1UY1A

Binding sub-site dissection of a family 6 carbohydrate-binding module by x-ray crystallography and isothermal titration calorimetry
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
132
structure length
132
Chain Sequence
b'SPIRRDAFSIIEAEEYNSTNSSTLQVIGTPNNGRGIGYIENGNTVTYSNIDFGSGATGFSATVATEVNTSIQIRSDSPTGTLLGTLYVSSTGSWNTYNTVSTNISKITGVHDIVLVFSGPVNVDNFIFSRSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE A
publication title Binding Sub-Site Dissection of a Carbohydrate-Binding Module Reveals the Contribution of Entropy to Oligosaccharide Recognition at "Non-Primary" Binding Subsites.
pubmed doi rcsb
source organism Clostridium stercorarium
molecule tags Carbohydrate-binding module
total genus 32
structure length 132
sequence length 132
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2004-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1uy1A00
2HLEA 4XUQA 2WABA 2VMFA 2WAOA 2XONA 4DUVA 3I2JA 4UOJA 3EB7A 1LNSA 1K45A 5A1AA 2CDOA 3I2GA 3THDA 1XPWA 2J1SA 2ZEWA 2QQJA 1UZ0A 1UYZA 2QQIA 4MADA 5EIYB 2YC2A 2RJ2A 3VD3A 3K46A 2J22A 4QB6A 2VM9A 1PMJX 2EIDA 4W50A 2VMEA 1R64A 4A41A 5IFPA 1EUTA 1GNYA 4DXTA 2Y8KA 3OG2A 1HN1A 2WN3A 4OMDA 4ET7A 2BERA 1NUKA 1UYXA 1W99A 1OF3A 3U37A 1UX7A 3K75B 2W95A 3FHQA 1ULPA 1DLCA 3FL7A 2VZ3A 5IFTA 1JZ8A 1RYYA 4QPWA 4ZZ8A 4LPLA 2Y6LA 2BGPA 3VDCA 1PMHX 2PQSA 3I3BA 4UI9L 5FUIA 2WZEA 4JKMA 2E26A 3LE0A 3A7QA 2W9XA 3NQHA 3C7FA 2ORZA 1PX4A 2Y6KA 1O8PA 1KEXA 5J1XA 3C7HA 4QAWA 1XNTA 4RYDA 2J7MA 4P5YA 4QX1A 4QB1A 2VOTA 3C7EA 2VC9A 2ZEXA 3LEKA 3K4DA 3F2ZA 3DYPA 4TXWA 4BDVB 4BK4A 4DUXA 2RV9A 1TG7A 2Y6GA 4QX0A 3T08A 2WO1A 1CX1A 1JZ7A 1JI6A 4XUNA 3VD5A 4JKKA 3VDBA 3FHAA 5LCWL 5CZKA 3WF4A 2QQOA 4LQRA 1JYNA 3OGRA 1JYWA 3MV01 3WNLA 4GWIA 3A22A 3PUHA 3NJXA 3WF1A 3WSOA 4W8JA 3E1F1 4D0QA 5C7GA 2Y6HA 2W92A 4A44A 4CU9A 2VCAA 4PF1A 4P08A 4CUAA 1T2XA 1WKYA 3OEBA 1GOHA 4XUPA 2W3JA 1SG3A 1J83A 2YB7A 3BN6A 2W47A 3T0AA 3LEIA 4OMCA 2W1UA 2ZEYA 4A6OA 5JXHA 2V4VA 4IUGA 1CIYA 3DYOA 1YQ2A 1K42A 3WF3A 1CZVA 4ARXA 4Z2AA 4CUCA 2WYSA 2YG0A 4CU7A 1UYYA 5DQ0A 3T0BA 2X05A 4E8CA 4M4RA 5B4XA 2VL4A 2WN2A 1JU4A 3GM8A 1UY4A 2DDUA 3GXUA 4QDSA 4JHZA 1UXXX 1W8NA 3SKVA 4YPJA 2VCCA 2J1AA 3I3EA 2YFZA 5JXGA 1NAEA 4A45A 5DMYA 2WO2A 4DXSA 1WCQA 1F4AA 2W1QA 3FN9A 3CIHA 5EJ1B 1OF4A 4A42A 1UMIA 3GDBA 2LS6A 4W4ZA 2E32A 3ACHA 3MO4A 2VZSA 3HPNA 3HEIA 3IAPA 2QQMA 3OGSA 1DYOA 5C71A 3C7OA 3PUIA 2WBKA 3CQOA 1JYVA 2W91A 4CU6A 2Z4FA 3P6BA 2VZTA 5IJRA 5HXMA 1UXZA 3SEEA 2J1VA 2E31A 4HG6B 2W87A 1OT5A 4LKSA 2JDAA 1W9TA 3LPFA 3VD9A 1L7QA 2V72A 1O59A 2VZVA 5IHRA 2ORXA 2QBXA 2QQLA 3VDAA 3C7GA 4CU8A 4XUOA 2W1WA 5LA0A 2VZUA 3P1IA 1JHJA 3OEAA 1KGYA 3OB8A 4MGQA 2VQTA 3HNMA 1D7PM 2R7EB 3LEGA 2OKXA 3THCA 3T2PA 3MBWA 1GUIA 1K12A 4KI5M 4A4AA 4RN5A 1US3A 2ZEZA 1I5PA 5LA1A 2CDPA 2ID4A 3JXSA 3CZUA 1W9WA 4OUEA 5B4NA 1OH4A 2JE8A 3GGLA 1GOFA 3CMGA 3NRUA 3VD4A 3NNGA 2LW8A 4OZOA 1GU3A 3C8XA 1SHWB 3LPGA 3D3AA 1PX3A 4QX3A 5EJZB 1H6XA 3CKHA 2BZDA 2QQKA 4PQQA 2WQ8A 1EUUA 1P8JA 2VZOA 2WUHA 3UESA 1J84A 2J1RA 3DECA 5JXIA 3I2IA 1W9SA 3I97A 3I2KA 2VQUA 2C9KA 2VCBA 5LA2A 3T2OA 2RVAA 2XOMA 1SDDB 1MPXA 2E33A 1UMHA 4QB2A 3W5NA 4BK5A 2J1EA 4XVHA 2VR4A 4P00B 1CZTA 3AC0A 3K4AA 3T09A 5C70A 3IB3A 3A21A 5JMOA 3K77A 4E8DA 4XURA 1GQPA 5G05L 4AG4A 1JZ2A 2VMCA 3A23A 3IAQA 3NJVA 2KD7A 1TVGA 4FI9A 3OGVA 4XUTA 2W46A 3WNOA 3SEPA 1K3IA 1UWWA 3HN3A 1UY3A 4DEVA 2WAAA 2XHNA 1UY2A 3I2FA 1O8SA 4GZ9A 2BGOA 4KMQA 3UETA 4MOAA 1US2A 5G04L 3T2QA 1BHGA 2QQNA 3WF0A 3ETPA 1NX9A 3HNYM 3I2HA 2EICA 1JZ3A 4PT6A 4JKLA 2YFUA 3I3DA 3MV11 4BXSV 1W8OA 3ECQA 4L0PA 1ULOA 3SKJE 2W94A 4BJ0A 3IDAA 4QX2A 3HNBM 3MUZ1 3WQBA 2B4KA 2VZ1A 4CUBA 2VZQA 5I0DA 3OBAA 1L7RA 1NKGA 4MGSA 5HPOA 3CZJA 5JR2A 3W5MA 2Y6JA 2JKXA 1JU3A 1UY1A 2WDBA 4A3ZA 4DUWA 4GWJA 3WNKA 5IYYA 4UAPA 4XZUG 1UY0A 4ZY9A 1GMMA 1JZ4A 2XQXA 2ZXQA 5DN2A 2DCKA 4QDQA 3HJRA 2JD9A 2WZ8A 2X09A 4P02B 3K4ZA 4KWUA 4JX0A 1IQDC 2X10A 3WEZA 4M4PA 5F7UA 2HYXA 3WF2A 2VMDA 2J1TA 1JZ6A 1DP0A 2YC4A 2EIBA 3IIIA 3J7HA 3BGAA 1F4HA 3UNPA 1OD3A 2L9LA 3ACFA 3ACIA 2VTFA 1XNAA 3WNNA 4ZZ5A 5JXJA 3VD7A 2DCJA 3WNMA 2Y64A 4D8MA 2VZRA 3MUY1 4MO3M 3HOBA 2EIEA 3ACGA 3ZM8A 4DEQA 1H6YA 2BBAA 3CDZB 3DYMA 4AAXA 5DPNA 3T0DA 4OYUA 4TTGA 2V5DA 1JYXA 2B9VA 4LHSA 4DXRA 3LQCA 3EYPA 2VO5A 4CVUA 2VZPA 4ARYA 1CZSA 2J1UA 2VJXA 3WNPA 2C4XA 2C26A 4QDRA 2WO3A 3ABZA 1W0NA 1GOGA 5CYYA 5JUVA 2W5FA 1XC6A 4ZXEA 1JZ5A 2W1SA
chains in the Genus database with same CATH superfamily
2WZR3 3O1MA 1EPZA 2HLEA 3H1MA 4CDXC 1Y43B 4JRAA 3RFRA 4XC9A 1JYIA 3MIGA 3GHNA 4NWWA 5F39A 3I2JA 1AR92 1HIXA 4UOJA 2SBAA 1OPMA 3IMMA 4F3JA 4NAOA 4FPCA 2CDOA 4CXXA 4DPNA 1Q56A 2RS31 1PZ9A 2V5YA 3WG4A 5A1AA 5FPXA 1BVP1 5J96B 1LKNA 3MFAA 3ES4A 2AH2A 4XHBA 5FLIA 1IKQA 1W2NA 5SV8A 2XG3A 5D1IA 3M7AA 2PHRA 3JU9A 4QB6A 4QQ2A 4R8HA 1LHWA 1Z7S3 4XOGA 1AR83 2OZJA 3E6DA 5DUWA 4B1MA 3TEWA 4RR3C 3GJAA 4X6QB 4WVMA 5CG9A 2JICA 2P6HA 2CHHA 1BBT1 4EZ4A 1W9FA 4MGYE 1QH6A 3L9JT 5KHHA 2C9AA 1ZZ9A 2Y8KA 4RFRB 3WUDA 2AEZA 2CY6A 2IXIA 2MEV3 1WWYA 5FTTC 1ZNPA 4OMDA 4ET7A 2BGCA 3B93A 5DAPA 4IQPA 1C8NA 1IG0A 3USUA 5EWSA 1ZBE3 5F1RA 1C5HA 1IS4A 4BWOA 3ZPOA 1I3HA 5I91A 1G9FA 4MH0E 1FX5A 2VZ3A 3WVJA 3ZFGC 1HQWA 4AI8A 1NY72 4LULA 4QGNA 1XYPA 5EXOA 1W04A 1TME2 1TEIA 4CDQA 2VMGA 1PMHX 2D44A 5F5QA 2PQSA 4FXGB 3DPRC 1W2TA 2E26A 5DG1A 1C3HA 3LE0A 5J98B 4IEQA 1D4M2 3NQHA 1PVC3 1RUD3 2R073 2Y6KA 4LORA 4M3CB 1S0EA 1O8PA 1KEXA 4C90A 1W6MB 4YW6A 3IDEA 1GZCA 4FFIA 1OURA 1SLCA 5AFEA 4M01A 4P5YA 4XABA 3ZDSA 3FUQA 5JCTA 4QX1A 3UK9A 4B4PA 3WQ7A 3FLRA 3KGZA 2XL7A 