1UY1A

Binding sub-site dissection of a family 6 carbohydrate-binding module by x-ray crystallography and isothermal titration calorimetry
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
132
structure length
132
Chain Sequence
SPIRRDAFSIIEAEEYNSTNSSTLQVIGTPNNGRGIGYIENGNTVTYSNIDFGSGATGFSATVATEVNTSIQIRSDSPTGTLLGTLYVSSTGSWNTYNTVSTNISKITGVHDIVLVFSGPVNVDNFIFSRSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE A
publication title Binding Sub-Site Dissection of a Carbohydrate-Binding Module Reveals the Contribution of Entropy to Oligosaccharide Recognition at "Non-Primary" Binding Subsites.
pubmed doi rcsb
source organism Clostridium stercorarium
molecule tags Carbohydrate-binding module
total genus 32
structure length 132
sequence length 132
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2004-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1uy1A00
5JR2A 3MO4A 3OGSA 3OGRA 3BN6A 1OF3A 1ULOA 4LPLA 2EIEA 2W94A 2VOTA 1JZ5A 4JKMA 2QQLA 4AG4A 4HG6B 2WUHA 4BK5A 1CZVA 4DEQA 1UXZA 4P00B 2Z4FA 3VD5A 4A41A 3T2PA 2WAAA 1US2A 2V4VA 4JKLA 3P6BA 2WO3A 1NAEA 4M4PA 3VDBA 3CQOA 1JZ7A 1UMHA 5J1XA 2VZOA 2Y6GA 4CUCA 4ZZ5A 2WZ8A 3T0AA 3C7EA 3I3DA 1PX4A 3C7HA 4XUOA 1YQ2A 1XNAA 2BERA 3E1F1 2WN3A 4GWJA 1WKYA 2LW8A 2XHNA 1JYNA 4DXSA 2W95A 4DUXA 3I2JA 2W5FA 5F7UA 1UY3A 2RVAA 2VJXA 3A23A 3DYOA 2E33A 3FL7A 2QQJA 3I97A 1D7PM 4GZ9A 1O59A 2ID4A 4QB1A 1GQPA 3IAPA 1KGYA 2E31A 2Y6JA 4TXWA 4CU6A 1K45A 2WQ8A 3MUY1 5IFTA 1EUUA 5HPOA 3WNOA 4A44A 1L7QA 1GOGA 5G04L 2JD9A 4A42A 4OMDA 3CZJA 1WCQA 4QAWA 2VZRA 3DYMA 2J1UA 3CKHA 2VZ1A 3JXSA 1K12A 2V5DA 1CZSA 3NQHA 1CX1A 3A21A 4QX3A 1US3A 3SEEA 3OEAA 2DCKA 4ARXA 3C8XA 5B4NA 4ZZ8A 4QB6A 2VL4A 1H6YA 1PMJX 2BZDA 4KWUA 4CU7A 4MO3M 4PT6A 4W50A 3ETPA 3LPFA 3MV01 2W1SA 2VZTA 1TVGA 4QX1A 4A6OA 2VQUA 3T09A 3VDAA 2VZUA 3PUIA 2C26A 1UY1A 3GGLA 3I2IA 5EJ1B 1JYVA 4CUAA 3OBAA 2QQNA 3K4ZA 3OEBA 3ABZA 2V72A 3DYPA 2J1RA 3WF4A 2J1SA 4BJ0A 1JZ3A 3SKVA 1JU3A 2QQKA 3P1IA 3ECQA 4W4ZA 1UZ0A 2WZEA 5C71A 3THCA 4QB2A 2VZ3A 3SEPA 2W9XA 4XUPA 2VZQA 2C9KA 4GWIA 4P5YA 1GNYA 3I3BA 5EIYB 4MADA 3K4AA 1JYXA 3BGAA 4MGQA 3LPGA 3WF0A 2VMFA 2JDAA 3HNYM 4RYDA 2VQTA 1NUKA 1UYZA 3NRUA 3T0BA 1NKGA 4P02B 1OT5A 2BGOA 2ZEYA 3OG2A 4E8CA 2VCAA 3AC0A 3EYPA 4LQRA 5DMYA 3LEGA 2VMEA 3A7QA 2EIDA 3ACHA 3NJVA 2VMDA 4KI5M 4QPWA 4D8MA 1UY4A 3D3AA 5JMOA 4QDSA 2WDBA 3FHAA 4XUNA 1SDDB 2ZEZA 2E26A 1L7RA 1EUTA 3OB8A 3IIIA 2BBAA 4CVUA 3HOBA 3I2KA 1OD3A 3T2QA 5CYYA 1CZTA 1O8PA 1JZ8A 3WF2A 2Y6LA 3HPNA 4JX0A 1P8JA 4JKKA 4OYUA 2YB7A 4E8DA 3K46A 4AAXA 5B4XA 4YPJA 1HN1A 1I5PA 2ZEWA 4XVHA 2Y8KA 1F4HA 2J1AA 1PX3A 3T08A 1GMMA 3VD4A 4LHSA 3EB7A 1IQDC 2X05A 1GUIA 2VC9A 2WN2A 3NJXA 4BXSV 1UMIA 1MPXA 1DYOA 1ULPA 3VD7A 1W9SA 2WO1A 2J1EA 5IYYA 3WF3A 5A1AA 3F2ZA 2YFZA 1R64A 1JU4A 4W8JA 4ET7A 5LA1A 2CDPA 3WNLA 3I2FA 4LKSA 4MGSA 4BK4A 1K42A 3MUZ1 4Z2AA 2VZVA 2W1QA 5I0DA 3I3EA 2W47A 1BHGA 1W8NA 2W87A 3LEIA 2OKXA 2RJ2A 2XONA 3K75B 2C4XA 2JKXA 3WSOA 4FI9A 2VCBA 4CU8A 1K3IA 4QDRA 4P08A 3W5MA 2J1VA 2WAOA 3LEKA 1JZ6A 3LE0A 4UI9L 4RN5A 1SG3A 2LS6A 1TG7A 3WNKA 2HYXA 2VCCA 3UESA 3UNPA 4ARYA 1W9WA 3IB3A 4QDQA 3OGVA 5C70A 2Y6KA 5LCWL 2VZSA 4UAPA 1UY2A 1DP0A 1JZ4A 3HEIA 5JXIA 5CZKA 2R7EB 4UOJA 2VM9A 5DQ0A 3C7GA 2VR4A 2QQOA 2VMCA 5HXMA 1GU3A 4ZXEA 2JE8A 3FN9A 2XQXA 3CIHA 4A3ZA 1JHJA 2W1WA 2DDUA 3WNMA 1UYYA 1W0NA 1JZ2A 5JXHA 4PF1A 2PQSA 4JHZA 3WEZA 3PUHA 2EIBA 2YC4A 3UETA 3CDZB 2BGPA 2WBKA 2QBXA 3A22A 3IDAA 4DXRA 2VO5A 4KMQA 1CIYA 2VTFA 3MBWA 2ZEXA 5G05L 3DECA 2X10A 1UX7A 4CUBA 2CDOA 3J7HA 4OZOA 2B9VA 1O8SA 3FHQA 1DLCA 2B4KA 3WNPA 2EICA 5IHRA 3VD9A 3WNNA 3U37A 3HJRA 4DXTA 4D0QA 5DPNA 2W3JA 3VDCA 1RYYA 3ACGA 3VD3A 2HLEA 1UXXX 1LNSA 5JUVA 3GM8A 3CMGA 5FUIA 5IFPA 4XUTA 3T2OA 2WO2A 3GXUA 2X09A 5IJRA 1UYXA 2DCJA 4BDVB 1PMHX 1W8OA 3ACIA 5JXJA 4M4RA 1XPWA 4OUEA 2VZPA 3I2GA 2YC2A 1GOHA 1OH4A 3WQBA 4A45A 1OF4A 4QX2A 1W99A 3ZM8A 5LA0A 2XOMA 3C7OA 3HNBM 3LQCA 2Y64A 3GDBA 1NX9A 1F4AA 2WYSA 2W91A 2L9LA 2WABA 5LA2A 4CU9A 2J1TA 2QQMA 3WF1A 3C7FA 1GOFA 3I2HA 3K4DA 3SKJE 4OMCA 2YFUA 1XC6A 2W46A 4XURA 1J83A 2J7MA 1JYWA 4MOAA 3HN3A 1KEXA 2W92A 4XUQA 5DN2A 4DUVA 1H6XA 3MV11 1XNTA 3ACFA 2KD7A 2ZXQA 3THDA 1J84A 1W9TA 4DEVA 4QX0A 4ZY9A 3W5NA 2ORXA 4L0PA 2RV9A 3NNGA 2Y6HA 2YG0A 3K77A 2ORZA 1T2XA 4A4AA 1JI6A 1UWWA 5EJZB 2W1UA 1SHWB 5C7GA 4IUGA 2E32A 2QQIA 1UY0A 3CZUA 4XZUG 5JXGA 3HNMA 4PQQA 4TTGA 2J22A 3T0DA 3IAQA 4DUWA
chains in the Genus database with same CATH superfamily
5JR2A 3MO4A 1SBEA 4S2HA 5DDJ3 3W58A 1D4M1 3BOWA 1OF3A 1ULOA 2XGXA 3H3LA 5D21A 2BWAA 1JZ5A 2DUOA 3DXTA 3PVOA 1G9CA 4JKMA 2QQLA 3Q9OA 3FBMA 5FWEA 1ULEA 1AZDA 3L2HA 4EWDA 2RMU2 5FFOC 1HV0A 2CAUA 2WYFA 1FOD1 1UXZA 1WCKA 2CV6A 2P6HA 3DV8A 2Z4FA 4GMP0 4NE9A 1SMVA 4P00B 4A41A 1QJZA 2ZPXA 4CE8A 2CGPA 3ZPOA 3O1PA 5M0TA 3SCFA 4KBBA 4Y3OA 5EPAA 3TYJA 5T5JA 5J1XA 4XJAA 1W8WA 5FR3A 3GBWA 5I8YA 1F31A 1PGW1 4Y5TA 2WZ8A 3T0AA 2E53A 3C7EA 2XVKA 5T3NA 2ZMNA 1PX4A 1JOPA 1YQ2A 1XNAA 4YW5A 1W2TA 1CAXB 4GWJA 1Z78A 3E6BA 3M3CA 1OC1A 1DYPA 1DQ0A 1WKYA 2CNAA 2XHNA 2IXCA 4RS5B 4XYXA 5FZ3A 4AQ2A 2D6PA 3KV5A 4DXSA 4BE3A 4I09A 2ET1A 2WT0A 4RA0A 4DY3A 4DUXA 5AC92 2YY1A 1HLCA 2E51A 2P5BA 1TMF3 1BYHA 2R0FA 3DYOA 3CJXA 3ROUA 4C90A 2K9ZA 1H8TB 5JPNB 2XLFA 5BNOC 2QQJA 1D7PM 2EXHA 4GZ9A 2D6OX 3RZMA 1IGOA 1QJEA 2OPWA 3RGBA 2ID4A 2XJVA 1V9U3 5F5IA 2JDYA 3JZVA 4M0NA 4FPOB 2VY0A 5GZCA 1K45A 2GALA 3I4IA 2ILMA 1H1IA 2WQ8A 4FPHA 1RVF2 5K0UC 1RMU1 2D44A 4X6QB 5FY1A 3VBUC 1ZRIA 4A44A 3WG1A 4D8MA 2WLQA 1GOGA 5FKCA 3TNPB 1QQP2 2PHXA 4I3PA 3CJIC 4Q4X1 1OLQA 5G04L 5FYZA 2JD9A 5LRRA 5LRSA 5LZ6A 2NP0A 4K8FA 1EAH2 4XBLA 3DYMA 2J1UA 4UWDA 1QHDA 2ZTNA 1MVEA 5FPZA 2H6BA 2DVBA 4MGKE 4IEUA 2ZGSA 3O14A 4NROA 4OVEA 5FP8A 1CZSA 4OLLA 5APAA 5L9RA 1OI6A 4RFT0 5FZEA 1VJ2A 2ZGRA 1ZBA2 4PLNA 4IE0A 4V2VA 1US3A 4YW7A 3SEEA 1GZWA 5F5AA 1KRIA 5IAVA 3AM2A 1OBNA 4UYBA 2IXLA 1ZZ7A 4FAHA 1Q8VA 4IEXA 1OSGA 2FZ1A 3ZSJA 4E9KA 4KWUA 3NNLA 4PDWC 4P9JA 1COV3 1OQEA 5KWRA 5FBZA 4QGNA 3ETPA 2BEOA 3E97A 3LPFA 1PZ8A 5GLTA 4HSLA 4Y26A 3AYCA 2VZTA 3H0OA 2Y0OA 4QHZA 1X33A 3RI8A 5J96B 3RQ0A 2C6SA 3QH6A 5A7WA 3T09A 1YFYA 4IE5A 2DWRA 4XJWA 1KDMA 4AHZA 4XMAA 4ZU7A 2J42A 2BFUL 2DCYA 2VZUA 2HWF2 4S2GA 3KZ4C 1OQDA 3WDYA 4WVVA 4EE2A 2ZX4A 2AENA 1R1ZA 3U0ZA 1O4TA 1NZIA 2RS32 4XQDA 2CAVA 1OQ1A 2J1RA 1QIQA 1IQAA 4IW3A 4XTPA 4XXPA 3BU0A 4HL0A 2OS2A 3R4SA 4AF9A 3OYWB 1VRH3 5FREA 4AI8A 4BWOA 3OUIA 2WFPA 1WBFA 2EXJA 3ES4A 1Z7S3 4GULA 4SLIA 1AR61 4W4ZA 3WDTA 2X29A 1N1YA 2JG8A 1EP0A 3IT8A 1UZ0A 1WZXA 5JOYA 4MUVA 5C71A 2XXZA 2HWD1 3LA3A 4W6YA 2WJSA 3BI3A 1W0OA 5LW9A 3T4HB 1GZWB 3SEPA 1LOFC 1BEV1 2VZQA 4CDXA 2AGSA 2UY9A 3JBG3 1ZA4A 4LO6B 2D97A 1CGPA 1ULFA 4OHYA 2QKDA 2QDRA 1PVXA 2RS53 5J09A 3I3BA 5EIYB 3LD8A 2AC1A 3K4AA 5A6YA 2IC1A 4FXGB 4JC1A 4CEYC 1GBGA 1GZCA 1SFNA 4LORA 2FQPA 5GZFA 5A7WB 2LTNA 4WZFA 1C28A 2R063 1MS8A 1G9BA 3HNYM 3VZOA 4RYDA 3N9OA 5C9AA 1UIKA 2FCUA 1QJU1 4JGZA 4AFBA 1OT5A 3ZSLA 2JB4A 1RTVA 4KU8A 2BGOA 2ZEYA 3OG2A 4XZPA 3GBFA 4EROA 1RUOA 3KT4A 2XB6C 3F95A 5EQUA 1PM7A 4A7ZA 1DQ5A 2JX9A 2R043 1C1LA 5FLIA 1H1AA 5DMYA 1UX6A 1NCRA 2BW8A 2VMEA 2WQZC 2EIDA 1HRV3 2VUJA 2VMDA 3LEGA 4PBOA 4PIZA 3D3AA 4QPWA 1DG6A 1A8MA 3N9QA 4FP3A 2VNRA 2DTYA 5GALA 3M3OA 1O5UA 1ZZ9A 3ORJA 1KJLA 5J98B 2ZA9A 1Q56A 1TME1 1PNGA 1GP5A 1QJY2 3J9SA 2ZGNA 1RUE2 2RDNA 4XJ9A 2RS13 2ZHNA 1QDCA 1EUTA 2IXIA 2UYAA 3OB8A 4BQ5A 2D93A 4TSVA 4QQ2A 2MPFA 2PMWB 4LHLA 2VECA 1OD3A 1UPSA 4CDXB 4BMEA 4Q0VA 1XU2A 3T2QA 4XW3A 5JIAA 4KBZA 5L7OC 2GMPA 1ZRRA 3WF2A 1PZ7A 2PHLA 1AX0A 3HPNA 4PI2A 4YW1A 3VZKA 1P8JA 4EN7B 5AC93 2YB7A 1HJGA 1ND2C 5I8SA 4AL9A 4QWNA 3ZYFA 4COYA 1RB8G 2HYKA 5C3OA 4DXZA 4HLTA 2NYYA 3AVSA 1LRHA 4B1MA 4AAXA 4IL7A 2GNBA 5FP7A 5A33B 5ACA1 4XVHA 5C9AB 3Q8BA 4WBBA 3PJYA 4NUBA 2J1AA 5EJ3A 1Q3EA 3BPSA 3D6EA 4LHSA 4N8MA 1IQDC 3TEXA 1FOD2 2VW0A 4COUA 3AMPA 5DDJ1 1MPXA 2Y33A 1Y3TA 2ZKLA 5A6ZA 1NY71 1NCRB 1ULPA 3ZOIA 2J1EA 1ZZCA 5FZIA 1QJX3 1JTZX 4L97A 3U14A 1YO8A 2WZR1 1QY4A 1R64A 4W8JA 2P3YA 2SBAA 2D43A 2FCTA 5FAXA 5CFDA 3I2FA 4LKSA 4MGSA 4BK4A 2PLV1 2Q5TA 5BYNA 5L36A 5C3RA 1D2QA 2VZVA 5I0DA 3I3EA 4BCUA 1O3SA 1BHGA 4QM9A 2W87A 3ZYRA 2OKXA 2OUHA 2CTVA 5FPUA 2IXJA 2Q8OA 1UOGA 1CAVA 2VCBA 3B9CA 1K3IA 1O4ZA 4QDRA 5FV3A 1POV1 2VULA 1C4RA 1BQPA 1HXS1 3AL6A 5FUNA 3ZKUA 2EVXA 3M3EA 3NNJA 1SG3A 1Q8OA 2CU5A 1AR83 1BK1A 2MEV3 2GU9A 1TG7A 2DUQA 2LS6A 2VCMA 3MLJA 5FZKA 3ZN4A 5BNNC 3UESA 1PGSA 3UNPA 3WDXA 2UYBA 1W9WA 1SCSA 4HK8A 3OGVA 3CNAA 3N7KA 2GN7A 3FHIB 3RFRA 4HETA 3WXPA 4UFKA 5JLVA 2VZSA 1UY2A 5LASA 4WM8A 1DYKA 1MS9A 1E57A 2ZAAA 3B5LB 4LLOA 5JXIA 2W52A 1RGSA 2YBPA 1NE6A 2ENRA 1RUI3 1WBLA 5C5UA 2XWJB 3C7GA 1WW4A 3K48A 1UZYA 2GC1A 4I0BA 5CB7A 1TMF1 3T1LA 3GHMA 1RUH3 5AFBA 3RWKX 1I5ZA 4LOTA 5ABJA 4LK6A 4ZXEA 2ZCWA 3USSA 3FWEA 2GZWA 3HBZA 4PIXA 5FWJA 4E4ZA 2FDIA 2QJVA 2W1WA 4RQPA 2YU2A 4AZZA 2NMNA 2YPDA 3HQUA 4W6XA 5CFDB 2H6CA 2E7AA 3TN93 3NMBA 3VBSA 3D5OA 3AKTA 1LEDA 5JVVA 1B09A 2CL2A 2PQSA 4I0AA 4CDQC 1TNRA 3NL1A 2D6LX 1CAVB 2CGOA 3OCPA 4NN0A 1VBE1 1WMDA 5HCAA 4FO9A 5FYBA 3DUIA 2GC0A 1MZ6A 5DAPA 5F6LB 3MFAA 2QBXA 3H9AA 4MGYE 1AYM3 3A22A 4QKFA 3IDAA 2EIGA 4DXRA 2VU9A 1BMV2 2BNNA 5HCFA 1CIYA 3MIHA 3KCXA 5JIUA 2Q0AA 3GYDA 5JI7A 2P1BA 4WM8B 4KG0A 2R1DA 4UT5A 3RZHA 2DTWA 2ZEXA 2ZZJA 2BRTA 1KXGA 2BP6A 2C1FA 4XFBA 5EYXA 1UOFA 4Z2WA 2Y0IA 1QOTA 4R4ZA 1E5SA 1S2KA 1W90A 2B9VA 4RGAA 3WW2A 1X50A 4QPGC 1VBD2 1YYNA 1HB1A 1WGPA 2B4KA 3M2MA 5IVFA 1XYPA 3ILFA 2Y26A 2GMEA 3KV6A 3WLUA 3EBRA 3IBMA 4MZUA 3VD9A 1COV1 4XHXA 4YGDA 1NXD1 3KSCA 5FPLA 3OPTA 4ZXKA 3VUOA 4DMIA 1XSRA 1H2LA 4CPBA 4Z8BA 4A2UA 3O1UA 3VBSB 5DPNA 3UT0A 3H50A 1OUXA 3K2OA 3VDCA 1G9FA 4ZPIA 4YYOA 1V70A 1FMD3 2HLEA 3FLRA 3KV4A 4NHLA 4A6SA 4GWNA 3VBHA 5IWFA 2C24A 1LNSA 3ZSEA 1YWKA 4PJYA 3AMHA 5IFPA 2ZMLA 2O8OA 4XUTA 4AI2A 5IVYA 1SLLA 4XABA 5IK8A 4HSJA 4KU7A 4QT6A 3VKFC 2HWD2 4GWMA 1ASJ2 2DCJA 4P14A 1V6JA 3DPRA 1PMHX 1RJ7A 3O1VA 3I3MA 1BEV2 1HRI3 2E9QA 5BUVA 4OUEA 2FD8A 2IVJA 1VMJA 2LM3A 4AW7A 1VBA1 2YZ4A 1Z7S1 1OMIA 3IDBB 1GOHA 1GWKA 4P9YA 1TQ5A 4YW4A 5KHJA 4IEOA 3NNFA 2ZZQA 1U0AA 4UFIA 3WCSA 2YGMA 4ISRA 4A45A 1UQXA 5A6QA 3VL9A 4WVZA 4D7TA 5A3TA 1BBT3 4LNVA 4L8QA 3K51A 4AGGA 1W99A 2ZHKA 4GH4C 1AL22 1VBB2 1UN1A 3JBG1 1Q8QA 2RDQA 4GB33 4BYYA 5JWPA 2G1MA 1ENSA 1YIPA 3R4DB 2DUPA 4CPBD 1C5HA 2RS51 1FX5A 5E1RA 2XJTA 1LHVA 1NX9A 1W8ZA 4Y1YA 4PHZA 1JMUB 2VOXA 3JUUA 4JAAA 2P2KA 5LA2A 5J48A 2R061 5A7SA 4IEPA 1OOPC 3VKNA 1XYOA 4MX3A 2YFUA 3AL5A 2V4AA 3H7JA 3VBHB 3WOGA 3SC7X 4QQLA 2TNFA 4XURA 2J7MA 4RFRB 4AI9A 5T50A 2R041 