XJAA 1NXMA 3IIIA 2Q8OA 4A6SA 4ZU5A 3PHMA 1WCKA 2DCTA 1QJX1 4B8EA 5JOXA 3I97A 4AVSA 1PMJX 3QH6A 3QD6A 1ULGA 4CYDA 5GZEA 1COV2 4AAXA 4AI0A 1D4M3 2ZKNA 5FMDA 4CDWC 1H6YA 1XU1A 2J1EA 3L2HA 3ZN5A 2VMGA 2WRAA 3Q8EA 4EN8B 1RUE3 3AYEA 1W6PA 2PHXA 3CLPA 3JD72 5TSWA 2QCSB 4XFFA 2VQAA 4A4AA 5J48A 4J25A 5BY5A 3I2OA 3IIAA 2Q4SA 3WQ7A 1ND2A 2DUOA 3D82A 3C7EA 3U37A 3X29B 2UWBA 3RZMA 1LENA 3OOXA 5FPBA 4WM8A 4OMDA 4CDUA 4E8CA 1C28A 2WNOA 2ZGKA 4A41A 2QQPA 1KITA 3O12A 1D4M1 2VNVA 3SH3A 2A6VA 4L9BA 2DCJA 2VZVA 3PURA 5FKCA 4XJWA 4K1YA 4IEYA 4PHZA 5FZMA 2UWAA 2VXRA 2GU9A 4CDWA 1LESA 1MQTB 3BN6A 1YWKA 4XBNA 2ZJCA 1LOBA 1QKQA 5FP8A 1UX7A 4WBBA 1RIRA 1FPN2 5CFDB 3V65A 5HXVA 2XR4A 4XUTA 1LOGA 5F3EA 4JCKA 4E4HA 3RZHA 2VULA 3L2YA 3ZXJA 1ZRFA 3J4UH 2JENA 1GQGA 3CKHA 3I2DA 4HONA 1QHDA 5IJRA 1WD4A 3EXUA 1QOOA 2VMIA 2AGSA 5KWRA 4LHKA 2WNUC 1RUE1 1YRZA 1SBFA 1UYZA 1S0FA 3MIFA 4MXWB 5D2AA 3S7IA 3I49A 1ND3C 3A7QA 2I2SA 4LE4A 2AYHA 2RDSA 3T4HB 1MZEA 1VRH1 1KEXA 3HR9A 4RR3A 5EXOA 4AEDC 3T2QA 3UT0A 1BBT1 2VTFA 2WIIB 4Y22B 1S55A 1LOEA 1ENSA 2D5FA 4IEOA 4LBQA 3AL5A 4EQVA 2E7QA 1HB3A 4KG8A 2HKXA 2ZX3A 4K1ZA 4CCEA 4HVQA 4AYUA 2BRTA 2F4PA 3T4VA 2C5DA 4ZPIA 4RSUA 3PMSA 3RWNA 5FYMA 2VZTA 2JDPA 2DWRA 5I0DA 3PVBB 2V5YA 3OG2A 3E5XA 4XXPA 1WMXA 2JDUA 5F2SA 5L73A 2QQUA 2ID4A 5T5OA 3H8RA 1AYN2 1BBT3 3M70A 1O3RA 4CCOA 1WA4A 1GBGA 2R041 3CL1A 2FBEA 4YGBA 2ARCA 3J8F2 2XJQA 2HEYF 3P5BA 5FP3A 4N53A 4FFGA 4DOUA 4QKBA 3CZUA 2JG9B 1SLTA 2J1SA 1LHWA 3PNAA 1AR72 4LKDA 4X8PA 5C33A 5IK7A 3ZDSA 4QPIB 2HEWF 2EXIA 5GLVA 1HB4A 4AFMA 1RUC1 3ZIWA 2JB4A 4XURA 3ZR6A 2WO7A 2R061 3H1YA 4L8QA 1AR63 3LKJA 5C3SA 3MW2A 4QU1A 4L2NA 4QKNA 3MW4A 4YVWC 4XJUA 5LW9A 1OXCA 2LW8A 3IB3A 5FPAA 4ZXKA 5I91A 1LOFC 1Q8PA 1XXNA 3AFGA 4C90A 2VC9A 5FUIA 2JG8C 1V6OA 3C2UA 2CGOA 4TN7A 2HWD2 3ZSMA 4BU2A 3MUZ1 4PIYA 4FP3A 2VQTA 5KXDA 3L9JT 1GZWB 3WNOA 3ZO0B 5JXJA 4NIGA 2BNNA 5T5JA 3S30A 2IZWA 4NJ4A 1NCQA 3I8TA 4P9GA 4Q4Y3 5A3MA 3H3LA 4OZXA 5L9BA 1VBB1 1R093 4MG2A 2DVAA 1W9FA 2ET7A 4YW5A 4BK5A 3TB0A 3AZZA 3BALA 5LB6A 3U4SA 2GC2A 1GV9A 1UNBA 5FYIA 1OLMA 1OLME 2W0XA 1S0JA 1MS3A 1ZA7A 2DYCA 1O59A 2WA3A 3CU7A 5CKMA 2XPJA 3K2OA 3K48A 4GWNA 3RJRA 1JTZX 1JMUB 1PHMA 1VMJA 4FOYA 1AXKA 4H3WA 3ZXAC 4OUSA 3LA2A 2F4LA 3R4SA 1XSRA 4FXGB 2VNRA 3C8XA 3VKFC 1RXGA 1NCRA 2ENRA 4CU7A 2WZR2 3KT7A 5IVFA 5FYZA 2Y33A 4CCMA 1CD3G 3R4DB 5IYYA 3S6PA 1FNZA 1OD3A 1OLQA 3WY6A 1D7PM 4BIFA 3GM8A 1WW6A 1ZBE1 5LA1A 4AWDA 1YQCA 3PDQA 1J59A 1PO23 1V70A 4QXHA 5DDJ2 3BPZA 4Q4V1 3NQHA 3JXSA 4XILA 1A3KA 2YG0A 4CU9A 4LE3A 4FPLA 4LNVA 2PLV3 4FCAA 1HW5A 1LU2A 2R6QA 4Y24A 5APAA 1OOPA 4S2FA 2VZQA 3KB5A 2VJXA 2RDRA 2WZ8A 3EB7A 1AVBA 2QQLA 4HN1A 3ZYIB 5GZCA 3SMHA 3ZKYA 1PK6A 1SLIA 2PELA 5FZFA 1DYPA 2QQOA 1HXS2 1YFXA 3GBFA 4Q0SA 1VBD3 4CCNA 1DU3D 3ZXEA 3ST7A 4QHBA 1VP6A 4JTOA 4XFHA 5FKBA 3FHIB 1NG0A 1BK1A 3WW1A 2DTYA 4DXZA 5ANQA 4B3NA 3HT1A 2BWCA 1HV0A 2LROA 4KU8A 3LOBA 3D3AA 3OUJA 1PIV3 4B7KA 3LGRA 5EHDA 4KU7A 5BUVA 3HBKA 3POBA 4AFBA 3IAQA 3MFAA 1AF9A 2RMU1 3BTYA 1GNZA 2CSGA 4BCUA 2HWB3 1QOSA 4JDMA 3WVJA 1HV1A 3RJ2X 3WP5A 4EWEA 5C8CC 5L19A 3J7MA 1GANA 2CU5A 4LK6A 5DZEA 4YARA 1J3PA 2DCYA 3I59B 5J7MA 4Y20B 2R063 1JZ4A 4NMIA 4X6QB 3T0BA 3A0KA 1QU0A 1QWRA 3ALQA 1JOPA 1K5MA 1US3A 4JC1A 3H50A 2GN7A 3VD4A 2ZGUA 3Q8CA 3ME2A 3EBRA 1OC1A 4DIQA 2BQPA 2YGMA 4QGLA 1V6MA 4NRQA 3DYPA 4GALA 4WZCA 1EV13 3FJSA 4QWNA 1BMV1 2RR12 3O1OA 1CPMA 1ZVFA 4CDQA 1UU4A 2XJPA 5F5QA 3U10A 3IT8A 2GMMA 2Y6LA 3WNLA 2GAUA 3O1MA 2W92A 1JI6A 1VIWB 2DDUA 2WLQA 5FLJA 3SCFA 3ZR5A 4ARYA 1AL0G 1JYVA 1PGL1 2WC2A 1UD1A 3A22A 3D8CA 4LBNA 4YW2A 3RYRA 2C6SA 5FFOC 3NKGA 4E27A 1OSGA 5B2GB 1W9SA 4KI5M 4RQPA 1QJY2 1GOGA 4I0AA 4JX0A 2FMDA 2VQUA 2VNGA 3DPRB 1W2UA 3HAGA 3OBRA 4NAMA 5LRSA 3UKTA 1IGOA 4PI0A 4YG0A 1NE4A 3MF9A 2OUJA 1OOPB 4G3YC 4UYBA 1AL22 3D6EA 1COV3 1LHVA 3BGAA 4GB32 4QX0A 1AR83 3T1MA 1TMF1 4BXSV 4ZU7A 2E6VA 1QJEA 5KHJA 1RUE2 3CJIC 1LEMA 5A3TA 2ARAA 4OUMA 4Q5OA 2YPJA 1JYIA 2ZPXA 2VMFA 1HXS1 3KCYA 3WW4A 3VZMA 4EWAA 2CDPA 1LGBA 3H1MA 1OPMA 1SMVA 3P3NA 4XZPA 5EYXA 3FUQA 3RG0A 5E89A 2BV4A 1A8MA 1XYNA 2JDAA 1SG3A 3BPSA 3ZFEB 5J3UA 4GWJA 1YI7A 1S0GA 5I0UA 1PMHX 5FO8B 4RS5A 1FI2A 2DFBA 1S1AA 4CDUC 3TEZA 2XJRA 5D21A 3VDCA 4DXSA 3KCXA 1ZBA1 1G9DA 4LEJA 1W05A 1KGYA 2JE9A 3G6JB 2G19A 1IKPA 5SV8A 1Y3TA 3WHUA 2A6XA 4HANA 3J7LA 3THDA 1O6UA 4LLOA 5AC93 1GOHA 1W2TA 4TLGA 3K4AA 3ZFEC 4E2QA 5F8PA 3HN1A 4ES9A 1CAXB 2RS11 3KHBA 3HQXA 1N1YA 2R1DA 1BXHA 5B4NA 1FPN1 1SZBA 4XJZA 4NVPA 2Q0AA 2XG3A 1EP0A 2JEMA 2FCVA 2C4XA 4QQHA 2E7TA 3VDBA 3WF1A 3M3IA 1A8DA 2YBPA 2O14A 1OQDA 4WZFA 4LBKA 1ZBA2 4M4PA 5L36A 3O0VA 1J58A 4W6XA 1VBD1 2TEPA 4BLJA 4EZ4A 3D0SA 2HJIA 2JB8A 2E26A 5D8AC 4HLTA 2D97A 4XQ4A 4CTEA 1C1LA 4Y4YA 3AB0A 2E31A 3ILRA 3OCPA 4HOOA 3VBUA 1EY2A 4QM9A 4P14A 1E57A 2R16A 2VCAA 3SH4A 2DUQA 1AX1A 2NQYA 2W1UA 2Q8DA 4AW7A 2P17A 4I3GA 3U75A 4EJRA 5JR7B 3BVCA 3ZYFA 5LCWL 3FHQA 1W99A 5C4WB 3MO4A 5IATA 2Y26A 2Z5WA 2YPDA 4FPJA 1XNCA 2WQZC 3ZYGA 3BIEA 4HBNA 5CFDC 5C4WC 2W3JA 1UY1A 2DTWA 2Y34A 1UZYA 3OTFA 3TAYA 1PGW2 2DVBA 3R05A 2CHHA 2VGDA 2H6CA 4XFAA 1UXZA 1YO8A 4A7ZA 4DEQA 1QGLA 1MACA 4RR3B 1QJY1 2UY8A 1CWPA 1AYN3 1BBT2 2VR4A 4FP2A 5DG2A 5FZGA 1ZA4A 1KJRA 2ZHLA 2P3KA 1Q8VA 1QNYA 2DCZA 5I0SA 1N1VA 3SCHA 4ISRA 5CG8A 3ROUA 2TBVA 2I74A 2ZHNA 1L7QA 4QQOA 3WEZA 3VBOC 4D7TA 1RVF1 2ETEA 3VV1A 1MR5A 2XXZA 1D2QA 2CNAA 4O65A 2ES3A 4OVEA 3C7GA 1XBFA 4QPIC 2WT0A 1Y9QA 1S0CA 5CVRA 3ZYBA 4CEWC 1UOJA 1YNAA 2PHUA 4CVUA 3SEEA 3H8OA 3N7MA 2PHTA 1Z78A 2WZR1 4FOWA 1BHGA 1MEC3 4EN6B 4MX3A 3DV8A 1AR62 3VGIA 1OT5A 3O1VA 4P08A 3T2PA 2W08A 2WLPA 5JLVA 2NMNA 4HK8A 4W50A 5FZDA 1LRHA 3ZXLA 1JYWA 2R30A 3W9AA 3S0MA 1W8UA 2Q1MA 3NVCA 1K5MC 5F3IA 5K9YA 1HRI2 2RG4A 2Y64A 1UYXA 2HWD1 4BWOA 1WBLA 1TE1B 2BTVC 4MVTA 4UW3A 2YMZA 2GALA 2R0FA 4LR4A 1L7RA 1X9TA 2ET1A 2WWUA 2QZ3A 5C8CA 1ACCA 4XCBA 2JIGA 3AP6A 3NV2A 2JE7A 4OHZA 3NV3A 1RXFA 4JAAA 4R8HA 3NV1A 1VBA2 2E33A 1DQ0A 1PX4A 2HWD3 4I30A 1IPKA 2TUNA 1ND3B 4WVMA 2NMOA 5FUNA 4KMQA 1RVF3 1OD5A 3GGLA 1PM7A 1Z0HA 3FHAA 4TWTA 4LT5A 2CAVA 2CYFA 4MGSA 2VUAA 4P00B 3JQXA 5IK5A 5JZGA 3ES1A 2XJUA 4RFT0 1UF2C 1S0IA 4D7YA 4XFGA 2G9GA 5ISLA 3JBG2 2NPIA 3TOJA 1ND2C 2Z4FA 3MZHA 1HRV2 1NCRB 2D43A 2QZ2A 4P9LA 3U4XA 2ZKLA 4WM8B 2D44A 4PLMA 5J98B 2ZMNA 2GNDA 4H14A 4HVOA 1NZCA 1I3HA 2VMCA 3N36A 4XXAA 5GLZA 4KGGA 3AKTA 2GZWA 2ZAAA 4UW4A 5A7OA 3UJOA 4Z1VA 1WA6X 2BGOA 3DPRA 4D69A 2NN8A 3DYOA 2R071 1BKZA 2OYZA 1ZZ8A 4BPZA 2ZHKA 3EHKA 4JV4A 2E7AA 3KLSA 3OUIA 2BNMA 1HKDA 4XC9A 1D4VB 3N7LA 4Z82A 4WVVA 1NCQB 1JU4A 3H42B 3MIGA 4HKOA 1NE6A 2V09A 4XABA 2BPA2 4UF0B 2LALA 3HMYA 4HK9A 2A71A 3JB8A 1GU3A 3E6CC 3WQ1A 4IESA 4RFRB 3O0XA 2PLV2 3SC7X 2HWC1 2R7EB 2VUDA 5J1XA 2VM9A 4AHXA 1HJFA 4MGQA 4CP1A 5A3LA 5L9VA 1PIV2 1F2NA 1O7FA 1VBC2 3OY8A 5D8AA 3UKNA 3ZM8A 4AFAA 4PCRA 4KBZA 4NHLA 2VMEA 1FOD3 4RD7A 1OF4A 1QEXA 1W3XA 1AR93 4QPGB 1W03A 4YM0A 5T50A 2I45A 4PJYA 3URFA 2BVVA 2FCUA 1TMF2 1WZXA 4LQRA 5DZFA 4B29A 5E1RA 4IE6A 1AX0A 4FPOB 3QACA 4N53B 4RYDA 1QJU3 2F6BA 1O4YA 2D93A 4CDXC 3AP7A 2D5HA 2YBSA 1AZDA 1AHSA 2C9KA 1HRV1 3OJBA 5DAWA 4C1WA 3S7EA 3QOPA 2IXIA 2RM22 4M00A 3RFRA 2DBNA 4GMP3 3ZSJA 3POIA 2VZ1A 4NIHA 3AX4A 2A6YA 4QX3A 5C9AC 5FTTC 1R64A 3FE5A 1STMA 2W46A 2ZEWA 1LGCA 1AX2A 2XWBB 1W06A 2W47A 3OGRA 2MEV2 3NNFA 4EROA 2QQJA 4G4FA 4ES8A 4QDSA 3O1RA 2C0ZA 1A34A 4NROA 1YXWA 4WM8C 1KQRA 5GZFA 4RGKA 1A6CA 2RDQA 3K77A 1AR82 1CONA 1IHMA 1CIWA 1PNFA 2QQVA 2B5HA 3EQEA 5DUUA 5KC5A 1LAJA 3HEIA 4DUXA 4UT5A 2QQNA 4IL7A 1W8FA 1PO21 3TNQA 4XF0A 3T30A 1J84A 5AC91 4XPVA 3VBOA 1IKQA 5DABA 3RPQA 2C1FA 2XDVA 2VZ3A 3I7DA 4E4DX 1N3OA 2DF7A 2HWE3 4IW3A 3VL9A 3VN4A 5F5AA 4CXYA 2WBKA 2YC4A 2ZGOA 3OEAA 3KCCA 3LFMA 3AL6A 3PUHA 2E51A 5JI9A 5HCFA 2C24A 2PHDA 4IV1C 2PQSA 3VBUB 2J1AA 5SV5A 2X05A 4CDWB 1H8TC 4AVBA 4QHZA 1JZ6A 1UY0A 1JU3A 1RINA 4AI9A 1C8M2 1DG6A 3H1WA 5FP7A 1O5LA 2R073 4PI2A 2W39A 5DPNA 1F9KA 2YBKA 1W6OB 4PBOA 1W6NB 3CJIA 4AI8A 5A1AA 2PXJA 3UETA 3UGGA 3VBUC 1V9U2 4J1WA 4Q26A 2BFUL 1H6XA 1MS5A 3Q8BA 1CR7A 1LHUA 1OF3A 1OH4A 4MADA 4LKEA 4BQYA 3QBQA 1VAMA 2XB6C 4GH4B 2IXLA 5FZBA 4BQ3A 5AC92 4IV1B 3MPBA 2G9ZA 4HZFA 1X36A 2IVIB 3CF6E 1BLZA 1G9AA 2XWJB 4UWDA 2WFF2 3ZN4A 3FWEA 1EUTA 1ZZ7A 2WJSA 3NJXA 3DKQA 4UFHA 5BNNC 5CFCC 2YZ4A 3G7DA 1LNSA 5CADA 4LK7A 1EV11 4I3PA 3J8F1 3KZ4C 4ZU4A 3S5QA 1PX3A 2AEYA 3ZFEA 2QVSB 4IEPA 5GLUA 5FYVA 5BNNA 5CFCA 4YVWA 1XYPA 1ZBA3 5EFUA 3LF7A 5IVEA 1RUC2 3UK9A 1IS3A 4XDPA 3PVEA 2DFCA 3O1PA 4PBPA 2WZEA 3BCWA 2GC0A 1LEDA 2ZCWA 1H2KA 1CZSA 2XQRA 3RI8A 2LRPA 3BUCA 4IEVA 2ZX0A 3UESA 1UO9A 2K9ZA 2YYOA 4RHV1 3B9CA 4AAPA 4BZ4A 2H0BA 2OQ6A 3WHTA 1W04A 5EQUA 1VBA1 4SLIA 3CNAA 5DN2A 1IG0A 4QPWA 3ORJA 3BI3A 1W6MB 2A6WA 1SEFA 2YDEA 3FLPA 3KQ4B 4LBOA 2PA7A 5FJKA 2V4VA 2WYFA 3PVOA 4Z2WA 2CWMA 1VRH2 2D6KA 1WMDA 3IDCB 1G9FA 2AACA 1Y9GA 1WD3A 2V73A 2EIEA 4YW3A 1H9PA 