4I01A 2EVXA 4P9LA 2EA7A 4BK4A 5A6YA 5KXDA 1TG7A 4LKDA 1NQJA 4PBPA 1V9U1 5DDJ1 5I0RA 3VD5A 3ZOIA 2ZGQA 1VMHA 3KM5A 4JKKA 5EJ3A 4CTEA 2WQ4A 3VDBA 4YZ3A 4O9GA 1Y4WA 4OHWA 2EXHA 1SLAA 1FATA 2XLAA 5A6ZA 2VUDA 3SH5A 3K48A 5L9VA 4LQRA 2F17A 3BPSA 4QX0A 1AR93 4ES8A 3H9AA 2EAAA 5LY1A 4XBLA 4CUGA 2PELA 3VBUA 3A22A 3PUHA 4NAMA 1PMIA 2Q1FA 3PNAA 2Q30A 3M3OA 3WSOA 1NQDA 3BKZA 4OI1A 2A3WA 3VL8A 4IV3A 4KU7A 4ES9A 1GWKA 5A7WB 4CDUA 1V70A 3AVSA 5T55A 4EQVA 5FO9B 4D0QA 4XFCA 5A3LA 3M1HA 1QOTA 1SFYA 3RGBA 1ND2A 2VCAA 3ILRA 4O65A 5FUNA 2YBKA 3BCWA 3Q8EA 4L8QA 3Q8BA 5CFCB 1MQTC 1V6MA 3OEBA 4JQTA 3LCPA 4OCTA 1YHFA 2P3IA 1VBD1 4AAPA 5K4LA 2W3JA 2AR6A 1J83A 1GFF2 4HLTA 4N9IA 4JTNA 2W47A 3ZXEA 3LEIA 3V64A 3U4SA 3G7DA 2XWBB 3FFZA 1G9AA 3WDVA 1HX6A 4NVPA 1Q8OA 1QXRA 3E6BA 1QEXA 3DYOA 2HWB2 2D6NA 4Z8BA 5IATA 5KWRA 3WXPA 2ZMKA 5LZ6A 1CAUB 5T5OA 1K42A 4K20A 3WF3A 4ARXA 1BXHA 4Q4W2 4OUSA 1RB8G 2IXJA 5JOYA 2D3PA 1LENA 1WLWA 2WWUA 2WYSA 5E16A 4YZ4A 2YBSA 1RUI2 4Y5SA 5K8SA 4CP0A 2BNOA 2VCMA 2VOVA 3O1UA 4XTMA 4Q8LA 1BBT2 2A3YA 2PHTA 1H9WA 2UYAA 4M4RA 4YM0A 5IVBA 2WN2A 1SLIA 3VKFC 1RVF2 3O0XA 4LIUA 1UY4A 1YIPA 3GXUA 1EAH2 3LDBA 2B46X 5D21A 1MS5A 3LD8A 2ZGNA 4BQ4A 2JDYA 3POWA 4XDOA 4OQ8A 1QJY3 4RQPB 3VBRA 4JRLA 5C9AB 2P6CA 3LWCA 4WM8A 2X5IA 1VB2A 2W1QA 3ROUA 1NYWA 4KWLA 5EJ1B 3K2OA 3RI8A 3H1YA 3WG2A 1OF4A 2FZ1A 4YW7A 3B3QE 4NUBA 2K2SA 3EMRA 3IDCB 3S7IA 3VBSA 5GZEA 5CFCC 1F8VA 1ZZCA 3FBYA 2JJ6A 3AP4A 2E32A 1QIQA 2UY9A 3VL9A 2VZSA 5DZGA 3HPNA 4AZZA 3ZXFA 4KGGA 2PXJA 4IERA 1IGOA 1WA6X 4LBQB 3O1VA 2QQMA 1DYOA 5C71A 4YM2A 3N7JA 4Y33A 2Q8OA 3PUIA 4AHZA 3CQOA 3ZYJB 3UJOA 4LITA 1IPSA 5DZEA 1YEWA 5E88A 3LDKA 2BFUS 2VQ0A 4I0WB 5A3PA 5H9SA 2J1VA 4OI4A 3N9PA 3ZPYA 1W6QB 1FV2A 2W87A 4PJYA 4ASKA 4XFFA 3BALA 4CCDA 1KFXL 2PN5A 1SQ4A 1I9RA 2D93A 2VZVA 5FZOB 2QBXA 3AYEA 4XACA 5FP8A 3U75A 3V65A 4LNVA 1JTZX 1OBNA 3ALQA 2VUCA 3TB0A 4CU8A 1DU3D 2E6VA 4MHRA 1XNKA 2ZZJA 2D97A 2RS33 3N9MA 4YFZA 4EJRA 4XFBA 4O9EA 2ET7A 4RQPC 5LBCA 5C9AC 3URFA 3OPZA 2HWB3 2JWPA 3CJIB 3RZZA 4FOWA 2ZX1A 3HNMA 5ABJB 2WKKA 1ZBA2 4FO9A 1APNA 3KCYA 4YVSB 4K8RB 1S0FA 2ARAA 3Q8CA 2J42A 1IS3A 3UKTA 3D5OA 4FCAA 4ZS3A 3FJSA 4QM8A 3PHMA 1FMD1 1BBT3 2ZEZA 5K0UB 2VPVA 3TNPB 1RXGA 1RVF3 2B7YA 2DCZA 1W9WA 3LFIA 1EAH3 3V0BB 2G1MA 5JPNB 2XHKA 3VBHA 5FP9A 1OH4A 5GALA 2JE8A 1X36A 1YI9A 1AF9A 4IETA 2QDRA 1ZZ7A 1VBB2 3VBHB 3CHXA 4ZU7A 5IT6A 3ZR5A 1RJ8A 3RSJA 1UX6A 1RUG1 3IPVB 3AX4A 2ADDA 2ZGOA 3UGFA 4AR2A 5C4WB 2HBTA 2WQZC 3N9LA 4GWNA 4OZOA 5FQ0B 2VD7A 4W6WA 3O5SA 1IPKA 1SHWB 2XL9A 3KV5A 1MEC2 3VBUB 4Z07A 2A6VA 3IM0A 4NJ4A 3WDXA 1FPN2 2OPWA 2VBBA 1VJ2A 4FPFA 4YW4A 2BUKA 3PUAA 3EJKA 1MR5A 1P8JA 5AC92 2VZOA 3CLPA 3GYDA 3MHZA 1EV12 3R4UA 2ZZQA 4IEPA 5C8CB 2XR4A 5DZFA 2D43A 1F35A 5AFBA 4P9WA 3CJIC 3DECA 3KS7A 5JXIA 5ABJC 2F6BA 2KA3A 3OBZA 5JIAA 4CSWA 1PGL1 4XJ8A 2PFWA 4YVSC 5H9PA 1N1TA 4NHYA 4DQAA 3I2IA 3MPBA 3I2KA 1MS8A 2RE9A 5LA2A 5JZGA 3EHKA 2RVAA 4NHMA 3INAA 4HN1A 4RHV2 2YHJA 5KXCA 3N9OA 1MPXA 2Z69A 1DHKB 1QJZA 1XSRA 2ZABA 1LTEA 4WM7A 4BK5A 2J1EA 2VOWA 4RSUA 5K0UC 1CAWA 1GBGA 1JOJA 4L97A 5CISA 2IXLA 1C4RA 2K0GA 3GCWA 2RJLA 4M0NA 4MGKE 1OI6A 1QU0A 2P17A 1ZM1A 2RDRA 2Z79A 3VLBB 4HT1T 5AVAA 4LO4B 4AHYA 1RC6A 3R4SA 1XE0A 3T09A 3OUJA 4AQSA 4QX5A 4FPKA 4HSJA 3WP5A 1LJ7A 1K5MB 1GQPA 3MIDA 3O1TA 5C4WC 4QKBA 3ZXJA 2DVBA 3RMXA 3LIHA 3NJVA 4GQ7A 4YWAA 1TVGA 1NE4A 2A1XA 2C1FA 2VXRA 1BEV2 2QE3A 2W46A 5J3UA 1ASJ1 5JDBA 1G9BA 1WCKA 3AP9A 3BYWA 1T6GC 3DL3A 4O7XA 4PI0A 3RWNA 3SNMA 3SEPA 3WNOA 4Y1ZA 5FBJA 2HWD1 1VBD3 1Z78A 5EHDA 4E4ZA 1EY2A 1HXS1 4X8PA 5C3RA 2BGOA 2YMZA 4ZU5A 2RM21 4MOAA 1GNZA 2ZGUA 5G04L 3T2QA 4AI1A 3WF0A 2WSVA 1AX0A 1RUF1 3POIA 1AYM2 5BNOB 4H7LA 3ZSJA 3KWVA 4XQ4A 4PT6A 4MXWA 5DAQA 2RS11 4IGOA 1VBB3 4NPMA 2UWAA 4AEDB 3J8F2 4PIZA 4YSFA 5BXXA 2JKBA 3H0OA 3RZLA 3ECQA 3A4UA 1QY4A 2VGDA 3SKJE 5CFDB 4QX2A 1HRV1 2GNDA 4LO7A 4CEYC 2RR11 2B4KA 2VZ1A 1F9KA 1UPIA 2YBPA 3PVNA 5FK7A 3POBA 4MYEA 1GZ9A 2FCTA 1QJFA 1SZBA 1YQ6A 3H42B 5FZGA 5JPMB 3KQRA 4ZHNA 3O1SA 1FPN3 1SPPA 4U36A 5FZLA 1X82A 1TMF2 4RR3A 1PK6A 4DY3A 3VN4A 3AXEA 3AMPA 5AC93 2ET1A 2BVVA 5JSRA 4ONUA 5IYYA 3JCIA 3GBWA 3OJBA 1O3SA 3UL2A 1K5MC 2LRPA 4H55A 4GXLA 3BTZA 1NLSA 3NV1A 4OFGA 5IAVA 1GMMA 1OLQA 3B7MA 3WDTA 5JMCA 1YXWA 3OD0A 5JR7B 2ZACA 3CL1A 1DFQA 3MEPA 2DCKA 3SH4A 1UIJA 3MIBA 2X09A 2OXBA 3I59A 1CAVB 1JYCA 4LKEA 1R091 5JI7A 4JX0A 3WEZA 2CU5A 3FHIB 4HKLA 1V6OA 2I07B 5EQUA 3DPRA 1KITA 5BNOC 2QTWB 3ZSMA 2Y6FA 3KCCA 4D94A 4BM8A 2WFF1 2VNVA 1RMU2 3MFCA 1PZ7A 4LOSA 5I0TA 1J58A 4B7EA 5FK8A 4BYYA 2RDSA 1IZ3A 1DP0A 2YC4A 2EIBA 4AEDC 4XF1A 3S30A 1L3JA 2JDMA 2WA4A 3R05A 5FOBB 1F5FA 1Q3EA 2H6CA 4WV8A 3WCRA 1BEV3 1AL22 1XNBA 2D40A 4N53B 5H9RA 3APBA 4QHOA 2DCJA 3RDIA 2VZRA 4QQLA 4NOTA 1ODMA 5LK7B 3RRDA 4EN0A 2WYFA 2XH6A 4MO3M 1AYN2 2ES3A 2W68A 1BK0A 3PVOA 5A33A 1JODA 1HRI2 1OC1A 2QZ2A 3JQXA 3ZM8A 1H6YA 4AFAA 3T4VA 2BBAA 1ZZ6A 4IE6A 2CAVA 4TTGA 2JDUA 2JG8C 3VHPA 3D4KA 4LHSA 4V1PA 2E7QA 3O1PA 2VO5A 3ZYGA 3RZJA 3AZXA 3TNQA 2WSUA 2Y34A 2MNGA 3VDDB 5A3TA 4YGBA 3CEWA 2IXKA 3GZTB 4XILA 4AGRA 2C26A 2ZGRA 3A0NA 4A7YA 5JVVA 1R082 1VBA1 2BTVC 5JUVA 3F95A 4IV1B 3RYKA 5GKAC 3SCFA 4NHLA 4HONA 5BNPA 1FMD3 1V6LA 4BQWA 4AFDA 1LHVA 4HPKA 1YI7A 1RHI1 2GMEA 2WNVB 4PF5A 1OD5A 1MQTA 1WD4A 4OHVA 4XJWA 2Q4SA 2ZHKA 1RUOA 1OKQA 1MS3A 3DEMA 5IVVA 4RL7A 2ZGTA 2GC1A 3EB7A 4R52A 1LNSA 4EN8B 2E63A 4FP2A 4HFSA 2BFUL 4IW3A 1DGLA 1RUG3 1W8FA 3OGJA 1XPWA 5F3CA 3NAPB 1ULDA 2QQJA 5JOXA 3E6CC 4AK3A 4MADA 1OXCA 3MDPA 4PCRA 4N53C 4P14A 4XTPA 2F4PA 3Q8FA 3MLJA 4ZS2A 3SC7X 1PM4A 2ZJCA 1AJOA 1W2AX 