3OPZA 1U5YA 5HCBA 2ZS6B 3DPRB 5FYYA 3NV4A 4NAMA 4ZONA 3VKOA 4AVSA 4COVA 3DXUA 1YRZA 3D4KA 3AKSA 2HEVF 3TEWA 3AYEA 3OY8B 2IXKA 3PTRB 5DG2A 2AEYA 4ISQA 2P6CA 3GZUC 2FMYA 1W39A 1O6UA 1POV0 1W9TA 4ZS2A 5A7OA 4ZY9A 1IPSA 4K40A 2RS11 2E7TA 3ENRA 2QFEA 2WNVC 4L0PA 3ZFFC 5LY1A 4FPJA 1LENA 2BDRA 5I0SA 2QCSB 3N7MA 5ACA2 2VOKA 1FV3A 1LU2A 2ARBA 5K4LA 3THPA 3AP9A 4IEZA 3PU3A 5AC91 1UZVA 1UD1A 4N7IA 4YZ5A 2JE7A 5GZGA 2KR2A 4OQ9A 1KJRA 3TWIA 1MZEA 2WNUC 3L2YA 3PIJA 1F9KA 4FPLA 4XMIA 4UW3A 5DDJ2 5F9TA 5IVCA 3TEZA 2E32A 1N1TA 4XJZA 3I49A 1LEMA 1NY72 2X5IC 4WM7C 4ATFA 4XZUG 5FZ0A 1O3QA 4K20A 1A34A 1MS4A 3LA2A 4E2GA 1VBC3 5KHIA 4KL1A 5FIXA 1U5IA 5FPXA 1L7LA 3OGRA 4XIOA 2C9AA 3CU7A 4LLFA 4LUMA 2PTMA 4DQAA 5CFCC 4R52A 4Q0UA 2EIEA 2W94A 2QNKA 2VOTA 1RVF1 4AGRA 5C8CA 1KITA 4D6RA 2PHFA 1QJX1 1NZCA 3AKPA 4HG6B 4NAOA 1H2MA 4E4HA 2FDHA 5KXBA 4QU1A 4M3CF 4AFDA 3KHBA 3B94A 2WFF3 4BK5A 4LKDA 5JZGB 5C4WC 1J1TA 3MDPA 4CCJA 4ASMB 5A70A 1QQP1 2VD7A 4HMZA 2ARXA 5FZFA 2VAUA 3LWCA 3VD5A 2BBVA 2JKBA 2WAAA 3KLSA 1US2A 1JUHA 2JEMA 2V4VA 2EXIA 4JKLA 5FYHA 1JOJA 5GLWA 1XE8A 3ZSMA 3ZMOA 1UMHA 1JZ7A 2R49A 3ME2A 4NIAA 4C8DA 2VUCA 2P34A 1S1AA 4D7SA 2OZJA 2VZOA 2Y6GA 1LGBA 4XF0A 3ZYGA 4Y33A 5FO7B 3CL1A 4LR4A 2WIIB 4D3WA 2VVFA 4M3CA 4CP2A 1TMF2 4ASLA 1WCSA 3E1F1 4YZ3A 4B29A 3AVRA 1FT9A 3LKJA 4UFHA 1N1VA 5A7NA 4YG6A 1YI7A 2LW8A 4WV8A 1SFPA 4S2DA 4M0HA 1UPIA 4URTA 4OHZA 5IVVA 1S0GA 2W5FA 1RUI1 3DL3A 3ZYIB 1V9U2 4I2OA 2RVAA 2VJXA 4HT1T 4IEWA 4L99A 3A23A 3FJSA 1RUH1 2YGLA 4AVAA 1N3OA 3RZZA 2HWF1 3KWVA 1R083 4RGGA 3AMNA 3FL7A 3SCHA 5C8CB 1C3HA 3AXDA 1WLCA 4I3GA 3WUDA 4OHWA 5BNPA 3W21A 1PK6A 2RS31 1CJPA 1O59A 4XFAA 4MG2A 1MS0A 3IAPA 3ILRA 5FJHA 4N9HA 3HIFA 3MI8A 3QOPA 3TN91 2Y6JA 5C3SA 3BKZA 1OKOA 3JD73 2BFUS 4FFHA 4LBNA 4S2FA 5F2WA 1YEWA 3R05A 3ES1A 4BU2A 1UOJA 2OUJA 1CD3G 4EZ4A 4IXLA 4XACA 3BODA 4QPIC 1NXMA 5HPOA 3UKTA 4AEDB 2JE9A 4QMAA 3JB8A 4XFIA 3WNOA 4HFSA 3J8F3 5FQ0A 2ZAHA 4XQWA 1UMZA 4R8HA 5KXEA 1AYM1 4M3CB 3KHCA 2WS93 3FC0A 4ZU4A 4A42A 3CZJA 3MF9A 5A1LA 1WCQA 4Q4V3 2JG9A 1NQJA 2VZRA 4BQXA 2BOJA 3IZOA 1COV2 3UK9A 4MXWA 2W0XA 1EPZA 1CX1A 3A21A 3OUHA 3NSTA 1QNYA 4QX3A 3ZXLA 2JDMA 2DU0A 2WO7A 3OEAA 2EF6A 2DCKA 1U12A 3KGLA 2WA4A 4HVQA 4FAGA 1EPWA 4AEMA 4ZZ8A 4GALA 2VL4A 1SLCA 1ZYBA 3FMGA 3WT3A 1SDWA 4CU7A 4WVWA 5BNPB 5GZEA 4PT6A 1PK6B 2WWSA 1I3HA 1TVGA 2PHDA 4Q1PA 4ZS3A 4QX1A 1BJQA 2VQUA 4E2SA 3LFMA 2W2IA 2F4LA 4A7KA 3VDAA 1RITA 1B35A 3VBFA 1XE7A 1VRH2 2E63A 3LF7A 3GGLA 4XAAA 3RI9A 1X9PA 3LGRA 4CUAA 2VXJA 1QJY1 3OBAA 4Q0QA 3NV1A 5FOJB 3K4ZA 3RYKA 1RUE1 4AGVA 1LECA 2JD4A 1BZWA 1ZBE3 4FP2A 4W6WA 3WG4A 4KQ7A 2J1SA 3W59A 4FSJA 2WWJA 1HRI1 4IQPA 3PUSA 4J6GA 1QEXA 3WHTA 2BUKA 3MW2A 1JZ3A 3JBG2 4O61A 3KB5A 2Z79A 5KXDA 4HZFA 3VL8A 4GA9A 2CYFA 2RS52 4MGIE 4OUSA 2BJSA 4MXWB 4XPVA 3THCA 1H8TA 3ZXKA 1IHMA 4QB2A 3O7OA 3PUQA 4NMIA 4XUPA 1BBT1 2R062 1MEC3 1ENRA 2HWE3 1O5LA 3KT7A 3OOXA 4GWIA 4LULA 3H8OA 3H7YA 4GB31 4P5YA 3ON7A 3PVNA 1HQWA 1PMIA 2RJLA 4XFGA 1W3VA 4BH9A 3LSDA 4K7JA 5FXWA 2R042 2VMFA 5IW0A 3WG3A 1GANA 1T6GC 5DAXA 1HRV2 3UJQA 1IPJA 1B35B 1UYZA 3NRUA 4P9GA 3VBFB 3POEA 2ZX3A 4DPNA 3T0BA 1NQDA 4P02B 1SFYA 4DB5A 5FZLA 1DQ4A 4XDOA 3THTA 3DCQA 5FYIA 2RS12 3VDDC 4HN0A 1CONA 3AMMA 3ACHA 2OZ6A 4KI5M 3GZEA 1OA2A 3VBRC 3AP4A 1NLSA 1N3QA 2ETEA 5FZAA 4NHXA 5EHDA 4NR1A 3AZWA 1SDDB 4R9AA 1PO13 4Y5SA 1L7RA 3NW4A 3ZXEA 4FFGA 1AXKA 5I8TA 2YHJA 1BVVA 3HWJA 4XF3A 1GR3A 5FZOA 2D7FA 2A6ZA 4Y1XA 5JMCA 3BUCA 4FTSA 1S0JA 1XBFA 1NA1A 3POFA 1O8PA 2D5HA 2Y6LA 3KM5A 4JX0A 4JKKA 4OYUA 1FYUA 3O1MA 1NT0A 3AK0A 2DCZA 2BYVE 3VN4A 5GLZA 1W6PA 1S0FA 3LEMA 2WT2A 1X9TA 4CCOA 1GNZA 2V09A 2JG8C 1Y9MA 1QJX2 4C1XA 1PX3A 3EJKA 1GMMA 3T08A 3KD4A 3SNMA 1URXA 2BPA2 3EB7A 2VPVA 3EQEA 4K8RB 5FMBA 1CPMA 2GNMA 2WN2A 2VQAA 1ACCA 2B46X 1GICA 3NJXA 1XNKA 5EXOA 3OYWA 3OSDA 1W9SA 5IYYA 1XNDA 3JB4C 1AR93 3ZX7A 2AR6A 4YVSC 2QZ3A 3KV9A 4OUMA 3F2ZA 5A1AA 4QHOA 1AVBA 5FJKA 3BVCA 5FYTA 1QH7A 4ET7A 4YW3A 3BIEA 1TEIA 2WFF1 3WP6A 4ASKA 3R6SA 1LGNA 2MEV2 4JDOA 1AR82 1H4GA 1ONAA 1GP4A 2W1QA 2WT1A 1BMV1 2BV4A 2AH2A 4DY5A 1W8NA 3LEIA 2RJ2A 2XL7A 3MW4A 4Q1RA 1M4WA 1H2NA 3KT1A 1OLME 3BOPA 4JGZC 5FZOB 1LB2A 1U5ZA 2DBIA 4FI9A 4CU8A 4NOTA 3W5MA 2Q8CA 2J1VA 2WAOA 1S2EA 3LEKA 1NA1B 1W05A 4QXHA 4QHBA 1Z0HA 2UWCA 2FZ2A 4UI9L 4RN5A 1SLBA 1IG0A 1BK0A 1IG3A 1RUI2 4Y1ZA 2AREA 3GHNA 3TB0A 2VCCA 3CEWA 1XJAA 3T2TA 2IFRA 1OVSA 1W6PB 3U07A 3ZIWA 1VBD1 1RUH2 1SACA 4ARYA 2Y6KA 5C70A 3LFIA 3AMQA 3N9LA 3WCRA 5IATA 3SLIA 4COZA 1WW7A 1GWMA 1Y43B 5EWSA 3IDEA 2GNTA 4N9IA 1VB2A 5CZKA 1A3KA 4EWEA 2B9UA 5KC6A 2PAEA 3BB6A 4NO4A 2K2SA 3TN92 2XJRA 1T6BX 2A71A 2HJIA 4B4QA 5L73A 1IOAA 4MHRA 2D3RA 4Q4W3 2VQ0A 5HXMA 3W9AA 2VUDA 1R081 2DVFA 2LALA 3T30A 1ZRDA 3CIHA 4GAZA 1LOGA 3BTYA 3WQ0A 4YM0A 3HMYA 1LKNA 4CP9A 1ASJ1 5HXVA 4CXWA 5BNOA 1Y9QA 1JZ2A 1RUD3 2WKKA 4UFJA 4NIIA 1AYM2 1ODMA 5A3LA 4JHZA 2PXJA 4XHBA 3VKLA 3PUHA 5F5CA 2YC4A 5J36A 4XCAA 4N53C 4Y4RA 3N4MA 5CG9A 1IZ3A 1DZTA 2BGPA 2IVIB 4AQSA 3BIWE 1G8WA 3GCXA 2BGCA 3J8F1 5K0UA 2RM22 2YYOA 5GM0A 5CADA 1ULGA 1QXPA 4C0BA 5C6CA 1W28A 1N1SA 1DGLA 2UURA 1UOBA 3AP7A 2WS91 3ELNA 3PDQA 2VO5A 5F39A 1AL21 1VBB1 5L9BA 4KMQA 4MSVA 3U78A 1GQHA 2YROA 3LB9A 1LOEA 5FKBA 4NVPA 2DVAA 1H9WA 1J1LA 5EZWA 3RZKA 3CJIA 2XHKA 1UCXA 1W04A 2A5ZA 4LE4A 2R32A 1FPN2 1REFA 2YDEA 1RXFA 4XQ4A 4YG3A 2OYZA 4CUBA 4DOUA 3U1XA 3PURA 3WP5A 3O1OA 3W20A 4OZOA 4LMFA 5LA9A 1AYN3 3WNXA 3FHQA 1UU5A 1FMD2 1CWPA 1H9PA 1DGWA 4AK3A 4U2AA 1STMA 3JCIA 4GQ7A 3HJRA 4CP9B 4X6RB 5BNOB 5FXVA 2FDJA 4R9DA 1DLLA 4JQTA 5E16A 1XQNA 2W3JA 3AZVA 3UYJA 1HIXA 1MS1A 3VBOC 3PVBB 3ACGA 1HRI2 3VD3A 2JDKA 1H2KA 4BQ2A 1UXXX 3MFCA 5CIRA 5JUVA 3PJQA 3GM8A 1CPNA 2OXBA 5FUIA 2JDPA 2A6XA 2Y34A 3KF5A 4OFGA 1TNFA 1GZ9A 1WA6X 2WRAA 3RYPA 1ZBE1 4CP0A 3DGTA 5K0UB 3LCPA 3E5QA 4LBLA 3TBDA 3VBUB 3ZDSA 4BDVB 2ZMKA 3T4VA 5JXJA 4IE7A 2QZ2A 1BBT2 4FPKA 4LUKA 4RQPC 3RZLA 1XPWA 3M3QA 2VZPA 5HCHA 4TZDA 1UNBA 2YC2A 1Y9GA 4GB32 3PNAA 4JV4A 4COWA 5A7PA 3CJIB 4E4DX 1CAWA 3ST7A 4EQVA 3WQBA 5DUXA 4EWAA 1ND3C 4PLMA 1JW6A 4NHMA 4EZHA 5CBLA 4IEYA 1YC61 5D8AC 2A6WA 4NPRA 2BVBA 1PGL1 2NQYA 1IS4A 4RL7A 4AXOA 4GKXA 3QH7A 3ZM8A 1X7NA 3RMXA 4YVWC 3H1WA 1O91A 3U75A 3ZKYA 4XCBA 1LOFA 3LQCA 3Q8FA 3GDBA 5CKMA 2BNOA 3KS7A 4QQPA 4BIOA 1F4AA 5LBEA 3D8CA 3FFQA 4OHXA 1UYPA 2L9LA 3WR0A 1DDLA 3WF1A 3C7FA 3UKNA 5A33A 1W6OA 1PVC3 2XJUA 4CEYA 3POWA 4QX8A 3M3IA 4YLZA 4UW5A 3JQXA 3PVEA 4IV1C 1IS3A 3H42B 5CVRA 4Y1UA 3NVCA 2W39A 1PHMA 4AHXA 3Q8AA 1IPKA 5E6HA 4BPZA 4HONA 1MQTA 4KGGA 3PIGA 2XVLA 4DUVA 2PFWA 2DFCA 4TLGA 3MV11 1S0DA 2HWC3 5FY5A 4F83A 1CAWB 5JI9A 1PO11 2R6QA 1NCQC 1WWYA 3I7DA 4QX0A 3V64A 2FDGA 5CA6A 4Q0SA 3ZDVA 3BTXA 2DVGA 1X8MA 2ERFA 2RV9A 4JRLA 1X36A 1RUF3 4IGQA 5FLJA 1N47A 1EV13 4UBGA 3WVJA 2Y6HA 1V9U1 4AVTA 2ZBJA 1VBC2 1ZZ8A 3DPRC 2AZ5A 1T2XA 4A4AA 5FK8A 2XJQA 1V6LA 3ZN5A 3NAPC 1S55A 5EJZB 3CLPA 1FNYA 1SHWB 2JECA 4IV3C 5C7GA 2ET7A 1JH5A 2GP3A 1ND2A 2XDVA 3VHPA 3V0BA 1W6OB 2D6MA 3VZNA 4CEYB 5JXGA 4V1PA 4FVVA 3IKWA 4RHV3 4FOWA 1S0EA 1YQCA 2WFF2 4O9GA 5LBCA 2J22A 3RZGA 1FI2A 1G7YA 4DUWA 1CR7A 4CCLA 3OGSA 4XF9A 2D6NA 3BN6A 3KQRA 2RDSA 5FK7A 5T52A 3AKQA 1UZWA 1JHNA 2HWB3 4N43C 2Z42A 1MQTB 3T3YA 4XF1A 1RUJ2 1AR91 2QDNA 2RG4A 3AFGA 4R9CA 5IVJA 4JZRA 4AAPA 2WUHA 2QQPA 3I3QA 4Q4Y3 5F3CA 4CEWC 2XH6A 5SV8A 4JHTA 1CZVA 2RM23 4P9IA 4JDNA 1K5MC 1VP6A 3P5BA 3POJA 5FZ7A 4CDWC 1UF2C 4OHVA 2XJSA 1F2NA 3T2PA 5LEJA 3ZFGA 1NAEA 4LBJA 5FYSA 3VDBA 1XU1A 4LBKA 4LK7A 4YG0A 3ZFEC 4BQ1A 2CY6A 4A3XA 1RUC2 1ZREA 1YUDA 4L92A 5A7QA 3X29B 1JS9A 5LK7B 1FPN3 4AHWA 1UZZA 2XMLA 1QXJA 4ZZ5A 1HQNA 4AEJA 1QXRA 3IMNA 3SH4A 3I3DA 4IE6A 4MVTA 5L7OB 3BCWA 4J1WA 4RR3C 4BQYA 4RD7A 2VGDA 4KWJA 5C8WA 1R082 1ND2B 2R073 5BNNA 5HV0A 3V0BB 2D98A 2NZ9A 3ZSKA 1YLLA 4Z1VA 1JUIA 1VAMA 5EFUA 1OXCA 2ZKNA 3I2JA 2DYCA 1UY3A 4CYDA 2QTWB 5F7UA 2WR9A 4LO8A 2GAUA 3WW4A 3ITQA 2GH8A 1AHSA 2E33A 2CHHA 3GBGA 3FE5A 3JD72 2WZPP 1VRH1 1CVNA 3HAGA 3OY8A 1RUG3 4JGYC 1C5IA 5AVAA 2XVGA 5H9PA 4PBPA 5F3IA 4D7YA 1DIWA 2W08A 3HT2A 5L19A 4ITCA 4QB1A 1GQPA 3O0XA 1MS5A 4CUGA 5FZ4A 1KGYA 1QOSA 2JJ6A 4O9EA 3G6JB 3J8F2 2Q8DA 3ZFGB 1Q5OA 3HBKA 1DGWX 3MICA 4HVOA 5FUPA 2WS92 4P9XA 3ZYJB 3GZTB 2ZABA 4GIQA 1BKZA 2AEZA 5FY7A 5IFTA 2A3YA 3GNEA 4QD2A 4XE9A 4H7MA 4Q4V2 1CQ9A 1DU3D 2A70A 4EJRA 1S4CA 1W8HA 5A3MA 2CWMA 1LU1A 2W68A 3VHNA 5C8CC 5F6KA 1AL0G 1D4M3 1W2NA 1XB9A 1GV9A 1Q8PA 2I07B 2UWAA 3M4FA 4LBOA 4Y5Z0 5FLHA 3ZR6A 1WLTA 4AVCA 1WCUA 4I01A 4ZKTB 2FDFA 3Q8EA 5BNNB 1YQ5A 4TN7A 3I2OA 2EAAA 3B02A 3CKHA 2VZ1A 2ZGMA 3JXSA 4NJ4A 4OI2A 1RIRA 3NQHA 2Z2SB 1O4YA 3LDBA 3H8UA 5E88A 3WX5A 1GWLA 1XSQA 3MIGA 2PAKA 4AFCA 1HRV1 1WCDJ 1JN2P 5CISA 2XLGA 3C8XA 3URFA 4UF0A 1AYN1 5F3EA 4AR2A 1VIWB 5HV4A 1DZQA 5IK7A 5A32A 4Z92B 1H6YA 1PMJX 2BZDA 3EXUA 4LIUA 4XIKA 4BA6A 4CRQA 5JZGA 5J37A 3B7MA 1Y7BA 4W50A 4Y4YA 3MV01 2W1SA 5F32A 3PUAA 1QDOA 4QPGA 3WQ1A 2PHUA 3OGJA 1SPPA 5EV7A 1PO23 1ZBE2 5GKAC 2AYHA 4YGBA 5CNAA 1C1FA 3ZXFA 3MZHA 2XBO3 3EMRA 3OTFA 1W03A 1SLIA 5T5OA 2XPJA 1S0IA 1VMFA 1OPOA 2RHPA 3PUIA 1ZZ6A 4NRQA 5EJ1B 1JYVA 1DQ2A 1W6QA 4NIGA 4XF4A 2PAMA 3S6PA 5JR7B 3OEBA 4CDQB 4EN0A 4CCMA 2V72A 2B5HA 4XOGA 3NKTA 4K1ZA 3USUA 2TBVA 4BJ0A 3UV9A 1J59A 4QQOA 3MF6A 4X8PA 1HDKA 4IEVA 1PGL2 1MEC2 2HWE2 3A4UA 4GXLA 1WLWA 2BVVA 3KF3A 4C1WA 2FCVA 3ECQA 1D0HA 1REDA 2RJKA 3D0JA 5F1RA 2WZEA 1CIWA 3AJZA 3LDKA 4JCKA 3POBA 1LHWA 2JWPA 4MXVA 1KDKA 1ALYA 4C91A 3BALA 5FP9A 3ZPYA 1QH6A 3WD5A 2C9KA 4UF0B 2ZGUA 2A6VA 5A32B 4SBVA 1RMU3 4B7EA 2Q8EA 1F5JA 1GNYA 4YM3A 5FTTC 1J3QA 4CXYA 4QPGB 3BGAA 1JYXA 4D6QA 4GH4A 4BIFA 1SPPB 1H4HA 1EYBA 4QPYA 4YNIA 5A1FA 1RUJ3 2JG9C 1YNAA 4Q4X3 3WV6A 2O8QA 1GSLA 2Y38A 4CA9A 1O7FA 2VVEA 3POIA 4AEDA 1QWRA 1NG0A 3LAGA 4AI1A 1NKGA 4H55A 1W6QB 2MEV1 2WNEA 1AR81 2NMOA 4QKNA 2HEYF 4MGZE 3WQ7A 4CDUA 3DKQA 1PO12 1RXGA 2BOIA 3WHUA 3Q8CA 4NRPA 2OW4A 2VCAA 5IVBA 2JDHA 3EYPA 4ZU5A 3KVBA 4LQRA 3USUB 4NIDA 4AEKA 1UIJA 4META 3E6DA 3NJVA 3V65A 1RUC3 3J26N 4G3YC 1UY4A 3WP4A 1H8VA 3AP5A 4QDSA 3C3VA 5H9SA 3N9NA 1TE1B 4XFFA 3G7DA 4NHYA 4XUNA 4E2QA 5I0RA 1SBDA 3WW3A 2E7QA 1YI9A 2P4EA 2ZEZA 1WD4A 2E26A 3D82A 4UW6A 3TNQA 3LDRA 3FX3A 2VNGA 3IIIA 2BBAA 3VZMA 3HOBA 1OD5A 4FPCA 4IESA 4PI0A 3OPWA 4UXAA 5ISLA 3MPBA 5FZ1A 1V00A 1YFUA 5CYYA 4YRDA 4XFCA 1CZTA 4EN9B 1JZ8A 2C5DA 1EV11 1I9RA 1SEFA 2WNVA 5I93A 1OFNA 4RS5C 4E8DA 1FV2A 1KQRA 3J7LA 4GH4B 4XDPA 4LT5A 3K46A 3ZYBA 3C2UA 3PMSA 4K21A 3LA7A 4YPJA 4LO4B 1HN1A 1W6NA 1I5PA 2ZEWA 1AR92 1H30A 4HOOA 4KNCA 1F4HA 3MW3A 1W2AX 1H8TC 1AR63 2X5IA 1MZFA 3PLQA 4WM7A 3QD6A 5FXXA 4BLIA 4CDUB 