1LOCA 3IBMA 1JUIA 1HN0A 2FHRA 4IV1A 3M3CA 3M3OA 4S2HA 1KS5A 2OUHA 4CDQB 4L97A 3PL0A 1PK6C 5IAVA 4AGGA 4XE9A 3VL8A 2ZA9A 1W0OA 2UYAA 5A1LA 3J26N 2KD7A 1JN2P 2ZGSA 4YG6A 5CKNA 1LKNA 1K5MB 2Q8CA 2Y6GA 1HXS3 1TNRA 2PTMA 2EALA 3PLQA 1H8TB 2YFUA 3KMHA 2W91A 1Z7S3 2JWPA 3KWVA 4AGVA 1N1SA 4CDQC 3GYDA 1W6OA 1SCRA 2ZZQA 1NYWA 2VVEA 4W4ZA 4XJ9A 1L7LA 4OUEA 4CUAA 1KD7A 4E2GA 2R042 1MEC2 1PMIA 1YIPA 1BVP1 3FMGA 4KWUA 5FZ8A 1QJZA 5C8WA 4I01A 5I0TA 2GNBA 1YFUA 1BYHA 5KR7A 3CQOA 4K6BA 1F35A 2WAAA 4YW6A 5ACA3 2HWB2 3IDAA 2W87A 1VBA3 4LBLA 1N1TA 3HPNA 3RMYA 1W6QA 1ASJ2 1IG3A 1U5YA 4EE2A 1AR71 4L11A 5FMOS 5CU1A 2HWC2 2WO2A 4WM7B 2PLV1 4MSVA 5GKAC 4OCTA 3DXUA 1OVPA 1WCUA 1NY71 4HFSA 1VAVA 4HPKB 4W65A 2CGPA 2WS92 2VO5A 5I93A 1V6NA 2XKPA 2OQ7A 1ND2B 4FQZA 4P5YA 1BK0A 4GQ7A 2HYKA 2LM3A 4UFLA 4KH9A 5JOYA 3N3HA 1M4WA 3ASIA 4BLIA 3C7HA 3TRSB 4XTPA 3SKVA 3ZLIA 2OPWA 3RRDA 2FD8A 1RVF2 5FZEA 3CEWA 1XYOA 4Y20A 5HCHA 2WWJA 1JOJA 2WKKA 1QJY3 4IEXA 4QQPA 5IVBA 3DXTA 1GZ9A 3QLQA 3GNEA 3N9OA 2PHFA 4K40A 1H8TA 4S2GA 1CQ9A 3PU8A 1AL23 2JIJA 1QJFA 1WUVA 3ILNA 1O5UA 3IZOA 3H0OA 4LHSA 1QQP3 2UURA 1RHI3 2VUCA 4JGYB 5FLIA 2YGLA 4R9BA 3VBFA 4DZGA 2J22A 1CAVB 3VBRA 4E4ZA 5ABJA 5H9PA 2KA3A 5F32A 1ENQA 1W8OA 4G9SB 3SXWA 4Q4X2 4FBFA 5JXHA 1RYYA 2ZGPA 1BEV3 4YWAA 1DLLA 2XUEA 5DAPA 4PLOA 2V4AA 3GALA 4B1LA 1BMV2 5LBFA 3WXPA 1NKGA 1W8WA 4GMP0 3VBHA 1K42A 1ULPA 3AKRA 3JU9A 2AR6A 4YRDA 2HYXA 3KT4A 1R082 4CUBA 1W6MA 1C5HA 3BKZA 3D4KA 2WNUA 4OHYA 2EICA 3T1LA 2F17A 2QE3A 4CCLA 1RUJ2 1ENXA 3M3EA 1UIJA 3PUQA 3RZJA 1YEWA 4D0QA 4XEZA 2P34A 4NO4A 3ENRA 5FMCA 1TVGA 3SHRA 1LOFA 2E9QA 5CNAA 4AI3A 1OVSA 3U14A 4OI4A 4U36A 3TBDA 1PVC2 3SH5A 3VD5A 4CDXB 3FLRA 4DPNA 1IPSA 1CX4A 5KHGA 5CG9A 2RS52 4Q1RA 3WG2A 1X9PA 3DL3A 3ZPOA 1VBC3 4YVWB 2XKOA 5KXBA 2WL1A 1GSLA 3AVSA 5K8SA 1UMZA 3OD0A 4AE2A 5DAXA 4BIOA 1RUH1 1NLRA 1CJDA 2NLRA 2BOIA 4FOQA 1VMHA 2OW4A 2WNVC 1ST8A 2W2IA 3E97A 3AXDA 1C8M1 1UIKA 2ZZJA 5E88A 5F6KA 5FZ4A 4ARXA 4CEYB 2JG8A 4JKMA 2E53A 4FPCA 1AUYA 3KV6A 5JIUA 3PIJA 1W8HA 1DQ6A 5FO9B 4ZZ8A 5LY1A 5BNOC 1Y7BA 1JW6A 3SKJE 3BB6A 2NM1A 5ABJC 4QX7A 4ZKTB 3WQ0A 1EPWA 1XOYA 2XVLA 1Y9MA 1RITA 4MGYE 4QB2A 2V5DA 1JHJA 1XE8A 4FAHA 3MI8A 4XHBA 4I0WB 5T54A 1AYM3 4IV3C 4QGNA 3B69A 4NRPA 4HVRA 4OZOA 3RZLA 1VB2A 2WQ8A 3BTXA 4IE5A 4MV2A 5F5CA 2MEV3 1G9CA 2HWE2 4YFZA 3OGJA 4ET7A 3NAPA 1CZTA 4FXKB 2WFPA 4RGGA 5F37A 2OA2A 4JHTA 4LJHA 1Q3EA 1RUJ1 4GAZA 2FZ1A 4XDOA 2OXBA 5EWSA 2X10A 3CIHA 3OPZA 4P9IA 4DMIA 5C5TA 4K7JA 4F7ZA 1PNGA 1BQPA 4N9HA 3POYA 3VDAA 3E6BA 3R4UA 3AKQA 3ECQA 3WV6A 2X5IC 4JDOA 1NY72 1LGNA 4HG6B 3ZYJB 4MGTA 4D8MA 5A33A 2AEZA 5FDBA 3VLBB 2WS91 3IMMA 2BBVA 3GJAA 1SCSA 1QH6A 1V6LA 2QQMA 1REDA 3LEIA 2VZOA 4YW7A 5FWEA 4Q8KA 4QX8A 2FDKA 3POJA 3LDRA 5HV4A 5LBCA 4YGDA 2XUMA 1JH5A 4IGOA 3IAPA 5C5UA 1KXGA 4BDVB 4BXFA 2P1BA 1PGW1 4P5HA 4NHKA 3TN92 3J7NA 3AK0A 1NQDA 1SPPA 4Q0PA 1KRIA 5LRRA 1RUNA 2R072 4M4RA 4YM3A 3WG4A 3SNMA 5JSPA 1U12A 4RGAA 4HKLA 2JG9C 1TG7A 1DQ2A 5D1IA 4GWIA 3DPRC 1HJGA 2ORXA 4JHZA 2ZXQA 5C70A 1LR5A 5JMCA 3KVBA 1ZZ6A 3V0AB 1GYKA 3H8UA 4LBQB 4AF9A 4JKKA 1W6QB 1YLLA 2ZAHA 3DN7A 1FAYA 1RUC3 3LA3A 5A3WA 5KBFA 2R0HA 2XJTA 1AR61 2FZ2A 1LB2A 3AKSA 3VZJA 1BVVA 3DUIA 4MGIE 3Q8FA 3I3QA 2JDMA 3JUUA 1R081 5FYSA 3B93A 1KFXL 3C3VA 1HRV3 2A3WA 1PZ8A 3AMQA 5J37A 1FX5A 3I59A 4Y1VA 4UOJA 4Q27A 4V2VA 5FYYA 4OI1A 5G05L 1GNYA 1T6BX 3WF2A 4OHXA 1YJLA 2IVJA 5D8AB 5DUWA 4ASKA 5L7OA 1J1TA 1O3TA 4Q2FA 3VBHC 1HRI1 4LO6B 4LOSA 1NLQA 2PAEA 1R1A1 3PJQA 1XRUA 1OHFA 2XH6A 2EAAA 4KNCA 3DEMA 1E5IA 2Z2SB 4UW6A 5HXMA 3P3PA 2JKBA 4K8FA 2R32A 3EO6A 1DF0A 1D0HA 4W6YA 1FOD1 4LXLA 5FP4A 4EN7B 1AR91 2VUJA 4CRQA 1FMD1 2VECA 4H7LA 2XONA 4IGPA 4XETA 4IQPA 4YSFA 3JD73 1YUDA 1GLHA 3APBA 4QPYA 4MHUA 3V56A 3M3QA 1CAWB 5AVAA 2A3XA 4JRLA 2VBDA 1URXA 3FL7A 3NNLA 1VRH3 5L7OC 1Z7S2 3AYCA 4FTBA 1TME1 5A6ZA 4C1XA 1HLCA 4XJ8A 4XUOA 2Y0OA 4Y5Z0 2YC2A 1NAEA 3OY8B 5J96B 1RUG1 3T08A 1X7NA 1SDWA 4UBHA 1RC6A 4XMAA 2RMU3 4N43B 1AR92 2ZS6B 4EN9B 2V72A 5I0RA 1CN1A 5T5LA 1TMF3 5LASA 1K3IA 1W8NA 2K2SA 1DGRA 5LEKA 3ACIA 1QOTA 3HN3A 2P5BA 4DFSA 3WNXA 1OFNA 1DQ5A 1W2OA 3C7FA 1NOVA 1QJU2 5JI7A 1QDOA 1W0PA 2JDNA 2R043 4M3CF 4CZSA 5L7OB 1ENRA 1POV0 1T2XA 2QFEA 1BJQA 3CDZB 3AMNA 4QGMA 4RL7A 1RUG3 4Z8BA 4MYEA 5FPLA 4Y1YA 1K45A 3VDDA 2WT1A 5FPZA 4HT1T 1QXJA 1JBCA 3K4DA 5A7WA 2RS32 1ONAA 4UAPA 5IVJA 2JXAA 2ZGTA 4CCKA 2Y6HA 3WF0A 3WNPA 5LK7B 2ZBJA 3N9QA 2RDNA 3NWKA 4HETA 4LKSA 1NUKA 1CGPA 3MFCA 2XLAA 5H9QA 3LAGA 4RS5C 5FCCA 1ODMA 5HBAA 3HBZA 5FMBA 4YZ1A 1FMD3 1JODA 1GQHA 4YM1A 3U07A 2D6OX 1UZVA 5DXDA 5JAXA 2BU9A 5LBEA 2FDGA 2HWF3 2VCMA 1GZWA 5FR3A 1XSQA 4FFHA 2WO1A 1HB2A 1RUI3 1VBE3 3BU7A 1UYYA 2JDKA 1EAH2 4CP0A 5IFTA 2BGCA 3JCIA 4B4PA 3FC0A 3WINE 5DAQA 5BNQA 1H4HA 2GC1A 2PN5A 4WM7C 4WVMB 1YJKA 5BNPB 4Y1ZA 4K20A 1BEV2 3VBSA 3VD7A 1IQAA 2C26A 2VOVA 2RVAA 2YUEA 3BODA 1WCDJ 2BZDA 2BW8A 3ATGA 4LTAA 5FZOB 2WT2A 1IS4A 2DU1A 1VLNA 3VBOB 2ZABA 3ES4A 5FAXA 2RJ2A 4IV3A 4DXRA 3MIDA 2JICA 3N9MA 3PUIA 4QKFA 5FXWA 2JG9A 1HX6A 2BP6A 4Q4X1 1SLAA 5FQ0B 4CPBD 3JQWA 3UKVA 2O8OA 2LTNA 1PZ9A 2XLFA 1E5RA 2JKXA 3I2IA 2UWCA 4D94A 3KM5A 4PT6A 1H1MA 4GKXA 1DDLA 1RGSA 2B8MA 3O0WA 3HJRA 4AFCA 5CEHA 2CDOA 4KBBA 1W8ZA 1UX6A 5C71A 2JJ6A 1N47A 3MIHA 5HCBA 5KHKA 3GZUC 5DDJ1 1YHFA 4XAAA 4HKWA 1CESA 2R49A 2ARBA 2IXHA 1H2MA 1YC61 2X09A 3W59A 1K12A 1SPPB 2UY9A 5JMOA 3IMNA 1QIQA 4IDZA 5B4XA 1O4ZA 2GH2A 2W52A 3WDTA 5DG1A 4C8DA 2XBO3 4UFKA 4KGQA 4LO5B 4FOVA 4FPKA 5A32A 5HPOA 3BIWE 2IXJA 2RHPA 2HWF1 5JVVA 3WW2A 1LTEA 2EA7A 4BQ5A 1ZYBA 4QM8A 1XC6A 4LO4B 3MLJA 4QMAA 4FFFA 1F8VA 1KFUL 2OIIA 4LO7A 4NIIA 2VZSA 3KGLA 4D6QA 3NAPC 2IXKA 1ULCA 3RDIA 4BA6A 5I8YA 1PM4A 1UW8A 3ETQA 4YPJA 4I2OA 5FZOA 3I2HA 2IXCA 1QXRA 4NWVA 4Y5TA 4XQDA 3CJXA 3GCXA 3JB4C 3MPPG 1AYN1 3WLUA 4GWMA 3BOPA 5IVCA 3BU0A 1MVQA 4D6SA 1C5IA 1CAUA 5CISA 3RQ0A 1IS5A 5BNPA 4PLNA 3AP5A 1MZ6A 3VZOA 3USUA 4TTGA 3HNMA 2G1MA 5C3QA 3DCQA 3IDEA 3E1F1 5JOZA 4QAWA 5A7NA 5A80A 2W5FA 3CMGA 4QDRA 5CA6A 1KJLA 1HIXA 3IPVB 5BNOA 5DDJ3 3LZZA 1JZ2A 1H30A 1V0AA 3MV01 5EZWA 3RZKA 5FLHA 3RNSA 4AHZA 1Q56A 4J1XA 4CSWA 2CV6A 3AFKA 1S0BA 2VXJA 3H7JA 4KQ7A 4O61A 5DUVA 2D3PA 1S4CA 4PF5A 2XJVA 2WNVA 3P6BA 1SLBA 3J8F3 3MLKA 3MLLA 4PQ9A 1B09A 3T2TA 1REFA 4B4RA 3SEPA 4X6RB 2RR11 5FZAA 5HI0A 4N90A 1G86A 1AR73 1XE0A 2VG9A 5C7GA 3D0JA 1VBD2 3VDDC 3S5AA 2EXHA 3MYXA 3Q8AA 3WT3A 1LULA 3WD5A 2A3YA 3LPFA 5E8AA 1LOAA 3H7YA 1UY2A 2QQWA 1SFNA 1PGSA 1YFWA 5DAVA 1GP5A 3HD8B 3N9LA 3RGBA 1J3RA 1XNDA 4AFDA 4BM8A 5JPNB 3ON7A 1COV1 1UOBA 5FZ1A 5ACA2 1VRBA 2VZRA 2NZ9A 4IEWA 4ITCA 4IE4A 5JDBA 4JKLA 4QB1A 3ACHA 4CUGA 3KVAA 4OQ9A 3WZ1A 1WLWA 3KF5A 4YVSA 4IGQA 1O3SA 1R1A3 2EVXA 1TME2 1U5XA 4Q0QA 4JTNA 4YZ3A 5KXEA 2EXJA 3DGTA 3MF6A 5I8SA 1ALYA 1RUOA 2RV9A 4H7MA 3K3OA 1UCXA 3M7AA 5EV7A 4DQAA 2ARXA 3AZXA 4MOAA 1QNWA 4A3XA 5A3PA 3AP9A 5C8CB 1RMU1 1RUF2 2X53S 4XAEA 1I5ZA 4FTSA 3KV4A 1W9YA 2WDBA 2AUYA 3MDPA 1VMFA 3OD4A 3WDXA 2O8QA 2DVGA 4UFIA 5CBLA 2B9UA 5IAXA 4AI1A 2GP5A 4UW5A 5LEJA 5LBBA 4A44A 1DGWX 4HSJA 3ILFA 2ORZA 2WAOA 5F7UA 3VBRB 4TXWA 1S2BA 2ERFA 1SHWB 4AK3A 4QT6A 3NKTA 5T55A 1Q5OA 3LSDA 1W8TA 1MZ5A 2DURA 5FXXA 4XMIA 2ZGMA 4BJ0A 3ZFFA 3KHCA 3DYMA 2JD4A 3EJKA 3AP4A 3WG1A 2D7FA 1FNYA 3VB9A 1HQNA 3WSOA 5IK4A 2DBIA 3JZVA 1I1EA 4J6GA 4JDNA 1F4AA 1YQ6A 2XHKA 5AFBA 3RMXA 2XVKA 3FUOA 5FY0A 1OA3A 3NW4A 3WG3A 4ASMB 1DQ4A 5JXIA 2ZGQA 4DRRA 1N3PA 2W1WA 4A45A 1R083 1JZ5A 3WUDA 3UL2A 1NA1C 5JCTA 3VBRC 3AMMA 4XUPA 1RUJ3 4Z92B 3PMEA 4M0HA 4NHXA 3ETPA 5FYHA 3CO2A 1DYKA 1GUIA 5HCAA 2BGPA 2WN2A 1NA1A 4NN0A 3POSA 4E9KA 2P6HA 1FV2A 1I9RA 5FZKA 3A4UA 1UN1A 3CZJA 4FPGA 2A1XA 4XYXA 5CYYA 3HWJA 4QXCA 4DS0A 5C3PA 1ULFA 2D3RA 2ZOEB 3M8LA 4K8RB 1X50A 3EYPA 4XW3A 4E2SA 2Z42A 4DEVA 5K0UC 4JVAA 3GBWA 2B46X 1WLTA 1UOGA 5CIRA 3V0BA 3LEKA 4URTA 1RUG2 1WW5A 2Y8KA 1HQLA 3KQRA 5FYTA 1QQP1 1BZWA 2ZACA 4AZZA 4AEKA 1K5JA 1OUSA 4ATFA 1HB1A 1OLRA 3M2MA 4CP2A 5LA0A 2ZGRA 3E6DA 1SACA 4AEJA 3LD8A 4PDWB 1O8SA 3LDBA 3J9SA 3NNJA 3QCWA 4MLOA 1F5JA 1ZX5A 5C3RA 2AREA 1RJ7A 4LA2A 5H9SA 3W20A 2K46A 2XQXA 1GOFA 3I2JA 1H4GA 2LUWA 2ZHMA 2HBUA 4CCJA 3E5UA 2J1VA 1DGLA 2J1TA 1FMD2 2RJLA 3GBGA 3LCPA 2OX0A 1WWYA 1M06G 1EV12 1ZRRA 4TSVA 3ZSLA 3OF1A 4H55A 3HQRA 3USUB 3WP3A 4LIUA 1ND3A 3A0NA 5GJ6A 1SLLA 5FO7B 5KXCA 4U2AA
chains in the Genus database with same CATH topology