4XIKA 5LBEA 2B39A 1VRH2 2C6SA 4YW3A 3GZAA 2D3SA 2OZ6A 2JDNA 3OYWB 4A41A 2WJSA 4DOUA 4S2FA 3B5LB 3D6EA 3OG2A 1GSLA 3HN1A 5LA9A 1UN1A 1V6JA 1BJQA 2NZ9A 2BERA 3MW3A 2UY8A 4H3WA 4UWDA 3VDDC 5LW9A 3PIJA 1ZRIA 3VZJA 4LJHA 5C8WA 2W39A 3IBMA 3K75B 2RS51 1KQRA 4D6RA 1XNCA 5A7WA 5ISLA 2E7AA 1DLCA 2IXCA 4IV1C 1JZ8A 4CEWA 1OMIA 3LSEA 2WZR2 3MIFA 1OSGA 1QOOA 4LPLA 2Y6LA 2WNVC 1UMZA 3W9AA 1WBFA 1R1A2 3UGHA 3ZMNA 5FUIA 1OLRA 4XETA 1SLBA 2WZEA 4CP2A 1GWLA 3ZFFC 2VH9A 1LGCA 3OD4A 1SCSA 2FZ2A 2ARXA 3KB5A 2P3JA 3AYDA 4RS5B 5FCCA 1IS6A 1S2BA 3RS6A 3ZSLA 4BH9A 1POV1 1YYNA 4D69A 1F15A 3WW3A 2WT0A 1YQ8A 1VR3A 1W2OA 3FFQA 3KSCA 1XXNA 5A32B 3LEMA 4YW5A 4QB1A 1ASJ3 2VOTA 2YYOA 2DCYA 3LEKA 4L11A 2JD4A 5CU1A 3TN91 4UFKA 2Y6GA 3OTFA 2HWD3 2WO1A 3GALA 1S1AA 3JBG2 3M3EA 4NHXA 2WT1A 1LOEA 4RGGA 4IL7A 1JI6A 1JZ7A 1A6CA 1HXS3 1VBC1 4YM1A 2GZWA 1BYHA 4AFCA 4XF0A 1HW5A 1QJX2 4X8NA 5LRRA 4Q0SA 3FHAA 1ZYBA 5CZKA 3GZEA 3IT8A 3WF4A 4JTOA 5FYYA 1TE1B 4IE4A 2RS13 1W28A 1UAIA 1FT9A 2WC2A 2WT2A 5IAXA 3MV01 5FZ8A 1JYWA 4OLLA 5T5LA 5FWEA 5FYHA 3VGIA 1DQ0A 3SHRA 2A73B 1AL0G 2AENA 1EP0A 4RQPA 3THTA 5C9AA 5CBLA 1GP6A 2CGOA 4QM9A 1NT0A 4EV0A 1HRV3 2BOJA 4CRQA 2CWSA 2BU9A 3R4DB 1JOPA 1ENRA 2BWAA 1ENSA 2W92A 1LGNA 1YCIA 1AHSA 1AR71 4L2NA 4M3CF 5FY0A 1VRH3 4DRRA 1CJDA 3ATGA 3KGLA 4LO8A 4MLOA 1ZX5A 4XAEA 1LESA 1WKYA 1XYNA 1LCLA 3NKTA 3USSA 3QH6A 4RS5C 1Q8SA 4XUPA 5C3PA 4KBZA 2GMMA 2OVUA 3R6SA 4MGZE 3WDWA 3SH3A 4E4HA 5FKBA 1H1MA 1FXZA 3KT4A 3OGGA 2AUYA 1RUJ2 4IEUA 2E53A 1CIYA 1W6PB 1WCDJ 1S4CA 2R042 4I30A 1UU6A 1HQNA 1CZVA 4NROA 4HKOA 1AZDA 1W8UA 4Z2AA 5J09A 1E5HA 5JAXA 2WWJA 1B35B 1R093 1BZWA 1QWRA 4ZU4A 3MIEA 1R1A3 3AL5A 4LBQD 1PO12 5FXWA 3TEXA 4AL9A 5BV6A 5L36A 1C57A 3T0BA 1AX1A 1KRIA 3PIGA 4E8CA 4Y26A 1Y9QA 5B4XA 2VL4A 4YZ2A 1ZRDA 3KVAA 2C0ZA 2DDUA 3AP5A 4KU8A 1SMVA 4XDQA 1HLCA 2QFEA 3ZXKA 1LU1A 1S0CA 1UXXX 1WCUA 5GLVA 2RDQA 3M2MA 2PAKA 1KDKA 5IWFA 3I3EA 2HEVF 3BU7A 3GF6A 3D8CA 4DXSA 4GMP1 5FYIA 3VZNA 1UZWA 3CIHA 2BNMA 3M3IA 3T3YA 4EN7B 3HAGA 1AX2A 3JBG3 3CU7A 4YRDA 2EF6A 2NPIA 4XHXA 3FC0A 2VNRA 3DF0A 4JC1A 1GQGA 1QXJA 1XU2A 2Y38A 4A42A 1QJX3 1HB3A 1NOVA 2NN8A 2JG9B 3ACHA 3MO4A 5M0TA 1RUC2 1OUSA 4FTSA 4MSVA 4V2VA 4AHWA 2FMDA 4S2DA 1BVVA 1NA1B 3T1LA 4DMIA 2GNBA 5JI9A 5IW0A 5FKCA 4XXAA 5FPAA 4CU6A 2EALA 5GLTA 2A6XA 3IPVA 4IESA 4LBLA 5BNNB 5IJRA 3VBOB 3CO2A 5HXMA 4YNIA 1JN2P 1B35C 4FXKB 4HG6B 1J59A 4R4ZA 4W6XA 4LKSA 1UOJA 3QD6A 1JW6A 1YC61 2ZGPA 1ODNA 1L7QA 1W2UA 4JGYA 4RGKA 5F6LB 3I3MA 3BU0A 1RJ7A 5IHRA 1SFPA 1ULCA 2H0BA 2QQLA 4YGEA 1WZXA 1OH3A 5D8AA 3VDAA 4LHNA 2F4LA 2W2IA 4XUOA 2BQPA 5LEKA 2W1WA 2YV8A 1GZWB 1BCXA 3TOJA 1S2EA 1QJY2 2BBVA 4KG8A 4S2HA 4D7TA 2WA3A 1RUJ3 3IDBB 3OEAA 4QMAA 3ZN6B 2GNMA 1C8M2 3BIWE 4MGQA 4UFIA 3MF6A 2R043 3TRSB 3IKWA 1REFA 1WW7A 4I0BA 3HBKA 3VKMA 3AFGA 1W6NB 5BYNA 5JOZA 1VMFA 4AI0A 1AR72 2HWC1 2VW0A 3QLQA 4KI5M 4CEYA 4Y20B 2EXJA 4A4AA 1CIWA 1PO13 4DZGA 2CWMA 2RMU1 1OFNA 1PM7A 5ERLA 1HV1A 4QKDA 4COUA 2BYVE 1US3A 4I0AA 4IE5A 1I5PA 1O3RA 2OX0A 2YDEA 5E8AA 4AI9A 1W8TA 2A6ZA 2ZAAA 4J1XA 5IVFA 4XFAA 2ID4A 1UOGA 4PDWB 3M70A 1XSQA 1NA1C 1W3XA 3AVRA 2R0FA 4JV4A 1LAJA 1UKRA 5FREA 5B4NA 2GN7A 4XFGA 4ASLA 4MVTA 2HWF1 4URTA 4K40A 3K3OA 4QXCA 4UW6A 2Q1ZB 3GGLA 1GOFA 4TN7A 1V6KA 3ON7A 1CR7A 1K5MA 4CPBD 1NXMA 3NRUA 2JX9A 1N1SA 5HCFA 4Q4X2 3ZYIB 3S0MA 3VD4A 5IVYA 2WR9A 4C0BA 5ANNA 1KXGA 2W0XA 2DURA 1SBDA 1RUNA 2ARCA 4XQDA 2FMYA 1LOAA 3C8XA 4MX3A 1G6NA 3BOWA 3LPGA 3D3AA 4KQ7A 1CONA 1CAXB 1KS5A 2RS32 1POV3 1RUC3 1H6XA 4ZKTB 3CKHA 4N43B 2BZDA 3MYXA 3WHUA 1J3PA 4INDA 2WQ8A 1EUUA 1MVQA 1JXNA 4XF3A 4AFMA 1I5ZA 5JOWA 5KC6A 4PI2A 1FI2A 1J84A 2JDKA 4FT8A 3UESA 5C3QA 4F7ZA 3FMGA 1SFNA 3DXTA 3NSTA 4Q0VA 4Q4V1 3N9NA 4YG3A 3B02A 3I3QA 4CP9A 4ORFA 4TYSA 2UURA 3HT1A 3K3NA 3MF9A 3TN93 5FOJB 3I97A 4TZDA 3N4MA 1GNHA 1LECA 3NV2A 1VBC3 3OY8B 5FZ3A 1JH5A 4YGCA 5FYSA 1TNFA 3GBGA 4KH9A 2WNUB 2XOMA 5FZMA 5HCBA 4AVSA 1WUVA 1JOBA 3M4FA 3UJQA 4Y22B 2AC1A 4QGLA 3W5NA 1YFUA 1MACA 1D0GA 2X53S 3NJYA 4AVTA 4BU2A 5BNQA 5KHJA 5C6CA 4XJAA 1GLHA 4PDWC 2Q8DA 3I49A 4XFHA 3T2TA 1OOPA 2JG8A 4FFHA 3AMMA 1NCRB 1X33A 3ZFEB 3IB3A 5T50A 4MG2A 1C8M3 2D3RA 1LOCA 2NQYA 2RDNA 4NPRA 4QHZA 4PBOA 3N36A 2FBEA 1J1LA 2TNFA 5J36A 1JZ2A 2OYZA 2WLPA 4HSLA 2KD7A 3ASIA 5F2WA 1VAVA 3OGVA 1AR73 1N3QA 1FNZA 4JZRA 5A7QA 4P9GA 1UWWA 2RHPA 3SMHA 4DEVA 4NRQA 4CP1A 2BV4A 1PIV1 1TNRA 1UY2A 4GH4B 4QT6A 3HVDA 3N7KA 4GZ9A 4AGGA 4N43C 2GNTA 4N9HA 1D2SA 3UETA 1LHUA 2N7GA 3P3NA 5IK8A 1CJPA 3ZSKA 1GYKA 4QXHA 5I0SA 3ETPA 1NX9A 2XBO1 3HMYA 2C24A 1UF2C 4BQXA 3DN7A 1JZ3A 5HXVA 1RINA 2A6WA 3LOBA 2OUHA 1V9U2 5DDJ2 1O6UA 1OLMA 1POV0 4Q4X3 3VZOA 4L9BA 5TSWA 2R061 3B9CA 4XJZA 4BXSV 1O3TA 4XMIA 1W8OA 4COZA 3AJZA 1AXZA 4OZXA 4LK6A 4BJ0A 1PVXA 2WNUC 2WZPP 3BTXA 3U10A 1OVSA 5GLWA 3WR0A 1U0AA 2ZAHA 2G4IA 4Y1VA 4DB5A 1POQA 4K1YA 1JMUB 5T3NA 3HQUA 3OBAA 4WVVA 2D6OX 2HH9A 1L7RA 4YYOA 3GCXA 2EXIA 4OI2A 2XJQA 1QH7A 3CZJA 5JR2A 2Y6JA 2JKXA 3W5MA 2WDBA 1NCRC 3RJRA 1U5XA 1BLZA 4NPLA 5GJ6A 4CDWB 2GSYA 1Z0HA 4UAPA 4BQYA 4L99A 1F2NA 1VIWB 3H7JA 4GMP3 4AQTA 2D6LX 4E9KA 3KLSA 2JIJA 3NMBA 4DIQA 3O12A 2A5ZA 2YC0A 2ZKNA 5IK5A 2XQXA 2EXKA 5LWBA 1VBD2 1VPHA 3I54A 2X8KA 4Y3OA 4J1WA 4EROA 3JD71 2IFRA 2Q8EA 4KWUA 2BRTA 5FYTA 4CXWA 5ACA1 4M4PA 1JS9A 1AVBA 3RZKA 2XVGA 1HB4A 3J26N 4YFWA 3WZ1A 3ZFFA 5IVCA 1I1EA 2R49A 3WF2A 2V73A 5C3SA 3I2OA 4BLIA 1HB1A 4BZ4A 4KG0A 4Q4V2 4UXAA 4AEKA 4IEWA 3WP6A 2YUEA 3KCXA 4WVMB 1A34A 2ZGLA 3BODA 1LOFC 4NWVA 1OQDA 3J7HA 1F4HA 1H2MA 3VHRA 2ZHLA 4M00A 2PMWB 2VE1A 4BE3A 4B7KA 4EZHA 2ZX0A 3VKNA 1RGSA 4Y4YA 1YIFA 2L9LA 1S0BA 