2VC9A 4K9SA 1OOPB 1HB4A 1C8M2 2MNGA 2OVUA 2KA3A 5FP4A 1CJDA 1UMIA 1DBNA 4CCDA 4BQWA 4UFLA 1DYOA 3PL0A 4CSWA 2V73A 4BHPA 5CG8A 4AYUA 5EYYA 1W6MB 3J7MA 2FHRA 4DRRA 2VMGA 5CFCA 4HANA 1JU4A 5JSPA 1GP6A 2ZX1A 5LA1A 2DU1A 2VOVA 5FZMA 2RDRA 2RM21 3MUZ1 5FXZA 4Z2AA 4BB3A 3I2DA 4YFWA 2W47A 3I59A 4O7XA 4YGEA 3VV1A 5C4WA 3LOIA 3OGGA 2X53S 3K75B 2JKXA 3WSOA 3RJRA 4GD4A 2NLRA 4P08A 5LBBA 4L11A 4YZ4A 2R0HA 1JZ6A 1FPN1 4HXCA 1AF9A 1QJU3 2WNVB 4FXKB 1KFXL 1FXZA 2PELA 4HN1A 1OKQA 2ATFA 3ZFFB 2BU9A 3AJYA 2EA7A 3QLQA 4IGOA 4QDQA 2YUEA 2XUMA 5JSOA 1F35A 1RHI2 3H3UA 4YZ1A 5LCWL 2ZX0A 3HD8B 1FMD1 3IN9A 3LIHA 4Q4W2 4EN6B 1W6NB 1DP0A 2BQPA 4PF5A 2RE9A 2XLAA 1V6NA 2WNUB 3HEIA 5GJ6A 4DRVA 4BXFA 1WW6A 2VBPA 1VB4A 2R7EB 4UOJA 3QBQA 2X5IB 4WM7B 2P37A 5DQ0A 1TME3 5DXDA 2F17A 1YCIA 5CKNA 1AJOA 1RUD2 2VMCA 3FBYA 4QX5A 4UW4A 4AI0A 1GU3A 3LOBA 2JE8A 3FN9A 3CF6E 1HX6A 4K6BA 1RUG1 2PHTA 2XQXA 3BPZA 3INAA 4FPFA 2BWCA 4QXBA 1L3JA 1XNBA 5D2AA 4DS0A 5CFCB 5C5TA 2DCTA 2WWUA 1OURA 1OFSA 5FPVA 3MGUA 1R093 1PZ9A 4ES9A 2O1QA 1QF3A 4PF1A 4FCAA 3I59B 3S5QA 2LROA 1ODNA 1GYKA 4XILA 5CKQA 3WEZA 5C4WB 1HV1A 4CP1A 3UETA 1FNZA 3CDZB 4NHKA 2VNOA 4QKBA 5FZ9A 5A6XA 1ZVFA 2D3PA 3ATGA 4XEZA 2P3KA 1MACA 5FY9A 1S2BA 2XKPA 3OD0A 4NPMA 4QPIA 2PN5A 3AZXA 5FYVA 2CGNA 1AYN2 5FZGA 4O65A 2VTFA 3MBWA 2VNVA 5LK5A 3O1TA 2B7YA 2WZR3 2OIIA 3TAYA 2PLV3 3HN1A 2X10A 1UX7A 4BMBA 2FDKA 2CDOA 3J7HA 5KXCA 4JRAA 2P3JA 1O8SA 4XTMA 3WDUA 5FY8A 1SLAA 2EICA 3PU8A 1W8TA 1ZNPA 3MIFA 3OBTA 3U37A 3CBNA 2IFWA 1POV3 1HXS3 2WINB 2XUEA 3UGHA 1DZRA 4D0QA 4TYSA 1PO21 1AR73 5FZ6A 2XBO1 3FLTA 5D1IA 1W3XA 3APBA 1RYYA 4YM1A 4DFSA 1RUNA 1XYNA 1IKPA 4XXAA 4RSUA 2DVDA 2DV9A 3CMGA 1Y4WA 4FOVA 3KMHA 4XFHA 1RC6A 1W9FA 2XWBB 3RJ2X 1NYWA 4LHKA 2X09A 5EP9A 5FBJA 4KWKA 4PQ9A 1UYXA 1S0CA 4Y22A 5IJRA 3RMYA 3ZMNA 5JOWA 1LHOA 4K1YA 4QPIB 2JXAA 2OX0A 3KGZA 3V0AA 4M4RA 1OHFA 3HR9A 5J7MA 1VBC1 2RR13 2YMZA 1RJ8A 2VMIA 1OH4A 3R4UA 4X8NA 1R1A3 4CDXC 3AB0A 1UL9A 2WNOA 3ZYHA 4EN8B 5BXXA 1OF4A 1PIV3 1LGCA 3CO2A 3GCWA 4Y24A 3TOJA 4QX2A 5JPMB 1A8DA 2Q30A 5FMDA 3S57A 2A6YA 1PVC2 3M70A 4CCEA 5LA0A 2XOMA 3ILNA 4N7UA 1YQ8A 1BCXA 1ZA7A 3HNBM 4QU2A 1C8M3 1VBE3 1APNA 2CWSA 3B69A 5C9AC 3I8TA 1VPHA 2DBNA 1V6MA 1UU6A 2NPIA 2VW1A 1HQLA 3SQOA 2WABA 4HK9A 1J3PA 1LESA 1Q8SA 3FUOA 2J1TA 1RUJ1 2QQMA 4A7YA 1GOFA 3I2HA 2JB8A 2HKXA 2KM2A 3SKJE 1NLQA 5ERLA 2PYTA 1NCRC 4XAEA 1VRBA 5FMOS 4HKLA 2HWC2 3HT1A 1NE4A 1ST8A 1OLMA 2ZGLA 3ACLA 3I54A 2QQVA 4IGPA 3MLLA 5CEHA 4K3UA 3O5SA 5CAZA 4Y22B 2IWGB 4AVVA 1ENXA 1OVPA 4JDMA 1KEXA 1RUC1 4H3WA 5DAVA 2R16A 5DG1A 5DN2A 5T55A 2CSGA 1XOYA 5DAWA 1RUF2 3LZZA 2ZGQA 1XE0A 1XNTA 3ACFA 3E5UA 1EV12 2KD7A 2ZXQA 3VDDA 3VKMA 4C0HA 3WG2A 3NJZA 1W2OA 1J84A 2H0VA 1RHI3 3IIAA 4IDZA 2TEPA 3HVDA 2YBKA 3VBRA 2JIGA 1A6CA 2PHRA 5IAXA 2WLPA 5A80A 3GJBA 3W5NA 2ORXA 4F7ZA 3ASIA 3NKGA 4P9LA 1HB3A 4LOSA 2HEWF 3NJYA 3NNGA 3ZLIA 5F37A 3TEYA 2WA3A 3AX4A 2YG0A 4RHV2 2ORZA 4OCTA 3VLBB 5DABA 3H1MA 2F4PA 3B3QE 1SZBA 3CHXA 1UWWA 3JD71 1YFXA 2A3WA 4IUGA 1D0GA 4P5HA 2H0BA 2HWB2 1F5FA 3POGA 3RPQA 2B42B 5K9YA 2UWBA 1IS5A 3CZUA 1H1MA 3WZ1A 4CXXA 2I74A 5ANQA 5AVPA 1YQ6A 3HNMA 4Q4Y2 1BLZA 1SBFA 1AX1A 1CAUA 1OPMA 1VBA3 2R30A 3S7EA 4TTGA 3T0DA 3IAQA 2OQ7A 3VBUA 2OA2A 3MIEA 2VH9A 1LOAA 1GKBA 4XBNA 5CFDC 4LPLA 2XG3A 5FYUA 4AG4A 1E5RA 4Q4V1 4QM8A 1Q43A 5FYMA 5JDBA 2WSUA 1FATA 3NO8A 3AKRA 1RL3A 2GMMA 2Y60A 3VDDB 1O3RA 1HB2A 4DEQA 4G4FA 5HBAA 2ADDA 2HH9A 5GZDA 4YVSA 3S7IA 3TRSB 4Q5OA 3VBRB 4HBNA 3P6BA 2WO3A 5ABJB 4NRMA 3O0VA 4M4PA 4HKWA 5DUWA 4XBQA 3CQOA 3PTYA 2ZGPA 5ABJC 2R072 1G9DA 1CX4A 4RGKA 2RMU3 4B3NA 4CUCA 1KS5A 2A73B 3LSEA 1OA3A 2FBEA 4PDWA 1MQTC 5B2GB 4PLOA 1I1EA 4WM8C 2HBUA 3C7HA 4XUOA 1GFF2 5FO8B 1V0AA 2BERA 5JSRA 1MZ5A 2WN3A 3SH5A 5TSWA 2G4IA 1BVP1 1QGLA 1RUG2 4CCCA 2WQ4A 3S0MA 4FOQA 4ONUA 1JYNA 2W95A 4OI0A 1CAUB 1U5XA 3GZAA 2I45A 4AOCA 1O3TA 3ZXDA 3WP3A 1WD3A 5FOBB 2JG8B 1F15A 2ZX2A 2D5FA 4B8EA 2ES3A 3T1MA 1KD7A 1LAJA 3EO6A 4HVRA 3I97A 1IKQA 1W2UA 5E8AA 1X8EA 3VBSC 5FY4A 2VMHA 2VUAA 3J7NA 4FPEA 2E31A 4BQ4A 3K3OA 4YVSB 2YV8A 5HI0A 4XDQA 4N90A 4TXWA 1R091 4CU6A 1K5JA 1MEC1 2EXKA 2HWE1 2WL1A 1D4M2 4JVAA 4AQTA 3OF1A 1QKQA 1LR5A 1AXZA 3L9JT 4Z07A 3MUY1 1EUUA 5A3PA 5A3NA 4M01A 1F8VA 4GMP3 3LIGA 2V5YA 3GF6A 4HPKA 2VE1A 1KS4A 3B9IA 4JGZB 2NM1A 1L7QA 4N53A 3WUCA 4LO5B 4PDWB 1LODA 4IETA 2B45X 3R0RA 3E6CC 4WZCA 4DINB 5T54A 1QJFA 5FMCA 4OMDA 4ES8A 4NPLA 1LCLA 4OZXA 4AFMA 1RVF3 4QAWA 5FPAA 1EY2A 2AUYA 2F6BA 3RYRA 3ZFGC 2B8MA 1K12A 2V5DA 1UAIA 4G9SB 4U36A 4L2NA 1PGW2 1QQP3 4UFMA 4YSFA 1PO22 4LKFA 1JYIA 3SISA 4ARXA 1G6NA 2ZGKA 3SHRA 2XBO2 5B4NA 4QB6A 1XXNA 1EAH3 2DFBA 3RRDA 3A0KA 3SITA 4MO3M 5JOZA 1TZOA 4P9WA 1ZBA3 4A6OA 2OQ6A 4Y20A 4LITA 1AR71 4H7LA 4Q29A 5F3GA 3VBHC 3KCCA 4JQRA 4R9BA 5ANNA 2C26A 3UJOA 1UY1A 2XJPA 2LUWA 3I2IA 5LY2A 4QGMA 4ZHNA 3ALQA 4BM8A 4HPKB 4JTNA 4YGCA 2QQNA 4DIQA 2IZWA 4WVMA 3DN7A 5L7OA 4E27A 3ABZA 3VBOA 3DYPA 4N53B 4Z82A 3UL2A 3WF4A 2UY8A 3U4XA 3RDIA 1ZM1A 4CTEA 2NN8A 3RVHA 3SMHA 4LE3A 4LXLA 5BPXA 4F8AA 2VOWA 2XKOA 4NWVA 3VZLA 4MV2A 2HWF3 2Q1FA 2JDNA 1POQA 4MHUA 3SKVA 1JU3A 5C3PA 5IT6A 2YC0A 2RR11 4M00A 2QQKA 2A1XA 1RMU2 1KFUL 1XNCA 2RS33 1WMFA 3P1IA 5DZEA 5FMOL 3WW1A 4CCKA 3S5AA 1R1A1 3N7LA 3VZJA 1V6KA 4DZGA 2G9GA 3OBRA 1WA4A 5I0TA 1PIV1 2AACA 2VZ3A 4TLFA 4MGTA 2GH2A 2W9XA 4LBQA 3VHRA 1G86A 5L9VA 4Q4X2 3ZVXA 2YXSA 1ND3A 5LWBA 3IDCB 2X8KA 2G19A 5FDBA 4LA2A 1DGRN 5D8AA 2D6KA 4XJUA 2A3XA 1C8M1 3NNMA 4MADA 1UKGA 5DZFA 1S0BA 3LPGA 2WSVA 2GN3A 4Y20B 4YVWA 1DCSA 1ULDA 2I2SA 3WF0A 5IUQA 2JDAA 3WDWA 2VQTA 4I30A 1AXYA 1NUKA 1VALA 2ZGOA 3JU9A 3PHMA 4PCRA 1YJLA 3UKVA 1JYCA 3OD4A 2QVSB 2PHWA 4NIHA 4YW2A 4WVMB 3OUJA 4E8CA 3VBOB 3ZN6A 3AC0A 4Q8KA 1WW5A 3WDVA 4IV1A 5BY5A 5JZGC 4XETA 3A7QA 3EHKA 3U4SA 3MPPG 3ZXGA 2BTVC 4GJZA 3ZO0B 1PM4A 2ARAA 5JMOA 3RNSA 2WDBA 2FMDA 2Z5WA 5DUUA 3RS6A 5C3QA 3FHAA 2Q1ZB 1UU4A 1LOCA 3V0AB 4XC9A 3KVAA 4PIYA 3U10A 4RQPB 4HKOA 5IVEA 1RHI1 5FCCA 2A75A 2P17A 4GKYA 4LBQD 2VXRA 4MYEA 4Q4W1 1SQ4A 5A3WA 4YW6A 4CVUA 5FRAA 2D3SA 3BTAA 3I2KA 4LBQB 1NCQA 1XRUA 4FOYA 1ND3B 1GNHA 4LBMA 1QNWA 3FZ3A 1YXWA 2JIJA 2O14A 4YWAA 4AFAA 1PNFA 1QJY3 1W8FA 2LRPA 5D8AB 1AR62 1V6IA 4V2WA 1X82A 1RUD1 1RUE3 2HBTA 3KCYA 4W65A 5H9RA 1ZZBA 3H1YA 4YVWB 3B01A 1SLTA 5B4XA 2EAKA 3RG0A 5LEKA 1VLNA 2Y8KA 3NAPA 1GZTA 4IE4A 4CDQA 4IV3A 3VD4A 4ATEA 3FFZA 4FQ4A 5FZBA 2QQWA 5IK4A 2SLIA 2X05A 1GUIA 4FT8A 3GALA 3GJAA 1ZX5A 3ZN6B 4BXSV 5LATA 1HW5A 3DF0A 5KHHA 3O0WA 2A7AA 4IV1B 3VD7A 2WO1A 4Q0PA 3WF3A 1LULA 5T5LA 1AX2A 3M8LA 1J3RA 2YFZA 4J1XA 2CDPA 3WNLA 4URAA 4N43A 1FOD3 1QJU2 1WMXA 3ZXAC 2O0OA 2QE3A 5JOXA 1K42A 1LJ7A 2YPJA 4I0WB 5GLUA 2MHFA 4YFZA 1ZRFA 2K0GA 4JTOA 4F3JA 4AEDC 4CEWA 2XONA 4FTEA 1K5MA 2C4XA 5SV5A 2K46A 4CDWA 2Y6FA 4CDUC 4EYUA 1NCQB 3P3NA 1VMHA 5I0UA 3UGFA 2RMU1 3LE0A 2Q1MA 2B39A 3BYWA 3E5XA 4B4RA 2ZJCA 4IEQA 3ZFEA 3WNKA 2HYXA 1TME2 1N3PA 5CU1A 1HN0A 5F2SA 3O1RA 3IB3A 4L9BA 3N9MA 3AZZA 2IUWA 1C57A 1LTEA 4UAPA 2TUNA 1JZ4A 3MIBA 3HQXA 3NAPB 1JYTA 1M06G 3MIDA 4IV3B 4RR3A 5A3UA 1W8UA 3M7AA 3MHZA 5FPBA 2VM9A 4BZ4A 2KXLA 2XL9A 5BNPC 5I91A 1AJKA 1LOBA 5JAXA 2VR4A 2QQOA 1PK6C 5T5PA 5KC5A 1R092 4QXCA 4LIVA 1CN1A 1E5HA 3B00A 3SXWA 4YARA 2ARCA 2E6VA 4FPYA 1YIFA 3K3NA 4LHNA 1JHJA 4A3ZA 4AHYA 2PA7A 1CESA 1GQGA 2DDUA 2VBDA 3WNMA 1UYYA 4N43B 1W0NA 3IPVA 3S30A 1VR3A 2Z69A 3AXEA 4JGYA 4E4SA 3ETQA 5H9QA 4NWWA 1A78A 3ZXJA 5BV6A 3MYXA 5DAQA 5FZ8A 3IM0A 5JXHA 4IERA 4OULA 4CEWB 3O12A 3N36A 2EIBA 1MR5A 4D94A 3N3HA 1K5MB 3NV2A 1E5IA 4FPGA 4CDWB 4BISA 4GMP1 1SCRA 1QU0A 3A0NA 2WBKA 5KR7A 1QMJA 1YJKA 2ZHMA 2WZR2 2G9ZA 3UGGA 1LHNA 2JDZA 2VTXJ 3ZFEB 2PLV2 3FUQA 4FTBA 2GC2A 2ZGTA 2OPKA 4H2AA 4Q8LA 4D69A 5LB6A 4DNYA 1PVC1 2ADEA 3OJBA 1D4VB 2QQUA 4Q2FA 3ZIXA 4KGQA 1VE0A 1DFQA 1DQ6A 5A3OA 2R1BA 3RWNA 2IXHA 5DUVA 5JCTA 3H8RA 1OOPA 4RR3B 1ULCA 1QOOA 3DECA 5G05L 5FZCA 1JOBA 3AZYA 4KG8A 1HXS2 4AQ6A 5FO9B 5F8PA 1GLHA 3U11A 3DKWA 4H14A 4LKEA 1AR72 4EV0A 4KH9A 1W6MA 4Q26A 4QGLA 3FLPA 4OQ8A 1DLCA 3WNPA 3JQWA 5IHRA 3AFKA 3BTZA 1OH3A 1EAH1 4M3CE 4CCNA 4FBFA 2HWC1 1W06A 4UBHA 4BOWA 3WNNA 4MLOA 1AUYA 5DZGA 1B35C 4DXTA 1G9AA 1REEA 3IPVB 2DURA 4J25A 3VBFC 4JGYB 5BNQA 1UKRA 1ZBA1 5IK5A 3QCWA 4QX7A 2ZOEB 5KHGA 3WY6A 2DF7A 1D2SA 4Q27A 1VBD3 4QXKA 4XJ8A 3ZYPA 3N9PA 3OBZA 3WINE 1RUF1 4YM2A 2JENA 4MH0E 2VVDA 3P3PA 1RINA 3KQ4B 3ZFFA 2RR12 3D0SA 3AYDA 4ORFA 2OT7A 2QUOA 2WO2A 3GXUA 3T2OA 2JICA 1R1A2 2XQRA 2GC3A 3SCGA 3J4UH 1PIV2 1UW8A 1W8OA 3N7JA 4LA3A 3RSJA 1I6XA 3ACIA 4YZ2A 5KHKA 3H8XA 2WNUA 5AFEA 3O1SA 1W9YA 1YFWA 4OI4A 1FAYA 4RHV1 3I2GA 3IWZA 4QKDA 5GLVA 5E89A 1ENQA 5FP3A 1NLRA 2GP5A 1DF0A 3PMEA 1VBE2 2BNMA 2HWD3 1ASJ3 4FFFA 2GSYA 5K7PA 2HWB1 3BU7A 1BEV3 4QQHA 3IMMA 3NWKA 4Q4Y1 3VHOA 2G9FA 3C7OA 4B1LA 1MVQA 1OLRA 2WC2A 2Y64A 1J58A 4BQ3A 3SH3A 5FZHA 2WYSA 2W91A 5FY0A 3VB9A 4AI3A 3POSA 4CU9A 2GNDA 4DO0A 4B7KA 5J3UA 3K4DA 4FQZA 4FFIA 1AL23 1VBB3 2ZACA 3POYA 4OMCA 4D6SA 2XR4A 1C8NA 1XC6A 2EALA 2GDFA 3DEMA 1OA4A 2W46A 4LJHA 3VGIA 1OUSA 1J83A 2VW2A 1NOVA 3B93A 4LTAA 1JYWA 1UO9A 4MOAA 3AP6A 3MEPA 1JBCA 3QACA 3N35A 5FYCA 5KBFA 2P3IA 2R071 3HN3A 3V56A 1YHFA 5C33A 4BLJA 2W92A 4XUQA 4I02A 3H3ZA 1H6XA 3ZR5A 1DHKB 1MS3A 3THDA 1DQ1A 1VAKA 4DEVA 3HQRA 5F5QA 1NA1C 2UU8A 3AYAA 4Y1VA 1WUVA 5LBFA 1LHUA 4CZSA 1ZRCA 1BXHA 1JODA 1WLDA 4GJYA 3NV3A 2ZHLA 2YBSA 5FZDA 1JXNA 1V6OA 2D40A 4LEJA 3K77A 1VBA2 2YU1A 4KWLA 2VBBA 1W0PA 1Z7S2 2N7GA 3MLKA 4INDA 4AVBA 2VG9A 1JI6A 4LO7A 2W1UA 1HKDA 5FQ0B 1CAXA 1HJFA 4B4PA 3RZJA 2JDUA 2QQIA 2C0ZA 5ACA3 4R4XA 1UY0A 4RS5A 1IS6A 4AWDA 1WMEA 4TWTA 1H0BA 5K8SA 1VAVA 4PQQA 2PQQA 2VTXA 2Q4SA 3M1HA 2JG9B 4OI1A 4MGQA 4AE2A 1DGRA
chains in the Genus database with same CATH topology