3VD9A 2J1RA 5EJZB 4ARXA 1GOHA 1JYNA 1CIYA 3K4AA 4JKMA 1UMIA 3OGVA 3LE0A 3I2FA 3I3BA 5B4NA 4ZZ8A 3J7HA 3SKJE 3C7OA 2W1QA 3MUY1 2C4XA 3VDBA 3WF1A 3DECA 4M4PA 3WNMA 4QB2A 2V5DA 1JHJA 3T0AA 4CU6A 3MBWA 2E26A 2WUHA 4OZOA 1I5PA 2E31A 2WQ8A 2VCAA 3NJVA 2W1UA 2YB7A 4GZ9A 4ET7A 5LCWL 3FHQA 1YQ2A 1W99A 3MV11 1CZTA 3MO4A 4ZY9A 4ZZ5A 2QQIA 2VOTA 2W3JA 3OEBA 1UY1A 2X10A 3CIHA 4Z2AA 1UXZA 1J83A 4DEQA 3VDAA 4A42A 3HOBA 3ECQA 2VR4A 2XHNA 4XUQA 4HG6B 4DXTA 2WYSA 4D8MA 4CU8A 2QQMA 1L7QA 3LEIA 3WEZA 1W9TA 2VZOA 4CUCA 5IHRA 2BERA 1XPWA 3T0DA 3C7GA 3IAPA 4L0PA 4BDVB 2YFZA 4CVUA 2EIBA 3SEEA 1ULOA 1GMMA 1BHGA 4M4RA 1OT5A 2B9VA 4P08A 3T2PA 3A23A 4QDQA 1TG7A 4W50A 4GWIA 1JYWA 2ORXA 4JHZA 1HN1A 4E8DA 3T09A 2ZXQA 5C70A 1CX1A 4A6OA 3OGSA 3ACGA 4JKKA 2Y64A 1UYXA 4UI9L 3AC0A 3GXUA 1L7RA 3NRUA 4QB6A 2L9LA 1W9WA 5EJ1B 3K46A 1P8JA 3WNNA 2Y6KA 2VL4A 3UNPA 1UXXX 4XUNA 1DP0A 4UOJA 2E33A 5G05L 1GNYA 3WF2A 1PX4A 3I2KA 4KMQA 3GGLA 3FHAA 4MGSA 2W9XA 4P00B 5EIYB 5HXMA 4MO3M 2J1UA 4W8JA 2Z4FA 1NX9A 2QQKA 1UMHA 2XONA 3OBAA 1F4HA 4OMCA 2WABA 2VMCA 1O8PA 3FL7A 2VCBA 1DLCA 2E32A 2BGOA 2W1SA 3DYOA 2XOMA 4XUOA 3WQBA 2YC2A 3W5NA 1NAEA 3T08A 1UY4A 2BBAA 1DYOA 2V72A 1JU4A 5IFPA 5JXGA 1K3IA 1W8NA 4DUVA 2VZPA 3F2ZA 3I3DA 3ACIA 3HN3A 1GU3A 2QBXA 3C7FA 3IIIA 2R7EB 1T2XA 5J1XA 2OKXA 2VM9A 3CDZB 3I97A 4MGQA 1PMJX 3ACFA 1K45A 3ZM8A 4AAXA 1MPXA 1H6YA 2VMEA 2J1EA 2LS6A 1OF4A 3K4DA 4UAPA 4A4AA 2Y6HA 3WF0A 3WNPA 4LQRA 5G04L 4LKSA 3C7EA 1NUKA 3U37A 4PQQA 4RYDA 4RN5A 4OMDA 4E8CA 1XNAA 4A41A 2C9KA 1UZ0A 2DCJA 3THCA 2VZVA 1EUUA 2WO1A 5JR2A 1UYYA 2VZ1A 2Y6JA 5IFTA 3BN6A 4QX3A 1R64A 3HNYM 3LQCA 2W46A 2ZEWA 1UX7A 2J7MA 3VD7A 2C26A 2W47A 2RVAA 3OGRA 2QQJA 4XUTA 4QDSA 4XVHA 2BZDA 3CKHA 3K77A 5IJRA 2RJ2A 2ZEXA 3HEIA 4DUXA 4DXRA 2QQNA 3PUIA 2JD9A 1UYZA 1J84A 3A7QA 1KEXA 2VZ3A 3LEGA 3T2QA 2VTFA 2JKXA 3I2IA 2WBKA 4PT6A 1UY3A 2YC4A 3OEAA 2ZEYA 3HJRA 1UWWA 2CDOA 3PUHA 4PF1A 5C71A 5DQ0A 4IUGA 2VZTA 2VMDA 3W5MA 2PQSA 5DMYA 2J1AA 5I0DA 2X05A 1JZ6A 3P1IA 3OG2A 1UY0A 2X09A 1K12A 2B4KA 5JMOA 1JU3A 5B4XA 2VCCA 2ID4A 5HPOA 5DPNA 3OB8A 5A1AA 1SDDB 3LPGA 3UETA 2VZUA 1XC6A 1H6XA 3CZUA 2JE8A 2VZSA 2J1SA 1OF3A 1OH4A 4MADA 4YPJA 3I2HA 4XURA 1W0NA 5JUVA 1EUTA 3NJXA 1IQDC 1WKYA 1LNSA 2LW8A 3IB3A 4QX2A 4TTGA 2VC9A 5FUIA 3HNMA 1PX3A 3E1F1 4QAWA 3T2OA 3MUZ1 2W5FA 3CMGA 2VQTA 4QDRA 3WNOA 5JXJA 1JZ2A 3MV01 2WZEA 2EIDA 1CZSA 3HNBM 4QX1A 4BK5A 3UESA 3P6BA 1XNTA 5DN2A 4QPWA 2WO3A 1O59A 3SEPA 3FN9A 4OYUA 5C7GA 2V4VA 2W95A 4ZXEA 3LPFA 1UY2A 3C8XA 2EIEA 4CU7A 3I3EA 4DUWA 5IYYA 1JZ8A 1WCQA 2VZRA 1OD3A 3WF3A 1D7PM 3GM8A 2KD7A 4JKLA 5LA1A 4QB1A 3ACHA 2Y6GA 2YFUA 2W91A 3NQHA 3JXSA 4CU9A 2YG0A 4W4ZA 4OUEA 4XZUG 4CUAA 4KWUA 2RV9A 2VZQA 3CQOA 2WAAA 4MOAA 2VJXA 2WZ8A 4FI9A 3EB7A 2QQLA 3IDAA 2W87A 3I2GA 2WDBA 4A3ZA 2QQOA 3HPNA 4A44A 2HLEA 2WO2A 4AG4A 2ORZA 2WAOA 5F7UA 3D3AA 2VO5A 4P02B 2DCKA 1GQPA 4TXWA 2ZEZA 1SHWB 4P5YA 3VD3A 3WNKA 3IAQA 4BJ0A 3DYMA 3C7HA 3SKVA 3WSOA 1US2A 1F4AA 1JZ7A 5CZKA 3T0BA 3K75B 5JXIA 1US3A 3VD4A 3WF4A 2W1WA 4A45A 1JZ5A 3DYPA 4XUPA 4LHSA 3ABZA 3ETPA 3WNLA 2Y6LA 1GUIA 2BGPA 2WN2A 2W92A 1JI6A 2DDUA 2J22A 3GDBA 4ARYA 1JYVA 1W8OA 3CZJA 5CYYA 3A22A 5JXHA 4LPLA 1RYYA 3NNGA 3EYPA 1W9SA 4KI5M 4DEVA 1GOGA 4JX0A 1CZVA 2VQUA 1NKGA 3LEKA 1K42A 1ULPA 2HYXA 2Y8KA 5LA2A 1JYXA 4CUBA 4BXSV 3BGAA 4QX0A 2EICA 5LA0A 2W94A 4D0QA 2VMFA 1O8SA 2CDPA 1TVGA 2XQXA 1GOFA 3A21A 3I2JA 3VD5A 2J1VA 1SG3A 2J1TA 2JDAA 4GWJA 1PMHX 3VDCA 4DXSA 3K4ZA 1JZ3A 1KGYA 4BK4A 1JZ4A 2WN3A 3THDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VD9 A;  2J1R A;  5EJZ B;  4ARX A;  1GOH A;  1JYN A;  1CIY A;  3K4A A;  4JKM A;  1UMI A;  3OGV A;  3LE0 A;  3I2F A;  3I3B A;  5B4N A;  4ZZ8 A;  3J7H A;  3SKJ E;  3C7O A;  2W1Q A;  3MUY 1;  2C4X A;  3VDB A;  3WF1 A;  3DEC A;  4M4P A;  3WNM A;  4QB2 A;  2V5D A;  1JHJ A;  3T0A A;  4CU6 A;  3MBW A;  2E26 A;  2WUH A;  4OZO A;  1I5P A;  2E31 A;  2WQ8 A;  2VCA A;  3NJV A;  2W1U A;  2YB7 A;  4GZ9 A;  4ET7 A;  5LCW L;  3FHQ A;  1YQ2 A;  1W99 A;  3MV1 1;  1CZT A;  3MO4 A;  4ZY9 A;  4ZZ5 A;  2QQI A;  2VOT A;  2W3J A;  3OEB A;  1UY1 A;  2X10 A;  3CIH A;  4Z2A A;  1UXZ A;  1J83 A;  4DEQ A;  3VDA A;  4A42 A;  3HOB A;  3ECQ A;  2VR4 A;  2XHN A;  4XUQ A;  4HG6 B;  4DXT A;  2WYS A;  4D8M A;  4CU8 A;  2QQM A;  1L7Q A;  3LEI A;  3WEZ A;  1W9T A;  2VZO A;  4CUC A;  5IHR A;  2BER A;  1XPW A;  3T0D A;  3C7G A;  3IAP A;  4L0P A;  4BDV B;  2YFZ A;  4CVU A;  2EIB A;  3SEE A;  1ULO A;  1GMM A;  1BHG A;  4M4R A;  1OT5 A;  2B9V A;  4P08 A;  3T2P A;  3A23 A;  4QDQ A;  1TG7 A;  4W50 A;  4GWI A;  1JYW A;  2ORX A;  4JHZ A;  1HN1 A;  4E8D A;  3T09 A;  2ZXQ A;  5C70 A;  1CX1 A;  4A6O A;  3OGS A;  3ACG A;  4JKK A;  2Y64 A;  1UYX A;  4UI9 L;  3AC0 A;  3GXU A;  1L7R A;  3NRU A;  4QB6 A;  2L9L A;  1W9W A;  5EJ1 B;  3K46 A;  1P8J A;  3WNN A;  2Y6K A;  2VL4 A;  3UNP A;  1UXX X;  4XUN A;  1DP0 A;  4UOJ A;  2E33 A;  5G05 L;  1GNY A;  3WF2 A;  1PX4 A;  3I2K A;  4KMQ A;  3GGL A;  3FHA A;  4MGS A;  2W9X A;  4P00 B;  5EIY B;  5HXM A;  4MO3 M;  2J1U A;  4W8J A;  2Z4F A;  1NX9 A;  2QQK A;  1UMH A;  2XON A;  3OBA A;  1F4H A;  4OMC A;  2WAB A;  2VMC A;  1O8P A;  3FL7 A;  2VCB A;  1DLC A;  2E32 A;  2BGO A;  2W1S A;  3DYO A;  2XOM A;  4XUO A;  3WQB A;  2YC2 A;  3W5N A;  1NAE A;  3T08 A;  1UY4 A;  2BBA A;  1DYO A;  2V72 A;  1JU4 A;  5IFP A;  5JXG A;  1K3I A;  1W8N A;  4DUV A;  2VZP A;  3F2Z A;  3I3D A;  3ACI A;  3HN3 A;  1GU3 A;  2QBX A;  3C7F A;  3III A;  2R7E B;  1T2X A;  5J1X A;  2OKX A;  2VM9 A;  3CDZ B;  3I97 A;  4MGQ A;  1PMJ X;  3ACF A;  1K45 A;  3ZM8 A;  4AAX A;  1MPX A;  1H6Y A;  2VME A;  2J1E A;  2LS6 A;  1OF4 A;  3K4D A;  4UAP A;  4A4A A;  2Y6H A;  3WF0 A;  3WNP A;  4LQR A;  5G04 L;  4LKS A;  3C7E A;  1NUK A;  3U37 A;  4PQQ A;  4RYD A;  4RN5 A;  4OMD A;  4E8C A;  1XNA A;  4A41 A;  2C9K A;  1UZ0 A;  2DCJ A;  3THC A;  2VZV A;  1EUU A;  2WO1 A;  5JR2 A;  1UYY A;  2VZ1 A;  2Y6J A;  5IFT A;  3BN6 A;  4QX3 A;  1R64 A;  3HNY M;  3LQC A;  2W46 A;  2ZEW A;  1UX7 A;  2J7M A;  3VD7 A;  2C26 A;  2W47 A;  2RVA A;  3OGR A;  2QQJ A;  4XUT A;  4QDS A;  4XVH A;  2BZD A;  3CKH A;  3K77 A;  5IJR A;  2RJ2 A;  2ZEX A;  3HEI A;  4DUX A;  4DXR A;  2QQN A;  3PUI A;  2JD9 A;  1UYZ A;  1J84 A;  3A7Q A;  1KEX A;  2VZ3 A;  3LEG A;  3T2Q A;  2VTF A;  2JKX A;  3I2I A;  2WBK A;  4PT6 A;  1UY3 A;  2YC4 A;  3OEA A;  2ZEY A;  3HJR A;  1UWW A;  2CDO A;  3PUH A;  4PF1 A;  5C71 A;  5DQ0 A;  4IUG A;  2VZT A;  2VMD A;  3W5M A;  2PQS A;  5DMY A;  2J1A A;  5I0D A;  2X05 A;  1JZ6 A;  3P1I A;  3OG2 A;  1UY0 A;  2X09 A;  1K12 A;  2B4K A;  5JMO A;  1JU3 A;  5B4X A;  2VCC A;  2ID4 A;  5HPO A;  5DPN A;  3OB8 A;  5A1A A;  1SDD B;  3LPG A;  3UET A;  2VZU A;  1XC6 A;  1H6X A;  3CZU A;  2JE8 A;  2VZS A;  2J1S A;  1OF3 A;  1OH4 A;  4MAD A;  4YPJ A;  3I2H A;  4XUR A;  1W0N A;  5JUV A;  1EUT A;  3NJX A;  1IQD C;  1WKY A;  1LNS A;  2LW8 A;  3IB3 A;  4QX2 A;  4TTG A;  2VC9 A;  5FUI A;  3HNM A;  1PX3 A;  3E1F 1;  4QAW A;  3T2O A;  3MUZ 1;  2W5F A;  3CMG A;  2VQT A;  4QDR A;  3WNO A;  5JXJ A;  1JZ2 A;  3MV0 1;  2WZE A;  2EID A;  1CZS A;  3HNB M;  4QX1 A;  4BK5 A;  3UES A;  3P6B A;  1XNT A;  5DN2 A;  4QPW A;  2WO3 A;  1O59 A;  3SEP A;  3FN9 A;  4OYU A;  5C7G A;  2V4V A;  2W95 A;  4ZXE A;  3LPF A;  1UY2 A;  3C8X A;  2EIE A;  4CU7 A;  3I3E A;  4DUW A;  5IYY A;  1JZ8 A;  1WCQ A;  2VZR A;  1OD3 A;  3WF3 A;  1D7P M;  3GM8 A;  2KD7 A;  4JKL A;  5LA1 A;  4QB1 A;  3ACH A;  2Y6G A;  2YFU A;  2W91 A;  3NQH A;  3JXS A;  4CU9 A;  2YG0 A;  4W4Z A;  4OUE A;  4XZU G;  4CUA A;  4KWU A;  2RV9 A;  2VZQ A;  3CQO A;  2WAA A;  4MOA A;  2VJX A;  2WZ8 A;  4FI9 A;  3EB7 A;  2QQL A;  3IDA A;  2W87 A;  3I2G A;  2WDB A;  4A3Z A;  2QQO A;  3HPN A;  4A44 A;  2HLE A;  2WO2 A;  4AG4 A;  2ORZ A;  2WAO A;  5F7U A;  3D3A A;  2VO5 A;  4P02 B;  2DCK A;  1GQP A;  4TXW A;  2ZEZ A;  1SHW B;  4P5Y A;  3VD3 A;  3WNK A;  3IAQ A;  4BJ0 A;  3DYM A;  3C7H A;  3SKV A;  3WSO A;  1US2 A;  1F4A A;  1JZ7 A;  5CZK A;  3T0B A;  3K75 B;  5JXI A;  1US3 A;  3VD4 A;  3WF4 A;  2W1W A;  4A45 A;  1JZ5 A;  3DYP A;  4XUP A;  4LHS A;  3ABZ A;  3ETP A;  3WNL A;  2Y6L A;  1GUI A;  2BGP A;  2WN2 A;  2W92 A;  1JI6 A;  2DDU A;  2J22 A;  3GDB A;  4ARY A;  1JYV A;  1W8O A;  3CZJ A;  5CYY A;  3A22 A;  5JXH A;  4LPL A;  1RYY A;  3NNG A;  3EYP A;  1W9S A;  4KI5 M;  4DEV A;  1GOG A;  4JX0 A;  1CZV A;  2VQU A;  1NKG A;  3LEK A;  1K42 A;  1ULP A;  2HYX A;  2Y8K A;  5LA2 A;  1JYX A;  4CUB A;  4BXS V;  3BGA A;  4QX0 A;  2EIC A;  5LA0 A;  2W94 A;  4D0Q A;  2VMF A;  1O8S A;  2CDP A;  1TVG A;  2XQX A;  1GOF A;  3A21 A;  3I2J A;  3VD5 A;  2J1V A;  1SG3 A;  2J1T A;  2JDA A;  4GWJ A;  1PMH X;  3VDC A;  4DXS A;  3K4Z A;  1JZ3 A;  1KGY A;  4BK4 A;  1JZ4 A;  2WN3 A;  3THD A; 
#chains in the Genus database with same CATH topology