2HEWF 3ACFA 2VTFA 3ACIA 3PUQA 4ZZ5A 5E1RA 5A3MA 3LFMA 2VQAA 3PUSA 4NIHA 3AXDA 4YVWA 2Y64A 3B9IA 4IEYA 5FZIA 3WNMA 1D0HA 5CVRA 4PIYA 3WT3A 4TLGA 5FXVA 3PMEA 3HOBA 4UW3A 4GB31 3ACGA 4DEQA 1H30A 3W21A 2X29A 3POJA 3LOIA 3ZXGA 4DO0A 1W0OA 2VNGA 4CDWC 4XMAA 4CDQB 2FDFA 3HIFA 3HD8B 1MZFA 4CVUA 1V9U3 5DDJ3 1IS5A 1LHNA 2VZPA 1CZSA 1QQP1 2GH8A 2YU2A 2VJXA 5HCHA 1MS1A 2HWC3 2WO3A 1DDLA 3ABZA 5FYCA 2VTXA 4AI2A 2HWE1 5KBFA 4K9SA 1RXFA 4GMP0 4QQHA 4FOQA 4ZXEA 4NR1A 4QPIA 3ZXAC 3SXWA 3ZYRA 2W1SA 3ILFA 4LEJA 3AKSA 1J3QA 1C28A 1DQ5A 3AMNA 1O4ZA 2WABA 1IHMA 1PNFA 2HWF3 5HV0A 2XONA 2GC0A 4DUVA 3WNXA 3WDYA 1AUYA 2QNKA 1K45A 2OIIA 3X29B 3RYRA 1UYPA 1GP5A 4LHLA 3ZIXA 3S5QA 5J37A 4COVA 3DCQA 2ZEWA 1UZ0A 2O8OA 2QQIA 2XJTA 1VBE1 4N8MA 4QPGA 3VBUC 4CCCA 1DQ1A 5EIYB 1NZCA 4QQPA 2BPA2 1OKOA 2RJ2A 5CKNA 3VD3A 4Q26A 3K46A 1VRBA 4HOOA 2WL1A 3TWIA 2UWBA 1S2KA 2WLQA 4CDXA 4AXOA 3BB6A 4OHXA 2VECA 5A80A 4IV3B 4YZ1A 3ELNA 4YG6A 5C8CC 5K7PA 2VM9A 1PMJX 3AJYA 4L92A 1PGW1 1A3KA 3WW4A 4UFMA 1N1VA 2R0HA 1O5UA 2H0VA 4MZUA 2VMEA 4QXBA 3LB9A 4HKWA 1UZVA 1W06A 1G8WA 1ND2B 3FLPA 5IFPA 1YJLA 2GC3A 1EUTA 1GNYA 2CL2A 3M8LA 4Q4V3 3L2HA 1LU2A 5CIRA 3QH7A 2WN3A 3KT7A 1PO21 5E6HA 1NUKA 1ZZ8A 3AKPA 2DWRA 1BQPA 3VBFB 4C1XA 1OF3A 4KBBA 4Y4RA 1FV3A 2BVBA 1D4VB 2EAKA 1YUDA 3FHQA 3U37A 1FMD2 5FP7A 1W6OA 2DVAA 5IFTA 2ZMLA 3IN9A 3MW4A 5GZFA 3RNSA 1V6IA 1RYYA 1RL3A 2JDHA 1X8EA 3NL1A 3TEYA 3H3LA 4QPWA 2WS91 4S2GA 2JIGA 2BGPA 3C3VA 4D6QA 5FYMA 2ZX2A 5ACA2 4LK7A 1HJGA 3NV4A 1LOGA 2LM3A 4ITCA 4UI9L 1TZOA 5KC5A 5APAA 2FQPA 3CJXA 4QX8A 3U78A 3EBRA 2VU9A 3GHMA 2W9XA 5FZFA 4OHZA 1RUG2 2ORZA 3POFA 1PX4A 1DCSA 3QACA 4PLMA 4QQOA 1JUHA 3OOXA 4XCAA 3FX3A 1ZRFA 4FPYA 3KV6A 2DUPA 1XNTA 4RD7A 1H2NA 3LZZA 4NRMA 4RYDA 5DG2A 4Q5OA 4PLOA 5DXDA 2XJPA 2NLRA 3ZFGA 4O61A 3NVCA 2QQWA 1WMFA 4CCMA 2NMOA 2GP3A 2G9FA 4TXWA 4AOCA 2YROA 4DUXA 2RV9A 4I09A 4Q1RA 3T08A 3VBRB 1CX1A 4P9JA 4AQ6A 4PIXA 3RVHA 1LEDA 4WM8B 4XUNA 4WZFA 2X5IB 2XDVA 3O14A 4Q4Y1 4HBNA 5FR3A 2XBO3 1ND2C 4NIDA 1PGL2 2QQOA 2XGXA 3U1XA 3VBSB 3ZYHA 1CD3G 3LDRA 4MV2A 3U14A 3WNLA 1BMV1 4LR4A 5CFDC 1U5ZA 4GWIA 4XE9A 5CNAA 4YGDA 3NJXA 2R063 5C3OA 3AP7A 2AREA 3VBFC 5EZWA 2G9ZA 3N3HA 2R1DA 2K46A 1XQNA 2Y0IA 1X9TA 2VY0A 3BPZA 4W8JA 3RPQA 3VZLA 3WQ1A 3AK0A 4K21A 5LBBA 5FUPA 4WZCA 4FOYA 5L9BA 1H8TB 4PF1A 1RUE1 5FLJA 4DNYA 3RZGA 3BVCA 3OSDA 2A75A 1ONAA 1GOHA 1VMJA 5FZ9A 3UGGA 3WW2A 1QDCA 2YB7A 3VZMA 3BN6A 2XJRA 4KNCA 2KM2A 3T0AA 4QGMA 4OMCA 1ND3B 2ZEYA 4GJYA 5JXHA 3KF3A 1ASJ2 1GANA 1XJAA 3JZVA 1VBE2 2UYBA 4IUGA 3RG0A 4EE2A 3U0ZA 3NWKA 2HWD2 1YFXA 2DUOA 2WIIB 1X50A 4IEVA 1HXS2 4CCKA 1MZEA 5CA6A 4Q0UA 3VBRC 3NKGA 2MEV1 2RM22 4XIOA 5D2AA 3SCHA 4CUCA 4WM8C 2DU1A 3OBRA 1FOD1 1RUF2 2X5IC 5A70A 5ACA3 1UOFA 1ZBE1 1QJU1 1N3PA 1XB9A 2RS12 2JXAA 4M3CA 4QU2A 2CYFA 3ETQA 2XUEA 3HQRA 5DQ0A 2X05A 1W6MA 3RZHA 1AR61 1EPWA 3HR9A 1JU4A 1SCRA 4P9YA 5IVEA 3GM8A 4QDSA 1LGBA 2YU1A 3JQWA 4JHZA 4Q8KA 1Q8PA 1W8NA 1JYTA 3ILNA 3SKVA 1LB2A 1HRV2 2PHWA 3L2YA 2RR12 1NLQA 2ZHNA 5FZ0A 4ZXKA 4YPJA 2VCCA 4BIOA 5JXGA 3WP4A 1NAEA 3POSA 1G86A 2P5BA 2XVKA 2WO2A 2Q5TA 3PU3A 1PVC1 1VALA 1W6NA 4FPOB 2R071 1GKBA 1NG0A 5FY7A 2WS92 1OLME 2CSGA 3B69A 3KMHA 1H8TC 4QD2A 3S6PA 4AI3A 3PU8A 4CCNA 4GB33 4Y1XA 4META 5L7OB 2ZBJA 1UMIA 3GDBA 1VAMA 4HVQA 3S5AA 1HB2A 1RUH1 1VLNA 1VP6A 3IAPA 4CCOA 3VKLA 4TWTA 4P5HA 5SV5A 3RMYA 1ND3C 4HL0A 1E5IA 3OGSA 4K6BA 2R6QA 4LUMA 3J7NA 3WUCA 3ITQA 4J25A 4BA6A 4FFFA 3RQ0A 4Z2WA 4QU1A 4NRPA 4K7JA 1KFUL 3WY6A 1HKDA 4G4FA 4IEZA 4D7SA 1R1ZA 4YLZA 2Z4FA 3P6BA 1R092 2VZTA 2FDHA 2HWE3 3JUUA 1AR91 4HZFA 1XBFA 1CPNA 4NN0A 5CFCA 2E31A 3D82A 3HBZA 1OT5A 4A6SA 2R30A 1CWPA 1BKZA 4LBNA 2JDAA 1W9TA 2ETEA 4B4QA 2WFF2 5HCAA 3VD9A 2V72A 1W03A 4Q4Y2 4AFBA 2JEMA 2ORXA 5I8SA 5T52A 4FBFA 5JZGB 2D98A 4N43A 2GC2A 1NCQB 3AL6A 5ANQA 1CN1A 4Z92B 2VTXJ 3NAPC 2QCSB 1DZTA 4WM7B 1CAUA 1WW6A 1JHJA 1XNDA 1CAWB 2DFCA 1VBE3 2A7AA 3OB8A 4EWAA 4E4DX 2LUWA 3A0KA 1YO8A 3M3QA 1YFYA 2R7EB 1W05A 4R9BA 3O0WA 2RM23 3OY8A 2OKXA 4ATFA 1GUIA 4KL1A 1K12A 1MS9A 1RUF3 1KDMA 5L7OC 2G19A 3T30A 3M3CA 1DYKA 4RN5A 5LA1A 2DFBA 3VKOA 1H1AA 1ALYA 4COWA 3JXSA 1NY71 2ZGMA 2ZKLA 1FAYA 2IUWA 3CZUA 1S0DA 3K51A 1TQ5A 4MUVA 1PO23 1V0AA 1W8ZA 1TME1 5GZDA 5LASA 3JB4C 2P4EA 1VBA2 4Q29A 3HWJA 2RR13 1Y9GA 4XZPA 2VMHA 3J9SA 2E9QA 4E4SA 3PDQA 3NW4A 1DG6A 1D4M1 2VMIA 3BUCA 4DY5A 1RHI2 2LW8A 2NYYA 4MXWB 3RI9A 5I0UA 5A6XA 2WS93 4A7ZA 5F8PA 1FOD2 4UW5A 5F5AA 3RJ2X 4UYBA 1G7YA 1KS4A 1VAKA 3ZO0B 4BOWA 4BXFA 1GZTA 4LBQA 4LLOA 5CB7A 3SQOA 1PX3A 3U4XA 2VULA 4QX3A 1XE7A 1NCQC 4B4RA 2AACA 4JGZB 4OVEA 3IMNA 5EJZB 1AR62 3TEZA 3AKTA 2BOIA 1H8VA 2WINB 4FP3A 2Q1MA 5L9RA 4WM7C 4AVAA 1G9DA 3ZYFA 4PQQA 5I93A 2LALA 4XEZA 1GICA 5FY5A 4FAGA 2GDFA 3MI8A 1LOBA 2PYTA 2VVDA 3QOPA 4LO5B 4IEOA 4PLNA 4Y1YA 5A7NA 1SPPB 3AZVA 4BQ2A 1W6QA 1PK6B 2J1RA 2R16A 5I8TA 5FAXA 4AYUA 2TEPA 3I7DA 1HDKA 4IGPA 3WINE 1IPJA 3OPWA 4ATEA 2C9KA 4AW7A 5FZOA 3ENRA 1N47A 3T2OA 3PJQA 4C0HA 2WFF3 4SBVA 1SDDB 4BQ3A 5FPUA 4Q4Y3 5F5IA 4BB3A 3B94A 4R9AA 1UMHA 2E7TA 2RJKA 5IVJA 4AEMA 4KGQA 4BPZA 1M06G 5F37A 3NNLA 3RZMA 3UT0A 5FPVA 5FYBA 4GWMA 2OQ7A 1DGRA 3CJIA 3I59B 1DLLA 2RS52 3N7LA 3POYA 4NIGA 5ABJA 3K4AA 4CDWA 2B42B 2JE7A 4YVSA 3ZIWA 3CF6E 5FYUA 2WWSA 3NNMA 3DPRB 4XCBA 5F3GA 2JB4A 2ENRA 4E8DA 5KHGA 1KD7A 1Q43A 4AWDA 1U5IA 2VMCA 3A23A 3IAQA 3BTAA 2VUAA 5K0UA 2OA2A 1S0IA 1RUE3 3FWEA 3WDUA 1OA2A 4HETA 3RWKX 3HN3A 1UY3A 1L7LA 2HWB1 3I2FA 1VE0A 3V0BA 1Q8VA 4JGZC 1C1LA 4CXYA 1UIKA 1DYPA 2XWJB 4P9IA 5AVPA 4Q4W1 4BLJA 4HK8A 1BHGA 2QQNA 1D2QA 5BY5A 3I2HA 1RUI1 1VBA3 5A33B 1PK6C 3TN92 