5JR2A 3MO4A 3OGSA 3OGRA 3BN6A 1OF3A 1ULOA 4LPLA 2EIEA 2W94A 2VOTA 1JZ5A 4JKMA 2QQLA 4AG4A 4HG6B 2WUHA 4BK5A 1CZVA 4DEQA 1UXZA 4P00B 2Z4FA 3VD5A 4A41A 3T2PA 2WAAA 1US2A 2V4VA 4JKLA 3P6BA 2WO3A 1NAEA 4M4PA 3VDBA 3CQOA 1JZ7A 1UMHA 5J1XA 2VZOA 2Y6GA 4CUCA 4ZZ5A 2WZ8A 3T0AA 3C7EA 3I3DA 1PX4A 3C7HA 4XUOA 1YQ2A 1XNAA 2BERA 3E1F1 2WN3A 4GWJA 1WKYA 2LW8A 2XHNA 1JYNA 4DXSA 2W95A 4DUXA 3I2JA 2W5FA 5F7UA 1UY3A 2RVAA 2VJXA 3A23A 3DYOA 2E33A 3FL7A 2QQJA 3I97A 1D7PM 4GZ9A 1O59A 2ID4A 4QB1A 1GQPA 3IAPA 1KGYA 2E31A 2Y6JA 4TXWA 4CU6A 1K45A 2WQ8A 3MUY1 5IFTA 1EUUA 5HPOA 3WNOA 4A44A 1L7QA 1GOGA 5G04L 2JD9A 4A42A 4OMDA 3CZJA 1WCQA 4QAWA 2VZRA 3DYMA 2J1UA 3CKHA 2VZ1A 3JXSA 1K12A 2V5DA 1CZSA 3NQHA 1CX1A 3A21A 4QX3A 1US3A 3SEEA 3OEAA 2DCKA 4ARXA 3C8XA 5B4NA 4ZZ8A 4QB6A 2VL4A 1H6YA 1PMJX 2BZDA 4KWUA 4CU7A 4MO3M 4PT6A 4W50A 3ETPA 3LPFA 3MV01 2W1SA 2VZTA 1TVGA 4QX1A 4A6OA 2VQUA 3T09A 3VDAA 2VZUA 3PUIA 2C26A 1UY1A 3GGLA 3I2IA 5EJ1B 1JYVA 4CUAA 3OBAA 2QQNA 3K4ZA 3OEBA 3ABZA 2V72A 3DYPA 2J1RA 3WF4A 2J1SA 4BJ0A 1JZ3A 3SKVA 1JU3A 2QQKA 3P1IA 3ECQA 4W4ZA 1UZ0A 2WZEA 5C71A 3THCA 4QB2A 2VZ3A 3SEPA 2W9XA 4XUPA 2VZQA 2C9KA 4GWIA 4P5YA 1GNYA 3I3BA 5EIYB 4MADA 3K4AA 1JYXA 3BGAA 4MGQA 3LPGA 3WF0A 2VMFA 2JDAA 3HNYM 4RYDA 2VQTA 1NUKA 1UYZA 3NRUA 3T0BA 1NKGA 4P02B 1OT5A 2BGOA 2ZEYA 3OG2A 4E8CA 2VCAA 3AC0A 3EYPA 4LQRA 5DMYA 3LEGA 2VMEA 3A7QA 2EIDA 3ACHA 3NJVA 2VMDA 4KI5M 4QPWA 4D8MA 1UY4A 3D3AA 5JMOA 4QDSA 2WDBA 3FHAA 4XUNA 1SDDB 2ZEZA 2E26A 1L7RA 1EUTA 3OB8A 3IIIA 2BBAA 4CVUA 3HOBA 3I2KA 1OD3A 3T2QA 5CYYA 1CZTA 1O8PA 1JZ8A 3WF2A 2Y6LA 3HPNA 4JX0A 1P8JA 4JKKA 4OYUA 2YB7A 4E8DA 3K46A 4AAXA 5B4XA 4YPJA 1HN1A 1I5PA 2ZEWA 4XVHA 2Y8KA 1F4HA 2J1AA 1PX3A 3T08A 1GMMA 3VD4A 4LHSA 3EB7A 1IQDC 2X05A 1GUIA 2VC9A 2WN2A 3NJXA 4BXSV 1UMIA 1MPXA 1DYOA 1ULPA 3VD7A 1W9SA 2WO1A 2J1EA 5IYYA 3WF3A 5A1AA 3F2ZA 2YFZA 1R64A 1JU4A 4W8JA 4ET7A 5LA1A 2CDPA 3WNLA 3I2FA 4LKSA 4MGSA 4BK4A 1K42A 3MUZ1 4Z2AA 2VZVA 2W1QA 5I0DA 3I3EA 2W47A 1BHGA 1W8NA 2W87A 3LEIA 2OKXA 2RJ2A 2XONA 3K75B 2C4XA 2JKXA 3WSOA 4FI9A 2VCBA 4CU8A 1K3IA 4QDRA 4P08A 3W5MA 2J1VA 2WAOA 3LEKA 1JZ6A 3LE0A 4UI9L 4RN5A 1SG3A 2LS6A 1TG7A 3WNKA 2HYXA 2VCCA 3UESA 3UNPA 4ARYA 1W9WA 3IB3A 4QDQA 3OGVA 5C70A 2Y6KA 5LCWL 2VZSA 4UAPA 1UY2A 1DP0A 1JZ4A 3HEIA 5JXIA 5CZKA 2R7EB 4UOJA 2VM9A 5DQ0A 3C7GA 2VR4A 2QQOA 2VMCA 5HXMA 1GU3A 4ZXEA 2JE8A 3FN9A 2XQXA 3CIHA 4A3ZA 1JHJA 2W1WA 2DDUA 3WNMA 1UYYA 1W0NA 1JZ2A 5JXHA 4PF1A 2PQSA 4JHZA 3WEZA 3PUHA 2EIBA 2YC4A 3UETA 3CDZB 2BGPA 2WBKA 2QBXA 3A22A 3IDAA 4DXRA 2VO5A 4KMQA 1CIYA 2VTFA 3MBWA 2ZEXA 5G05L 3DECA 2X10A 1UX7A 4CUBA 2CDOA 3J7HA 4OZOA 2B9VA 1O8SA 3FHQA 1DLCA 2B4KA 3WNPA 2EICA 5IHRA 3VD9A 3WNNA 3U37A 3HJRA 4DXTA 4D0QA 5DPNA 2W3JA 3VDCA 1RYYA 3ACGA 3VD3A 2HLEA 1UXXX 1LNSA 5JUVA 3GM8A 3CMGA 5FUIA 5IFPA 4XUTA 3T2OA 2WO2A 3GXUA 2X09A 5IJRA 1UYXA 2DCJA 4BDVB 1PMHX 1W8OA 3ACIA 5JXJA 4M4RA 1XPWA 4OUEA 2VZPA 3I2GA 2YC2A 1GOHA 1OH4A 3WQBA 4A45A 1OF4A 4QX2A 1W99A 3ZM8A 5LA0A 2XOMA 3C7OA 3HNBM 3LQCA 2Y64A 3GDBA 1NX9A 1F4AA 2WYSA 2W91A 2L9LA 2WABA 5LA2A 4CU9A 2J1TA 2QQMA 3WF1A 3C7FA 1GOFA 3I2HA 3K4DA 3SKJE 4OMCA 2YFUA 1XC6A 2W46A 4XURA 1J83A 2J7MA 1JYWA 4MOAA 3HN3A 1KEXA 2W92A 4XUQA 5DN2A 4DUVA 1H6XA 3MV11 1XNTA 3ACFA 2KD7A 2ZXQA 3THDA 1J84A 1W9TA 4DEVA 4QX0A 4ZY9A 3W5NA 2ORXA 4L0PA 2RV9A 3NNGA 2Y6HA 2YG0A 3K77A 2ORZA 1T2XA 4A4AA 1JI6A 1UWWA 5EJZB 2W1UA 1SHWB 5C7GA 4IUGA 2E32A 2QQIA 1UY0A 3CZUA 4XZUG 5JXGA 3HNMA 4PQQA 4TTGA 2J22A 3T0DA 3IAQA 4DUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JR2 A;  3MO4 A;  3OGS A;  3OGR A;  3BN6 A;  1OF3 A;  1ULO A;  4LPL A;  2EIE A;  2W94 A;  2VOT A;  1JZ5 A;  4JKM A;  2QQL A;  4AG4 A;  4HG6 B;  2WUH A;  4BK5 A;  1CZV A;  4DEQ A;  1UXZ A;  4P00 B;  2Z4F A;  3VD5 A;  4A41 A;  3T2P A;  2WAA A;  1US2 A;  2V4V A;  4JKL A;  3P6B A;  2WO3 A;  1NAE A;  4M4P A;  3VDB A;  3CQO A;  1JZ7 A;  1UMH A;  5J1X A;  2VZO A;  2Y6G A;  4CUC A;  4ZZ5 A;  2WZ8 A;  3T0A A;  3C7E A;  3I3D A;  1PX4 A;  3C7H A;  4XUO A;  1YQ2 A;  1XNA A;  2BER A;  3E1F 1;  2WN3 A;  4GWJ A;  1WKY A;  2LW8 A;  2XHN A;  1JYN A;  4DXS A;  2W95 A;  4DUX A;  3I2J A;  2W5F A;  5F7U A;  1UY3 A;  2RVA A;  2VJX A;  3A23 A;  3DYO A;  2E33 A;  3FL7 A;  2QQJ A;  3I97 A;  1D7P M;  4GZ9 A;  1O59 A;  2ID4 A;  4QB1 A;  1GQP A;  3IAP A;  1KGY A;  2E31 A;  2Y6J A;  4TXW A;  4CU6 A;  1K45 A;  2WQ8 A;  3MUY 1;  5IFT A;  1EUU A;  5HPO A;  3WNO A;  4A44 A;  1L7Q A;  1GOG A;  5G04 L;  2JD9 A;  4A42 A;  4OMD A;  3CZJ A;  1WCQ A;  4QAW A;  2VZR A;  3DYM A;  2J1U A;  3CKH A;  2VZ1 A;  3JXS A;  1K12 A;  2V5D A;  1CZS A;  3NQH A;  1CX1 A;  3A21 A;  4QX3 A;  1US3 A;  3SEE A;  3OEA A;  2DCK A;  4ARX A;  3C8X A;  5B4N A;  4ZZ8 A;  4QB6 A;  2VL4 A;  1H6Y A;  1PMJ X;  2BZD A;  4KWU A;  4CU7 A;  4MO3 M;  4PT6 A;  4W50 A;  3ETP A;  3LPF A;  3MV0 1;  2W1S A;  2VZT A;  1TVG A;  4QX1 A;  4A6O A;  2VQU A;  3T09 A;  3VDA A;  2VZU A;  3PUI A;  2C26 A;  1UY1 A;  3GGL A;  3I2I A;  5EJ1 B;  1JYV A;  4CUA A;  3OBA A;  2QQN A;  3K4Z A;  3OEB A;  3ABZ A;  2V72 A;  3DYP A;  2J1R A;  3WF4 A;  2J1S A;  4BJ0 A;  1JZ3 A;  3SKV A;  1JU3 A;  2QQK A;  3P1I A;  3ECQ A;  4W4Z A;  1UZ0 A;  2WZE A;  5C71 A;  3THC A;  4QB2 A;  2VZ3 A;  3SEP A;  2W9X A;  4XUP A;  2VZQ A;  2C9K A;  4GWI A;  4P5Y A;  1GNY A;  3I3B A;  5EIY B;  4MAD A;  3K4A A;  1JYX A;  3BGA A;  4MGQ A;  3LPG A;  3WF0 A;  2VMF A;  2JDA A;  3HNY M;  4RYD A;  2VQT A;  1NUK A;  1UYZ A;  3NRU A;  3T0B A;  1NKG A;  4P02 B;  1OT5 A;  2BGO A;  2ZEY A;  3OG2 A;  4E8C A;  2VCA A;  3AC0 A;  3EYP A;  4LQR A;  5DMY A;  3LEG A;  2VME A;  3A7Q A;  2EID A;  3ACH A;  3NJV A;  2VMD A;  4KI5 M;  4QPW A;  4D8M A;  1UY4 A;  3D3A A;  5JMO A;  4QDS A;  2WDB A;  3FHA A;  4XUN A;  1SDD B;  2ZEZ A;  2E26 A;  1L7R A;  1EUT A;  3OB8 A;  3III A;  2BBA A;  4CVU A;  3HOB A;  3I2K A;  1OD3 A;  3T2Q A;  5CYY A;  1CZT A;  1O8P A;  1JZ8 A;  3WF2 A;  2Y6L A;  3HPN A;  4JX0 A;  1P8J A;  4JKK A;  4OYU A;  2YB7 A;  4E8D A;  3K46 A;  4AAX A;  5B4X A;  4YPJ A;  1HN1 A;  1I5P A;  2ZEW A;  4XVH A;  2Y8K A;  1F4H A;  2J1A A;  1PX3 A;  3T08 A;  1GMM A;  3VD4 A;  4LHS A;  3EB7 A;  1IQD C;  2X05 A;  1GUI A;  2VC9 A;  2WN2 A;  3NJX A;  4BXS V;  1UMI A;  1MPX A;  1DYO A;  1ULP A;  3VD7 A;  1W9S A;  2WO1 A;  2J1E A;  5IYY A;  3WF3 A;  5A1A A;  3F2Z A;  2YFZ A;  1R64 A;  1JU4 A;  4W8J A;  4ET7 A;  5LA1 A;  2CDP A;  3WNL A;  3I2F A;  4LKS A;  4MGS A;  4BK4 A;  1K42 A;  3MUZ 1;  4Z2A A;  2VZV A;  2W1Q A;  5I0D A;  3I3E A;  2W47 A;  1BHG A;  1W8N A;  2W87 A;  3LEI A;  2OKX A;  2RJ2 A;  2XON A;  3K75 B;  2C4X A;  2JKX A;  3WSO A;  4FI9 A;  2VCB A;  4CU8 A;  1K3I A;  4QDR A;  4P08 A;  3W5M A;  2J1V A;  2WAO A;  3LEK A;  1JZ6 A;  3LE0 A;  4UI9 L;  4RN5 A;  1SG3 A;  2LS6 A;  1TG7 A;  3WNK A;  2HYX A;  2VCC A;  3UES A;  3UNP A;  4ARY A;  1W9W A;  3IB3 A;  4QDQ A;  3OGV A;  5C70 A;  2Y6K A;  5LCW L;  2VZS A;  4UAP A;  1UY2 A;  1DP0 A;  1JZ4 A;  3HEI A;  5JXI A;  5CZK A;  2R7E B;  4UOJ A;  2VM9 A;  5DQ0 A;  3C7G A;  2VR4 A;  2QQO A;  2VMC A;  5HXM A;  1GU3 A;  4ZXE A;  2JE8 A;  3FN9 A;  2XQX A;  3CIH A;  4A3Z A;  1JHJ A;  2W1W A;  2DDU A;  3WNM A;  1UYY A;  1W0N A;  1JZ2 A;  5JXH A;  4PF1 A;  2PQS A;  4JHZ A;  3WEZ A;  3PUH A;  2EIB A;  2YC4 A;  3UET A;  3CDZ B;  2BGP A;  2WBK A;  2QBX A;  3A22 A;  3IDA A;  4DXR A;  2VO5 A;  4KMQ A;  1CIY A;  2VTF A;  3MBW A;  2ZEX A;  5G05 L;  3DEC A;  2X10 A;  1UX7 A;  4CUB A;  2CDO A;  3J7H A;  4OZO A;  2B9V A;  1O8S A;  3FHQ A;  1DLC A;  2B4K A;  3WNP A;  2EIC A;  5IHR A;  3VD9 A;  3WNN A;  3U37 A;  3HJR A;  4DXT A;  4D0Q A;  5DPN A;  2W3J A;  3VDC A;  1RYY A;  3ACG A;  3VD3 A;  2HLE A;  1UXX X;  1LNS A;  5JUV A;  3GM8 A;  3CMG A;  5FUI A;  5IFP A;  4XUT A;  3T2O A;  2WO2 A;  3GXU A;  2X09 A;  5IJR A;  1UYX A;  2DCJ A;  4BDV B;  1PMH X;  1W8O A;  3ACI A;  5JXJ A;  4M4R A;  1XPW A;  4OUE A;  2VZP A;  3I2G A;  2YC2 A;  1GOH A;  1OH4 A;  3WQB A;  4A45 A;  1OF4 A;  4QX2 A;  1W99 A;  3ZM8 A;  5LA0 A;  2XOM A;  3C7O A;  3HNB M;  3LQC A;  2Y64 A;  3GDB A;  1NX9 A;  1F4A A;  2WYS A;  2W91 A;  2L9L A;  2WAB A;  5LA2 A;  4CU9 A;  2J1T A;  2QQM A;  3WF1 A;  3C7F A;  1GOF A;  3I2H A;  3K4D A;  3SKJ E;  4OMC A;  2YFU A;  1XC6 A;  2W46 A;  4XUR A;  1J83 A;  2J7M A;  1JYW A;  4MOA A;  3HN3 A;  1KEX A;  2W92 A;  4XUQ A;  5DN2 A;  4DUV A;  1H6X A;  3MV1 1;  1XNT A;  3ACF A;  2KD7 A;  2ZXQ A;  3THD A;  1J84 A;  1W9T A;  4DEV A;  4QX0 A;  4ZY9 A;  3W5N A;  2ORX A;  4L0P A;  2RV9 A;  3NNG A;  2Y6H A;  2YG0 A;  3K77 A;  2ORZ A;  1T2X A;  4A4A A;  1JI6 A;  1UWW A;  5EJZ B;  2W1U A;  1SHW B;  5C7G A;  4IUG A;  2E32 A;  2QQI A;  1UY0 A;  3CZU A;  4XZU G;  5JXG A;  3HNM A;  4PQQ A;  4TTG A;  2J22 A;  3T0D A;  3IAQ A;  4DUW A; 
#chains in the Genus database with same CATH topology
 5JR2 A;  3MO4 A;  1SBE A;  4S2H A;  5DDJ 3;  3W58 A;  1D4M 1;  3BOW A;  1OF3 A;  1ULO A;  2XGX A;  3H3L A;  5D21 A;  2BWA A;  1JZ5 A;  2DUO A;  3DXT A;  3PVO A;  1G9C A;  4JKM A;  2QQL A;  3Q9O A;  3FBM A;  5FWE A;  1ULE A;  1AZD A;  3L2H A;  4EWD A;  2RMU 2;  5FFO C;  1HV0 A;  2CAU A;  2WYF A;  1FOD 1;  1UXZ A;  1WCK A;  2CV6 A;  2P6H A;  3DV8 A;  2Z4F A;  4GMP 0;  4NE9 A;  1SMV A;  4P00 B;  4A41 A;  1QJZ A;  2ZPX A;  4CE8 A;  2CGP A;  3ZPO A;  3O1P A;  5M0T A;  3SCF A;  4KBB A;  4Y3O A;  5EPA A;  3TYJ A;  5T5J A;  5J1X A;  4XJA A;  1W8W A;  5FR3 A;  3GBW A;  5I8Y A;  1F31 A;  1PGW 1;  4Y5T A;  2WZ8 A;  3T0A A;  2E53 A;  3C7E A;  2XVK A;  5T3N A;  2ZMN A;  1PX4 A;  1JOP A;  1YQ2 A;  1XNA A;  4YW5 A;  1W2T A;  1CAX B;  4GWJ A;  1Z78 A;  3E6B A;  3M3C A;  1OC1 A;  1DYP A;  1DQ0 A;  1WKY A;  2CNA A;  2XHN A;  2IXC A;  4RS5 B;  4XYX A;  5FZ3 A;  4AQ2 A;  2D6P A;  3KV5 A;  4DXS A;  4BE3 A;  4I09 A;  2ET1 A;  2WT0 A;  4RA0 A;  4DY3 A;  4DUX A;  5AC9 2;  2YY1 A;  1HLC A;  2E51 A;  2P5B A;  1TMF 3;  1BYH A;  2R0F A;  3DYO A;  3CJX A;  3ROU A;  4C90 A;  2K9Z A;  1H8T B;  5JPN B;  2XLF A;  5BNO C;  2QQJ A;  1D7P M;  2EXH A;  4GZ9 A;  2D6O X;  3RZM A;  1IGO A;  1QJE A;  2OPW A;  3RGB A;  2ID4 A;  2XJV A;  1V9U 3;  5F5I A;  2JDY A;  3JZV A;  4M0N A;  4FPO B;  2VY0 A;  5GZC A;  1K45 A;  2GAL A;  3I4I A;  2ILM A;  1H1I A;  2WQ8 A;  4FPH A;  1RVF 2;  5K0U C;  1RMU 1;  2D44 A;  4X6Q B;  5FY1 A;  3VBU C;  1ZRI A;  4A44 A;  3WG1 A;  4D8M A;  2WLQ A;  1GOG A;  5FKC A;  3TNP B;  1QQP 2;  2PHX A;  4I3P A;  3CJI C;  4Q4X 1;  1OLQ A;  5G04 L;  5FYZ A;  2JD9 A;  5LRR A;  5LRS A;  5LZ6 A;  2NP0 A;  4K8F A;  1EAH 2;  4XBL A;  3DYM A;  2J1U A;  4UWD A;  1QHD A;  2ZTN A;  1MVE A;  5FPZ A;  2H6B A;  2DVB A;  4MGK E;  4IEU A;  2ZGS A;  3O14 A;  4NRO A;  4OVE A;  5FP8 A;  1CZS A;  4OLL A;  5APA A;  5L9R A;  1OI6 A;  4RFT 0;  5FZE A;  1VJ2 A;  2ZGR A;  1ZBA 2;  4PLN A;  4IE0 A;  4V2V A;  1US3 A;  4YW7 A;  3SEE A;  1GZW A;  5F5A A;  1KRI A;  5IAV A;  3AM2 A;  1OBN A;  4UYB A;  2IXL A;  1ZZ7 A;  4FAH A;  1Q8V A;  4IEX A;  1OSG A;  2FZ1 A;  3ZSJ A;  4E9K A;  4KWU A;  3NNL A;  4PDW C;  4P9J A;  1COV 3;  1OQE A;  5KWR A;  5FBZ A;  4QGN A;  3ETP A;  2BEO A;  3E97 A;  3LPF A;  1PZ8 A;  5GLT A;  4HSL A;  4Y26 A;  3AYC A;  2VZT A;  3H0O A;  2Y0O A;  4QHZ A;  1X33 A;  3RI8 A;  5J96 B;  3RQ0 A;  2C6S A;  3QH6 A;  5A7W A;  3T09 A;  1YFY A;  4IE5 A;  2DWR A;  4XJW A;  1KDM A;  4AHZ A;  