 3VD9 A;  3D5O A;  2J1R A;  1J1L A;  1V6I A;  4Q4Y 1;  1EAH 3;  1JYN A;  5A6Y A;  1VBB 3;  1CIY A;  3GZE A;  1PZ7 A;  2QTW B;  3OGV A;  2RS5 1;  3LE0 A;  3OGG A;  3I2F A;  3I3B A;  4RS5 B;  3AZY A;  4AVC A;  1WLD A;  4QPI A;  3J7H A;  1OQE A;  5FY4 A;  2WNV B;  1PIV 1;  3MW3 A;  4COV A;  3MUY 1;  3VHP A;  1RUD 3;  5FJH A;  4GB3 3;  4JQT A;  1RL3 A;  2QNK A;  4YZ2 A;  3S57 A;  1H2N A;  1AXZ A;  1LOD A;  1SQ4 A;  3RSJ A;  3DEC A;  1RUI 2;  1VBE 2;  4Q4W 2;  3WNM A;  1UOF A;  1VJ2 A;  1TQ5 A;  2EF6 A;  2GN3 A;  4NPR A;  4LA3 A;  2PHL A;  4RQP C;  4Y5S A;  3IPV A;  3MBW A;  3T0A A;  5BNO B;  1I6X A;  3GHN A;  5EJ3 A;  1H9W A;  4LIT A;  2WUH A;  3WDY A;  2PQQ A;  2OZ6 A;  2AEN A;  4YGC A;  4C0B A;  2P4E A;  1H1I A;  1I5P A;  3U11 A;  2PHR A;  2H6B A;  2WSV A;  5FZH A;  4AL9 A;  1L3J A;  3U78 A;  2ZX1 A;  5BNN B;  5CFC B;  1MS8 A;  1U5I A;  3AMH A;  5BYN A;  1YQ2 A;  3O1U A;  4RQP B;  4ZY9 A;  1GIC A;  4IER A;  3LB9 A;  1H8V A;  2UU8 A;  4R9C A;  2VOT A;  4BQ1 A;  4CEY A;  4K3U A;  3K51 A;  2KM2 A;  4AR2 A;  1NA1 B;  4Q4W 1;  5JSO A;  5H9R A;  1RB8 G;  2EAK A;  5FOJ B;  1J83 A;  1DQ1 A;  2Z79 A;  4A42 A;  2EXK A;  5GZG A;  3FZ3 A;  4QXK A;  3NNM A;  5BXX A;  1TNF A;  4BIS A;  4DXT A;  1S0E A;  2PAM A;  2WYS A;  2IUW A;  4CU8 A;  3VHR A;  4COY A;  4QU2 A;  2A70 A;  5JIA A;  2CL2 A;  1NCQ C;  4ZS2 A;  4AVV A;  3WOG A;  4GKY A;  5FUP A;  3IDB B;  2BER A;  1D0G A;  1XPW A;  3I4I A;  3ZMN A;  5E16 A;  4B7E A;  1OA2 A;  1NT0 A;  1NCR C;  1KDK A;  4L0P A;  4XJA A;  5CFD A;  2YFZ A;  2ZML A;  2EIB A;  2O1Q A;  4AED B;  3H8X A;  1DZQ A;  5AVP A;  4LLF A;  2XBO 2;  1G9B A;  3UYJ A;  3B5L B;  1DCS A;  1TEI A;  1RUD 1;  1MQT A;  5FY7 A;  1O4T A;  5FZC A;  2B9V A;  2K0G A;  1KS4 A;  3LWC A;  4BQW A;  3A23 A;  2JDZ A;  5CAZ A;  1XNB A;  4XQW A;  2X29 A;  4LMF A;  1DGW A;  2BOJ A;  3JD7 1;  5C6C A;  1VE0 A;  1AXY A;  4E8D A;  3E5Q A;  3T09 A;  1O3Q A;  3OPT A;  4A6O A;  4I09 A;  5ABJ B;  4Y1X A;  3OGS A;  1G8W A;  5A6X A;  3UGH A;  4IEU A;  2VH9 A;  4GJZ A;  5FZI A;  4MXW A;  2BJS A;  4NHM A;  3WDV A;  2VVF A;  2DVD A;  1FAT A;  3AC0 A;  3GXU A;  1NZI A;  1SFP A;  2WA4 A;  3GZT B;  3NRU A;  4QB6 A;  1QJU 1;  5M0T A;  4Y1U A;  1H1A A;  3K46 A;  4N53 C;  1OUX A;  3TN9 1;  4F3J A;  1P8J A;  2RS1 3;  3FBY A;  4CEY C;  1OH3 A;  2VL4 A;  3B9I A;  1B35 A;  4BE3 A;  3TEW A;  1DZT A;  1R1Z A;  4NE9 A;  1JYX A;  1CVN A;  5FY8 A;  1DP0 A;  3THP A;  2YHJ A;  1Y43 B;  1KDM A;  1OKO A;  1ZBE 3;  2UYB A;  4BH9 A;  2CGN A;  1NQJ A;  1RMU 2;  1RUF 1;  2CTV A;  2X5I A;  3I2K A;  3POE A;  4XFI A;  4KWJ A;  5FZ9 A;  4CXW A;  2JEC A;  2W9X A;  4JGZ A;  1JXN A;  1MS1 A;  4Q0V A;  3SQO A;  4YYO A;  4QPG C;  2QDN A;  3ZXD A;  2YU1 A;  1GWL A;  4HPK A;  4CP9 A;  1NX9 A;  2O0O A;  4NUB A;  3UGF A;  1YIF A;  3HQU A;  4WM7 A;  4ASL A;  2YC0 A;  4GB3 1;  1RTV A;  4PDW A;  1GP4 A;  2VW1 A;  1XNK A;  1UZW A;  3NJY A;  4DY5 A;  3OBA A;  4D6R A;  1B35 C;  1HRI 3;  2B39 A;  3O5S A;  4OMC A;  1IZ3 A;  4BQ4 A;  2CWS A;  1O8P A;  2VQ0 A;  1UZZ A;  2QDR A;  4YW1 A;  1R1A 2;  2VCB A;  4IND A;  1DLC A;  2BVB A;  2R1B A;  3ZYP A;  5A7W B;  3V0B B;  3VZK A;  1DIW A;  3AM2 A;  4Q4V 2;  1OMI A;  2Y38 A;  4MET A;  1UU6 A;  4N9I A;  1Q8Q A;  4OHW A;  5IVY A;  2XOM A;  4HL0 A;  4ZHN A;  3N7J A;  3VDD B;  1APN A;  4QPG A;  1GZC A;  2Q1Z B;  4V2W A;  5FK7 A;  3ZVX A;  3KV5 A;  4BYY A;  4ISQ A;  2BWA A;  4OI0 A;  2VBB A;  1UL9 A;  2RS3 3;  4N7U A;  4FVV A;  2Q1F A;  2RM2 3;  5IVV A;  5IFP A;  2WZP P;  1NXD 1;  2VW0 A;  2GMP A;  3VKO A;  5JXG A;  1ZRD A;  1S2K A;  3RI9 A;  4F83 A;  1JHN A;  2VZP A;  3I3D A;  2RJK A;  3MGU A;  1TME 3;  3TEX A;  4CDX A;  2QBX A;  4TYS A;  4OFG A;  2VW2 A;  4PIX A;  1OQ1 A;  3O1T A;  1WLC A;  3WDW A;  1C57 A;  4UF0 A;  4AXO A;  2ADD A;  4ZS3 A;  2OKX A;  4DNY A;  3WX5 A;  4OQ8 A;  5J36 A;  4CEW B;  2VD7 A;  3ACF A;  4CCC A;  2HWF 2;  5JOW A;  5A3O A;  1JUH A;  2D6M A;  2Q5T A;  1MPX A;  4X8N A;  1RUF 3;  4BME A;  2LS6 A;  1WW4 A;  2BNO A;  1OPO A;  2HBT A;  3KSC A;  4M3C A;  3IKW A;  4MGK E;  4O9G A;  1RHI 1;  4AHW A;  3VUO A;  3M1H A;  1PO1 3;  1POV 1;  3ELN A;  5FV3 A;  5G04 L;  2D6P A;  5KC6 A;  2GDF A;  4ZON A;  4N7I A;  3WCR A;  5A3N A;  4PQQ A;  4RN5 A;  1X8M A;  1MS9 A;  3SCG A;  3NV4 A;  3FFQ A;  3MHZ A;  4URA A;  1XNA A;  3LDK A;  3THT A;  1IPJ A;  4NID A;  4LOR A;  1BCX A;  1UZ0 A;  3THC A;  1EUU A;  1PGL 2;  2BDR A;  3ACL A;  3POG A;  1VB4 A;  5JR2 A;  4JQR A;  3GJB A;  1GFF 2;  4LOT A;  2Y6J A;  3ZDV A;  4AED A;  2P37 A;  2RS3 1;  4OUL A;  2AC1 A;  3RYP A;  1POQ A;  5F39 A;  3ZSE A;  4YZ5 A;  5IT6 A;  3HNY M;  3LQC A;  4EN0 A;  4A2U A;  2CY6 A;  4GIQ A;  1JYC A;  1REE A;  2J7M A;  3SIT A;  1DBN A;  4P9J A;  5ERL A;  1AL2 1;  1ZRE A;  3KV9 A;  2ZTN A;  1YCI A;  1NLS A;  4KWL A;  1W28 A;  5FBJ A;  4XVH A;  3RVH A;  4Y22 A;  2D98 A;  4Y26 A;  4FAG A;  2DV9 A;  1V9U 3;  1ODN A;  1FOD 2;  5FQ0 A;  4Y4R A;  5T5P A;  3USS A;  2ZEX A;  1U5Z A;  4EYU A;  2FCT A;  1XE7 A;  2JD9 A;  4V1P A;  1JOB A;  3RZZ A;  4AQT A;  4P9X A;  1EAH 1;  4B1M A;  1X82 A;  1UAI A;  1OA4 A;  2E63 A;  2OZJ A;  3KS7 A;  2XML A;  2VOK A;  4ONU A;  3LEG A;  4LUL A;  1MZF A;  2P3I A;  2WFF 3;  1FPN 3;  1UKR A;  5FZ7 A;  2X8K A;  4XIO A;  1UY3 A;  1V9U 1;  5DZG A;  5C4W A;  2ZEY A;  4WV8 A;  3R6S A;  3VBS B;  1UWW A;  3NL1 A;  1YI9 A;  3VHN A;  1PO1 1;  4PF1 A;  5DQ0 A;  4IUG A;  3VKN A;  4LBM A;  3N4M A;  3ZXG A;  4FPE A;  5L9R A;  3W5M A;  1GP6 A;  2VMD A;  5DMY A;  1VAK A;  3IM0 A;  3P1I A;  2B4K A;  1V6K A;  5GLT A;  2VCC A;  3U0Z A;  2FQP A;  1QY4 A;  3HT2 A;  4KG0 A;  2WFF 1;  2VY0 A;  2IWG B;  3B3Q E;  3OB8 A;  4MH0 E;  3OUH A;  3RWK X;  1SDD B;  2XGX A;  4KWK A;  2BYV E;  4UFM A;  3LPG A;  1DFQ A;  1LHO A;  3KF3 A;  1G6N A;  1ULD A;  3O14 A;  5DUX A;  2VZU A;  2ZMK A;  4KL1 A;  5A7S A;  1GNH A;  5F2W A;  2P3Y A;  2JE8 A;  2PFW A;  4LHL A;  1VAL A;  3VBS C;  2P6C A;  4N43 C;  1CAX A;  3SIS A;  5GAL A;  4FFI A;  5T3N A;  3WDU A;  5JSR A;  1C4R A;  4S2D A;  1SBE A;  4XTM A;  3FLT A;  3ZXK A;  4XBL A;  3AVR A;  1QH7 A;  3ZX7 A;  1CPN A;  4OLL A;  1W0N A;  3PU3 A;  4GH4 C;  4OHV A;  3K3N A;  5JUV A;  4RHV 2;  1V00 A;  5FPV A;  2Y60 A;  5CB7 A;  3ZN6 A;  4CE8 A;  3NAP B;  2MHF A;  1IQD C;  1WKY A;  2QJV A;  4COZ A;  1MVE A;  5LWB A;  2KR2 A;  4QD2 A;  1RUD 2;  3OBT A;  4QX2 A;  4YM2 A;  1SLC A;  1YQ5 A;  5FYC A;  1IS6 A;  5C3O A;  4EZH A;  2DUP A;  3T2O A;  2GH8 A;  4UXA A;  4K21 A;  3AKP A;  2VPV A;  1SBD A;  1SFY A;  2YXS A;  4COW A;  5K0U B;  5LY2 A;  1QJX 2;  4LKF A;  4XIK A;  1C8M 3;  2EID A;  3BYW A;  5FZL A;  3HNB M;  2JX9 A;  3OYW B;  4QX1 A;  1ZRI A;  5FYB A;  2MNG A;  5A32 B;  5FZ3 A;  3ZFG A;  2B42 B;  4XF4 A;  2GSY A;  1FV3 A;  1ZNP A;  3IWZ A;  1XNT A;  3ITQ A;  4IEQ A;  1ULE A;  5K7P A;  3NO8 A;  4JZR A;  4SBV A;  4LBJ A;  4CCD A;  2FDI A;  3LIH A;  2WO3 A;  3MIB A;  4FQ4 A;  5IW0 A;  3WR0 A;  4FT8 A;  3FN9 A;  4FTE A;  1W2A X;  1ZM1 A;  4OYU A;  2A7A A;  2XL7 A;  3MEP A;  4TLF A;  1TZO A;  5A7P A;  2GNM A;  2W95 A;  4ZXE A;  3ZSK A;  2VE1 A;  5JWP A;  5F5I A;  2HWC 3;  3KT1 A;  4AQS A;  4Q4Y 2;  5A70 A;  2A73 B;  4GUL A;  4MXV A;  4AI2 A;  4CEW A;  3VBF C;  3I3E A;  4FPH A;  2WS9 3;  2YV8 A;  3DKW A;  4A7K A;  4DUW A;  1DHK B;  2Q30 A;  4JGY A;  5FY9 A;  1JZ8 A;  1WCQ A;  1X33 A;  2AH2 A;  3WF3 A;  3OBZ A;  2VU9 A;  4IET A;  1UPI A;  3POW A;  4YFW A;  5FRE A;  4P9W A;  1W6N A;  3B01 A;  3CJI B;  4GA9 A;  2N7G A;  2BUK A;  1ASJ 1;  4XZU G;  2OPK A;  1GKB A;  2VTX A;  2A5Z A;  1WGP A;  2Z69 A;  5IWF A;  1E5H A;  1FXZ A;  4CA9 A;  3ZFF B;  4MGZ E;  1OUR A;  4DRV A;  1A78 A;  3O1S A;  4FI9 A;  1S2E A;  2GME A;  1MS4 A;  1RUH 3;  5FY1 A;  3I2G A;  4K9S A;  4XOG A;  3VHO A;  4CXX A;  1QF3 A;  2XL9 A;  4A3Z A;  5EPA A;  2WNE A;  3W21 A;  3B94 A;  3F95 A;  2QUO A;  2JDH A;  3TYJ A;  1H2L A;  3RYK A;  4YLZ A;  1F15 A;  2HLE A;  1C3H A;  1CAV A;  4YW4 A;  4EV0 A;  2CAU A;  3BOW A;  4AG4 A;  2WSU A;  3BTZ A;  4CDU B;  3TEY A;  5GM0 A;  3WUC A;  1Q8O A;  3B7M A;  4P02 B;  2DCK A;  1GQP A;  4BHP A;  4TZD A;  5CKQ A;  2ZEZ A;  2PMW B;  1D2S A;  2P3J A;  4XF1 A;  4B4Q A;  5JZG B;  1D4M 2;  1VR3 A;  4XFC A;  3VD3 A;  3WNK A;  1XQN A;  3ZXF A;  3CBN A;  4Q8L A;  2D6L X;  5C9A B;  5A7Q A;  1W39 A;  5E6H A;  1C1F A;  1US2 A;  1MQT C;  1OI6 A;  4AHY A;  2OVU A;  2YRO A;  1JZ3 A;  2P2K A;  1JZ7 A;  2YY1 A;  4JGY C;  2PHW A;  4Y33 A;  5CZK A;  2HWE 1;  2IC1 A;  1ZZC A;  2JDY A;  3AZW A;  4Q4V 3;  3K75 B;  1Y4W A;  4YG3 A;  2ZGN A;  1R09 1;  2IFW A;  2PAK A;  3WF4 A;  3AYA A;  2RS5 3;  3WW3 A;  5FXZ A;  5JPM B;  4GJY A;  1C8N A;  4O7X A;  3ZOI A;  4M3C E;  4LHN A;  3ABZ A;  5BPX A;  5JZG C;  1UKG A;  1PVX A;  4AOC A;  3LSE A;  5FMO L;  4AVT A;  3GDB A;  2OT7 A;  4MZU A;  3ZFF C;  4EWD A;  1ASJ 3;  4NHY A;  3GCW A;  4N8M A;  3ZMO A;  4BMB A;  4NPM A;  4LPL A;  4HSL A;  1FT9 A;  4W6W A;  3NNG A;  1ZZ9 A;  4YNI A;  5FZ0 A;  5F3G A;  1Q8S A;  2PYT A;  5IUQ A;  3CHX A;  2XVG A;  1CZV A;  4NWW A;  3WP6 A;  1W2N A;  2TNF A;  4Q29 A;  1PK6 B;  5F1R A;  3POF A;  3RZG A;  4YVS C;  1UU5 A;  5LA2 A;  1CAW A;  1N3Q A;  2VMH A;  3T3Y