2JB8A 5C4WA 5FZBA 4JKLA 1WMXA 3LAGA 3KV4A 3WG3A 5FQ0A 1VBC2 2NMNA 4LBOA 1RHI3 1RVF1 1Y9MA 3V0AB 3IWZA 1DGRN 2Y33A 5LEJA 4L0PA 2GU9A 1EAH1 1ULOA 3KV9A 4FFGA 2W94A 4GIQA 1FOD3 3ME2A 5GLUA 3IDAA 4J6GA 2AGSA 3AKQA 3HNBM 1OQ1A 1IG3A 3PL0A 5FY1A 4A2UA 1QJU3 1GR3A 3ZX7A 4CUBA 2VZQA 2GALA 2AEYA 5L73A 1AR63 2KR2A 4KWJA 5C8CA 1LEMA 1W3VA 1DZQA 1JU3A 1UY1A 3AFKA 2WNEA 2YGLA 5BNPB 4A3ZA 1O4YA 1B09A 3S57A 4DUWA 4YW1A 2XB6C 4HPKB 4BQ5A 4MGIE 1E57A 3WNKA 4A7KA 1MQTB 4OI0A 3ES1A 4OUMA 1O7FA 4CPBA 4XZUG 3BOPA 1BK1A 1UO9A 5I8YA 2OPKA 4N7UA 1JZ4A 1SBEA 3GNEA 2ZS6B 4TLFA 4OHYA 2JG9C 2IFWA 3R0RA 4XDPA 2ZX3A 1N1YA 5T5JA 2BWCA 4QDQA 1Y7BA 2JD9A 5DAXA 4P02B 4K1ZA 3K4ZA 5A7SA 3NJZA 1RUH3 1UZZA 2OQ6A 1IQDC 1J3RA 2X10A 4DFSA 5FO8B 3LIGA 5FYVA 5F7UA 1F5JA 4UFLA 1ENXA 5JLVA 5DUVA 4XW3A 2CV6A 2RS53 1J1TA 3VUOA 5BNNC 3VBOC 2J1TA 2IC1A 5JSPA 5DUUA 3T1MA 1ZA7A 2CTVA 1AXKA 4Y24A 1S0JA 3UV9A 1JZ6A 4FPGA 2V4AA 3D0JA 4N90A 4FOVA 5EP9A 3BGAA 4QKFA 2BNNA 5LRSA 1ULFA 1OD3A 5FMOS 3G6JB 3VHOA 2XKPA 1DGWA 1W8WA 3WNNA 3ZYPA 4W6YA 5DAWA 4G9SB 4Q0QA 3VD7A 4AGVA 3TYJA 5F5CA 5B2GB 4RFT0 4UF0B 1COV1 2YPJA 2YZ4A 3MUY1 5BNOA 1MZ5A 1ZBA1 2XLGA 1V00A 1MS0A 4CEWB 5BNPC 4FTBA 5FP3A 5DPNA 1UU4A 3ZVXA 1UU5A 2V5DA 2ZA9A 4AEDA 5DAVA 3ZYBA 4M3CE 3LQCA 4BQ1A 3VZKA 5CKMA 3FBMA 5CFDA 1RITA 2WRAA 2YGMA 3IZOA 5FZAA 4ARYA 4D3WA 2J1UA 2AYHA 3H8RA 2PHUA 5FIXA 1QMJA 5A3WA 4OQ9A 5A7PA 3VBFA 4PHZA 3WNPA 1YFWA 4R9CA 3SISA 2C4XA 2NM1A 2A71A 4QDRA 4C8DA 1PZ8A 5CYYA 4IXLA 1WCSA 1HV0A 1VBB1 2PHDA 4P9XA 4LBMA 2E51A 1OA4A 3B01A 1M4WA 2IXHA 4M0HA 1O91A 1JHNA 4I3PA 4LKFA 2PHFA 2VXJA 4XUQA 1TME3 2PAMA 3NV3A 3PURA 5HV4A 1X8MA 2VMFA 1UCXA 4FPHA 4K8FA 2WAOA 5A6QA 1NLRA 5F3EA 4XF9A 4AEJA 5JWPA 1MEC1 3NNFA 3KD4A 3MICA 4N7IA 5FXXA 5BPXA 2D6MA 1D4M3 2FCVA 3I4IA 3I2GA 1WGPA 1FPN1 3FUOA 1S0GA 3THDA 2J1SA 2HYKA 1UYZA 4CZSA 3N7MA 1ZRCA 5AC91 5FJHA 3LA7A 4JHTA 1CAVA 2FCUA 3I2DA 5K9YA 1EV11 3VHNA 2YC2A 4Z82A 4FTEA 1PHMA 2NP0A 5F3IA 4JDNA 2XQRA 5FPBA 2XJVA 2IWGB 1OQEA 5F32A 1ACCA 2J22A 3HQXA 2YY1A 3CNAA 3AZWA 3H8OA 3WLUA 4CEWC 3N35A 2EIDA 4W50A 3W59A 2FDJA 1R64A 3CBNA 4WVZA 1HN0A 4RHV1 2DUQA 4DXTA 2B8MA 5DABA 5KR7A 3UKVA 1HN1A 2OT7A 3POEA 3PVBB 2HWC2 3SITA 4N53A 4EN6B 3ZXLA 5FDBA 2P34A 2XKOA 4I3GA 4Q4X1 5EYYA 1UYXA 1EYBA 1W99A 1KJRA 1W9YA 2RMU2 4U2AA 1UX7A 1OPOA 3WG1A 2W95A 1WMEA 4D7YA 3O1RA 1ULPA 2W52A 3AZZA 5EYXA 5HBAA 1ZREA 3FL7A 5A3UA 2ARBA 1SEFA 1U12A 2WFPA 3NNJA 1AJKA 1DIWA 1H8TA 4ZZ8A 3VDCA 3AMHA 3GZUC 4OULA 2DTWA 2HWF2 3I3BA 3ZFEC 1LR5A 3MPPG 1YNAA 4JKMA 4Q27A 3D0SA 2QQUA 1NXD1 1BEV1 2I74A 5IK7A 3A7QA 4XPVA 2FDGA 3LF7A 1X7NA 3AMQA 5IK4A 2JENA 3VDDA 1YLLA 2MHFA 3C7FA 4HANA 1ND3A 4LTAA 2VVFA 1Q8QA 1AXYA 4GJZA 2MPFA 5J1XA 5FZ7A 1O4TA 3C7HA 4QAWA 4SLIA 5FMCA 5GZCA 1W90A 2J7MA 4I02A 2DVDA 4IV1A 4LHKA 5L19A 1DQ2A 2WNOA 4GH4C 1SACA 1AYM1 5C5TA 2UU8A 2B45X 2QKDA 2VC9A 2ZEXA 3C7EA 1UZYA 2A3XA 3F2ZA 2WNVA 3DYPA 2ZCWA 3K4DA 5F2SA 4BDVB 4Y1UA 5T5PA 5FBZA 4QHBA 1COV2 4HK9A 5FPLA 4B8EA 4D6SA 2CNAA 4ZONA 4ASMB 3J8F1 3Q8AA 4Q1PA 4UT5A 5GM0A 5CEHA 4Q4W3 4EWDA 3WW1A 2ADEA 4DINB 5LCWL 2DVFA 4UBHA 4K3UA 1RUI3 5FJKA 5FYZA 2Z2SB 2D6KA 3NAPA 1JYNA 3OGRA 4E2QA 2CAUA 4LE3A 1QOSA 3QCWA 2TUNA 2ZPXA 3WF1A 1OVPA 4NE9A 1E5SA 1TMF1 2JECA 3LGRA 4NO4A 4XYXA 5CG8A 3ZN5A 3USUB 2YPDA 5CKQA 5KXBA 2VW2A 4BCUA 3FE5A 4DXZA 3T4HB 1GP4A 3PTYA 1DGWX 3EQEA 3E1F1 3OYWA 1V6NA 4FSJA 5C7GA 2Y6HA 1A8DA 3ZKUA 1O3QA 4A3XA 3AKRA 4A44A 4CU9A 1ZZBA 1H2KA 1PNGA 1UL9A 4FQZA 4P08A 5A3OA 3WD5A 5J48A 1RTVA 2QDNA 4CUAA 4BMEA 1SLLA 3DXUA 4W65A 3AM2A 1T2XA 3AZYA 4H7MA 4HXCA 4HMZA 1SG3A 1ZA4A 3VB9A 4JGYB 3E5UA 1YQCA 5FLHA 4CCLA 4FAHA 1OFSA 1T6BX 3TAYA 5FY4A 1YQ5A 2W1UA 4A6OA 3E5QA 4FPLA 2V4VA 1JBCA 1WW4A 5D8AB 4MHUA 4COYA 4I2OA 1F31A 1WLCA 2RMU3 3ST7A 3WHTA 1PIV2 1YQ2A 1WLDA 2PA7A 1H2LA 2VVEA 3IIAA 4IDZA 3EO6A 1RMU1 4JVAA 3UYJA 2VG9A 1C1FA 4GKYA 3PLQA 2XBO2 4RS5A 2WO7A 2YG0A 5FZDA 3SEEA 2A70A 1W0PA 4CU7A 1UYYA 2FHRA 2Q8CA 4LO6B 4WVWA 1NCQA 1UKGA 1AL21 3E5XA 4LA2A 3UKNA 5FWJA 3LKJA 4CEYB 3H8XA 3ORJA 2R062 2Y0OA 1CX4A 3LA3A 5A32A 2XVLA 5FZCA 5BUVA 4XBNA 1AYN1 1DZRA 3KHCA 5KXEA 1HRI1 4LUKA 4NMIA 3P5BA 1SBFA 2J1AA 3PTRB 2PHXA 2YFZA 3DKQA 4AE2A 4A45A 5DMYA 4Q2FA 1IQAA 1WCQA 1F4AA 2ZGKA 3FN9A 2O0OA 5CADA 2DBIA 3W20A 4CDUB 1COV3 4YARA 1QXPA 1ULGA 2PLV1 4FPJA 4RA0A 5FZEA 1ZBA3 3GJBA 2O1QA 3ZR6A 4CDQC 1FYUA 3JB8A 3MW2A 3OF1A 2LS6A 4IGQA 4W4ZA 2DYCA 1MS4A 4Q0PA 2XXZA 3MLKA 2XPJA 1R081 3HEIA 4JGYC 4NIIA 4AQ2A 2FD8A 5A7OA 4UFJA 4JAAA 4AF9A 3I8TA 3OUIA 4XFIA 2HKXA 1ENQA 5D8AC 3C7OA 1H4GA 1QKQA 2WBKA 1JYVA 1DF0A 3JD72 2W91A 1XU1A 3N9QA 4FPEA 4YG0A 5EFUA 4YZ5A 2O14A 1LRHA 1UXZA 1HJFA 4XBQA 2ZMNA 2ZGSA 4KWKA 2ATFA 5T54A 1IOAA 1PGSA 5FO7B 2JE9A 2QJVA 4FVVA 4MXVA 4CP9B 1WD3A 3LPFA 3DUIA 4LIVA 5FFOC 1O59A 5LBFA 1CESA 4JGZA 1OA3A 5FRAA 1E5RA 3C7GA 3KZ4C 5F9TA 2Z5WA 1MEC3 3MGUA 3AYCA 3U11A 1H4HA 1W6PA 3BI3A 5LA0A 2VZUA 3P1IA 1QHDA 5F6KA 2JDZA 4C1WA 1VRH1 3SLIA 4ISRA 2DU0A 2R1BA 2V09A 1A78A 1KGYA 5FMOL 1B35A 1VB4A 1XOYA 1EV13 2AZ5A 2BP6A 1PIV3 2H6BA 2VQTA 4HVOA 1W8HA 4URAA 1OOPB 2JG8B 1MVEA 1D7PM 4IV3C 3WV6A 2ILMA 3LEGA 3O7OA 4CDUC 3H8UA 1DQ4A 4GB32 3THCA 3T2PA 2XJSA 3MBWA 5GZGA 2KXLA 5H9QA 1YJKA 3AYAA 3DKWA 1REDA 2VOXA 4V2WA 2TBVA 2VOKA 5FZ1A 2VAUA 4F83A 1KJLA 2CGNA 1UQXA 1QNWA 3E97A 4RHV3 3ZLIA 3PMSA 4BISA 1QQP2 2CDPA 3J7MA 3KT1A 2WZR1 4ISQA 3NO8A 4OUEA 2QUOA 3WQ0A 4DRVA 2P1BA 1R1A1 1H9PA 2HWE2 2VBDA 3CMGA 3LSDA 1WA4A 2IZWA 1XRUA 1ULEA 4CE8A 2PTMA 3NNGA 1XYOA 4B1LA 2DVGA 3ZKYA 3C2UA 1URXA 1REEA 3KVBA 2RG4A 2JG9A 2SLIA 4Y5Z0 2OS2A 2DCTA 1GU3A 2LROA 4CYDA 5C33A 