4XMA A;  4ZU7 A;  2J42 A;  2BFU L;  2DCY A;  2VZU A;  2HWF 2;  4S2G A;  3KZ4 C;  1OQD A;  3WDY A;  4WVV A;  4EE2 A;  2ZX4 A;  2AEN A;  1R1Z A;  3U0Z A;  1O4T A;  1NZI A;  2RS3 2;  4XQD A;  2CAV A;  1OQ1 A;  2J1R A;  1QIQ A;  1IQA A;  4IW3 A;  4XTP A;  4XXP A;  3BU0 A;  4HL0 A;  2OS2 A;  3R4S A;  4AF9 A;  3OYW B;  1VRH 3;  5FRE A;  4AI8 A;  4BWO A;  3OUI A;  2WFP A;  1WBF A;  2EXJ A;  3ES4 A;  1Z7S 3;  4GUL A;  4SLI A;  1AR6 1;  4W4Z A;  3WDT A;  2X29 A;  1N1Y A;  2JG8 A;  1EP0 A;  3IT8 A;  1UZ0 A;  1WZX A;  5JOY A;  4MUV A;  5C71 A;  2XXZ A;  2HWD 1;  3LA3 A;  4W6Y A;  2WJS A;  3BI3 A;  1W0O A;  5LW9 A;  3T4H B;  1GZW B;  3SEP A;  1LOF C;  1BEV 1;  2VZQ A;  4CDX A;  2AGS A;  2UY9 A;  3JBG 3;  1ZA4 A;  4LO6 B;  2D97 A;  1CGP A;  1ULF A;  4OHY A;  2QKD A;  2QDR A;  1PVX A;  2RS5 3;  5J09 A;  3I3B A;  5EIY B;  3LD8 A;  2AC1 A;  3K4A A;  5A6Y A;  2IC1 A;  4FXG B;  4JC1 A;  4CEY C;  1GBG A;  1GZC A;  1SFN A;  4LOR A;  2FQP A;  5GZF A;  5A7W B;  2LTN A;  4WZF A;  1C28 A;  2R06 3;  1MS8 A;  1G9B A;  3HNY M;  3VZO A;  4RYD A;  3N9O A;  5C9A A;  1UIK A;  2FCU A;  1QJU 1;  4JGZ A;  4AFB A;  1OT5 A;  3ZSL A;  2JB4 A;  1RTV A;  4KU8 A;  2BGO A;  2ZEY A;  3OG2 A;  4XZP A;  3GBF A;  4ERO A;  1RUO A;  3KT4 A;  2XB6 C;  3F95 A;  5EQU A;  1PM7 A;  4A7Z A;  1DQ5 A;  2JX9 A;  2R04 3;  1C1L A;  5FLI A;  1H1A A;  5DMY A;  1UX6 A;  1NCR A;  2BW8 A;  2VME A;  2WQZ C;  2EID A;  1HRV 3;  2VUJ A;  2VMD A;  3LEG A;  4PBO A;  4PIZ A;  3D3A A;  4QPW A;  1DG6 A;  1A8M A;  3N9Q A;  4FP3 A;  2VNR A;  2DTY A;  5GAL A;  3M3O A;  1O5U A;  1ZZ9 A;  3ORJ A;  1KJL A;  5J98 B;  2ZA9 A;  1Q56 A;  1TME 1;  1PNG A;  1GP5 A;  1QJY 2;  3J9S A;  2ZGN A;  1RUE 2;  2RDN A;  4XJ9 A;  2RS1 3;  2ZHN A;  1QDC A;  1EUT A;  2IXI A;  2UYA A;  3OB8 A;  4BQ5 A;  2D93 A;  4TSV A;  4QQ2 A;  2MPF A;  2PMW B;  4LHL A;  2VEC A;  1OD3 A;  1UPS A;  4CDX B;  4BME A;  4Q0V A;  1XU2 A;  3T2Q A;  4XW3 A;  5JIA A;  4KBZ A;  5L7O C;  2GMP A;  1ZRR A;  3WF2 A;  1PZ7 A;  2PHL A;  1AX0 A;  3HPN A;  4PI2 A;  4YW1 A;  3VZK A;  1P8J A;  4EN7 B;  5AC9 3;  2YB7 A;  1HJG A;  1ND2 C;  5I8S A;  4AL9 A;  4QWN A;  3ZYF A;  4COY A;  1RB8 G;  2HYK A;  5C3O A;  4DXZ A;  4HLT A;  2NYY A;  3AVS A;  1LRH A;  4B1M A;  4AAX A;  4IL7 A;  2GNB A;  5FP7 A;  5A33 B;  5ACA 1;  4XVH A;  5C9A B;  3Q8B A;  4WBB A;  3PJY A;  4NUB A;  2J1A A;  5EJ3 A;  1Q3E A;  3BPS A;  3D6E A;  4LHS A;  4N8M A;  1IQD C;  3TEX A;  1FOD 2;  2VW0 A;  4COU A;  3AMP A;  5DDJ 1;  1MPX A;  2Y33 A;  1Y3T A;  2ZKL A;  5A6Z A;  1NY7 1;  1NCR B;  1ULP A;  3ZOI A;  2J1E A;  1ZZC A;  5FZI A;  1QJX 3;  1JTZ X;  4L97 A;  3U14 A;  1YO8 A;  2WZR 1;  1QY4 A;  1R64 A;  4W8J A;  2P3Y A;  2SBA A;  2D43 A;  2FCT A;  5FAX A;  5CFD A;  3I2F A;  4LKS A;  4MGS A;  4BK4 A;  2PLV 1;  2Q5T A;  5BYN A;  5L36 A;  5C3R A;  1D2Q A;  2VZV A;  5I0D A;  3I3E A;  4BCU A;  1O3S A;  1BHG A;  4QM9 A;  2W87 A;  3ZYR A;  2OKX A;  2OUH A;  2CTV A;  5FPU A;  2IXJ A;  2Q8O A;  1UOG A;  1CAV A;  2VCB A;  3B9C A;  1K3I A;  1O4Z A;  4QDR A;  5FV3 A;  1POV 1;  2VUL A;  1C4R A;  1BQP A;  1HXS 1;  3AL6 A;  5FUN A;  3ZKU A;  2EVX A;  3M3E A;  3NNJ A;  1SG3 A;  1Q8O A;  2CU5 A;  1AR8 3;  1BK1 A;  2MEV 3;  2GU9 A;  1TG7 A;  2DUQ A;  2LS6 A;  2VCM A;  3MLJ A;  5FZK A;  3ZN4 A;  5BNN C;  3UES A;  1PGS A;  3UNP A;  3WDX A;  2UYB A;  1W9W A;  1SCS A;  4HK8 A;  3OGV A;  3CNA A;  3N7K A;  2GN7 A;  3FHI B;  3RFR A;  4HET A;  3WXP A;  4UFK A;  5JLV A;  2VZS A;  1UY2 A;  5LAS A;  4WM8 A;  1DYK A;  1MS9 A;  1E57 A;  2ZAA A;  3B5L B;  4LLO A;  5JXI A;  2W52 A;  1RGS A;  2YBP A;  1NE6 A;  2ENR A;  1RUI 3;  1WBL A;  5C5U A;  2XWJ B;  3C7G A;  1WW4 A;  3K48 A;  1UZY A;  2GC1 A;  4I0B A;  5CB7 A;  1TMF 1;  3T1L A;  3GHM A;  1RUH 3;  5AFB A;  3RWK X;  1I5Z A;  4LOT A;  5ABJ A;  4LK6 A;  4ZXE A;  2ZCW A;  3USS A;  3FWE A;  2GZW A;  3HBZ A;  4PIX A;  5FWJ A;  4E4Z A;  2FDI A;  2QJV A;  2W1W A;  4RQP A;  2YU2 A;  4AZZ A;  2NMN A;  2YPD A;  3HQU A;  4W6X A;  5CFD B;  2H6C A;  2E7A A;  3TN9 3;  3NMB A;  3VBS A;  3D5O A;  3AKT A;  1LED A;  5JVV A;  1B09 A;  2CL2 A;  2PQS A;  4I0A A;  4CDQ C;  1TNR A;  3NL1 A;  2D6L X;  1CAV B;  2CGO A;  3OCP A;  4NN0 A;  1VBE 1;  1WMD A;  5HCA A;  4FO9 A;  5FYB A;  3DUI A;  2GC0 A;  1MZ6 A;  5DAP A;  5F6L B;  3MFA A;  2QBX A;  3H9A A;  4MGY E;  1AYM 3;  3A22 A;  4QKF A;  3IDA A;  2EIG A;  4DXR A;  2VU9 A;  1BMV 2;  2BNN A;  5HCF A;  1CIY A;  3MIH A;  3KCX A;  5JIU A;  2Q0A A;  3GYD A;  5JI7 A;  2P1B A;  4WM8 B;  4KG0 A;  2R1D A;  4UT5 A;  3RZH A;  2DTW A;  2ZEX A;  2ZZJ A;  2BRT A;  1KXG A;  2BP6 A;  2C1F A;  4XFB A;  5EYX A;  1UOF A;  4Z2W A;  2Y0I A;  1QOT A;  4R4Z A;  1E5S A;  1S2K A;  1W90 A;  2B9V A;  4RGA A;  3WW2 A;  1X50 A;  4QPG C;  1VBD 2;  1YYN A;  1HB1 A;  1WGP A;  2B4K A;  3M2M A;  5IVF A;  1XYP A;  3ILF A;  2Y26 A;  2GME A;  3KV6 A;  3WLU A;  3EBR A;  3IBM A;  4MZU A;  3VD9 A;  1COV 1;  4XHX A;  4YGD A;  1NXD 1;  3KSC A;  5FPL A;  3OPT A;  4ZXK A;  3VUO A;  4DMI A;  1XSR A;  1H2L A;  4CPB A;  4Z8B A;  4A2U A;  3O1U A;  3VBS B;  5DPN A;  3UT0 A;  3H50 A;  1OUX A;  3K2O A;  3VDC A;  1G9F A;  4ZPI A;  4YYO A;  1V70 A;  1FMD 3;  2HLE A;  3FLR A;  3KV4 A;  4NHL A;  4A6S A;  4GWN A;  3VBH A;  5IWF A;  2C24 A;  1LNS A;  3ZSE A;  1YWK A;  4PJY A;  3AMH A;  5IFP A;  2ZML A;  2O8O A;  4XUT A;  4AI2 A;  5IVY A;  1SLL A;  4XAB A;  5IK8 A;  4HSJ A;  4KU7 A;  4QT6 A;  3VKF C;  2HWD 2;  4GWM A;  1ASJ 2;  2DCJ A;  4P14 A;  1V6J A;  3DPR A;  1PMH X;  1RJ7 A;  3O1V A;  3I3M A;  1BEV 2;  1HRI 3;  2E9Q A;  5BUV A;  4OUE A;  2FD8 A;  2IVJ A;  1VMJ A;  2LM3 A;  4AW7 A;  1VBA 1;  2YZ4 A;  1Z7S 1;  1OMI A;  3IDB B;  1GOH A;  1GWK A;  4P9Y A;  1TQ5 A;  4YW4 A;  5KHJ A;  4IEO A;  3NNF A;  2ZZQ A;  1U0A A;  4UFI A;  3WCS A;  2YGM A;  4ISR A;  4A45 A;  1UQX A;  5A6Q A;  3VL9 A;  4WVZ A;  4D7T A;  5A3T A;  1BBT 3;  4LNV A;  4L8Q A;  3K51 A;  4AGG A;  1W99 A;  2ZHK A;  4GH4 C;  1AL2 2;  1VBB 2;  1UN1 A;  3JBG 1;  1Q8Q A;  2RDQ A;  4GB3 3;  4BYY A;  5JWP A;  2G1M A;  1ENS A;  1YIP A;  3R4D B;  2DUP A;  4CPB D;  1C5H A;  2RS5 1;  1FX5 A;  5E1R A;  2XJT A;  1LHV A;  1NX9 A;  1W8Z A;  4Y1Y A;  4PHZ A;  1JMU B;  2VOX A;  3JUU A;  4JAA A;  2P2K A;  5LA2 A;  5J48 A;  2R06 1;  5A7S A;  4IEP A;  1OOP C;  3VKN A;  1XYO A;  4MX3 A;  2YFU A;  3AL5 A;  2V4A A;  3H7J A;  3VBH B;  3WOG A;  3SC7 X;  4QQL A;  2TNF A;  4XUR A;  2J7M A;  4RFR B;  4AI9 A;  5T50 A;  2R04 1;  3OPZ A;  1U5Y A;  5HCB A;  2ZS6 B;  3DPR B;  5FYY A;  3NV4 A;  4NAM A;  4ZON A;  3VKO A;  4AVS A;  4COV A;  3DXU A;  1YRZ A;  3D4K A;  3AKS A;  2HEV F;  3TEW A;  3AYE A;  3OY8 B;  2IXK A;  3PTR B;  5DG2 A;  2AEY A;  4ISQ A;  2P6C A;  3GZU C;  2FMY A;  1W39 A;  1O6U A;  1POV 0;  1W9T A;  4ZS2 A;  5A7O A;  4ZY9 A;  1IPS A;  4K40 A;  2RS1 1;  2E7T A;  3ENR A;  2QFE A;  2WNV C;  4L0P A;  3ZFF C;  5LY1 A;  4FPJ A;  1LEN A;  2BDR A;  5I0S A;  2QCS B;  3N7M A;  5ACA 2;  2VOK A;  1FV3 A;  1LU2 A;  2ARB A;  5K4L A;  3THP A;  3AP9 A;  4IEZ A;  3PU3 A;  5AC9 1;  1UZV A;  1UD1 A;  4N7I A;  4YZ5 A;  2JE7 A;  5GZG A;  2KR2 A;  4OQ9 A;  1KJR A;  3TWI A;  1MZE A;  2WNU C;  3L2Y A;  3PIJ A;  1F9K A;  4FPL A;  4XMI A;  4UW3 A;  5DDJ 2;  5F9T A;  5IVC A;  3TEZ A;  2E32 A;  1N1T A;  4XJZ A;  3I49 A;  1LEM A;  1NY7 2;  2X5I C;  4WM7 C;  4ATF A;  4XZU G;  5FZ0 A;  1O3Q A;  4K20 A;  1A34 A;  1MS4 A;  3LA2 A;  4E2G A;  1VBC 3;  5KHI A;  4KL1 A;  5FIX A;  1U5I A;  5FPX A;  1L7L A;  3OGR A;  4XIO A;  2C9A A;  3CU7 A;  4LLF A;  4LUM A;  2PTM A;  4DQA A;  5CFC C;  4R52 A;  4Q0U A;  2EIE A;  2W94 A;  2QNK A;  2VOT A;  1RVF 1;  4AGR A;  5C8C A;  1KIT A;  4D6R A;  2PHF A;  1QJX 1;  1NZC A;  3AKP A;  4HG6 B;  4NAO A;  1H2M A;  4E4H A;  2FDH A;  5KXB A;  4QU1 A;  4M3C F;  4AFD A;  3KHB A;  3B94 A;  2WFF 3;  4BK5 A;  4LKD A;  5JZG B;  5C4W C;  1J1T A;  3MDP A;  4CCJ A;  4ASM B;  5A70 A;  1QQP 1;  2VD7 A;  4HMZ A;  2ARX A;  5FZF A;  2VAU A;  3LWC A;  3VD5 A;  2BBV A;  2JKB A;  2WAA A;  3KLS A;  1US2 A;  1JUH A;  2JEM A;  2V4V A;  2EXI A;  4JKL A;  5FYH A;  1JOJ A;  5GLW A;  1XE8 A;  3ZSM A;  3ZMO A;  1UMH A;  1JZ7 A;  2R49 A;  3ME2 A;  4NIA A;  4C8D A;  2VUC A;  2P34 A;  1S1A A;  4D7S A;  2OZJ A;  2VZO A;  2Y6G A;  1LGB A;  4XF0 A;  3ZYG A;  4Y33 A;  5FO7 B;  3CL1 A;  4LR4 A;  2WII B;  4D3W A;  2VVF A;  4M3C A;  4CP2 A;  1TMF 2;  4ASL A;  1WCS A;  3E1F 1;  4YZ3 A;  4B29 A;  3AVR A;  1FT9 A;  3LKJ A;  4UFH A;  1N1V A;  5A7N A;  4YG6 A;  1YI7 A;  2LW8 A;  4WV8 A;  1SFP A;  4S2D A;  4M0H A;  1UPI A;  4URT A;  4OHZ A;  5IVV A;  1S0G A;  2W5F A;  1RUI 1;  3DL3 A;  3ZYI B;  1V9U 2;  4I2O A;  2RVA A;  2VJX A;  4HT1 T;  4IEW A;  4L99 A;  3A23 A;  3FJS A;  1RUH 1;  2YGL A;  4AVA A;  1N3O A;  3RZZ A;  2HWF 1;  3KWV A;  1R08 3;  4RGG A;  3AMN A;  3FL7 A;  3SCH A;  5C8C B;  1C3H A;  3AXD A;  1WLC A;  4I3G A;  3WUD A;  4OHW A;  5BNP A;  3W21 A;  1PK6 A;  2RS3 1;  1CJP A;  1O59 A;  4XFA A;  4MG2 A;  1MS0 A;  3IAP A;  3ILR A;  5FJH A;  4N9H A;  3HIF A;  3MI8 A;  3QOP A;  3TN9 1;  2Y6J A;  5C3S A;  3BKZ A;  1OKO A;  3JD7 3;  2BFU S;  4FFH A;  4LBN A;  4S2F A;  5F2W A;  1YEW A;  3R05 A;  3ES1 A;  4BU2 A;  1UOJ A;  2OUJ A;  1CD3 G;  4EZ4 A;  4IXL A;  4XAC A;  3BOD A;  4QPI C;  1NXM A;  5HPO A;  3UKT A;  4AED B;  2JE9 A;  4QMA A;  3JB8 A;  4XFI A;  3WNO A;  4HFS A;  3J8F 3;  5FQ0 A;  2ZAH A;  4XQW A;  1UMZ A;  4R8H A;  5KXE A;  1AYM 1;  4M3C B;  3KHC A;  2WS9 3;  3FC0 A;  4ZU4 A;  4A42 A;  3CZJ A;  3MF9 A;  5A1L A;  1WCQ A;  4Q4V 3;  2JG9 A;  1NQJ A;  2VZR A;  4BQX A;  2BOJ A;  3IZO A;  1COV 2;  3UK9 A;  4MXW A;  2W0X A;  1EPZ A;  1CX1 A;  3A21 A;  3OUH A;  3NST A;  1QNY A;  4QX3 A;  3ZXL A;  2JDM A;  2DU0 A;  2WO7 A;  3OEA A;  2EF6 A;  2DCK A;  1U12 A;  3KGL A;  2WA4 A;  4HVQ A;  4FAG A;  1EPW A;  4AEM A;  4ZZ8 A;  4GAL A;  2VL4 A;  1SLC A;  1ZYB A;  3FMG A;  3WT3 A;  1SDW A;  4CU7 A;  4WVW A;  5BNP B;  5GZE A;  4PT6 A;  1PK6 B;  2WWS A;  1I3H A;  1TVG A;  2PHD A;  4Q1P A;  4ZS3 A;  4QX1 A;  1BJQ A;  2VQU A;  4E2S A;  3LFM A;  2W2I A;  2F4L A;  4A7K A;  3VDA A;  1RIT A;  1B35 A;  3VBF A;  1XE7 A;  1VRH 2;  2E63 A;  3LF7 A;  3GGL A;  4XAA A;  3RI9 A;  1X9P A;  3LGR A;  4CUA A;  2VXJ A;  1QJY 1;  3OBA A;  4Q0Q A;  3NV1 A;  5FOJ B;  3K4Z A;  3RYK A;  1RUE 1;  4AGV A;  1LEC A;  2JD4 A;  1BZW A;  1ZBE 3;  4FP2 A;  4W6W A;  3WG4 A;  4KQ7 A;  2J1S A;  3W59 A;  4FSJ A;  