A;  3PVN A;  2WQ4 A;  4GMP 1;  2W94 A;  3FBM A;  4NR1 A;  2WR9 A;  3ZKU A;  2QKD A;  3N35 A;  1RUI 1;  1VBE 1;  3PUS A;  4RR3 C;  3VKM A;  1GWM A;  4FPY A;  1HDK A;  1DGR N;  4WVZ A;  1VBB 2;  1LHN A;  1AYM 2;  2ZX2 A;  2ILM A;  5FPU A;  2FDH A;  3A21 A;  4YVS B;  1IOA A;  2VOW A;  2Y6F A;  2D40 A;  4LO8 A;  4AVA A;  2ATF A;  4QKD A;  1QDC A;  4QXB A;  2HWB 1;  3KGZ A;  1XU2 A;  3MIE A;  3K4Z A;  3N9P A;  4QX5 A;  1X8E A;  1QQP 2;  3NJZ A;  2JG8 B;  4I0B A;  2WN3 A;  4JRA A;  5GLW A;  3IN9 A;  4Q4W 3;  4BK4 A;  1RHI 2;  5HV0 A;  3ZIX A;  4DO0 A;  1LCL A;  1O91 A;  2A6Z A;  2DU0 A;  2VVD A;  3PTY A;  4Q4X 3;  1WBF A;  5EJZ B;  4BB3 A;  5FRA A;  4R9D A;  1J3Q A;  2RE9 A;  1UMI A;  3HIF A;  4I02 A;  4BQX A;  2Q8E A;  1W3V A;  3TWI A;  2FMY A;  2NYY A;  1EPZ A;  2VAU A;  2ZGL A;  4XDQ A;  3I54 A;  2OS2 A;  3NMB A;  4NPL A;  4HMZ A;  4M0N A;  2ADE A;  5BV6 A;  4M01 A;  3C7O A;  3INA A;  2W1Q A;  1JYT A;  3M4F A;  4FO9 A;  2MPF A;  2BFU S;  4H2A A;  1ZZB A;  3RS6 A;  1LEC A;  4P9Y A;  3SLI A;  3V0A A;  3LA7 A;  4AQ2 A;  2HH9 A;  5K0U A;  2Y0I A;  1V6J A;  4CU6 A;  2H0V A;  3R0R A;  3H9A A;  4COU A;  2C9A A;  4BQ2 A;  3ZYR A;  5FZ6 A;  2VBP A;  1ZRC A;  4GD4 A;  4RA0 A;  4FSJ A;  1R09 2;  2D3S A;  1PVC 3;  3FX3 A;  3H3Z A;  3NJV A;  4JGZ B;  4NAO A;  1YFY A;  1QMJ A;  2YB7 A;  3NST A;  4Q1P A;  4HN0 A;  4HXC A;  4CPB A;  4GZ9 A;  4QQL A;  4AGR A;  1OKQ A;  3MV1 1;  5FIX A;  1Q43 A;  2X5I B;  4JGZ C;  3ZN6 B;  2GNT A;  3O7O A;  4ZZ5 A;  5GZD A;  4XFB A;  1WME A;  2QQI A;  2B45 X;  1CAU B;  4BOW A;  2ZX4 A;  5FP9 A;  4NIA A;  3AYD A;  2W68 A;  3U1X A;  3OEB A;  5FBZ A;  1OOP C;  1Z7S 1;  2B7Y A;  4R52 A;  4GH4 A;  4Z2A A;  1B35 B;  1HQW A;  1WCS A;  4MUV A;  4Y3O A;  3PIG A;  5A33 B;  3OSD A;  1UPS A;  3PUA A;  4YGE A;  5T52 A;  3HOB A;  2XHN A;  4XUQ A;  2VNO A;  3W58 A;  4IV3 B;  2WZR 3;  2HEV F;  3WCS A;  4XCA A;  1EYB A;  3HVD A;  4IEZ A;  1YQ8 A;  2RM2 1;  3MIC A;  4CUC A;  1W9T A;  5FY5 A;  3V64 A;  1E5S A;  4E4S A;  1AR8 1;  3PTR B;  3UV9 A;  2BEO A;  5IHR A;  4PIZ A;  5A3U A;  3LFI A;  4O9E A;  3T0D A;  3TNP B;  4QHO A;  4NRM A;  1AJK A;  1MS0 A;  3QH7 A;  4L92 A;  5FWJ A;  1LJ7 A;  4UBG A;  4DIN B;  3N9N A;  4GXL A;  1ULO A;  1GMM A;  1UYP A;  5F3C A;  2RS1 2;  5FXV A;  1W90 A;  2D6N A;  2SLI A;  4RHV 3;  4QDQ A;  2IFR A;  4IE0 A;  1AJO A;  1PVC 1;  2WIN B;  1JS9 A;  1ZBE 2;  1VBC 1;  5EYY A;  5LZ6 A;  1HN1 A;  3ZPY A;  1CX1 A;  3LIG A;  1GZT A;  1RMU 3;  2G4I A;  5ACA 1;  2XJS A;  1WMF A;  1PO2 2;  1POV 3;  3ACG A;  3GF6 A;  1GWK A;  1G7Y A;  1XB9 A;  3WP4 A;  4UI9 L;  5FPX A;  3I3M A;  5F9T A;  2KXL A;  1RJ8 A;  2L9L A;  1W9W A;  5I8T A;  5EJ1 B;  3JBG 1;  1FYU A;  2WWS A;  5FYU A;  1VPH A;  3WNN A;  1W6P B;  3AMP A;  2Y6K A;  2XBO 1;  3UNP A;  1UXX X;  3BTA A;  4ATE A;  4F8A A;  4M3C B;  4FPF A;  5A1F A;  3DF0 A;  4XUN A;  5LA9 A;  4L99 A;  2VOX A;  2AZ5 A;  2RMU 2;  3LOI A;  2DVF A;  3LEM A;  5K4L A;  1U0A A;  2G9F A;  3B00 A;  4DB5 A;  1H0B A;  1BEV 1;  3AXE A;  1DZR A;  4ORF A;  1F31 A;  1WW7 A;  4NOT A;  2I07 B;  3AZV A;  4Z07 A;  1QJX 3;  3TN9 3;  5EIY B;  1AYM 1;  1OBN A;  4XBQ A;  2SBA A;  2VTX J;  4QQ2 A;  4AEM A;  5BNP C;  4MO3 M;  5KHI A;  1YYN A;  5LAT A;  3VKL A;  5LK5 A;  3AJY A;  3OPW A;  5A6Q A;  3UJQ A;  2J1U A;  4LUK A;  4N43 A;  4W8J A;  1LU1 A;  2MEV 1;  3VZN A;  2QQK A;  4C0H A;  4MHR A;  1UMH A;  5IK8 A;  1S0D A;  3H3U A;  2RR1 3;  4DY3 A;  3EMR A;  1T6G C;  3GZA A;  4WVW A;  2J42 A;  5FOB B;  1F4H A;  1F5F A;  2A75 A;  5FK8 A;  5F6L B;  4LBQ D;  3N7K A;  3ZFG C;  2WAB A;  1UQX A;  2WNU B;  4PDW C;  3ZYH A;  2EIG A;  1MEC 1;  4R9A A;  2R06 2;  4LUM A;  4D7S A;  5J09 A;  3VBH B;  4A7Y A;  2GC3 A;  2E32 A;  3PJY A;  4XF9 A;  3AJZ A;  4AQ6 A;  2W1S A;  4IE7 A;  2FDF A;  1GR3 A;  2GP3 A;  4C91 A;  3GHM A;  5C9A A;  4R4Z A;  3JBG 3;  5KHH A;  3WQB A;  3W5N A;  1OFS A;  4XAC A;  2YU2 A;  3OYW A;  4XF3 A;  3ZFG B;  1UY4 A;  2BBA A;  2FDJ A;  1DYO A;  5EP9 A;  3B02 A;  3KD4 A;  1CJP A;  5ANN A;  1RUH 2;  3VBF B;  2XLG A;  1PO1 2;  3Q9O A;  4Q0U A;  3VZL A;  4CP9 B;  5AFE A;  4DUV A;  4YZ4 A;  4IXL A;  4XHX A;  3F2Z A;  3FFZ A;  4OI2 A;  4R4X A;  4LIV A;  4UFJ A;  4D3W A;  1QXP A;  2NP0 A;  1XJA A;  1NXM A;  3III A;  2Q8O A;  4A6S A;  4ZU5 A;  3PHM A;  1WCK A;  2DCT A;  1QJX 1;  4B8E A;  5JOX A;  3I97 A;  4AVS A;  1PMJ X;  3QH6 A;  3QD6 A;  1ULG A;  4CYD A;  5GZE A;  1COV 2;  4AAX A;  4AI0 A;  1D4M 3;  2ZKN A;  5FMD A;  4CDW C;  1H6Y A;  1XU1 A;  2J1E A;  3L2H A;  3ZN5 A;  2VMG A;  2WRA A;  3Q8E A;  4EN8 B;  1RUE 3;  3AYE A;  1W6P A;  2PHX A;  3CLP A;  3JD7 2;  5TSW A;  2QCS B;  4XFF A;  2VQA A;  4A4A A;  5J48 A;  4J25 A;  5BY5 A;  3I2O A;  3IIA A;  2Q4S A;  3WQ7 A;  1ND2 A;  2DUO A;  3D82 A;  3C7E A;  3U37 A;  3X29 B;  2UWB A;  3RZM A;  1LEN A;  3OOX A;  5FPB A;  4WM8 A;  4OMD A;  4CDU A;  4E8C A;  1C28 A;  2WNO A;  2ZGK A;  4A41 A;  2QQP A;  1KIT A;  3O12 A;  1D4M 1;  2VNV A;  3SH3 A;  2A6V A;  4L9B A;  2DCJ A;  2VZV A;  3PUR A;  5FKC A;  4XJW A;  4K1Y A;  4IEY A;  4PHZ A;  5FZM A;  2UWA A;  2VXR A;  2GU9 A;  4CDW A;  1LES A;  1MQT B;  3BN6 A;  1YWK A;  4XBN A;  2ZJC A;  1LOB A;  1QKQ A;  5FP8 A;  1UX7 A;  4WBB A;  1RIR A;  1FPN 2;  5CFD B;  3V65 A;  5HXV A;  2XR4 A;  4XUT A;  1LOG A;  5F3E A;  4JCK A;  4E4H A;  3RZH A;  2VUL A;  3L2Y A;  3ZXJ A;  1ZRF A;  3J4U H;  2JEN A;  1GQG A;  3CKH A;  3I2D A;  4HON A;  1QHD A;  5IJR A;  1WD4 A;  3EXU A;  1QOO A;  2VMI A;  2AGS A;  5KWR A;  4LHK A;  2WNU C;  1RUE 1;  1YRZ A;  1SBF A;  1UYZ A;  1S0F A;  3MIF A;  4MXW B;  5D2A A;  3S7I A;  3I49 A;  1ND3 C;  3A7Q A;  2I2S A;  4LE4 A;  2AYH A;  2RDS A;  3T4H B;  1MZE A;  1VRH 1;  1KEX A;  3HR9 A;  4RR3 A;  5EXO A;  4AED C;  3T2Q A;  3UT0 A;  1BBT 1;  2VTF A;  2WII B;  4Y22 B;  1S55 A;  1LOE A;  1ENS A;  2D5F A;  4IEO A;  4LBQ A;  3AL5 A;  4EQV A;  2E7Q A;  1HB3 A;  4KG8 A;  2HKX A;  2ZX3 A;  4K1Z A;  4CCE A;  4HVQ A;  4AYU A;  2BRT A;  2F4P A;  3T4V A;  2C5D A;  4ZPI A;  4RSU A;  3PMS A;  3RWN A;  5FYM A;  2VZT A;  2JDP A;  2DWR A;  5I0D A;  3PVB B;  2V5Y A;  3OG2 A;  3E5X A;  4XXP A;  1WMX A;  2JDU A;  5F2S A;  5L73 A;  2QQU A;  2ID4 A;  5T5O A;  3H8R A;  1AYN 2;  1BBT 3;  3M70 A;  1O3R A;  4CCO A;  1WA4 A;  1GBG A;  2R04 1;  3CL1 A;  2FBE A;  4YGB A;  2ARC A;  3J8F 2;  2XJQ A;  2HEY F;  3P5B A;  5FP3 A;  4N53 A;  4FFG A;  4DOU A;  4QKB A;  3CZU A;  2JG9 B;  1SLT A;  2J1S A;  1LHW A;  3PNA A;  1AR7 2;  4LKD A;  4X8P A;  5C33 A;  5IK7 A;  3ZDS A;  4QPI B;  2HEW F;  2EXI A;  5GLV A;  1HB4 A;  4AFM A;  1RUC 1;  3ZIW A;  2JB4 A;  4XUR A;  3ZR6 A;  2WO7 A;  2R06 1;  3H1Y A;  4L8Q A;  1AR6 3;  3LKJ A;  5C3S A;  3MW2 A;  4QU1 A;  4L2N A;  4QKN A;  3MW4 A;  4YVW C;  4XJU A;  5LW9 A;  1OXC A;  2LW8 A;  3IB3 A;  5FPA A;  4ZXK A;  5I91 A;  1LOF C;  1Q8P A;  1XXN A;  3AFG A;  4C90 A;  2VC9 A;  5FUI A;  2JG8 C;  1V6O A;  3C2U A;  2CGO A;  4TN7 A;  2HWD 2;  3ZSM A;  4BU2 A;  3MUZ 1;  4PIY A;  4FP3 A;  2VQT A;  5KXD A;  3L9J T;  1GZW B;  3WNO A;  3ZO0 B;  5JXJ A;  4NIG A;  2BNN A;  5T5J A;  3S30 A;  2IZW A;  4NJ4 A;  1NCQ A;  3I8T A;  4P9G A;  4Q4Y 3;  5A3M A;  3H3L A;  4OZX A;  5L9B A;  1VBB 1;  1R09 3;  4MG2 A;  2DVA A;  1W9F A;  2ET7 A;  4YW5 A;  4BK5 A;  3TB0 A;  3AZZ A;  3BAL A;  5LB6 A;  3U4S A;  2GC2 A;  1GV9 A;  1UNB A;  5FYI A;  1OLM A;  1OLM E;  2W0X A;  1S0J A;  1MS3 A;  1ZA7 A;  2DYC A;  1O59 A;  2WA3 A;  3CU7 A;  5CKM A;  2XPJ A;  3K2O A;  3K48 A;  4GWN A;  3RJR A;  1JTZ X;  1JMU B;  1PHM A;  1VMJ A;  4FOY A;  1AXK A;  4H3W A;  3ZXA C;  4OUS A;  3LA2 A;  2F4L A;  3R4S A;  1XSR A;  4FXG B;  2VNR A;  3C8X A;  3VKF C;  1RXG A;  1NCR A;  2ENR A;  4CU7 A;  2WZR 2;  3KT7 A;  5IVF A;  5FYZ A;  2Y33 A;  4CCM A;  1CD3 G;  3R4D B;  5IYY A;  3S6P A;  1FNZ A;  1OD3 A;  1OLQ A;  3WY6 A;  1D7P M;  4BIF A;  3GM8 A;  1WW6 A;  1ZBE 1;  5LA1 A;  4AWD A;  1YQC A;  3PDQ A;  1J59 A;  1PO2 3;  1V70 A;  4QXH A;  5DDJ 2;  3BPZ A;  4Q4V 1;  3NQH A;  3JXS A;  4XIL A;  1A3K A;  2YG0 A;  4CU9 A;  4LE3 A;  4FPL A;  4LNV A;  2PLV 3;  4FCA A;  1HW5 A;  1LU2 A;  2R6Q A;  4Y24 A;  5APA A;  1OOP A;  4S2F A;  2VZQ A;  3KB5 A;  2VJX A;  2RDR A;  2WZ8 A;  3EB7 A;  1AVB A;  2QQL A;  4HN1 A;  3ZYI B;  5GZC A;  3SMH A;  3ZKY A;  1PK6 A;  1SLI A;  2PEL A;  5FZF A;  1DYP A;  2QQO A;  1HXS 2;  1YFX A;  3GBF A;  4Q0S A;  1VBD 3;  4CCN A;  1DU3 D;  3ZXE A;  3ST7 A;  4QHB A;  1VP6 A;  4JTO A;  4XFH A;  5FKB A;  3FHI B;  1NG0 A;  1BK1 A;  3WW1 A;  2DTY A;  4DXZ A;  5ANQ A;  4B3N A;  3HT1 A;  2BWC A;  1HV0 A;  2LRO A;  4KU8 A;  3LOB A;  3D3A A;  3OUJ A;  1PIV 3;  4B7K A;  3LGR A;  5EHD A;  4KU7 A;  5BUV A;  3HBK A;  3POB A;  4AFB A;  3IAQ A;  3MFA A;  1AF9 