3VV1A 4C91A 2G9GA 2QZ3A 2XUMA 1NA1A 5FP4A 4XAAA 4GKXA 5FY9A 2ZOEB 2A6YA 1JUIA 4LMFA 1Z7S1 5EV7A 1AR81 1X9PA 2QQKA 3JBG1 3MZHA 2VBPA 2WUHA 5BNNA 1QGLA 3VBOA 1WLTA 4LXLA 1A8MA 1QJX1 2BJSA 4R9DA 3DGTA 4XXPA 3JD73 3POGA 2FDIA 1AYM3 1OOPC 3OBTA 3RYPA 3V0AA 2Z42A 1WMDA 4GALA 1XE8A 4X6RB 1W9SA 5A1FA 4QPYA 2QQPA 2PLV2 1DQ6A 1PGW2 2VCBA 2VQUA 2W08A 4CA9A 3V56A 4E2GA 5J7MA 3J8F3 1QNYA 3VBSC 3MLLA 3ZSEA 5KHKA 3HT2A 1UOBA 1W39A 1GZWA 2E33A 2IVJA 2P37A 4QB2A 4RGAA 4XVHA 1PO22 1RIRA 2VR4A 2XLFA 5FZHA 4P00B 2DTYA 2HBUA 3AB0A 1CZTA 1I6XA 3ZN6A 1WW5A 2P3KA 2ZX4A 3AC0A 4JQRA 3W58A 4QKNA 5GLZA 3SCGA 2VW1A 1TMF3 4Y5TA 5LB6A 4GAZA 5C70A 1FNYA 3S7EA 1CQ9A 1RUD1 3A21A 2XJUA 3H7YA 3ZFFB 5JMOA 2BEOA 4JDOA 4LBKA 3LA2A 3K77A 4QX7A 3J4UH 3OCPA 4XURA 4Y20A 4BHPA 2IVIB 4ZPIA 2D6PA 2B5HA 2XMLA 5G05L 4AG4A 2OW4A 4BIFA 4E2SA 4UFHA 2GN3A 2DV9A 4FI9A 4XUTA 1H0BA 1RUJ1 1K3IA 2BW8A 4QWNA 5FPZA 2WAAA 1YWKA 4PDWA 1WBLA 2XHNA 3B00A 1H1IA 2C5DA 2R041 2QVSB 5E89A 3WCSA 4EYUA 1O8SA 4NHKA 4KMQA 1QQP3 1QJEA 3ZXDA 1US2A 4MGTA 1S55A 3H3ZA 4YVWB 3O0VA 2Y26A 4JDMA 1OHFA 4XQWA 4LE4A 5FZ4A 5A1LA 5FZKA 3HNYM 3KHBA 2EICA 3MIHA 3THPA 1SLTA 3FZ3A 1PO11 2JDPA 4B29A 4YW2A 2YFUA 1GV9A 4JCKA 1QDOA 1RMU3 1UNBA 2VNOA 3I3DA 3MV11 1UD1A 5L7OA 2PHLA 3OUHA 4FQ4A 3ZN4A 1CAXA 3MUZ1 3WQBA 4TSVA 2DBNA 5FMDA 4CCJA 4UF0A 4EN9B 5I0DA 1AL23 2I45A 1IKPA 4HN0A 1BMV2 3P3PA 5LK5A 1Y3TA 1DBNA 1LODA 1NKGA 1QF3A 4MGSA 4GULA 2ERFA 5HPOA 4IE0A 4G3YC 5FXZA 1AYN3 4QPIB 4H2AA 4GWJA 4AVBA 3VBHC 1N3OA 1HRI3 4BMBA 4XF4A 1GWMA 3H1WA 2GH2A 5A3NA 3H3UA 3Q9OA 1SDWA 3PVEA 4XJUA 1NE6A 1UY0A 5FY8A 2WNUA 4ZY9A 2DF7A 4AVVA 1RUC1 3KF5A 5FMBA 1RUE2 1MZ6A 3J7LA 2PLV3 2GP5A 3ACLA 4Y22A 3OPTA 2QQVA 3WX5A 2HEYF 2ZXQA 4WBBA 2Y60A 5DN2A 3BTYA 5EPAA 2GAUA 3HJRA 2P3YA 1NZIA 2WZ8A 4QPGB 1R083 1GQHA 2BDRA 2YXSA 5DUXA 5JSOA 4Z1VA 1NCRA 4GD4A 1Z7S2 3GBFA 5KHIA 4YVWC 1AR82 3ZFEA 2I2SA 2HYXA 3ZDVA 1HQLA 4IE7A 4LLFA 4LOTA 4CDXB 1U5YA 5FV3A 2FDKA 2P2KA 2VMDA 4H14A 4YM3A 4XJ9A 4HVRA 2MEV2 2VUJA 2R32A 4LT5A 4DS0A 3IIIA 4AVCA 1C5IA 1ZBE2 2Q0AA 3UNPA 3KQ4B 5LY2A 2B9UA 1QJU2 3AP6A 4E27A 3PJYA 2LTNA 4GH4A 1QJY1 3TBDA 5HI0A 5CAZA 2UWCA 2PAEA 3O1OA 5JZGC 1CVNA 4UBGA 5IUQA 1XNAA 1LULA 2GMPA 4F8AA 5JXJA 3BIEA 5FZ6A 1CGPA 4D8MA 1C8M1 2ZTNA 5C5UA 4LBJA 1W6OB 4UW4A 3ZMOA 1CPMA 2EIEA 4QPIC 1ST8A 3CDZB 4B3NA 3DYMA 4RR3B 4AAXA 2HJIA 2ZHMA 4OYUA 3T0DA 2EIGA 1JYXA 4GA9A 4AHXA 1LOFA 1PVC2 1STMA 2B9VA 3DV8A 1RUD2 2R072 3EYPA 4CCEA 4DXRA 1ZVFA 1OUXA 1UPSA 1UW8A 5JIUA 3EXUA 4EWEA 2PQQA 4R4XA 1K5JA 2D5FA 4LA3A 1G9CA 2D7FA 1LHOA 2OUJA 4NIAA 3U07A 3WP3A 1W0NA 4PQ9A 1YRZA 1GOGA 1RUH2 1Q5OA 4QXKA 2K9ZA 3WOGA 4IEXA 4QPGC 2W5FA 3ZFGB 2O8QA 2D5HA 1O5LA 1XC6A 3H50A 1ZRRA 3QBQA 5LATA 1JZ5A 2CGPA 3FLTA
chains in the Genus database with same CATH topology
2HLEA 4XUQA 2WABA 2VMFA 2WAOA 2XONA 4DUVA 3I2JA 4UOJA 3EB7A 1LNSA 1K45A 5A1AA 2CDOA 3I2GA 3THDA 1XPWA 2J1SA 2ZEWA 2QQJA 1UZ0A 1UYZA 2QQIA 4MADA 5EIYB 2YC2A 2RJ2A 3VD3A 3K46A 2J22A 4QB6A 2VM9A 1PMJX 2EIDA 4W50A 2VMEA 1R64A 4A41A 5IFPA 1EUTA 1GNYA 4DXTA 2Y8KA 3OG2A 1HN1A 2WN3A 4OMDA 4ET7A 2BERA 1NUKA 1UYXA 1W99A 1OF3A 3U37A 1UX7A 3K75B 2W95A 3FHQA 1ULPA 1DLCA 3FL7A 2VZ3A 5IFTA 1JZ8A 1RYYA 4QPWA 4ZZ8A 4LPLA 2Y6LA 2BGPA 3VDCA 1PMHX 2PQSA 3I3BA 4UI9L 5FUIA 2WZEA 4JKMA 2E26A 3LE0A 3A7QA 2W9XA 3NQHA 3C7FA 2ORZA 1PX4A 2Y6KA 1O8PA 1KEXA 5J1XA 3C7HA 4QAWA 1XNTA 4RYDA 2J7MA 4P5YA 4QX1A 4QB1A 2VOTA 3C7EA 2VC9A 2ZEXA 3LEKA 3K4DA 3F2ZA 3DYPA 4TXWA 4BDVB 4BK4A 4DUXA 2RV9A 1TG7A 2Y6GA 4QX0A 3T08A 2WO1A 1CX1A 1JZ7A 1JI6A 4XUNA 3VD5A 4JKKA 3VDBA 3FHAA 5LCWL 5CZKA 3WF4A 2QQOA 4LQRA 1JYNA 3OGRA 1JYWA 3MV01 3WNLA 4GWIA 3A22A 3PUHA 3NJXA 3WF1A 3WSOA 4W8JA 3E1F1 4D0QA 5C7GA 2Y6HA 2W92A 4A44A 4CU9A 2VCAA 4PF1A 4P08A 4CUAA 1T2XA 1WKYA 3OEBA 1GOHA 4XUPA 2W3JA 1SG3A 1J83A 2YB7A 3BN6A 2W47A 3T0AA 3LEIA 4OMCA 2W1UA 2ZEYA 4A6OA 5JXHA 2V4VA 4IUGA 1CIYA 3DYOA 1YQ2A 1K42A 3WF3A 1CZVA 4ARXA 4Z2AA 4CUCA 2WYSA 2YG0A 4CU7A 1UYYA 5DQ0A 3T0BA 2X05A 4E8CA 4M4RA 5B4XA 2VL4A 2WN2A 1JU4A 3GM8A 1UY4A 2DDUA 3GXUA 4QDSA 4JHZA 1UXXX 1W8NA 3SKVA 4YPJA 2VCCA 2J1AA 3I3EA 2YFZA 5JXGA 1NAEA 4A45A 5DMYA 2WO2A 4DXSA 1WCQA 1F4AA 2W1QA 3FN9A 3CIHA 5EJ1B 1OF4A 4A42A 1UMIA 3GDBA 2LS6A 4W4ZA 2E32A 3ACHA 3MO4A 2VZSA 3HPNA 3HEIA 3IAPA 2QQMA 3OGSA 1DYOA 5C71A 3C7OA 3PUIA 2WBKA 3CQOA 1JYVA 2W91A 4CU6A 2Z4FA 3P6BA 2VZTA 5IJRA 5HXMA 1UXZA 3SEEA 2J1VA 2E31A 4HG6B 2W87A 1OT5A 4LKSA 2JDAA 1W9TA 3LPFA 3VD9A 1L7QA 2V72A 1O59A 2VZVA 5IHRA 2ORXA 2QBXA 2QQLA 3VDAA 3C7GA 4CU8A 4XUOA 2W1WA 5LA0A 2VZUA 3P1IA 1JHJA 3OEAA 1KGYA 3OB8A 4MGQA 2VQTA 3HNMA 1D7PM 2R7EB 3LEGA 2OKXA 3THCA 3T2PA 3MBWA 1GUIA 1K12A 4KI5M 4A4AA 4RN5A 1US3A 2ZEZA 1I5PA 5LA1A 2CDPA 2ID4A 3JXSA 3CZUA 1W9WA 4OUEA 5B4NA 1OH4A 2JE8A 3GGLA 1GOFA 3CMGA 3NRUA 3VD4A 3NNGA 2LW8A 4OZOA 1GU3A 3C8XA 1SHWB 3LPGA 3D3AA 1PX3A 4QX3A 5EJZB 1H6XA 3CKHA 2BZDA 2QQKA 4PQQA 2WQ8A 1EUUA 1P8JA 2VZOA 2WUHA 3UESA 1J84A 2J1RA 3DECA 5JXIA 3I2IA 1W9SA 3I97A 3I2KA 2VQUA 2C9KA 2VCBA 5LA2A 3T2OA 2RVAA 2XOMA 1SDDB 1MPXA 2E33A 1UMHA 4QB2A 3W5NA 4BK5A 2J1EA 4XVHA 2VR4A 4P00B 1CZTA 3AC0A 3K4AA 3T09A 5C70A 3IB3A 3A21A 5JMOA 3K77A 4E8DA 4XURA 1GQPA 5G05L 4AG4A 1JZ2A 2VMCA 3A23A 3IAQA 3NJVA 2KD7A 1TVGA 4FI9A 3OGVA 4XUTA 2W46A 3WNOA 3SEPA 1K3IA 1UWWA 3HN3A 1UY3A 4DEVA 2WAAA 2XHNA 1UY2A 3I2FA 1O8SA 4GZ9A 2BGOA 4KMQA 3UETA 4MOAA 1US2A 5G04L 3T2QA 1BHGA 2QQNA 3WF0A 3ETPA 1NX9A 3HNYM 3I2HA 2EICA 1JZ3A 4PT6A 4JKLA 2YFUA 3I3DA 3MV11 4BXSV 1W8OA 3ECQA 4L0PA 1ULOA 3SKJE 2W94A 4BJ0A 3IDAA 4QX2A 3HNBM 3MUZ1 3WQBA 2B4KA 2VZ1A 4CUBA 2VZQA 5I0DA 