2WWJ A;  1HRI 1;  4IQP A;  3PUS A;  4J6G A;  1QEX A;  3WHT A;  2BUK A;  3MW2 A;  1JZ3 A;  3JBG 2;  4O61 A;  3KB5 A;  2Z79 A;  5KXD A;  4HZF A;  3VL8 A;  4GA9 A;  2CYF A;  2RS5 2;  4MGI E;  4OUS A;  2BJS A;  4MXW B;  4XPV A;  3THC A;  1H8T A;  3ZXK A;  1IHM A;  4QB2 A;  3O7O A;  3PUQ A;  4NMI A;  4XUP A;  1BBT 1;  2R06 2;  1MEC 3;  1ENR A;  2HWE 3;  1O5L A;  3KT7 A;  3OOX A;  4GWI A;  4LUL A;  3H8O A;  3H7Y A;  4GB3 1;  4P5Y A;  3ON7 A;  3PVN A;  1HQW A;  1PMI A;  2RJL A;  4XFG A;  1W3V A;  4BH9 A;  3LSD A;  4K7J A;  5FXW A;  2R04 2;  2VMF A;  5IW0 A;  3WG3 A;  1GAN A;  1T6G C;  5DAX A;  1HRV 2;  3UJQ A;  1IPJ A;  1B35 B;  1UYZ A;  3NRU A;  4P9G A;  3VBF B;  3POE A;  2ZX3 A;  4DPN A;  3T0B A;  1NQD A;  4P02 B;  1SFY A;  4DB5 A;  5FZL A;  1DQ4 A;  4XDO A;  3THT A;  3DCQ A;  5FYI A;  2RS1 2;  3VDD C;  4HN0 A;  1CON A;  3AMM A;  3ACH A;  2OZ6 A;  4KI5 M;  3GZE A;  1OA2 A;  3VBR C;  3AP4 A;  1NLS A;  1N3Q A;  2ETE A;  5FZA A;  4NHX A;  5EHD A;  4NR1 A;  3AZW A;  1SDD B;  4R9A A;  1PO1 3;  4Y5S A;  1L7R A;  3NW4 A;  3ZXE A;  4FFG A;  1AXK A;  5I8T A;  2YHJ A;  1BVV A;  3HWJ A;  4XF3 A;  1GR3 A;  5FZO A;  2D7F A;  2A6Z A;  4Y1X A;  5JMC A;  3BUC A;  4FTS A;  1S0J A;  1XBF A;  1NA1 A;  3POF A;  1O8P A;  2D5H A;  2Y6L A;  3KM5 A;  4JX0 A;  4JKK A;  4OYU A;  1FYU A;  3O1M A;  1NT0 A;  3AK0 A;  2DCZ A;  2BYV E;  3VN4 A;  5GLZ A;  1W6P A;  1S0F A;  3LEM A;  2WT2 A;  1X9T A;  4CCO A;  1GNZ A;  2V09 A;  2JG8 C;  1Y9M A;  1QJX 2;  4C1X A;  1PX3 A;  3EJK A;  1GMM A;  3T08 A;  3KD4 A;  3SNM A;  1URX A;  2BPA 2;  3EB7 A;  2VPV A;  3EQE A;  4K8R B;  5FMB A;  1CPM A;  2GNM A;  2WN2 A;  2VQA A;  1ACC A;  2B46 X;  1GIC A;  3NJX A;  1XNK A;  5EXO A;  3OYW A;  3OSD A;  1W9S A;  5IYY A;  1XND A;  3JB4 C;  1AR9 3;  3ZX7 A;  2AR6 A;  4YVS C;  2QZ3 A;  3KV9 A;  4OUM A;  3F2Z A;  5A1A A;  4QHO A;  1AVB A;  5FJK A;  3BVC A;  5FYT A;  1QH7 A;  4ET7 A;  4YW3 A;  3BIE A;  1TEI A;  2WFF 1;  3WP6 A;  4ASK A;  3R6S A;  1LGN A;  2MEV 2;  4JDO A;  1AR8 2;  1H4G A;  1ONA A;  1GP4 A;  2W1Q A;  2WT1 A;  1BMV 1;  2BV4 A;  2AH2 A;  4DY5 A;  1W8N A;  3LEI A;  2RJ2 A;  2XL7 A;  3MW4 A;  4Q1R A;  1M4W A;  1H2N A;  3KT1 A;  1OLM E;  3BOP A;  4JGZ C;  5FZO B;  1LB2 A;  1U5Z A;  2DBI A;  4FI9 A;  4CU8 A;  4NOT A;  3W5M A;  2Q8C A;  2J1V A;  2WAO A;  1S2E A;  3LEK A;  1NA1 B;  1W05 A;  4QXH A;  4QHB A;  1Z0H A;  2UWC A;  2FZ2 A;  4UI9 L;  4RN5 A;  1SLB A;  1IG0 A;  1BK0 A;  1IG3 A;  1RUI 2;  4Y1Z A;  2ARE A;  3GHN A;  3TB0 A;  2VCC A;  3CEW A;  1XJA A;  3T2T A;  2IFR A;  1OVS A;  1W6P B;  3U07 A;  3ZIW A;  1VBD 1;  1RUH 2;  1SAC A;  4ARY A;  2Y6K A;  5C70 A;  3LFI A;  3AMQ A;  3N9L A;  3WCR A;  5IAT A;  3SLI A;  4COZ A;  1WW7 A;  1GWM A;  1Y43 B;  5EWS A;  3IDE A;  2GNT A;  4N9I A;  1VB2 A;  5CZK A;  1A3K A;  4EWE A;  2B9U A;  5KC6 A;  2PAE A;  3BB6 A;  4NO4 A;  2K2S A;  3TN9 2;  2XJR A;  1T6B X;  2A71 A;  2HJI A;  4B4Q A;  5L73 A;  1IOA A;  4MHR A;  2D3R A;  4Q4W 3;  2VQ0 A;  5HXM A;  3W9A A;  2VUD A;  1R08 1;  2DVF A;  2LAL A;  3T30 A;  1ZRD A;  3CIH A;  4GAZ A;  1LOG A;  3BTY A;  3WQ0 A;  4YM0 A;  3HMY A;  1LKN A;  4CP9 A;  1ASJ 1;  5HXV A;  4CXW A;  5BNO A;  1Y9Q A;  1JZ2 A;  1RUD 3;  2WKK A;  4UFJ A;  4NII A;  1AYM 2;  1ODM A;  5A3L A;  4JHZ A;  2PXJ A;  4XHB A;  3VKL A;  3PUH A;  5F5C A;  2YC4 A;  5J36 A;  4XCA A;  4N53 C;  4Y4R A;  3N4M A;  5CG9 A;  1IZ3 A;  1DZT A;  2BGP A;  2IVI B;  4AQS A;  3BIW E;  1G8W A;  3GCX A;  2BGC A;  3J8F 1;  5K0U A;  2RM2 2;  2YYO A;  5GM0 A;  5CAD A;  1ULG A;  1QXP A;  4C0B A;  5C6C A;  1W28 A;  1N1S A;  1DGL A;  2UUR A;  1UOB A;  3AP7 A;  2WS9 1;  3ELN A;  3PDQ A;  2VO5 A;  5F39 A;  1AL2 1;  1VBB 1;  5L9B A;  4KMQ A;  4MSV A;  3U78 A;  1GQH A;  2YRO A;  3LB9 A;  1LOE A;  5FKB A;  4NVP A;  2DVA A;  1H9W A;  1J1L A;  5EZW A;  3RZK A;  3CJI A;  2XHK A;  1UCX A;  1W04 A;  2A5Z A;  4LE4 A;  2R32 A;  1FPN 2;  1REF A;  2YDE A;  1RXF A;  4XQ4 A;  4YG3 A;  2OYZ A;  4CUB A;  4DOU A;  3U1X A;  3PUR A;  3WP5 A;  3O1O A;  3W20 A;  4OZO A;  4LMF A;  5LA9 A;  1AYN 3;  3WNX A;  3FHQ A;  1UU5 A;  1FMD 2;  1CWP A;  1H9P A;  1DGW A;  4AK3 A;  4U2A A;  1STM A;  3JCI A;  4GQ7 A;  3HJR A;  4CP9 B;  4X6R B;  5BNO B;  5FXV A;  2FDJ A;  4R9D A;  1DLL A;  4JQT A;  5E16 A;  1XQN A;  2W3J A;  3AZV A;  3UYJ A;  1HIX A;  1MS1 A;  3VBO C;  3PVB B;  3ACG A;  1HRI 2;  3VD3 A;  2JDK A;  1H2K A;  4BQ2 A;  1UXX X;  3MFC A;  5CIR A;  5JUV A;  3PJQ A;  3GM8 A;  1CPN A;  2OXB A;  5FUI A;  2JDP A;  2A6X A;  2Y34 A;  3KF5 A;  4OFG A;  1TNF A;  1GZ9 A;  1WA6 X;  2WRA A;  3RYP A;  1ZBE 1;  4CP0 A;  3DGT A;  5K0U B;  3LCP A;  3E5Q A;  4LBL A;  3TBD A;  3VBU B;  3ZDS A;  4BDV B;  2ZMK A;  3T4V A;  5JXJ A;  4IE7 A;  2QZ2 A;  1BBT 2;  4FPK A;  4LUK A;  4RQP C;  3RZL A;  1XPW A;  3M3Q A;  2VZP A;  5HCH A;  4TZD A;  1UNB A;  2YC2 A;  1Y9G A;  4GB3 2;  3PNA A;  4JV4 A;  4COW A;  5A7P A;  3CJI B;  4E4D X;  1CAW A;  3ST7 A;  4EQV A;  3WQB A;  5DUX A;  4EWA A;  1ND3 C;  4PLM A;  1JW6 A;  4NHM A;  4EZH A;  5CBL A;  4IEY A;  1YC6 1;  5D8A C;  2A6W A;  4NPR A;  2BVB A;  1PGL 1;  2NQY A;  1IS4 A;  4RL7 A;  4AXO A;  4GKX A;  3QH7 A;  3ZM8 A;  1X7N A;  3RMX A;  4YVW C;  3H1W A;  1O91 A;  3U75 A;  3ZKY A;  4XCB A;  1LOF A;  3LQC A;  3Q8F A;  3GDB A;  5CKM A;  2BNO A;  3KS7 A;  4QQP A;  4BIO A;  1F4A A;  5LBE A;  3D8C A;  3FFQ A;  4OHX A;  1UYP A;  2L9L A;  3WR0 A;  1DDL A;  3WF1 A;  3C7F A;  3UKN A;  5A33 A;  1W6O A;  1PVC 3;  2XJU A;  4CEY A;  3POW A;  4QX8 A;  3M3I A;  4YLZ A;  4UW5 A;  3JQX A;  3PVE A;  4IV1 C;  1IS3 A;  3H42 B;  5CVR A;  4Y1U A;  3NVC A;  2W39 A;  1PHM A;  4AHX A;  3Q8A A;  1IPK A;  5E6H A;  4BPZ A;  4HON A;  1MQT A;  4KGG A;  3PIG A;  2XVL A;  4DUV A;  2PFW A;  2DFC A;  4TLG A;  3MV1 1;  1S0D A;  2HWC 3;  5FY5 A;  4F83 A;  1CAW B;  5JI9 A;  1PO1 1;  2R6Q A;  1NCQ C;  1WWY A;  3I7D A;  4QX0 A;  3V64 A;  2FDG A;  5CA6 A;  4Q0S A;  3ZDV A;  3BTX A;  2DVG A;  1X8M A;  2ERF A;  2RV9 A;  4JRL A;  1X36 A;  1RUF 3;  4IGQ A;  5FLJ A;  1N47 A;  1EV1 3;  4UBG A;  3WVJ A;  2Y6H A;  1V9U 1;  4AVT A;  2ZBJ A;  1VBC 2;  1ZZ8 A;  3DPR C;  2AZ5 A;  1T2X A;  4A4A A;  5FK8 A;  2XJQ A;  1V6L A;  3ZN5 A;  3NAP C;  1S55 A;  5EJZ B;  3CLP A;  1FNY A;  1SHW B;  2JEC A;  4IV3 C;  5C7G A;  2ET7 A;  1JH5 A;  2GP3 A;  1ND2 A;  2XDV A;  3VHP A;  3V0B A;  1W6O B;  2D6M A;  3VZN A;  4CEY B;  5JXG A;  4V1P A;  4FVV A;  3IKW A;  4RHV 3;  4FOW A;  1S0E A;  1YQC A;  2WFF 2;  4O9G A;  5LBC A;  2J22 A;  3RZG A;  1FI2 A;  1G7Y A;  4DUW A;  1CR7 A;  4CCL A;  3OGS A;  4XF9 A;  2D6N A;  3BN6 A;  3KQR A;  2RDS A;  5FK7 A;  5T52 A;  3AKQ A;  1UZW A;  1JHN A;  2HWB 3;  4N43 C;  2Z42 A;  1MQT B;  3T3Y A;  4XF1 A;  1RUJ 2;  1AR9 1;  2QDN A;  2RG4 A;  3AFG A;  4R9C A;  5IVJ A;  4JZR A;  4AAP A;  2WUH A;  2QQP A;  3I3Q A;  4Q4Y 3;  5F3C A;  4CEW C;  2XH6 A;  5SV8 A;  4JHT A;  1CZV A;  2RM2 3;  4P9I A;  4JDN A;  1K5M C;  1VP6 A;  3P5B A;  3POJ A;  5FZ7 A;  4CDW C;  1UF2 C;  4OHV A;  2XJS A;  1F2N A;  3T2P A;  5LEJ A;  3ZFG A;  1NAE A;  4LBJ A;  5FYS A;  3VDB A;  1XU1 A;  4LBK A;  4LK7 A;  4YG0 A;  3ZFE C;  4BQ1 A;  2CY6 A;  4A3X A;  1RUC 2;  1ZRE A;  1YUD A;  4L92 A;  5A7Q A;  3X29 B;  1JS9 A;  5LK7 B;  1FPN 3;  4AHW A;  1UZZ A;  2XML A;  1QXJ A;  4ZZ5 A;  1HQN A;  4AEJ A;  1QXR A;  3IMN A;  3SH4 A;  3I3D A;  4IE6 A;  4MVT A;  5L7O B;  3BCW A;  4J1W A;  4RR3 C;  4BQY A;  4RD7 A;  2VGD A;  4KWJ A;  5C8W A;  1R08 2;  1ND2 B;  2R07 3;  5BNN A;  5HV0 A;  3V0B B;  2D98 A;  2NZ9 A;  3ZSK A;  1YLL A;  4Z1V A;  1JUI A;  1VAM A;  5EFU A;  1OXC A;  2ZKN A;  3I2J A;  2DYC A;  1UY3 A;  4CYD A;  2QTW B;  5F7U A;  2WR9 A;  4LO8 A;  2GAU A;  3WW4 A;  3ITQ A;  2GH8 A;  1AHS A;  2E33 A;  2CHH A;  3GBG A;  3FE5 A;  3JD7 2;  2WZP P;  1VRH 1;  1CVN A;  3HAG A;  3OY8 A;  1RUG 3;  4JGY C;  1C5I A;  5AVA A;  2XVG A;  5H9P A;  4PBP A;  5F3I A;  4D7Y A;  1DIW A;  2W08 A;  3HT2 A;  5L19 A;  4ITC A;  4QB1 A;  1GQP A;  3O0X A;  1MS5 A;  4CUG A;  5FZ4 A;  1KGY A;  1QOS A;  2JJ6 A;  4O9E A;  3G6J B;  3J8F 2;  2Q8D A;  3ZFG B;  1Q5O A;  3HBK A;  1DGW X;  3MIC A;  4HVO A;  5FUP A;  2WS9 2;  4P9X A;  3ZYJ B;  3GZT B;  2ZAB A;  4GIQ A;  1BKZ A;  2AEZ A;  5FY7 A;  5IFT A;  2A3Y A;  3GNE A;  4QD2 A;  4XE9 A;  4H7M A;  4Q4V 2;  1CQ9 A;  1DU3 D;  2A70 A;  4EJR A;  1S4C A;  1W8H A;  5A3M A;  2CWM A;  1LU1 A;  2W68 A;  3VHN A;  5C8C C;  5F6K A;  1AL0 G;  1D4M 3;  1W2N A;  1XB9 A;  1GV9 A;  1Q8P A;  2I07 B;  2UWA A;  3M4F A;  4LBO A;  4Y5Z 0;  5FLH A;  3ZR6 A;  1WLT A;  4AVC A;  1WCU A;  4I01 A;  4ZKT B;  2FDF A;  3Q8E A;  5BNN B;  1YQ5 A;  4TN7 A;  3I2O A;  2EAA A;  3B02 A;  3CKH A;  2VZ1 A;  2ZGM A;  3JXS A;  4NJ4 A;  4OI2 A;  1RIR A;  3NQH A;  2Z2S B;  1O4Y A;  3LDB A;  3H8U A;  5E88 A;  3WX5 A;  1GWL A;  1XSQ A;  3MIG A;  2PAK A;  4AFC A;  1HRV 1;  1WCD J;  1JN2 P;  5CIS A;  2XLG A;  3C8X A;  3URF A;  4UF0 A;  1AYN 1;  5F3E A;  4AR2 A;  1VIW B;  5HV4 A;  1DZQ A;  5IK7 A;  5A32 A;  4Z92 B;  1H6Y A;  1PMJ X;  2BZD A;  3EXU A;  4LIU A;  4XIK A;  4BA6 A;  4CRQ A;  5JZG A;  5J37 A;  3B7M A;  1Y7B A;  4W50 A;  4Y4Y A;  3MV0 1;  2W1S A;  5F32 A;  3PUA A;  1QDO A;  4QPG A;  3WQ1 A;  2PHU A;  3OGJ A;  1SPP A;  5EV7 A;  1PO2 3;  1ZBE 2;  5GKA C;  2AYH A;  4YGB A;  5CNA A;  1C1F A;  3ZXF A;  3MZH A;  2XBO 3;  3EMR A;  3OTF A;  1W03 A;  1SLI A;  5T5O A;  2XPJ A;  1S0I A;  1VMF A;  1OPO A;  2RHP A;  3PUI A;  1ZZ6 A;  4NRQ A;  5EJ1 B;  1JYV A;  1DQ2 A;  1W6Q A;  4NIG A;  4XF4 A;  2PAM A;  3S6P A;  5JR7 B;  3OEB A;  4CDQ B;  4EN0 A;  4CCM A;  2V72 A;  2B5H A;  4XOG A;  3NKT A;  4K1Z A;  3USU A;  2TBV A;  4BJ0 A;  3UV9 A;  1J59 A;  4QQO A;  3MF6 A;  4X8P A;  1HDK A;  4IEV A;  1PGL 2;  1MEC 2;  2HWE 2;  3A4U A;  4GXL A;  1WLW A;  2BVV A;  3KF3 A;  4C1W A;  2FCV A;  3ECQ A;  1D0H A;  1RED A;  2RJK A;  3D0J A;  5F1R A;  2WZE A;  1CIW A;  3AJZ A;  3LDK A;  4JCK A;  3POB A;  1LHW A;  2JWP A;  4MXV A;  1KDK A;  1ALY A;  4C91 A;  3BAL A;  5FP9 A;  3ZPY A;  1QH6 A;  3WD5 A;  2C9K A;  4UF0 B;  2ZGU A;  2A6V A;  5A32 B;  4SBV A;  1RMU 3;  4B7E A;  2Q8E A;  1F5J A;  1GNY A;  4YM3 A;  5FTT C;  1J3Q A;  4CXY A;  4QPG B;  3BGA A;  1JYX A;  4D6Q A;  4GH4 A;  4BIF A;  1SPP B;  1H4H A;  1EYB A;  4QPY A;  4YNI A;  5A1F A;  1RUJ 3;  2JG9 C;  1YNA A;  4Q4X 3;  3WV6 A;  2O8Q A;  1GSL A;  2Y38 A;  4CA9 A;  1O7F A;  2VVE A;  3POI A;  4AED A;  1QWR A;  1NG0 A;  