A;  2RMU 1;  3BTY A;  1GNZ A;  2CSG A;  4BCU A;  2HWB 3;  1QOS A;  4JDM A;  3WVJ A;  1HV1 A;  3RJ2 X;  3WP5 A;  4EWE A;  5C8C C;  5L19 A;  3J7M A;  1GAN A;  2CU5 A;  4LK6 A;  5DZE A;  4YAR A;  1J3P A;  2DCY A;  3I59 B;  5J7M A;  4Y20 B;  2R06 3;  1JZ4 A;  4NMI A;  4X6Q B;  3T0B A;  3A0K A;  1QU0 A;  1QWR A;  3ALQ A;  1JOP A;  1K5M A;  1US3 A;  4JC1 A;  3H50 A;  2GN7 A;  3VD4 A;  2ZGU A;  3Q8C A;  3ME2 A;  3EBR A;  1OC1 A;  4DIQ A;  2BQP A;  2YGM A;  4QGL A;  1V6M A;  4NRQ A;  3DYP A;  4GAL A;  4WZC A;  1EV1 3;  3FJS A;  4QWN A;  1BMV 1;  2RR1 2;  3O1O A;  1CPM A;  1ZVF A;  4CDQ A;  1UU4 A;  2XJP A;  5F5Q A;  3U10 A;  3IT8 A;  2GMM A;  2Y6L A;  3WNL A;  2GAU A;  3O1M A;  2W92 A;  1JI6 A;  1VIW B;  2DDU A;  2WLQ A;  5FLJ A;  3SCF A;  3ZR5 A;  4ARY A;  1AL0 G;  1JYV A;  1PGL 1;  2WC2 A;  1UD1 A;  3A22 A;  3D8C A;  4LBN A;  4YW2 A;  3RYR A;  2C6S A;  5FFO C;  3NKG A;  4E27 A;  1OSG A;  5B2G B;  1W9S A;  4KI5 M;  4RQP A;  1QJY 2;  1GOG A;  4I0A A;  4JX0 A;  2FMD A;  2VQU A;  2VNG A;  3DPR B;  1W2U A;  3HAG A;  3OBR A;  4NAM A;  5LRS A;  3UKT A;  1IGO A;  4PI0 A;  4YG0 A;  1NE4 A;  3MF9 A;  2OUJ A;  1OOP B;  4G3Y C;  4UYB A;  1AL2 2;  3D6E A;  1COV 3;  1LHV A;  3BGA A;  4GB3 2;  4QX0 A;  1AR8 3;  3T1M A;  1TMF 1;  4BXS V;  4ZU7 A;  2E6V A;  1QJE A;  5KHJ A;  1RUE 2;  3CJI C;  1LEM A;  5A3T A;  2ARA A;  4OUM A;  4Q5O A;  2YPJ A;  1JYI A;  2ZPX A;  2VMF A;  1HXS 1;  3KCY A;  3WW4 A;  3VZM A;  4EWA A;  2CDP A;  1LGB A;  3H1M A;  1OPM A;  1SMV A;  3P3N A;  4XZP A;  5EYX A;  3FUQ A;  3RG0 A;  5E89 A;  2BV4 A;  1A8M A;  1XYN A;  2JDA A;  1SG3 A;  3BPS A;  3ZFE B;  5J3U A;  4GWJ A;  1YI7 A;  1S0G A;  5I0U A;  1PMH X;  5FO8 B;  4RS5 A;  1FI2 A;  2DFB A;  1S1A A;  4CDU C;  3TEZ A;  2XJR A;  5D21 A;  3VDC A;  4DXS A;  3KCX A;  1ZBA 1;  1G9D A;  4LEJ A;  1W05 A;  1KGY A;  2JE9 A;  3G6J B;  2G19 A;  1IKP A;  5SV8 A;  1Y3T A;  3WHU A;  2A6X A;  4HAN A;  3J7L A;  3THD A;  1O6U A;  4LLO A;  5AC9 3;  1GOH A;  1W2T A;  4TLG A;  3K4A A;  3ZFE C;  4E2Q A;  5F8P A;  3HN1 A;  4ES9 A;  1CAX B;  2RS1 1;  3KHB A;  3HQX A;  1N1Y A;  2R1D A;  1BXH A;  5B4N A;  1FPN 1;  1SZB A;  4XJZ A;  4NVP A;  2Q0A A;  2XG3 A;  1EP0 A;  2JEM A;  2FCV A;  2C4X A;  4QQH A;  2E7T A;  3VDB A;  3WF1 A;  3M3I A;  1A8D A;  2YBP A;  2O14 A;  1OQD A;  4WZF A;  4LBK A;  1ZBA 2;  4M4P A;  5L36 A;  3O0V A;  1J58 A;  4W6X A;  1VBD 1;  2TEP A;  4BLJ A;  4EZ4 A;  3D0S A;  2HJI A;  2JB8 A;  2E26 A;  5D8A C;  4HLT A;  2D97 A;  4XQ4 A;  4CTE A;  1C1L A;  4Y4Y A;  3AB0 A;  2E31 A;  3ILR A;  3OCP A;  4HOO A;  3VBU A;  1EY2 A;  4QM9 A;  4P14 A;  1E57 A;  2R16 A;  2VCA A;  3SH4 A;  2DUQ A;  1AX1 A;  2NQY A;  2W1U A;  2Q8D A;  4AW7 A;  2P17 A;  4I3G A;  3U75 A;  4EJR A;  5JR7 B;  3BVC A;  3ZYF A;  5LCW L;  3FHQ A;  1W99 A;  5C4W B;  3MO4 A;  5IAT A;  2Y26 A;  2Z5W A;  2YPD A;  4FPJ A;  1XNC A;  2WQZ C;  3ZYG A;  3BIE A;  4HBN A;  5CFD C;  5C4W C;  2W3J A;  1UY1 A;  2DTW A;  2Y34 A;  1UZY A;  3OTF A;  3TAY A;  1PGW 2;  2DVB A;  3R05 A;  2CHH A;  2VGD A;  2H6C A;  4XFA A;  1UXZ A;  1YO8 A;  4A7Z A;  4DEQ A;  1QGL A;  1MAC A;  4RR3 B;  1QJY 1;  2UY8 A;  1CWP A;  1AYN 3;  1BBT 2;  2VR4 A;  4FP2 A;  5DG2 A;  5FZG A;  1ZA4 A;  1KJR A;  2ZHL A;  2P3K A;  1Q8V A;  1QNY A;  2DCZ A;  5I0S A;  1N1V A;  3SCH A;  4ISR A;  5CG8 A;  3ROU A;  2TBV A;  2I74 A;  2ZHN A;  1L7Q A;  4QQO A;  3WEZ A;  3VBO C;  4D7T A;  1RVF 1;  2ETE A;  3VV1 A;  1MR5 A;  2XXZ A;  1D2Q A;  2CNA A;  4O65 A;  2ES3 A;  4OVE A;  3C7G A;  1XBF A;  4QPI C;  2WT0 A;  1Y9Q A;  1S0C A;  5CVR A;  3ZYB A;  4CEW C;  1UOJ A;  1YNA A;  2PHU A;  4CVU A;  3SEE A;  3H8O A;  3N7M A;  2PHT A;  1Z78 A;  2WZR 1;  4FOW A;  1BHG A;  1MEC 3;  4EN6 B;  4MX3 A;  3DV8 A;  1AR6 2;  3VGI A;  1OT5 A;  3O1V A;  4P08 A;  3T2P A;  2W08 A;  2WLP A;  5JLV A;  2NMN A;  4HK8 A;  4W50 A;  5FZD A;  1LRH A;  3ZXL A;  1JYW A;  2R30 A;  3W9A A;  3S0M A;  1W8U A;  2Q1M A;  3NVC A;  1K5M C;  5F3I A;  5K9Y A;  1HRI 2;  2RG4 A;  2Y64 A;  1UYX A;  2HWD 1;  4BWO A;  1WBL A;  1TE1 B;  2BTV C;  4MVT A;  4UW3 A;  2YMZ A;  2GAL A;  2R0F A;  4LR4 A;  1L7R A;  1X9T A;  2ET1 A;  2WWU A;  2QZ3 A;  5C8C A;  1ACC A;  4XCB A;  2JIG A;  3AP6 A;  3NV2 A;  2JE7 A;  4OHZ A;  3NV3 A;  1RXF A;  4JAA A;  4R8H A;  3NV1 A;  1VBA 2;  2E33 A;  1DQ0 A;  1PX4 A;  2HWD 3;  4I30 A;  1IPK A;  2TUN A;  1ND3 B;  4WVM A;  2NMO A;  5FUN A;  4KMQ A;  1RVF 3;  1OD5 A;  3GGL A;  1PM7 A;  1Z0H A;  3FHA A;  4TWT A;  4LT5 A;  2CAV A;  2CYF A;  4MGS A;  2VUA A;  4P00 B;  3JQX A;  5IK5 A;  5JZG A;  3ES1 A;  2XJU A;  4RFT 0;  1UF2 C;  1S0I A;  4D7Y A;  4XFG A;  2G9G A;  5ISL A;  3JBG 2;  2NPI A;  3TOJ A;  1ND2 C;  2Z4F A;  3MZH A;  1HRV 2;  1NCR B;  2D43 A;  2QZ2 A;  4P9L A;  3U4X A;  2ZKL A;  4WM8 B;  2D44 A;  4PLM A;  5J98 B;  2ZMN A;  2GND A;  4H14 A;  4HVO A;  1NZC A;  1I3H A;  2VMC A;  3N36 A;  4XXA A;  5GLZ A;  4KGG A;  3AKT A;  2GZW A;  2ZAA A;  4UW4 A;  5A7O A;  3UJO A;  4Z1V A;  1WA6 X;  2BGO A;  3DPR A;  4D69 A;  2NN8 A;  3DYO A;  2R07 1;  1BKZ A;  2OYZ A;  1ZZ8 A;  4BPZ A;  2ZHK A;  3EHK A;  4JV4 A;  2E7A A;  3KLS A;  3OUI A;  2BNM A;  1HKD A;  4XC9 A;  1D4V B;  3N7L A;  4Z82 A;  4WVV A;  1NCQ B;  1JU4 A;  3H42 B;  3MIG A;  4HKO A;  1NE6 A;  2V09 A;  4XAB A;  2BPA 2;  4UF0 B;  2LAL A;  3HMY A;  4HK9 A;  2A71 A;  3JB8 A;  1GU3 A;  3E6C C;  3WQ1 A;  4IES A;  4RFR B;  3O0X A;  2PLV 2;  3SC7 X;  2HWC 1;  2R7E B;  2VUD A;  5J1X A;  2VM9 A;  4AHX A;  1HJF A;  4MGQ A;  4CP1 A;  5A3L A;  5L9V A;  1PIV 2;  1F2N A;  1O7F A;  1VBC 2;  3OY8 A;  5D8A A;  3UKN A;  3ZM8 A;  4AFA A;  4PCR A;  4KBZ A;  4NHL A;  2VME A;  1FOD 3;  4RD7 A;  1OF4 A;  1QEX A;  1W3X A;  1AR9 3;  4QPG B;  1W03 A;  4YM0 A;  5T50 A;  2I45 A;  4PJY A;  3URF A;  2BVV A;  2FCU A;  1TMF 2;  1WZX A;  4LQR A;  5DZF A;  4B29 A;  5E1R A;  4IE6 A;  1AX0 A;  4FPO B;  3QAC A;  4N53 B;  4RYD A;  1QJU 3;  2F6B A;  1O4Y A;  2D93 A;  4CDX C;  3AP7 A;  2D5H A;  2YBS A;  1AZD A;  1AHS A;  2C9K A;  1HRV 1;  3OJB A;  5DAW A;  4C1W A;  3S7E A;  3QOP A;  2IXI A;  2RM2 2;  4M00 A;  3RFR A;  2DBN A;  4GMP 3;  3ZSJ A;  3POI A;  2VZ1 A;  4NIH A;  3AX4 A;  2A6Y A;  4QX3 A;  5C9A C;  5FTT C;  1R64 A;  3FE5 A;  1STM A;  2W46 A;  2ZEW A;  1LGC A;  1AX2 A;  2XWB B;  1W06 A;  2W47 A;  3OGR A;  2MEV 2;  3NNF A;  4ERO A;  2QQJ A;  4G4F A;  4ES8 A;  4QDS A;  3O1R A;  2C0Z A;  1A34 A;  4NRO A;  1YXW A;  4WM8 C;  1KQR A;  5GZF A;  4RGK A;  1A6C A;  2RDQ A;  3K77 A;  1AR8 2;  1CON A;  1IHM A;  1CIW A;  1PNF A;  2QQV A;  2B5H A;  3EQE A;  5DUU A;  5KC5 A;  1LAJ A;  3HEI A;  4DUX A;  4UT5 A;  2QQN A;  4IL7 A;  1W8F A;  1PO2 1;  3TNQ A;  4XF0 A;  3T30 A;  1J84 A;  5AC9 1;  4XPV A;  3VBO A;  1IKQ A;  5DAB A;  3RPQ A;  2C1F A;  2XDV A;  2VZ3 A;  3I7D A;  4E4D X;  1N3O A;  2DF7 A;  2HWE 3;  4IW3 A;  3VL9 A;  3VN4 A;  5F5A A;  4CXY A;  2WBK A;  2YC4 A;  2ZGO A;  3OEA A;  3KCC A;  3LFM A;  3AL6 A;  3PUH A;  2E51 A;  5JI9 A;  5HCF A;  2C24 A;  2PHD A;  4IV1 C;  2PQS A;  3VBU B;  2J1A A;  5SV5 A;  2X05 A;  4CDW B;  1H8T C;  4AVB A;  4QHZ A;  1JZ6 A;  1UY0 A;  1JU3 A;  1RIN A;  4AI9 A;  1C8M 2;  1DG6 A;  3H1W A;  5FP7 A;  1O5L A;  2R07 3;  4PI2 A;  2W39 A;  5DPN A;  1F9K A;  2YBK A;  1W6O B;  4PBO A;  1W6N B;  3CJI A;  4AI8 A;  5A1A A;  2PXJ A;  3UET A;  3UGG A;  3VBU C;  1V9U 2;  4J1W A;  4Q26 A;  2BFU L;  1H6X A;  1MS5 A;  3Q8B A;  1CR7 A;  1LHU A;  1OF3 A;  1OH4 A;  4MAD A;  4LKE A;  4BQY A;  3QBQ A;  1VAM A;  2XB6 C;  4GH4 B;  2IXL A;  5FZB A;  4BQ3 A;  5AC9 2;  4IV1 B;  3MPB A;  2G9Z A;  4HZF A;  1X36 A;  2IVI B;  3CF6 E;  1BLZ A;  1G9A A;  2XWJ B;  4UWD A;  2WFF 2;  3ZN4 A;  3FWE A;  1EUT A;  1ZZ7 A;  2WJS A;  3NJX A;  3DKQ A;  4UFH A;  5BNN C;  5CFC C;  2YZ4 A;  3G7D A;  1LNS A;  5CAD A;  4LK7 A;  1EV1 1;  4I3P A;  3J8F 1;  3KZ4 C;  4ZU4 A;  3S5Q A;  1PX3 A;  2AEY A;  3ZFE A;  2QVS B;  4IEP A;  5GLU A;  5FYV A;  5BNN A;  5CFC A;  4YVW A;  1XYP A;  1ZBA 3;  5EFU A;  3LF7 A;  5IVE A;  1RUC 2;  3UK9 A;  1IS3 A;  4XDP A;  3PVE A;  2DFC A;  3O1P A;  4PBP A;  2WZE A;  3BCW A;  2GC0 A;  1LED A;  2ZCW A;  1H2K A;  1CZS A;  2XQR A;  3RI8 A;  2LRP A;  3BUC A;  4IEV A;  2ZX0 A;  3UES A;  1UO9 A;  2K9Z A;  2YYO A;  4RHV 1;  3B9C A;  4AAP A;  4BZ4 A;  2H0B A;  2OQ6 A;  3WHT A;  1W04 A;  5EQU A;  1VBA 1;  4SLI A;  3CNA A;  5DN2 A;  1IG0 A;  4QPW A;  3ORJ A;  3BI3 A;  1W6M B;  2A6W A;  1SEF A;  2YDE A;  3FLP A;  3KQ4 B;  4LBO A;  2PA7 A;  5FJK A;  2V4V A;  2WYF A;  3PVO A;  4Z2W A;  2CWM A;  1VRH 2;  2D6K A;  1WMD A;  3IDC B;  1G9F A;  2AAC A;  1Y9G A;  1WD3 A;  2V73 A;  2EIE A;  4YW3 A;  1H9P A;  1LOC A;  3IBM A;  1JUI A;  1HN0 A;  2FHR A;  4IV1 A;  3M3C A;  3M3O A;  4S2H A;  1KS5 A;  2OUH A;  