3OBAA 1L7RA 1NKGA 4MGSA 5HPOA 3CZJA 5JR2A 3W5MA 2Y6JA 2JKXA 1JU3A 1UY1A 2WDBA 4A3ZA 4DUWA 4GWJA 3WNKA 5IYYA 4UAPA 4XZUG 1UY0A 4ZY9A 1GMMA 1JZ4A 2XQXA 2ZXQA 5DN2A 2DCKA 4QDQA 3HJRA 2JD9A 2WZ8A 2X09A 4P02B 3K4ZA 4KWUA 4JX0A 1IQDC 2X10A 3WEZA 4M4PA 5F7UA 2HYXA 3WF2A 2VMDA 2J1TA 1JZ6A 1DP0A 2YC4A 2EIBA 3IIIA 3J7HA 3BGAA 1F4HA 3UNPA 1OD3A 2L9LA 3ACFA 3ACIA 2VTFA 1XNAA 3WNNA 4ZZ5A 5JXJA 3VD7A 2DCJA 3WNMA 2Y64A 4D8MA 2VZRA 3MUY1 4MO3M 3HOBA 2EIEA 3ACGA 3ZM8A 4DEQA 1H6YA 2BBAA 3CDZB 3DYMA 4AAXA 5DPNA 3T0DA 4OYUA 4TTGA 2V5DA 1JYXA 2B9VA 4LHSA 4DXRA 3LQCA 3EYPA 2VO5A 4CVUA 2VZPA 4ARYA 1CZSA 2J1UA 2VJXA 3WNPA 2C4XA 2C26A 4QDRA 2WO3A 3ABZA 1W0NA 1GOGA 5CYYA 5JUVA 2W5FA 1XC6A 4ZXEA 1JZ5A 2W1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HLE A;  4XUQ A;  2WAB A;  2VMF A;  2WAO A;  2XON A;  4DUV A;  3I2J A;  4UOJ A;  3EB7 A;  1LNS A;  1K45 A;  5A1A A;  2CDO A;  3I2G A;  3THD A;  1XPW A;  2J1S A;  2ZEW A;  2QQJ A;  1UZ0 A;  1UYZ A;  2QQI A;  4MAD A;  5EIY B;  2YC2 A;  2RJ2 A;  3VD3 A;  3K46 A;  2J22 A;  4QB6 A;  2VM9 A;  1PMJ X;  2EID A;  4W50 A;  2VME A;  1R64 A;  4A41 A;  5IFP A;  1EUT A;  1GNY A;  4DXT A;  2Y8K A;  3OG2 A;  1HN1 A;  2WN3 A;  4OMD A;  4ET7 A;  2BER A;  1NUK A;  1UYX A;  1W99 A;  1OF3 A;  3U37 A;  1UX7 A;  3K75 B;  2W95 A;  3FHQ A;  1ULP A;  1DLC A;  3FL7 A;  2VZ3 A;  5IFT A;  1JZ8 A;  1RYY A;  4QPW A;  4ZZ8 A;  4LPL A;  2Y6L A;  2BGP A;  3VDC A;  1PMH X;  2PQS A;  3I3B A;  4UI9 L;  5FUI A;  2WZE A;  4JKM A;  2E26 A;  3LE0 A;  3A7Q A;  2W9X A;  3NQH A;  3C7F A;  2ORZ A;  1PX4 A;  2Y6K A;  1O8P A;  1KEX A;  5J1X A;  3C7H A;  4QAW A;  1XNT A;  4RYD A;  2J7M A;  4P5Y A;  4QX1 A;  4QB1 A;  2VOT A;  3C7E A;  2VC9 A;  2ZEX A;  3LEK A;  3K4D A;  3F2Z A;  3DYP A;  4TXW A;  4BDV B;  4BK4 A;  4DUX A;  2RV9 A;  1TG7 A;  2Y6G A;  4QX0 A;  3T08 A;  2WO1 A;  1CX1 A;  1JZ7 A;  1JI6 A;  4XUN A;  3VD5 A;  4JKK A;  3VDB A;  3FHA A;  5LCW L;  5CZK A;  3WF4 A;  2QQO A;  4LQR A;  1JYN A;  3OGR A;  1JYW A;  3MV0 1;  3WNL A;  4GWI A;  3A22 A;  3PUH A;  3NJX A;  3WF1 A;  3WSO A;  4W8J A;  3E1F 1;  4D0Q A;  5C7G A;  2Y6H A;  2W92 A;  4A44 A;  4CU9 A;  2VCA A;  4PF1 A;  4P08 A;  4CUA A;  1T2X A;  1WKY A;  3OEB A;  1GOH A;  4XUP A;  2W3J A;  1SG3 A;  1J83 A;  2YB7 A;  3BN6 A;  2W47 A;  3T0A A;  3LEI A;  4OMC A;  2W1U A;  2ZEY A;  4A6O A;  5JXH A;  2V4V A;  4IUG A;  1CIY A;  3DYO A;  1YQ2 A;  1K42 A;  3WF3 A;  1CZV A;  4ARX A;  4Z2A A;  4CUC A;  2WYS A;  2YG0 A;  4CU7 A;  1UYY A;  5DQ0 A;  3T0B A;  2X05 A;  4E8C A;  4M4R A;  5B4X A;  2VL4 A;  2WN2 A;  1JU4 A;  3GM8 A;  1UY4 A;  2DDU A;  3GXU A;  4QDS A;  4JHZ A;  1UXX X;  1W8N A;  3SKV A;  4YPJ A;  2VCC A;  2J1A A;  3I3E A;  2YFZ A;  5JXG A;  1NAE A;  4A45 A;  5DMY A;  2WO2 A;  4DXS A;  1WCQ A;  1F4A A;  2W1Q A;  3FN9 A;  3CIH A;  5EJ1 B;  1OF4 A;  4A42 A;  1UMI A;  3GDB A;  2LS6 A;  4W4Z A;  2E32 A;  3ACH A;  3MO4 A;  2VZS A;  3HPN A;  3HEI A;  3IAP A;  2QQM A;  3OGS A;  1DYO A;  5C71 A;  3C7O A;  3PUI A;  2WBK A;  3CQO A;  1JYV A;  2W91 A;  4CU6 A;  2Z4F A;  3P6B A;  2VZT A;  5IJR A;  5HXM A;  1UXZ A;  3SEE A;  2J1V A;  2E31 A;  4HG6 B;  2W87 A;  1OT5 A;  4LKS A;  2JDA A;  1W9T A;  3LPF A;  3VD9 A;  1L7Q A;  2V72 A;  1O59 A;  2VZV A;  5IHR A;  2ORX A;  2QBX A;  2QQL A;  3VDA A;  3C7G A;  4CU8 A;  4XUO A;  2W1W A;  5LA0 A;  2VZU A;  3P1I A;  1JHJ A;  3OEA A;  1KGY A;  3OB8 A;  4MGQ A;  2VQT A;  3HNM A;  1D7P M;  2R7E B;  3LEG A;  2OKX A;  3THC A;  3T2P A;  3MBW A;  1GUI A;  1K12 A;  4KI5 M;  4A4A A;  4RN5 A;  1US3 A;  2ZEZ A;  1I5P A;  5LA1 A;  2CDP A;  2ID4 A;  3JXS A;  3CZU A;  1W9W A;  4OUE A;  5B4N A;  1OH4 A;  2JE8 A;  3GGL A;  1GOF A;  3CMG A;  3NRU A;  3VD4 A;  3NNG A;  2LW8 A;  4OZO A;  1GU3 A;  3C8X A;  1SHW B;  3LPG A;  3D3A A;  1PX3 A;  4QX3 A;  5EJZ B;  1H6X A;  3CKH A;  2BZD A;  2QQK A;  4PQQ A;  2WQ8 A;  1EUU A;  1P8J A;  2VZO A;  2WUH A;  3UES A;  1J84 A;  2J1R A;  3DEC A;  5JXI A;  3I2I A;  1W9S A;  3I97 A;  3I2K A;  2VQU A;  2C9K A;  2VCB A;  5LA2 A;  3T2O A;  2RVA A;  2XOM A;  1SDD B;  1MPX A;  2E33 A;  1UMH A;  4QB2 A;  3W5N A;  4BK5 A;  2J1E A;  4XVH A;  2VR4 A;  4P00 B;  1CZT A;  3AC0 A;  3K4A A;  3T09 A;  5C70 A;  3IB3 A;  3A21 A;  5JMO A;  3K77 A;  4E8D A;  4XUR A;  1GQP A;  5G05 L;  4AG4 A;  1JZ2 A;  2VMC A;  3A23 A;  3IAQ A;  3NJV A;  2KD7 A;  1TVG A;  4FI9 A;  3OGV A;  4XUT A;  2W46 A;  3WNO A;  3SEP A;  1K3I A;  1UWW A;  3HN3 A;  1UY3 A;  4DEV A;  2WAA A;  2XHN A;  1UY2 A;  3I2F A;  1O8S A;  4GZ9 A;  2BGO A;  4KMQ A;  3UET A;  4MOA A;  1US2 A;  5G04 L;  3T2Q A;  1BHG A;  2QQN A;  3WF0 A;  3ETP A;  1NX9 A;  3HNY M;  3I2H A;  2EIC A;  1JZ3 A;  4PT6 A;  4JKL A;  2YFU A;  3I3D A;  3MV1 1;  4BXS V;  1W8O A;  3ECQ A;  4L0P A;  1ULO A;  3SKJ E;  2W94 A;  4BJ0 A;  3IDA A;  4QX2 A;  3HNB M;  3MUZ 1;  3WQB A;  2B4K A;  2VZ1 A;  4CUB A;  2VZQ A;  5I0D A;  3OBA A;  1L7R A;  1NKG A;  4MGS A;  5HPO A;  3CZJ A;  5JR2 A;  3W5M A;  2Y6J A;  2JKX A;  1JU3 A;  1UY1 A;  2WDB A;  4A3Z A;  4DUW A;  4GWJ A;  3WNK A;  5IYY A;  4UAP A;  4XZU G;  1UY0 A;  4ZY9 A;  1GMM A;  1JZ4 A;  2XQX A;  2ZXQ A;  5DN2 A;  2DCK A;  4QDQ A;  3HJR A;  2JD9 A;  2WZ8 A;  2X09 A;  4P02 B;  3K4Z A;  4KWU A;  4JX0 A;  1IQD C;  2X10 A;  3WEZ A;  4M4P A;  5F7U A;  2HYX A;  3WF2 A;  2VMD A;  2J1T A;  1JZ6 A;  1DP0 A;  2YC4 A;  2EIB A;  3III A;  3J7H A;  3BGA A;  1F4H A;  3UNP A;  1OD3 A;  2L9L A;  3ACF A;  3ACI A;  2VTF A;  1XNA A;  3WNN A;  4ZZ5 A;  5JXJ A;  3VD7 A;  2DCJ A;  3WNM A;  2Y64 A;  4D8M A;  2VZR A;  3MUY 1;  4MO3 M;  3HOB A;  2EIE A;  3ACG A;  3ZM8 A;  4DEQ A;  1H6Y A;  2BBA A;  3CDZ B;  3DYM A;  4AAX A;  5DPN A;  3T0D A;  4OYU A;  4TTG A;  2V5D A;  1JYX A;  2B9V A;  4LHS A;  4DXR A;  3LQC A;  3EYP A;  2VO5 A;  4CVU A;  2VZP A;  4ARY A;  1CZS A;  2J1U A;  2VJX A;  3WNP A;  2C4X A;  2C26 A;  4QDR A;  2WO3 A;  3ABZ A;  1W0N A;  1GOG A;  5CYY A;  5JUV A;  2W5F A;  1XC6 A;  4ZXE A;  1JZ5 A;  2W1S A; 