3LAG A;  4AI1 A;  1NKG A;  4H55 A;  1W6Q B;  2MEV 1;  2WNE A;  1AR8 1;  2NMO A;  4QKN A;  2HEY F;  4MGZ E;  3WQ7 A;  4CDU A;  3DKQ A;  1PO1 2;  1RXG A;  2BOI A;  3WHU A;  3Q8C A;  4NRP A;  2OW4 A;  2VCA A;  5IVB A;  2JDH A;  3EYP A;  4ZU5 A;  3KVB A;  4LQR A;  3USU B;  4NID A;  4AEK A;  1UIJ A;  4MET A;  3E6D A;  3NJV A;  3V65 A;  1RUC 3;  3J26 N;  4G3Y C;  1UY4 A;  3WP4 A;  1H8V A;  3AP5 A;  4QDS A;  3C3V A;  5H9S A;  3N9N A;  1TE1 B;  4XFF A;  3G7D A;  4NHY A;  4XUN A;  4E2Q A;  5I0R A;  1SBD A;  3WW3 A;  2E7Q A;  1YI9 A;  2P4E A;  2ZEZ A;  1WD4 A;  2E26 A;  3D82 A;  4UW6 A;  3TNQ A;  3LDR A;  3FX3 A;  2VNG A;  3III A;  2BBA A;  3VZM A;  3HOB A;  1OD5 A;  4FPC A;  4IES A;  4PI0 A;  3OPW A;  4UXA A;  5ISL A;  3MPB A;  5FZ1 A;  1V00 A;  1YFU A;  5CYY A;  4YRD A;  4XFC A;  1CZT A;  4EN9 B;  1JZ8 A;  2C5D A;  1EV1 1;  1I9R A;  1SEF A;  2WNV A;  5I93 A;  1OFN A;  4RS5 C;  4E8D A;  1FV2 A;  1KQR A;  3J7L A;  4GH4 B;  4XDP A;  4LT5 A;  3K46 A;  3ZYB A;  3C2U A;  3PMS A;  4K21 A;  3LA7 A;  4YPJ A;  4LO4 B;  1HN1 A;  1W6N A;  1I5P A;  2ZEW A;  1AR9 2;  1H30 A;  4HOO A;  4KNC A;  1F4H A;  3MW3 A;  1W2A X;  1H8T C;  1AR6 3;  2X5I A;  1MZF A;  3PLQ A;  4WM7 A;  3QD6 A;  5FXX A;  4BLI A;  4CDU B;  2VC9 A;  4K9S A;  1OOP B;  1HB4 A;  1C8M 2;  2MNG A;  2OVU A;  2KA3 A;  5FP4 A;  1CJD A;  1UMI A;  1DBN A;  4CCD A;  4BQW A;  4UFL A;  1DYO A;  3PL0 A;  4CSW A;  2V73 A;  4BHP A;  5CG8 A;  4AYU A;  5EYY A;  1W6M B;  3J7M A;  2FHR A;  4DRR A;  2VMG A;  5CFC A;  4HAN A;  1JU4 A;  5JSP A;  1GP6 A;  2ZX1 A;  5LA1 A;  2DU1 A;  2VOV A;  5FZM A;  2RDR A;  2RM2 1;  3MUZ 1;  5FXZ A;  4Z2A A;  4BB3 A;  3I2D A;  4YFW A;  2W47 A;  3I59 A;  4O7X A;  4YGE A;  3VV1 A;  5C4W A;  3LOI A;  3OGG A;  2X53 S;  3K75 B;  2JKX A;  3WSO A;  3RJR A;  4GD4 A;  2NLR A;  4P08 A;  5LBB A;  4L11 A;  4YZ4 A;  2R0H A;  1JZ6 A;  1FPN 1;  4HXC A;  1AF9 A;  1QJU 3;  2WNV B;  4FXK B;  1KFX L;  1FXZ A;  2PEL A;  4HN1 A;  1OKQ A;  2ATF A;  3ZFF B;  2BU9 A;  3AJY A;  2EA7 A;  3QLQ A;  4IGO A;  4QDQ A;  2YUE A;  2XUM A;  5JSO A;  1F35 A;  1RHI 2;  3H3U A;  4YZ1 A;  5LCW L;  2ZX0 A;  3HD8 B;  1FMD 1;  3IN9 A;  3LIH A;  4Q4W 2;  4EN6 B;  1W6N B;  1DP0 A;  2BQP A;  4PF5 A;  2RE9 A;  2XLA A;  1V6N A;  2WNU B;  3HEI A;  5GJ6 A;  4DRV A;  4BXF A;  1WW6 A;  2VBP A;  1VB4 A;  2R7E B;  4UOJ A;  3QBQ A;  2X5I B;  4WM7 B;  2P37 A;  5DQ0 A;  1TME 3;  5DXD A;  2F17 A;  1YCI A;  5CKN A;  1AJO A;  1RUD 2;  2VMC A;  3FBY A;  4QX5 A;  4UW4 A;  4AI0 A;  1GU3 A;  3LOB A;  2JE8 A;  3FN9 A;  3CF6 E;  1HX6 A;  4K6B A;  1RUG 1;  2PHT A;  2XQX A;  3BPZ A;  3INA A;  4FPF A;  2BWC A;  4QXB A;  1L3J A;  1XNB A;  5D2A A;  4DS0 A;  5CFC B;  5C5T A;  2DCT A;  2WWU A;  1OUR A;  1OFS A;  5FPV A;  3MGU A;  1R09 3;  1PZ9 A;  4ES9 A;  2O1Q A;  1QF3 A;  4PF1 A;  4FCA A;  3I59 B;  3S5Q A;  2LRO A;  1ODN A;  1GYK A;  4XIL A;  5CKQ A;  3WEZ A;  5C4W B;  1HV1 A;  4CP1 A;  3UET A;  1FNZ A;  3CDZ B;  4NHK A;  2VNO A;  4QKB A;  5FZ9 A;  5A6X A;  1ZVF A;  2D3P A;  3ATG A;  4XEZ A;  2P3K A;  1MAC A;  5FY9 A;  1S2B A;  2XKP A;  3OD0 A;  4NPM A;  4QPI A;  2PN5 A;  3AZX A;  5FYV A;  2CGN A;  1AYN 2;  5FZG A;  4O65 A;  2VTF A;  3MBW A;  2VNV A;  5LK5 A;  3O1T A;  2B7Y A;  2WZR 3;  2OII A;  3TAY A;  2PLV 3;  3HN1 A;  2X10 A;  1UX7 A;  4BMB A;  2FDK A;  2CDO A;  3J7H A;  5KXC A;  4JRA A;  2P3J A;  1O8S A;  4XTM A;  3WDU A;  5FY8 A;  1SLA A;  2EIC A;  3PU8 A;  1W8T A;  1ZNP A;  3MIF A;  3OBT A;  3U37 A;  3CBN A;  2IFW A;  1POV 3;  1HXS 3;  2WIN B;  2XUE A;  3UGH A;  1DZR A;  4D0Q A;  4TYS A;  1PO2 1;  1AR7 3;  5FZ6 A;  2XBO 1;  3FLT A;  5D1I A;  1W3X A;  3APB A;  1RYY A;  4YM1 A;  4DFS A;  1RUN A;  1XYN A;  1IKP A;  4XXA A;  4RSU A;  2DVD A;  2DV9 A;  3CMG A;  1Y4W A;  4FOV A;  3KMH A;  4XFH A;  1RC6 A;  1W9F A;  2XWB B;  3RJ2 X;  1NYW A;  4LHK A;  2X09 A;  5EP9 A;  5FBJ A;  4KWK A;  4PQ9 A;  1UYX A;  1S0C A;  4Y22 A;  5IJR A;  3RMY A;  3ZMN A;  5JOW A;  1LHO A;  4K1Y A;  4QPI B;  2JXA A;  2OX0 A;  3KGZ A;  3V0A A;  4M4R A;  1OHF A;  3HR9 A;  5J7M A;  1VBC 1;  2RR1 3;  2YMZ A;  1RJ8 A;  2VMI A;  1OH4 A;  3R4U A;  4X8N A;  1R1A 3;  4CDX C;  3AB0 A;  1UL9 A;  2WNO A;  3ZYH A;  4EN8 B;  5BXX A;  1OF4 A;  1PIV 3;  1LGC A;  3CO2 A;  3GCW A;  4Y24 A;  3TOJ A;  4QX2 A;  5JPM B;  1A8D A;  2Q30 A;  5FMD A;  3S57 A;  2A6Y A;  1PVC 2;  3M70 A;  4CCE A;  5LA0 A;  2XOM A;  3ILN A;  4N7U A;  1YQ8 A;  1BCX A;  1ZA7 A;  3HNB M;  4QU2 A;  1C8M 3;  1VBE 3;  1APN A;  2CWS A;  3B69 A;  5C9A C;  3I8T A;  1VPH A;  2DBN A;  1V6M A;  1UU6 A;  2NPI A;  2VW1 A;  1HQL A;  3SQO A;  2WAB A;  4HK9 A;  1J3P A;  1LES A;  1Q8S A;  3FUO A;  2J1T A;  1RUJ 1;  2QQM A;  4A7Y A;  1GOF A;  3I2H A;  2JB8 A;  2HKX A;  2KM2 A;  3SKJ E;  1NLQ A;  5ERL A;  2PYT A;  1NCR C;  4XAE A;  1VRB A;  5FMO S;  4HKL A;  2HWC 2;  3HT1 A;  1NE4 A;  1ST8 A;  1OLM A;  2ZGL A;  3ACL A;  3I54 A;  2QQV A;  4IGP A;  3MLL A;  5CEH A;  4K3U A;  3O5S A;  5CAZ A;  4Y22 B;  2IWG B;  4AVV A;  1ENX A;  1OVP A;  4JDM A;  1KEX A;  1RUC 1;  4H3W A;  5DAV A;  2R16 A;  5DG1 A;  5DN2 A;  5T55 A;  2CSG A;  1XOY A;  5DAW A;  1RUF 2;  3LZZ A;  2ZGQ A;  1XE0 A;  1XNT A;  3ACF A;  3E5U A;  1EV1 2;  2KD7 A;  2ZXQ A;  3VDD A;  3VKM A;  4C0H A;  3WG2 A;  3NJZ A;  1W2O A;  1J84 A;  2H0V A;  1RHI 3;  3IIA A;  4IDZ A;  2TEP A;  3HVD A;  2YBK A;  3VBR A;  2JIG A;  1A6C A;  2PHR A;  5IAX A;  2WLP A;  5A80 A;  3GJB A;  3W5N A;  2ORX A;  4F7Z A;  3ASI A;  3NKG A;  4P9L A;  1HB3 A;  4LOS A;  2HEW F;  3NJY A;  3NNG A;  3ZLI A;  5F37 A;  3TEY A;  2WA3 A;  3AX4 A;  2YG0 A;  4RHV 2;  2ORZ A;  4OCT A;  3VLB B;  5DAB A;  3H1M A;  2F4P A;  3B3Q E;  1SZB A;  3CHX A;  1UWW A;  3JD7 1;  1YFX A;  2A3W A;  4IUG A;  1D0G A;  4P5H A;  2H0B A;  2HWB 2;  1F5F A;  3POG A;  3RPQ A;  2B42 B;  5K9Y A;  2UWB A;  1IS5 A;  3CZU A;  1H1M A;  3WZ1 A;  4CXX A;  2I74 A;  5ANQ A;  5AVP A;  1YQ6 A;  3HNM A;  4Q4Y 2;  1BLZ A;  1SBF A;  1AX1 A;  1CAU A;  1OPM A;  1VBA 3;  2R30 A;  3S7E A;  4TTG A;  3T0D A;  3IAQ A;  2OQ7 A;  3VBU A;  2OA2 A;  3MIE A;  2VH9 A;  1LOA A;  1GKB A;  4XBN A;  5CFD C;  4LPL A;  2XG3 A;  5FYU A;  4AG4 A;  1E5R A;  4Q4V 1;  4QM8 A;  1Q43 A;  5FYM A;  5JDB A;  2WSU A;  1FAT A;  3NO8 A;  3AKR A;  1RL3 A;  2GMM A;  2Y60 A;  3VDD B;  1O3R A;  1HB2 A;  4DEQ A;  4G4F A;  5HBA A;  2ADD A;  2HH9 A;  5GZD A;  4YVS A;  3S7I A;  3TRS B;  4Q5O A;  3VBR B;  4HBN A;  3P6B A;  2WO3 A;  5ABJ B;  4NRM A;  3O0V A;  4M4P A;  4HKW A;  5DUW A;  4XBQ A;  3CQO A;  3PTY A;  2ZGP A;  5ABJ C;  2R07 2;  1G9D A;  1CX4 A;  4RGK A;  2RMU 3;  4B3N A;  4CUC A;  1KS5 A;  2A73 B;  3LSE A;  1OA3 A;  2FBE A;  4PDW A;  1MQT C;  5B2G B;  4PLO A;  1I1E A;  4WM8 C;  2HBU A;  3C7H A;  4XUO A;  1GFF 2;  5FO8 B;  1V0A A;  2BER A;  5JSR A;  1MZ5 A;  2WN3 A;  3SH5 A;  5TSW A;  2G4I A;  1BVP 1;  1QGL A;  1RUG 2;  4CCC A;  2WQ4 A;  3S0M A;  4FOQ A;  4ONU A;  1JYN A;  2W95 A;  4OI0 A;  1CAU B;  1U5X A;  3GZA A;  2I45 A;  4AOC A;  1O3T A;  3ZXD A;  3WP3 A;  1WD3 A;  5FOB B;  2JG8 B;  1F15 A;  2ZX2 A;  2D5F A;  4B8E A;  2ES3 A;  3T1M A;  1KD7 A;  1LAJ A;  3EO6 A;  4HVR A;  3I97 A;  1IKQ A;  1W2U A;  5E8A A;  1X8E A;  3VBS C;  5FY4 A;  2VMH A;  2VUA A;  3J7N A;  4FPE A;  2E31 A;  4BQ4 A;  3K3O A;  4YVS B;  2YV8 A;  5HI0 A;  4XDQ A;  4N90 A;  4TXW A;  1R09 1;  4CU6 A;  1K5J A;  1MEC 1;  2EXK A;  2HWE 1;  2WL1 A;  1D4M 2;  4JVA A;  4AQT A;  3OF1 A;  1QKQ A;  1LR5 A;  1AXZ A;  3L9J T;  4Z07 A;  3MUY 1;  1EUU A;  5A3P A;  5A3N A;  4M01 A;  1F8V A;  4GMP 3;  3LIG A;  2V5Y A;  3GF6 A;  4HPK A;  2VE1 A;  1KS4 A;  3B9I A;  4JGZ B;  2NM1 A;  1L7Q A;  4N53 A;  3WUC A;  4LO5 B;  4PDW B;  1LOD A;  4IET A;  2B45 X;  3R0R A;  3E6C C;  4WZC A;  4DIN B;  5T54 A;  1QJF A;  5FMC A;  4OMD A;  4ES8 A;  4NPL A;  1LCL A;  4OZX A;  4AFM A;  1RVF 3;  4QAW A;  5FPA A;  1EY2 A;  2AUY A;  2F6B A;  3RYR A;  3ZFG C;  2B8M A;  1K12 A;  2V5D A;  1UAI A;  4G9S B;  4U36 A;  4L2N A;  1PGW 2;  1QQP 3;  4UFM A;  4YSF A;  1PO2 2;  4LKF A;  1JYI A;  3SIS A;  4ARX A;  1G6N A;  2ZGK A;  3SHR A;  2XBO 2;  5B4N A;  4QB6 A;  1XXN A;  1EAH 3;  2DFB A;  3RRD A;  3A0K A;  3SIT A;  4MO3 M;  5JOZ A;  1TZO A;  4P9W A;  1ZBA 3;  4A6O A;  2OQ6 A;  4Y20 A;  4LIT A;  1AR7 1;  4H7L A;  4Q29 A;  5F3G A;  3VBH C;  3KCC A;  4JQR A;  4R9B A;  5ANN A;  2C26 A;  3UJO A;  1UY1 A;  2XJP A;  2LUW A;  3I2I A;  5LY2 A;  4QGM A;  4ZHN A;  3ALQ A;  4BM8 A;  4HPK B;  4JTN A;  4YGC A;  2QQN A;  4DIQ A;  2IZW A;  4WVM A;  3DN7 A;  5L7O A;  4E27 A;  3ABZ A;  3VBO A;  3DYP A;  4N53 B;  4Z82 A;  3UL2 A;  3WF4 A;  2UY8 A;  3U4X A;  3RDI A;  1ZM1 A;  4CTE A;  2NN8 A;  3RVH A;  3SMH A;  4LE3 A;  4LXL A;  5BPX A;  4F8A A;  2VOW A;  2XKO A;  4NWV A;  3VZL A;  4MV2 A;  2HWF 3;  2Q1F A;  2JDN A;  1POQ A;  4MHU A;  3SKV A;  1JU3 A;  5C3P A;  5IT6 A;  2YC0 A;  2RR1 1;  4M00 A;  2QQK A;  2A1X A;  1RMU 2;  1KFU L;  1XNC A;  2RS3 3;  1WMF A;  3P1I A;  5DZE A;  5FMO L;  3WW1 A;  4CCK A;  3S5A A;  1R1A 1;  3N7L A;  3VZJ A;  1V6K A;  4DZG A;  2G9G A;  3OBR A;  1WA4 A;  5I0T A;  1PIV 1;  2AAC A;  2VZ3 A;  4TLF A;  4MGT A;  2GH2 A;  2W9X A;  4LBQ A;  3VHR A;  1G86 A;  5L9V A;  4Q4X 2;  3ZVX A;  2YXS A;  1ND3 A;  5LWB A;  3IDC B;  2X8K A;  2G19 A;  5FDB A;  4LA2 A;  1DGR N;  5D8A A;  2D6K A;  4XJU A;  2A3X A;  1C8M 1;  3NNM A;  4MAD A;  1UKG A;  5DZF A;  1S0B A;  3LPG A;  2WSV A;  2GN3 A;  4Y20 B;  4YVW A;  1DCS A;  1ULD A;  2I2S A;  3WF0 A;  5IUQ A;  2JDA A;  3WDW A;  2VQT A;  4I30 A;  1AXY A;  1NUK A;  1VAL A;  2ZGO A;  3JU9 A;  3PHM A;  4PCR A;  1YJL A;  3UKV A;  1JYC A;  3OD4 A;  2QVS B;  2PHW A;  4NIH A;  4YW2 A;  4WVM B;  3OUJ A;  4E8C A;  3VBO B;  3ZN6 A;  3AC0 A;  4Q8K A;  1WW5 A;  3WDV A;  4IV1 A;  5BY5 A;  5JZG C;  4XET A;  3A7Q A;  3EHK A;  3U4S A;  3MPP G;  3ZXG A;  2BTV C;  4GJZ A;  3ZO0 B;  1PM4 A;  2ARA A;  5JMO A;  3RNS A;  2WDB A;  2FMD A;  2Z5W A;  5DUU A;  3RS6 A;  5C3Q A;  3FHA A;  2Q1Z B;  1UU4 A;  1LOC A;  3V0A B;  4XC9 A;  3KVA A;  4PIY A;  3U10 A;  4RQP B;  4HKO A;  5IVE A;  1RHI 1;  5FCC A;  2A75 A;  2P17 A;  4GKY A;  4LBQ D;  2VXR A;  4MYE A;  4Q4W 1;  1SQ4 A;  5A3W A;  4YW6 A;  4CVU A;  5FRA A;  2D3S A;  3BTA A;  3I2K A;  4LBQ B;  1NCQ A;  1XRU A;  4FOY A;  1ND3 B;  1GNH A;  4LBM A;  1QNW A;  3FZ3 A;  1YXW A;  2JIJ A;  2O14 A;  4YWA A;  4AFA A;  1PNF A;  1QJY 3;  1W8F A;  2LRP A;  5D8A B;  1AR6 2;  1V6I A;  