4CDQ B;  4L97 A;  3PL0 A;  1PK6 C;  5IAV A;  4AGG A;  4XE9 A;  3VL8 A;  2ZA9 A;  1W0O A;  2UYA A;  5A1L A;  3J26 N;  2KD7 A;  1JN2 P;  2ZGS A;  4YG6 A;  5CKN A;  1LKN A;  1K5M B;  2Q8C A;  2Y6G A;  1HXS 3;  1TNR A;  2PTM A;  2EAL A;  3PLQ A;  1H8T B;  2YFU A;  3KMH A;  2W91 A;  1Z7S 3;  2JWP A;  3KWV A;  4AGV A;  1N1S A;  4CDQ C;  3GYD A;  1W6O A;  1SCR A;  2ZZQ A;  1NYW A;  2VVE A;  4W4Z A;  4XJ9 A;  1L7L A;  4OUE A;  4CUA A;  1KD7 A;  4E2G A;  2R04 2;  1MEC 2;  1PMI A;  1YIP A;  1BVP 1;  3FMG A;  4KWU A;  5FZ8 A;  1QJZ A;  5C8W A;  4I01 A;  5I0T A;  2GNB A;  1YFU A;  1BYH A;  5KR7 A;  3CQO A;  4K6B A;  1F35 A;  2WAA A;  4YW6 A;  5ACA 3;  2HWB 2;  3IDA A;  2W87 A;  1VBA 3;  4LBL A;  1N1T A;  3HPN A;  3RMY A;  1W6Q A;  1ASJ 2;  1IG3 A;  1U5Y A;  4EE2 A;  1AR7 1;  4L11 A;  5FMO S;  5CU1 A;  2HWC 2;  2WO2 A;  4WM7 B;  2PLV 1;  4MSV A;  5GKA C;  4OCT A;  3DXU A;  1OVP A;  1WCU A;  1NY7 1;  4HFS A;  1VAV A;  4HPK B;  4W65 A;  2CGP A;  2WS9 2;  2VO5 A;  5I93 A;  1V6N A;  2XKP A;  2OQ7 A;  1ND2 B;  4FQZ A;  4P5Y A;  1BK0 A;  4GQ7 A;  2HYK A;  2LM3 A;  4UFL A;  4KH9 A;  5JOY A;  3N3H A;  1M4W A;  3ASI A;  4BLI A;  3C7H A;  3TRS B;  4XTP A;  3SKV A;  3ZLI A;  2OPW A;  3RRD A;  2FD8 A;  1RVF 2;  5FZE A;  3CEW A;  1XYO A;  4Y20 A;  5HCH A;  2WWJ A;  1JOJ A;  2WKK A;  1QJY 3;  4IEX A;  4QQP A;  5IVB A;  3DXT A;  1GZ9 A;  3QLQ A;  3GNE A;  3N9O A;  2PHF A;  4K40 A;  1H8T A;  4S2G A;  1CQ9 A;  3PU8 A;  1AL2 3;  2JIJ A;  1QJF A;  1WUV A;  3ILN A;  1O5U A;  3IZO A;  3H0O A;  4LHS A;  1QQP 3;  2UUR A;  1RHI 3;  2VUC A;  4JGY B;  5FLI A;  2YGL A;  4R9B A;  3VBF A;  4DZG A;  2J22 A;  1CAV B;  3VBR A;  4E4Z A;  5ABJ A;  5H9P A;  2KA3 A;  5F32 A;  1ENQ A;  1W8O A;  4G9S B;  3SXW A;  4Q4X 2;  4FBF A;  5JXH A;  1RYY A;  2ZGP A;  1BEV 3;  4YWA A;  1DLL A;  2XUE A;  5DAP A;  4PLO A;  2V4A A;  3GAL A;  4B1L A;  1BMV 2;  5LBF A;  3WXP A;  1NKG A;  1W8W A;  4GMP 0;  3VBH A;  1K42 A;  1ULP A;  3AKR A;  3JU9 A;  2AR6 A;  4YRD A;  2HYX A;  3KT4 A;  1R08 2;  4CUB A;  1W6M A;  1C5H A;  3BKZ A;  3D4K A;  2WNU A;  4OHY A;  2EIC A;  3T1L A;  2F17 A;  2QE3 A;  4CCL A;  1RUJ 2;  1ENX A;  3M3E A;  1UIJ A;  3PUQ A;  3RZJ A;  1YEW A;  4D0Q A;  4XEZ A;  2P34 A;  4NO4 A;  3ENR A;  5FMC A;  1TVG A;  3SHR A;  1LOF A;  2E9Q A;  5CNA A;  4AI3 A;  1OVS A;  3U14 A;  4OI4 A;  4U36 A;  3TBD A;  1PVC 2;  3SH5 A;  3VD5 A;  4CDX B;  3FLR A;  4DPN A;  1IPS A;  1CX4 A;  5KHG A;  5CG9 A;  2RS5 2;  4Q1R A;  3WG2 A;  1X9P A;  3DL3 A;  3ZPO A;  1VBC 3;  4YVW B;  2XKO A;  5KXB A;  2WL1 A;  1GSL A;  3AVS A;  5K8S A;  1UMZ A;  3OD0 A;  4AE2 A;  5DAX A;  4BIO A;  1RUH 1;  1NLR A;  1CJD A;  2NLR A;  2BOI A;  4FOQ A;  1VMH A;  2OW4 A;  2WNV C;  1ST8 A;  2W2I A;  3E97 A;  3AXD A;  1C8M 1;  1UIK A;  2ZZJ A;  5E88 A;  5F6K A;  5FZ4 A;  4ARX A;  4CEY B;  2JG8 A;  4JKM A;  2E53 A;  4FPC A;  1AUY A;  3KV6 A;  5JIU A;  3PIJ A;  1W8H A;  1DQ6 A;  5FO9 B;  4ZZ8 A;  5LY1 A;  5BNO C;  1Y7B A;  1JW6 A;  3SKJ E;  3BB6 A;  2NM1 A;  5ABJ C;  4QX7 A;  4ZKT B;  3WQ0 A;  1EPW A;  1XOY A;  2XVL A;  1Y9M A;  1RIT A;  4MGY E;  4QB2 A;  2V5D A;  1JHJ A;  1XE8 A;  4FAH A;  3MI8 A;  4XHB A;  4I0W B;  5T54 A;  1AYM 3;  4IV3 C;  4QGN A;  3B69 A;  4NRP A;  4HVR A;  4OZO A;  3RZL A;  1VB2 A;  2WQ8 A;  3BTX A;  4IE5 A;  4MV2 A;  5F5C A;  2MEV 3;  1G9C A;  2HWE 2;  4YFZ A;  3OGJ A;  4ET7 A;  3NAP A;  1CZT A;  4FXK B;  2WFP A;  4RGG A;  5F37 A;  2OA2 A;  4JHT A;  4LJH A;  1Q3E A;  1RUJ 1;  4GAZ A;  2FZ1 A;  4XDO A;  2OXB A;  5EWS A;  2X10 A;  3CIH A;  3OPZ A;  4P9I A;  4DMI A;  5C5T A;  4K7J A;  4F7Z A;  1PNG A;  1BQP A;  4N9H A;  3POY A;  3VDA A;  3E6B A;  3R4U A;  3AKQ A;  3ECQ A;  3WV6 A;  2X5I C;  4JDO A;  1NY7 2;  1LGN A;  4HG6 B;  3ZYJ B;  4MGT A;  4D8M A;  5A33 A;  2AEZ A;  5FDB A;  3VLB B;  2WS9 1;  3IMM A;  2BBV A;  3GJA A;  1SCS A;  1QH6 A;  1V6L A;  2QQM A;  1RED A;  3LEI A;  2VZO A;  4YW7 A;  5FWE A;  4Q8K A;  4QX8 A;  2FDK A;  3POJ A;  3LDR A;  5HV4 A;  5LBC A;  4YGD A;  2XUM A;  1JH5 A;  4IGO A;  3IAP A;  5C5U A;  1KXG A;  4BDV B;  4BXF A;  2P1B A;  1PGW 1;  4P5H A;  4NHK A;  3TN9 2;  3J7N A;  3AK0 A;  1NQD A;  1SPP A;  4Q0P A;  1KRI A;  5LRR A;  1RUN A;  2R07 2;  4M4R A;  4YM3 A;  3WG4 A;  3SNM A;  5JSP A;  1U12 A;  4RGA A;  4HKL A;  2JG9 C;  1TG7 A;  1DQ2 A;  5D1I A;  4GWI A;  3DPR C;  1HJG A;  2ORX A;  4JHZ A;  2ZXQ A;  5C70 A;  1LR5 A;  5JMC A;  3KVB A;  1ZZ6 A;  3V0A B;  1GYK A;  3H8U A;  4LBQ B;  4AF9 A;  4JKK A;  1W6Q B;  1YLL A;  2ZAH A;  3DN7 A;  1FAY A;  1RUC 3;  3LA3 A;  5A3W A;  5KBF A;  2R0H A;  2XJT A;  1AR6 1;  2FZ2 A;  1LB2 A;  3AKS A;  3VZJ A;  1BVV A;  3DUI A;  4MGI E;  3Q8F A;  3I3Q A;  2JDM A;  3JUU A;  1R08 1;  5FYS A;  3B93 A;  1KFX L;  3C3V A;  1HRV 3;  2A3W A;  1PZ8 A;  3AMQ A;  5J37 A;  1FX5 A;  3I59 A;  4Y1V A;  4UOJ A;  4Q27 A;  4V2V A;  5FYY A;  4OI1 A;  5G05 L;  1GNY A;  1T6B X;  3WF2 A;  4OHX A;  1YJL A;  2IVJ A;  5D8A B;  5DUW A;  4ASK A;  5L7O A;  1J1T A;  1O3T A;  4Q2F A;  3VBH C;  1HRI 1;  4LO6 B;  4LOS A;  1NLQ A;  2PAE A;  1R1A 1;  3PJQ A;  1XRU A;  1OHF A;  2XH6 A;  2EAA A;  4KNC A;  3DEM A;  1E5I A;  2Z2S B;  4UW6 A;  5HXM A;  3P3P A;  2JKB A;  4K8F A;  2R32 A;  3EO6 A;  1DF0 A;  1D0H A;  4W6Y A;  1FOD 1;  4LXL A;  5FP4 A;  4EN7 B;  1AR9 1;  2VUJ A;  4CRQ A;  1FMD 1;  2VEC A;  4H7L A;  2XON A;  4IGP A;  4XET A;  4IQP A;  4YSF A;  3JD7 3;  1YUD A;  1GLH A;  3APB A;  4QPY A;  4MHU A;  3V56 A;  3M3Q A;  1CAW B;  5AVA A;  2A3X A;  4JRL A;  2VBD A;  1URX A;  3FL7 A;  3NNL A;  1VRH 3;  5L7O C;  1Z7S 2;  3AYC A;  4FTB A;  1TME 1;  5A6Z A;  4C1X A;  1HLC A;  4XJ8 A;  4XUO A;  2Y0O A;  4Y5Z 0;  2YC2 A;  1NAE A;  3OY8 B;  5J96 B;  1RUG 1;  3T08 A;  1X7N A;  1SDW A;  4UBH A;  1RC6 A;  4XMA A;  2RMU 3;  4N43 B;  1AR9 2;  2ZS6 B;  4EN9 B;  2V72 A;  5I0R A;  1CN1 A;  5T5L A;  1TMF 3;  5LAS A;  1K3I A;  1W8N A;  2K2S A;  1DGR A;  5LEK A;  3ACI A;  1QOT A;  3HN3 A;  2P5B A;  4DFS A;  3WNX A;  1OFN A;  1DQ5 A;  1W2O A;  3C7F A;  1NOV A;  1QJU 2;  5JI7 A;  1QDO A;  1W0P A;  2JDN A;  2R04 3;  4M3C F;  4CZS A;  5L7O B;  1ENR A;  1POV 0;  1T2X A;  2QFE A;  1BJQ A;  3CDZ B;  3AMN A;  4QGM A;  4RL7 A;  1RUG 3;  4Z8B A;  4MYE A;  5FPL A;  4Y1Y A;  1K45 A;  3VDD A;  2WT1 A;  5FPZ A;  4HT1 T;  1QXJ A;  1JBC A;  3K4D A;  5A7W A;  2RS3 2;  1ONA A;  4UAP A;  5IVJ A;  2JXA A;  2ZGT A;  4CCK A;  2Y6H A;  3WF0 A;  3WNP A;  5LK7 B;  2ZBJ A;  3N9Q A;  2RDN A;  3NWK A;  4HET A;  4LKS A;  1NUK A;  1CGP A;  3MFC A;  2XLA A;  5H9Q A;  3LAG A;  4RS5 C;  5FCC A;  1ODM A;  5HBA A;  3HBZ A;  5FMB A;  4YZ1 A;  1FMD 3;  1JOD A;  1GQH A;  4YM1 A;  3U07 A;  2D6O X;  1UZV A;  5DXD A;  5JAX A;  2BU9 A;  5LBE A;  2FDG A;  2HWF 3;  2VCM A;  1GZW A;  5FR3 A;  1XSQ A;  4FFH A;  2WO1 A;  1HB2 A;  1RUI 3;  1VBE 3;  3BU7 A;  1UYY A;  2JDK A;  1EAH 2;  4CP0 A;  5IFT A;  2BGC A;  3JCI A;  4B4P A;  3FC0 A;  3WIN E;  5DAQ A;  5BNQ A;  1H4H A;  2GC1 A;  2PN5 A;  4WM7 C;  4WVM B;  1YJK A;  5BNP B;  4Y1Z A;  4K20 A;  1BEV 2;  3VBS A;  3VD7 A;  1IQA A;  2C26 A;  2VOV A;  2RVA A;  2YUE A;  3BOD A;  1WCD J;  2BZD A;  2BW8 A;  3ATG A;  4LTA A;  5FZO B;  2WT2 A;  1IS4 A;  2DU1 A;  1VLN A;  3VBO B;  2ZAB A;  3ES4 A;  5FAX A;  2RJ2 A;  4IV3 A;  4DXR A;  3MID A;  2JIC A;  3N9M A;  3PUI A;  4QKF A;  5FXW A;  2JG9 A;  1HX6 A;  2BP6 A;  4Q4X 1;  1SLA A;  5FQ0 B;  4CPB D;  3JQW A;  3UKV A;  2O8O A;  2LTN A;  1PZ9 A;  2XLF A;  1E5R A;  2JKX A;  3I2I A;  2UWC A;  4D94 A;  3KM5 A;  4PT6 A;  1H1M A;  4GKX A;  1DDL A;  1RGS A;  2B8M A;  3O0W A;  3HJR A;  4AFC A;  5CEH A;  2CDO A;  4KBB A;  1W8Z A;  1UX6 A;  5C71 A;  2JJ6 A;  1N47 A;  3MIH A;  5HCB A;  5KHK A;  3GZU C;  5DDJ 1;  1YHF A;  4XAA A;  4HKW A;  1CES A;  2R49 A;  2ARB A;  2IXH A;  1H2M A;  1YC6 1;  2X09 A;  3W59 A;  1K12 A;  1SPP B;  2UY9 A;  5JMO A;  3IMN A;  1QIQ A;  4IDZ A;  5B4X A;  1O4Z A;  2GH2 A;  2W52 A;  3WDT A;  5DG1 A;  4C8D A;  2XBO 3;  4UFK A;  4KGQ A;  4LO5 B;  4FOV A;  4FPK A;  5A32 A;  5HPO A;  3BIW E;  2IXJ A;  2RHP A;  2HWF 1;  5JVV A;  3WW2 A;  1LTE A;  2EA7 A;  4BQ5 A;  1ZYB A;  4QM8 A;  1XC6 A;  4LO4 B;  3MLJ A;  4QMA A;  4FFF A;  1F8V A;  1KFU L;  2OII A;  4LO7 A;  4NII A;  2VZS A;  3KGL A;  4D6Q A;  3NAP C;  2IXK A;  1ULC A;  3RDI A;  4BA6 A;  5I8Y A;  1PM4 A;  1UW8 A;  3ETQ A;  4YPJ A;  4I2O A;  5FZO A;  3I2H A;  2IXC A;  1QXR A;  4NWV A;  4Y5T A;  4XQD A;  3CJX A;  3GCX A;  3JB4 C;  3MPP G;  1AYN 1;  3WLU A;  4GWM A;  3BOP A;  5IVC A;  3BU0 A;  1MVQ A;  4D6S A;  1C5I A;  1CAU A;  5CIS A;  3RQ0 A;  1IS5 A;  5BNP A;  4PLN A;  3AP5 A;  1MZ6 A;  3VZO A;  3USU A;  4TTG A;  3HNM A;  2G1M A;  5C3Q A;  3DCQ A;  3IDE A;  3E1F 1;  5JOZ A;  4QAW A;  5A7N A;  5A80 A;  2W5F A;  3CMG A;  4QDR A;  5CA6 A;  1KJL A;  1HIX A;  3IPV B;  5BNO A;  5DDJ 3;  3LZZ A;  1JZ2 A;  1H30 A;  1V0A A;  3MV0 1;  5EZW A;  3RZK A;  5FLH A;  3RNS A;  4AHZ A;  1Q56 A;  4J1X A;  4CSW A;  2CV6 A;  3AFK A;  1S0B A;  2VXJ A;  3H7J A;  4KQ7 A;  4O61 A;  5DUV A;  2D3P A;  1S4C A;  4PF5 A;  2XJV A;  2WNV A;  3P6B A;  1SLB A;  3J8F 3;  3MLK A;  3MLL A;  4PQ9 A;  1B09 A;  3T2T A;  1REF A;  4B4R A;  3SEP A;  4X6R B;  2RR1 1;  5FZA A;  5HI0 A;  4N90 A;  1G86 A;  1AR7 3;  1XE0 A;  2VG9 A;  5C7G A;  3D0J A;  1VBD 2;  3VDD C;  3S5A A;  2EXH A;  3MYX A;  3Q8A A;  3WT3 A;  1LUL A;  3WD5 A;  2A3Y A;  3LPF A;  5E8A A;  1LOA A;  3H7Y A;  1UY2 A;  2QQW A;  1SFN A;  1PGS A;  1YFW A;  5DAV A;  1GP5 A;  3HD8 B;  3N9L A;  3RGB A;  1J3R A;  1XND A;  4AFD A;  4BM8 A;  5JPN B;  3ON7 A;  1COV 1;  1UOB A;  5FZ1 A;  5ACA 2;  1VRB A;  2VZR A;  2NZ9 A;  4IEW A;  4ITC A;  4IE4 A;  5JDB A;  4JKL A;  4QB1 A;  3ACH A;  4CUG A;  3KVA A;  4OQ9 A;  3WZ1 A;  1WLW A;  3KF5 A;  4YVS A;  4IGQ A;  1O3S A;  1R1A 3;  2EVX A;  1TME 2;  1U5X A;  4Q0Q A;  4JTN A;  4YZ3 A;  5KXE A;  2EXJ A;  3DGT A;  3MF6 A;  5I8S A;  1ALY A;  1RUO A;  2RV9 A;  4H7M A;  3K3O A;  1UCX A;  3M7A A;  5EV7 A;  4DQA A;  2ARX A;  3AZX A;  4MOA A;  1QNW A;  4A3X A;  5A3P A;  3AP9 A;  5C8C B;  1RMU 1;  1RUF 2;  2X53 S;  4XAE A;  1I5Z A;  4FTS A;  3KV4 A;  1W9Y A;  2WDB A;  2AUY A;  3MDP A;  1VMF A;  3OD4 A;  3WDX A;  2O8Q A;  2DVG A;  4UFI A;  5CBL A;  2B9U A;  5IAX A;  4AI1 A;  2GP5 A;  4UW5 A;  5LEJ A;  5LBB A;  4A44 A;  1DGW X;  4HSJ A;  3ILF A;  2ORZ A;  2WAO A;  5F7U A;  3VBR B;  4TXW A;  1S2B A;  2ERF A;  1SHW B;  4AK3 A;  4QT6 A;  3NKT A;  5T55 A;  1Q5O A;  3LSD A;  1W8T A;  1MZ5 A;  2DUR A;  5FXX A;  4XMI A;  2ZGM A;  4BJ0 A;  3ZFF A;  3KHC A;  3DYM A;  2JD4 A;  3EJK A;  3AP4 A;  3WG1 A;  2D7F A;  1FNY A;  3VB9 A;  1HQN A;  3WSO A;  5IK4 A;  2DBI A;  3JZV A;  1I1E A;  4J6G A;  4JDN A;  1F4A A;  1YQ6 A;  2XHK A;  5AFB A;  3RMX A;  2XVK A;  3FUO A;  5FY0 A;  1OA3 A;  3NW4 A;  3WG3 A;  4ASM B;  1DQ4 A;  5JXI A;  2ZGQ A;  4DRR A;  1N3P A;  2W1W A;  4A45 A;  1R08 3;  1JZ5 A;  3WUD A;  3UL2 A;  1NA1 C;  5JCT A;  3VBR C;  3AMM A;  4XUP A;  1RUJ 3;  4Z92 B;  3PME A;  4M0H A;  4NHX A;  3ETP A;  5FYH A;  3CO2 A;  1DYK A;  1GUI A;  5HCA A;  2BGP A;  2WN2 A;  1NA1 A;  4NN0 A;  3POS A;  4E9K A;  2P6H A;  1FV2 A;  1I9R A;  5FZK A;  3A4U A;  1UN1 A;  3CZJ A;  4FPG A;  2A1X A;  4XYX A;  5CYY A;  3HWJ A;  4QXC A;  4DS0 A;  5C3P A;  1ULF A;  2D3R A;  2ZOE B;  3M8L A;  4K8R B;  1X50 A;  3EYP A;  4XW3 A;  4E2S A;  2Z42 A;  4DEV A;  5K0U C;  4JVA A;  3GBW A;  2B46 X;  1WLT A;  1UOG A;  5CIR A;  3V0B A;  3LEK A;  4URT A;  1RUG 2;  1WW5 A;  2Y8K A;  1HQL A;  3KQR A;  5FYT A;  1QQP 1;  1BZW A;  2ZAC A;  4AZZ A;  4AEK A;  1K5J A;  1OUS A;  4ATF A;  1HB1 A;  1OLR A;  3M2M A;  4CP2 A;  5LA0 A;  2ZGR A;  3E6D A;  1SAC A;  4AEJ A;  3LD8 A;  4PDW B;  1O8S A;  3LDB A;  3J9S A;  3NNJ A;  3QCW A;  4MLO A;  1F5J A;  1ZX5 A;  5C3R A;  2ARE A;  1RJ7 A;  4LA2 A;  5H9S A;  3W20 A;  2K46 A;  2XQX A;  1GOF A;  3I2J A;  1H4G A;  2LUW A;  2ZHM A;  2HBU A;  4CCJ A;  3E5U A;  2J1V A;  1DGL A;  2J1T A;  1FMD 2;  2RJL A;  3GBG A;  3LCP A;  2OX0 A;  1WWY A;  1M06 G;  1EV1 2;  1ZRR A;  4TSV A;  3ZSL A;  3OF1 A;  4H55 A;  3HQR A;  3USU B;  3WP3 A;  4LIU A;  1ND3 A;  3A0N A;  5GJ6 A;  1SLL A;  5FO7 B;  5KXC A;  4U2A A; 
#chains in the Genus database with same CATH homology
 3VD9 A;  2J1R A;  5EJZ B;  4ARX A;  1GOH A;  1JYN A;  1CIY A;  3K4A A;  4JKM A;  1UMI A;  3OGV A;  3LE0 A;  3I2F A;  3I3B A;  5B4N A;  4ZZ8 A;  3J7H A;  3SKJ E;  3C7O A;  2W1Q A;  3MUY 1;  2C4X A;  3VDB A;  3WF1 A;  3DEC A;  4M4P A;  3WNM A;  4QB2 A;  2V5D A;  1JHJ A;  3T0A A;  4CU6 A;  3MBW A;  2E26 A;  2WUH A;  4OZO A;  1I5P A;  2E31 A;  2WQ8 A;  2VCA A;  3NJV A;  2W1U A;  2YB7 A;  4GZ9 A;  4ET7 A;  5LCW L;  3FHQ A;  1YQ2 A;  1W99 A;  3MV1 1;  1CZT A;  3MO4 A;  4ZY9 A;  4ZZ5 A;  2QQI A;  2VOT A;  2W3J A;  3OEB A;  1UY1 A;  2X10 A;  3CIH A;  4Z2A A;  1UXZ A;  1J83 A;  4DEQ A;  3VDA A;  4A42 A;  3HOB A;  3ECQ A;  2VR4 A;  2XHN A;  4XUQ A;  4HG6 B;  4DXT A;  2WYS A;  4D8M A;  4CU8 A;  2QQM A;  1L7Q A;  3LEI A;  3WEZ A;  1W9T A;  2VZO A;  4CUC A;  5IHR A;  2BER A;  1XPW A;  3T0D A;  3C7G A;  3IAP A;  4L0P A;  4BDV B;  2YFZ A;  4CVU A;  2EIB A;  3SEE A;  1ULO A;  1GMM A;  1BHG A;  4M4R A;  1OT5 A;  2B9V A;  4P08 A;  3T2P A;  3A23 A;  4QDQ A;  1TG7 A;  4W50 A;  4GWI A;  1JYW A;  2ORX A;  4JHZ A;  1HN1 A;  4E8D A;  3T09 A;  2ZXQ A;  5C70 A;  1CX1 A;  4A6O A;  3OGS A;  3ACG A;  4JKK A;  2Y64 A;  1UYX A;  4UI9 L;  3AC0 A;  3GXU A;  1L7R A;  3NRU A;  4QB6 A;  2L9L A;  1W9W A;  5EJ1 B;  3K46 A;  1P8J A;  3WNN A;  2Y6K A;  2VL4 A;  3UNP A;  1UXX X;  4XUN A;  1DP0 A;  4UOJ A;  2E33 A;  5G05 L;  1GNY A;  3WF2 A;  1PX4 A;  3I2K A;  4KMQ A;  3GGL A;  3FHA A;  4MGS A;  2W9X A;  4P00 B;  5EIY B;  5HXM A;  4MO3 M;  2J1U A;  4W8J A;  2Z4F A;  1NX9 A;  2QQK A;  1UMH A;  2XON A;  3OBA A;  1F4H A;  4OMC A;  2WAB A;  2VMC A;  1O8P A;  3FL7 A;  2VCB A;  1DLC A;  2E32 A;  2BGO A;  2W1S A;  3DYO A;  2XOM A;  4XUO A;  3WQB A;  2YC2 A;  3W5N A;  1NAE A;  3T08 A;  1UY4 A;  2BBA A;  1DYO A;  2V72 A;  1JU4 A;  5IFP A;  5JXG A;  1K3I A;  1W8N A;  4DUV A;  2VZP A;  3F2Z A;  3I3D A;  3ACI A;  3HN3 A;  1GU3 A;  2QBX A;  3C7F A;  3III A;  2R7E B;  1T2X A;  5J1X A;  2OKX A;  2VM9 A;  3CDZ B;  3I97 A;  4MGQ A;  1PMJ X;  3ACF A;  1K45 A;  3ZM8 A;  4AAX A;  1MPX A;  1H6Y A;  2VME A;  2J1E A;  2LS6 A;  1OF4 A;  3K4D A;  4UAP A;  4A4A A;  2Y6H A;  3WF0 A;  3WNP A;  4LQR A;  5G04 L;  4LKS A;  3C7E A;  1NUK A;  3U37 A;  4PQQ A;  4RYD A;  4RN5 A;  4OMD A;  4E8C A;  1XNA A;  4A41 A;  2C9K A;  1UZ0 A;  2DCJ A;  3THC A;  2VZV A;  1EUU A;  2WO1 A;  5JR2 A;  1UYY A;  2VZ1 A;  2Y6J A;  5IFT A;  3BN6 A;  4QX3 A;  1R64 A;  3HNY M;  3LQC A;  2W46 A;  2ZEW A;  1UX7 A;  2J7M A;  3VD7 A;  2C26 A;  2W47 A;  2RVA A;  3OGR A;  2QQJ A;  4XUT A;  4QDS A;  4XVH A;  2BZD A;  3CKH A;  3K77 A;  5IJR A;  2RJ2 A;  2ZEX A;  3HEI A;  4DUX A;  4DXR A;  2QQN A;  3PUI A;  2JD9 A;  1UYZ A;  1J84 A;  3A7Q A;  1KEX A;  2VZ3 A;  3LEG A;  3T2Q A;  2VTF A;  2JKX A;  3I2I A;  2WBK A;  4PT6 A;  1UY3 A;  2YC4 A;  3OEA A;  2ZEY A;  3HJR A;  1UWW A;  2CDO A;  3PUH A;  4PF1 A;  5C71 A;  5DQ0 A;  4IUG A;  2VZT A;  2VMD A;  3W5M A;  2PQS A;  5DMY A;  2J1A A;  5I0D A;  2X05 A;  1JZ6 A;  3P1I A;  3OG2 A;  1UY0 A;  2X09 A;  1K12 A;  2B4K A;  5JMO A;  1JU3 A;  5B4X A;  2VCC A;  2ID4 A;  5HPO A;  5DPN A;  3OB8 A;  5A1A A;  1SDD B;  3LPG A;  3UET A;  2VZU A;  1XC6 A;  1H6X A;  3CZU A;  2JE8 A;  2VZS A;  2J1S A;  1OF3 A;  1OH4 A;  4MAD A;  4YPJ A;  3I2H A;  4XUR A;  1W0N A;  5JUV A;  1EUT A;  3NJX A;  1IQD C;  1WKY A;  1LNS A;  2LW8 A;  3IB3 A;  4QX2 A;  4TTG A;  2VC9 A;  5FUI A;  3HNM A;  1PX3 A;  3E1F 1;  4QAW A;  3T2O A;  3MUZ 1;  2W5F A;  3CMG A;  2VQT A;  4QDR A;  3WNO A;  5JXJ A;  1JZ2 A;  3MV0 1;  2WZE A;  2EID A;  1CZS A;  3HNB M;  4QX1 A;  4BK5 A;  3UES A;  3P6B A;  1XNT A;  5DN2 A;  4QPW A;  2WO3 A;  1O59 A;  3SEP A;  3FN9 A;  4OYU A;  5C7G A;  2V4V A;  2W95 A;  4ZXE A;  3LPF A;  1UY2 A;  3C8X A;  2EIE A;  4CU7 A;  3I3E A;  4DUW A;  5IYY A;  1JZ8 A;  1WCQ A;  2VZR A;  1OD3 A;  3WF3 A;  1D7P M;  3GM8 A;  2KD7 A;  4JKL A;  5LA1 A;  4QB1 A;  3ACH A;  2Y6G A;  2YFU A;  2W91 A;  3NQH A;  3JXS A;  4CU9 A;  2YG0 A;  4W4Z A;  4OUE A;  4XZU G;  4CUA A;  4KWU A;  2RV9 A;  2VZQ A;  3CQO A;  2WAA A;  4MOA A;  2VJX A;  2WZ8 A;  4FI9 A;  3EB7 A;  2QQL A;  3IDA A;  2W87 A;  3I2G A;  2WDB A;  4A3Z A;  2QQO A;  3HPN A;  4A44 A;  2HLE A;  2WO2 A;  4AG4 A;  2ORZ A;  2WAO A;  5F7U A;  3D3A A;  2VO5 A;  4P02 B;  2DCK A;  1GQP A;  4TXW A;  2ZEZ A;  1SHW B;  4P5Y A;  3VD3 A;  3WNK A;  3IAQ A;  4BJ0 A;  3DYM A;  3C7H A;  3SKV A;  3WSO A;  1US2 A;  1F4A A;  1JZ7 A;  5CZK A;  3T0B A;  3K75 B;  5JXI A;  1US3 A;  3VD4 A;  3WF4 A;  2W1W A;  4A45 A;  1JZ5 A;  3DYP A;  4XUP A;  4LHS A;  3ABZ A;  3ETP A;  3WNL A;  2Y6L A;  1GUI A;  2BGP A;  2WN2 A;  2W92 A;  1JI6 A;  2DDU A;  2J22 A;  3GDB A;  4ARY A;  1JYV A;  1W8O A;  3CZJ A;  5CYY A;  3A22 A;  5JXH A;  4LPL A;  1RYY A;  3NNG A;  3EYP A;  1W9S A;  4KI5 M;  4DEV A;  1GOG A;  4JX0 A;  1CZV A;  2VQU A;  1NKG A;  3LEK A;  1K42 A;  1ULP A;  2HYX A;  2Y8K A;  5LA2 A;  1JYX A;  4CUB A;  4BXS V;  3BGA A;  4QX0 A;  2EIC A;  5LA0 A;  2W94 A;  4D0Q A;  2VMF A;  1O8S A;  2CDP A;  1TVG A;  2XQX A;  1GOF A;  3A21 A;  3I2J A;  3VD5 A;  2J1V A;  1SG3 A;  2J1T A;  2JDA A;  4GWJ A;  1PMH X;  3VDC A;  4DXS A;  3K4Z A;  1JZ3 A;  1KGY A;  4BK4 A;  1JZ4 A;  2WN3 A;  3THD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...