4V2W A;  1X82 A;  1RUD 1;  1RUE 3;  2HBT A;  3KCY A;  4W65 A;  5H9R A;  1ZZB A;  3H1Y A;  4YVW B;  3B01 A;  1SLT A;  5B4X A;  2EAK A;  3RG0 A;  5LEK A;  1VLN A;  2Y8K A;  3NAP A;  1GZT A;  4IE4 A;  4CDQ A;  4IV3 A;  3VD4 A;  4ATE A;  3FFZ A;  4FQ4 A;  5FZB A;  2QQW A;  5IK4 A;  2SLI A;  2X05 A;  1GUI A;  4FT8 A;  3GAL A;  3GJA A;  1ZX5 A;  3ZN6 B;  4BXS V;  5LAT A;  1HW5 A;  3DF0 A;  5KHH A;  3O0W A;  2A7A A;  4IV1 B;  3VD7 A;  2WO1 A;  4Q0P A;  3WF3 A;  1LUL A;  5T5L A;  1AX2 A;  3M8L A;  1J3R A;  2YFZ A;  4J1X A;  2CDP A;  3WNL A;  4URA A;  4N43 A;  1FOD 3;  1QJU 2;  1WMX A;  3ZXA C;  2O0O A;  2QE3 A;  5JOX A;  1K42 A;  1LJ7 A;  2YPJ A;  4I0W B;  5GLU A;  2MHF A;  4YFZ A;  1ZRF A;  2K0G A;  4JTO A;  4F3J A;  4AED C;  4CEW A;  2XON A;  4FTE A;  1K5M A;  2C4X A;  5SV5 A;  2K46 A;  4CDW A;  2Y6F A;  4CDU C;  4EYU A;  1NCQ B;  3P3N A;  1VMH A;  5I0U A;  3UGF A;  2RMU 1;  3LE0 A;  2Q1M A;  2B39 A;  3BYW A;  3E5X A;  4B4R A;  2ZJC A;  4IEQ A;  3ZFE A;  3WNK A;  2HYX A;  1TME 2;  1N3P A;  5CU1 A;  1HN0 A;  5F2S A;  3O1R A;  3IB3 A;  4L9B A;  3N9M A;  3AZZ A;  2IUW A;  1C57 A;  1LTE A;  4UAP A;  2TUN A;  1JZ4 A;  3MIB A;  3HQX A;  3NAP B;  1JYT A;  1M06 G;  3MID A;  4IV3 B;  4RR3 A;  5A3U A;  1W8U A;  3M7A A;  3MHZ A;  5FPB A;  2VM9 A;  4BZ4 A;  2KXL A;  2XL9 A;  5BNP C;  5I91 A;  1AJK A;  1LOB A;  5JAX A;  2VR4 A;  2QQO A;  1PK6 C;  5T5P A;  5KC5 A;  1R09 2;  4QXC A;  4LIV A;  1CN1 A;  1E5H A;  3B00 A;  3SXW A;  4YAR A;  2ARC A;  2E6V A;  4FPY A;  1YIF A;  3K3N A;  4LHN A;  1JHJ A;  4A3Z A;  4AHY A;  2PA7 A;  1CES A;  1GQG A;  2DDU A;  2VBD A;  3WNM A;  1UYY A;  4N43 B;  1W0N A;  3IPV A;  3S30 A;  1VR3 A;  2Z69 A;  3AXE A;  4JGY A;  4E4S A;  3ETQ A;  5H9Q A;  4NWW A;  1A78 A;  3ZXJ A;  5BV6 A;  3MYX A;  5DAQ A;  5FZ8 A;  3IM0 A;  5JXH A;  4IER A;  4OUL A;  4CEW B;  3O12 A;  3N36 A;  2EIB A;  1MR5 A;  4D94 A;  3N3H A;  1K5M B;  3NV2 A;  1E5I A;  4FPG A;  4CDW B;  4BIS A;  4GMP 1;  1SCR A;  1QU0 A;  3A0N A;  2WBK A;  5KR7 A;  1QMJ A;  1YJK A;  2ZHM A;  2WZR 2;  2G9Z A;  3UGG A;  1LHN A;  2JDZ A;  2VTX J;  3ZFE B;  2PLV 2;  3FUQ A;  4FTB A;  2GC2 A;  2ZGT A;  2OPK A;  4H2A A;  4Q8L A;  4D69 A;  5LB6 A;  4DNY A;  1PVC 1;  2ADE A;  3OJB A;  1D4V B;  2QQU A;  4Q2F A;  3ZIX A;  4KGQ A;  1VE0 A;  1DFQ A;  1DQ6 A;  5A3O A;  2R1B A;  3RWN A;  2IXH A;  5DUV A;  5JCT A;  3H8R A;  1OOP A;  4RR3 B;  1ULC A;  1QOO A;  3DEC A;  5G05 L;  5FZC A;  1JOB A;  3AZY A;  4KG8 A;  1HXS 2;  4AQ6 A;  5FO9 B;  5F8P A;  1GLH A;  3U11 A;  3DKW A;  4H14 A;  4LKE A;  1AR7 2;  4EV0 A;  4KH9 A;  1W6M A;  4Q26 A;  4QGL A;  3FLP A;  4OQ8 A;  1DLC A;  3WNP A;  3JQW A;  5IHR A;  3AFK A;  3BTZ A;  1OH3 A;  1EAH 1;  4M3C E;  4CCN A;  4FBF A;  2HWC 1;  1W06 A;  4UBH A;  4BOW A;  3WNN A;  4MLO A;  1AUY A;  5DZG A;  1B35 C;  4DXT A;  1G9A A;  1REE A;  3IPV B;  2DUR A;  4J25 A;  3VBF C;  4JGY B;  5BNQ A;  1UKR A;  1ZBA 1;  5IK5 A;  3QCW A;  4QX7 A;  2ZOE B;  5KHG A;  3WY6 A;  2DF7 A;  1D2S A;  4Q27 A;  1VBD 3;  4QXK A;  4XJ8 A;  3ZYP A;  3N9P A;  3OBZ A;  3WIN E;  1RUF 1;  4YM2 A;  2JEN A;  4MH0 E;  2VVD A;  3P3P A;  1RIN A;  3KQ4 B;  3ZFF A;  2RR1 2;  3D0S A;  3AYD A;  4ORF A;  2OT7 A;  2QUO A;  2WO2 A;  3GXU A;  3T2O A;  2JIC A;  1R1A 2;  2XQR A;  2GC3 A;  3SCG A;  3J4U H;  1PIV 2;  1UW8 A;  1W8O A;  3N7J A;  4LA3 A;  3RSJ A;  1I6X A;  3ACI A;  4YZ2 A;  5KHK A;  3H8X A;  2WNU A;  5AFE A;  3O1S A;  1W9Y A;  1YFW A;  4OI4 A;  1FAY A;  4RHV 1;  3I2G A;  3IWZ A;  4QKD A;  5GLV A;  5E89 A;  1ENQ A;  5FP3 A;  1NLR A;  2GP5 A;  1DF0 A;  3PME A;  1VBE 2;  2BNM A;  2HWD 3;  1ASJ 3;  4FFF A;  2GSY A;  5K7P A;  2HWB 1;  3BU7 A;  1BEV 3;  4QQH A;  3IMM A;  3NWK A;  4Q4Y 1;  3VHO A;  2G9F A;  3C7O A;  4B1L A;  1MVQ A;  1OLR A;  2WC2 A;  2Y64 A;  1J58 A;  4BQ3 A;  3SH3 A;  5FZH A;  2WYS A;  2W91 A;  5FY0 A;  3VB9 A;  4AI3 A;  3POS A;  4CU9 A;  2GND A;  4DO0 A;  4B7K A;  5J3U A;  3K4D A;  4FQZ A;  4FFI A;  1AL2 3;  1VBB 3;  2ZAC A;  3POY A;  4OMC A;  4D6S A;  2XR4 A;  1C8N A;  1XC6 A;  2EAL A;  2GDF A;  3DEM A;  1OA4 A;  2W46 A;  4LJH A;  3VGI A;  1OUS A;  1J83 A;  2VW2 A;  1NOV A;  3B93 A;  4LTA A;  1JYW A;  1UO9 A;  4MOA A;  3AP6 A;  3MEP A;  1JBC A;  3QAC A;  3N35 A;  5FYC A;  5KBF A;  2P3I A;  2R07 1;  3HN3 A;  3V56 A;  1YHF A;  5C33 A;  4BLJ A;  2W92 A;  4XUQ A;  4I02 A;  3H3Z A;  1H6X A;  3ZR5 A;  1DHK B;  1MS3 A;  3THD A;  1DQ1 A;  1VAK A;  4DEV A;  3HQR A;  5F5Q A;  1NA1 C;  2UU8 A;  3AYA A;  4Y1V A;  1WUV A;  5LBF A;  1LHU A;  4CZS A;  1ZRC A;  1BXH A;  1JOD A;  1WLD A;  4GJY A;  3NV3 A;  2ZHL A;  2YBS A;  5FZD A;  1JXN A;  1V6O A;  2D40 A;  4LEJ A;  3K77 A;  1VBA 2;  2YU1 A;  4KWL A;  2VBB A;  1W0P A;  1Z7S 2;  2N7G A;  3MLK A;  4IND A;  4AVB A;  2VG9 A;  1JI6 A;  4LO7 A;  2W1U A;  1HKD A;  5FQ0 B;  1CAX A;  1HJF A;  4B4P A;  3RZJ A;  2JDU A;  2QQI A;  2C0Z A;  5ACA 3;  4R4X A;  1UY0 A;  4RS5 A;  1IS6 A;  4AWD A;  1WME A;  4TWT A;  1H0B A;  5K8S A;  1VAV A;  4PQQ A;  2PQQ A;  2VTX A;  2Q4S A;  3M1H A;  2JG9 B;  4OI1 A;  4MGQ A;  4AE2 A;  1DGR A; 
#chains in the Genus database with same CATH homology
 5JR2 A;  3MO4 A;  3OGS A;  3OGR A;  3BN6 A;  1OF3 A;  1ULO A;  4LPL A;  2EIE A;  2W94 A;  2VOT A;  1JZ5 A;  4JKM A;  2QQL A;  4AG4 A;  4HG6 B;  2WUH A;  4BK5 A;  1CZV A;  4DEQ A;  1UXZ A;  4P00 B;  2Z4F A;  3VD5 A;  4A41 A;  3T2P A;  2WAA A;  1US2 A;  2V4V A;  4JKL A;  3P6B A;  2WO3 A;  1NAE A;  4M4P A;  3VDB A;  3CQO A;  1JZ7 A;  1UMH A;  5J1X A;  2VZO A;  2Y6G A;  4CUC A;  4ZZ5 A;  2WZ8 A;  3T0A A;  3C7E A;  3I3D A;  1PX4 A;  3C7H A;  4XUO A;  1YQ2 A;  1XNA A;  2BER A;  3E1F 1;  2WN3 A;  4GWJ A;  1WKY A;  2LW8 A;  2XHN A;  1JYN A;  4DXS A;  2W95 A;  4DUX A;  3I2J A;  2W5F A;  5F7U A;  1UY3 A;  2RVA A;  2VJX A;  3A23 A;  3DYO A;  2E33 A;  3FL7 A;  2QQJ A;  3I97 A;  1D7P M;  4GZ9 A;  1O59 A;  2ID4 A;  4QB1 A;  1GQP A;  3IAP A;  1KGY A;  2E31 A;  2Y6J A;  4TXW A;  4CU6 A;  1K45 A;  2WQ8 A;  3MUY 1;  5IFT A;  1EUU A;  5HPO A;  3WNO A;  4A44 A;  1L7Q A;  1GOG A;  5G04 L;  2JD9 A;  4A42 A;  4OMD A;  3CZJ A;  1WCQ A;  4QAW A;  2VZR A;  3DYM A;  2J1U A;  3CKH A;  2VZ1 A;  3JXS A;  1K12 A;  2V5D A;  1CZS A;  3NQH A;  1CX1 A;  3A21 A;  4QX3 A;  1US3 A;  3SEE A;  3OEA A;  2DCK A;  4ARX A;  3C8X A;  5B4N A;  4ZZ8 A;  4QB6 A;  2VL4 A;  1H6Y A;  1PMJ X;  2BZD A;  4KWU A;  4CU7 A;  4MO3 M;  4PT6 A;  4W50 A;  3ETP A;  3LPF A;  3MV0 1;  2W1S A;  2VZT A;  1TVG A;  4QX1 A;  4A6O A;  2VQU A;  3T09 A;  3VDA A;  2VZU A;  3PUI A;  2C26 A;  1UY1 A;  3GGL A;  3I2I A;  5EJ1 B;  1JYV A;  4CUA A;  3OBA A;  2QQN A;  3K4Z A;  3OEB A;  3ABZ A;  2V72 A;  3DYP A;  2J1R A;  3WF4 A;  2J1S A;  4BJ0 A;  1JZ3 A;  3SKV A;  1JU3 A;  2QQK A;  3P1I A;  3ECQ A;  4W4Z A;  1UZ0 A;  2WZE A;  5C71 A;  3THC A;  4QB2 A;  2VZ3 A;  3SEP A;  2W9X A;  4XUP A;  2VZQ A;  2C9K A;  4GWI A;  4P5Y A;  1GNY A;  3I3B A;  5EIY B;  4MAD A;  3K4A A;  1JYX A;  3BGA A;  4MGQ A;  3LPG A;  3WF0 A;  2VMF A;  2JDA A;  3HNY M;  4RYD A;  2VQT A;  1NUK A;  1UYZ A;  3NRU A;  3T0B A;  1NKG A;  4P02 B;  1OT5 A;  2BGO A;  2ZEY A;  3OG2 A;  4E8C A;  2VCA A;  3AC0 A;  3EYP A;  4LQR A;  5DMY A;  3LEG A;  2VME A;  3A7Q A;  2EID A;  3ACH A;  3NJV A;  2VMD A;  4KI5 M;  4QPW A;  4D8M A;  1UY4 A;  3D3A A;  5JMO A;  4QDS A;  2WDB A;  3FHA A;  4XUN A;  1SDD B;  2ZEZ A;  2E26 A;  1L7R A;  1EUT A;  3OB8 A;  3III A;  2BBA A;  4CVU A;  3HOB A;  3I2K A;  1OD3 A;  3T2Q A;  5CYY A;  1CZT A;  1O8P A;  1JZ8 A;  3WF2 A;  2Y6L A;  3HPN A;  4JX0 A;  1P8J A;  4JKK A;  4OYU A;  2YB7 A;  4E8D A;  3K46 A;  4AAX A;  5B4X A;  4YPJ A;  1HN1 A;  1I5P A;  2ZEW A;  4XVH A;  2Y8K A;  1F4H A;  2J1A A;  1PX3 A;  3T08 A;  1GMM A;  3VD4 A;  4LHS A;  3EB7 A;  1IQD C;  2X05 A;  1GUI A;  2VC9 A;  2WN2 A;  3NJX A;  4BXS V;  1UMI A;  1MPX A;  1DYO A;  1ULP A;  3VD7 A;  1W9S A;  2WO1 A;  2J1E A;  5IYY A;  3WF3 A;  5A1A A;  3F2Z A;  2YFZ A;  1R64 A;  1JU4 A;  4W8J A;  4ET7 A;  5LA1 A;  2CDP A;  3WNL A;  3I2F A;  4LKS A;  4MGS A;  4BK4 A;  1K42 A;  3MUZ 1;  4Z2A A;  2VZV A;  2W1Q A;  5I0D A;  3I3E A;  2W47 A;  1BHG A;  1W8N A;  2W87 A;  3LEI A;  2OKX A;  2RJ2 A;  2XON A;  3K75 B;  2C4X A;  2JKX A;  3WSO A;  4FI9 A;  2VCB A;  4CU8 A;  1K3I A;  4QDR A;  4P08 A;  3W5M A;  2J1V A;  2WAO A;  3LEK A;  1JZ6 A;  3LE0 A;  4UI9 L;  4RN5 A;  1SG3 A;  2LS6 A;  1TG7 A;  3WNK A;  2HYX A;  2VCC A;  3UES A;  3UNP A;  4ARY A;  1W9W A;  3IB3 A;  4QDQ A;  3OGV A;  5C70 A;  2Y6K A;  5LCW L;  2VZS A;  4UAP A;  1UY2 A;  1DP0 A;  1JZ4 A;  3HEI A;  5JXI A;  5CZK A;  2R7E B;  4UOJ A;  2VM9 A;  5DQ0 A;  3C7G A;  2VR4 A;  2QQO A;  2VMC A;  5HXM A;  1GU3 A;  4ZXE A;  2JE8 A;  3FN9 A;  2XQX A;  3CIH A;  4A3Z A;  1JHJ A;  2W1W A;  2DDU A;  3WNM A;  1UYY A;  1W0N A;  1JZ2 A;  5JXH A;  4PF1 A;  2PQS A;  4JHZ A;  3WEZ A;  3PUH A;  2EIB A;  2YC4 A;  3UET A;  3CDZ B;  2BGP A;  2WBK A;  2QBX A;  3A22 A;  3IDA A;  4DXR A;  2VO5 A;  4KMQ A;  1CIY A;  2VTF A;  3MBW A;  2ZEX A;  5G05 L;  3DEC A;  2X10 A;  1UX7 A;  4CUB A;  2CDO A;  3J7H A;  4OZO A;  2B9V A;  1O8S A;  3FHQ A;  1DLC A;  2B4K A;  3WNP A;  2EIC A;  5IHR A;  3VD9 A;  3WNN A;  3U37 A;  3HJR A;  4DXT A;  4D0Q A;  5DPN A;  2W3J A;  3VDC A;  1RYY A;  3ACG A;  3VD3 A;  2HLE A;  1UXX X;  1LNS A;  5JUV A;  3GM8 A;  3CMG A;  5FUI A;  5IFP A;  4XUT A;  3T2O A;  2WO2 A;  3GXU A;  2X09 A;  5IJR A;  1UYX A;  2DCJ A;  4BDV B;  1PMH X;  1W8O A;  3ACI A;  5JXJ A;  4M4R A;  1XPW A;  4OUE A;  2VZP A;  3I2G A;  2YC2 A;  1GOH A;  1OH4 A;  3WQB A;  4A45 A;  1OF4 A;  4QX2 A;  1W99 A;  3ZM8 A;  5LA0 A;  2XOM A;  3C7O A;  3HNB M;  3LQC A;  2Y64 A;  3GDB A;  1NX9 A;  1F4A A;  2WYS A;  2W91 A;  2L9L A;  2WAB A;  5LA2 A;  4CU9 A;  2J1T A;  2QQM A;  3WF1 A;  3C7F A;  1GOF A;  3I2H A;  3K4D A;  3SKJ E;  4OMC A;  2YFU A;  1XC6 A;  2W46 A;  4XUR A;  1J83 A;  2J7M A;  1JYW A;  4MOA A;  3HN3 A;  1KEX A;  2W92 A;  4XUQ A;  5DN2 A;  4DUV A;  1H6X A;  3MV1 1;  1XNT A;  3ACF A;  2KD7 A;  2ZXQ A;  3THD A;  1J84 A;  1W9T A;  4DEV A;  4QX0 A;  4ZY9 A;  3W5N A;  2ORX A;  4L0P A;  2RV9 A;  3NNG A;  2Y6H A;  2YG0 A;  3K77 A;  2ORZ A;  1T2X A;  4A4A A;  1JI6 A;  1UWW A;  5EJZ B;  2W1U A;  1SHW B;  5C7G A;  4IUG A;  2E32 A;  2QQI A;  1UY0 A;  3CZU A;  4XZU G;  5JXG A;  3HNM A;  4PQQ A;  4TTG A;  2J22 A;  3T0D A;  3IAQ A;  4DUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...