#chains in the Genus database with same CATH topology
 2WZR 3;  3O1M A;  1EPZ A;  2HLE A;  3H1M A;  4CDX C;  1Y43 B;  4JRA A;  3RFR A;  4XC9 A;  1JYI A;  3MIG A;  3GHN A;  4NWW A;  5F39 A;  3I2J A;  1AR9 2;  1HIX A;  4UOJ A;  2SBA A;  1OPM A;  3IMM A;  4F3J A;  4NAO A;  4FPC A;  2CDO A;  4CXX A;  4DPN A;  1Q56 A;  2RS3 1;  1PZ9 A;  2V5Y A;  3WG4 A;  5A1A A;  5FPX A;  1BVP 1;  5J96 B;  1LKN A;  3MFA A;  3ES4 A;  2AH2 A;  4XHB A;  5FLI A;  1IKQ A;  1W2N A;  5SV8 A;  2XG3 A;  5D1I A;  3M7A A;  2PHR A;  3JU9 A;  4QB6 A;  4QQ2 A;  4R8H A;  1LHW A;  1Z7S 3;  4XOG A;  1AR8 3;  2OZJ A;  3E6D A;  5DUW A;  4B1M A;  3TEW A;  4RR3 C;  3GJA A;  4X6Q B;  4WVM A;  5CG9 A;  2JIC A;  2P6H A;  2CHH A;  1BBT 1;  4EZ4 A;  1W9F A;  4MGY E;  1QH6 A;  3L9J T;  5KHH A;  2C9A A;  1ZZ9 A;  2Y8K A;  4RFR B;  3WUD A;  2AEZ A;  2CY6 A;  2IXI A;  2MEV 3;  1WWY A;  5FTT C;  1ZNP A;  4OMD A;  4ET7 A;  2BGC A;  3B93 A;  5DAP A;  4IQP A;  1C8N A;  1IG0 A;  3USU A;  5EWS A;  1ZBE 3;  5F1R A;  1C5H A;  1IS4 A;  4BWO A;  3ZPO A;  1I3H A;  5I91 A;  1G9F A;  4MH0 E;  1FX5 A;  2VZ3 A;  3WVJ A;  3ZFG C;  1HQW A;  4AI8 A;  1NY7 2;  4LUL A;  4QGN A;  1XYP A;  5EXO A;  1W04 A;  1TME 2;  1TEI A;  4CDQ A;  2VMG A;  1PMH X;  2D44 A;  5F5Q A;  2PQS A;  4FXG B;  3DPR C;  1W2T A;  2E26 A;  5DG1 A;  1C3H A;  3LE0 A;  5J98 B;  4IEQ A;  1D4M 2;  3NQH A;  1PVC 3;  1RUD 3;  2R07 3;  2Y6K A;  4LOR A;  4M3C B;  1S0E A;  1O8P A;  1KEX A;  4C90 A;  1W6M B;  4YW6 A;  3IDE A;  1GZC A;  4FFI A;  1OUR A;  1SLC A;  5AFE A;  4M01 A;  4P5Y A;  4XAB A;  3ZDS A;  3FUQ A;  5JCT A;  4QX1 A;  3UK9 A;  4B4P A;  3WQ7 A;  3FLR A;  3KGZ A;  2XL7 A;  4I01 A;  2EVX A;  4P9L A;  2EA7 A;  4BK4 A;  5A6Y A;  5KXD A;  1TG7 A;  4LKD A;  1NQJ A;  4PBP A;  1V9U 1;  5DDJ 1;  5I0R A;  3VD5 A;  3ZOI A;  2ZGQ A;  1VMH A;  3KM5 A;  4JKK A;  5EJ3 A;  4CTE A;  2WQ4 A;  3VDB A;  4YZ3 A;  4O9G A;  1Y4W A;  4OHW A;  2EXH A;  1SLA A;  1FAT A;  2XLA A;  5A6Z A;  2VUD A;  3SH5 A;  3K48 A;  5L9V A;  4LQR A;  2F17 A;  3BPS A;  4QX0 A;  1AR9 3;  4ES8 A;  3H9A A;  2EAA A;  5LY1 A;  4XBL A;  4CUG A;  2PEL A;  3VBU A;  3A22 A;  3PUH A;  4NAM A;  1PMI A;  2Q1F A;  3PNA A;  2Q30 A;  3M3O A;  3WSO A;  1NQD A;  3BKZ A;  4OI1 A;  2A3W A;  3VL8 A;  4IV3 A;  4KU7 A;  4ES9 A;  1GWK A;  5A7W B;  4CDU A;  1V70 A;  3AVS A;  5T55 A;  4EQV A;  5FO9 B;  4D0Q A;  4XFC A;  5A3L A;  3M1H A;  1QOT A;  1SFY A;  3RGB A;  1ND2 A;  2VCA A;  3ILR A;  4O65 A;  5FUN A;  2YBK A;  3BCW A;  3Q8E A;  4L8Q A;  3Q8B A;  5CFC B;  1MQT C;  1V6M A;  3OEB A;  4JQT A;  3LCP A;  4OCT A;  1YHF A;  2P3I A;  1VBD 1;  4AAP A;  5K4L A;  2W3J A;  2AR6 A;  1J83 A;  1GFF 2;  4HLT A;  4N9I A;  4JTN A;  2W47 A;  3ZXE A;  3LEI A;  3V64 A;  3U4S A;  3G7D A;  2XWB B;  3FFZ A;  1G9A A;  3WDV A;  1HX6 A;  4NVP A;  1Q8O A;  1QXR A;  3E6B A;  1QEX A;  3DYO A;  2HWB 2;  2D6N A;  4Z8B A;  5IAT A;  5KWR A;  3WXP A;  2ZMK A;  5LZ6 A;  1CAU B;  5T5O A;  1K42 A;  4K20 A;  3WF3 A;  4ARX A;  1BXH A;  4Q4W 2;  4OUS A;  1RB8 G;  2IXJ A;  5JOY A;  2D3P A;  1LEN A;  1WLW A;  2WWU A;  2WYS A;  5E16 A;  4YZ4 A;  2YBS A;  1RUI 2;  4Y5S A;  5K8S A;  4CP0 A;  2BNO A;  2VCM A;  2VOV A;  3O1U A;  4XTM A;  4Q8L A;  1BBT 2;  2A3Y A;  2PHT A;  1H9W A;  2UYA A;  4M4R A;  4YM0 A;  5IVB A;  2WN2 A;  1SLI A;  3VKF C;  1RVF 2;  3O0X A;  4LIU A;  1UY4 A;  1YIP A;  3GXU A;  1EAH 2;  3LDB A;  2B46 X;  5D21 A;  1MS5 A;  3LD8 A;  2ZGN A;  4BQ4 A;  2JDY A;  3POW A;  4XDO A;  4OQ8 A;  1QJY 3;  4RQP B;  3VBR A;  4JRL A;  5C9A B;  2P6C A;  3LWC A;  4WM8 A;  2X5I A;  1VB2 A;  2W1Q A;  3ROU A;  1NYW A;  4KWL A;  5EJ1 B;  3K2O A;  3RI8 A;  3H1Y A;  3WG2 A;  1OF4 A;  2FZ1 A;  4YW7 A;  3B3Q E;  4NUB A;  2K2S A;  3EMR A;  3IDC B;  3S7I A;  3VBS A;  5GZE A;  5CFC C;  1F8V A;  1ZZC A;  3FBY A;  2JJ6 A;  3AP4 A;  2E32 A;  1QIQ A;  2UY9 A;  3VL9 A;  2VZS A;  5DZG A;  3HPN A;  4AZZ A;  3ZXF A;  4KGG A;  2PXJ A;  4IER A;  1IGO A;  1WA6 X;  4LBQ B;  3O1V A;  2QQM A;  1DYO A;  5C71 A;  4YM2 A;  3N7J A;  4Y33 A;  2Q8O A;  3PUI A;  4AHZ A;  3CQO A;  3ZYJ B;  3UJO A;  4LIT A;  1IPS A;  5DZE A;  1YEW A;  5E88 A;  3LDK A;  2BFU S;  2VQ0 A;  4I0W B;  5A3P A;  5H9S A;  2J1V A;  4OI4 A;  3N9P A;  3ZPY A;  1W6Q B;  1FV2 A;  2W87 A;  4PJY A;  4ASK A;  4XFF A;  3BAL A;  4CCD A;  1KFX L;  2PN5 A;  1SQ4 A;  1I9R A;  2D93 A;  2VZV A;  5FZO B;  2QBX A;  3AYE A;  4XAC A;  5FP8 A;  3U75 A;  3V65 A;  4LNV A;  1JTZ X;  1OBN A;  3ALQ A;  2VUC A;  3TB0 A;  4CU8 A;  1DU3 D;  2E6V A;  4MHR A;  1XNK A;  2ZZJ A;  2D97 A;  2RS3 3;  3N9M A;  4YFZ A;  4EJR A;  4XFB A;  4O9E A;  2ET7 A;  4RQP C;  5LBC A;  5C9A C;  3URF A;  3OPZ A;  2HWB 3;  2JWP A;  3CJI B;  3RZZ A;  4FOW A;  2ZX1 A;  3HNM A;  5ABJ B;  2WKK A;  1ZBA 2;  4FO9 A;  1APN A;  3KCY A;  4YVS B;  4K8R B;  1S0F A;  2ARA A;  3Q8C A;  2J42 A;  1IS3 A;  3UKT A;  3D5O A;  4FCA A;  4ZS3 A;  3FJS A;  4QM8 A;  3PHM A;  1FMD 1;  1BBT 3;  2ZEZ A;  5K0U B;  2VPV A;  3TNP B;  1RXG A;  1RVF 3;  2B7Y A;  2DCZ A;  1W9W A;  3LFI A;  1EAH 3;  3V0B B;  2G1M A;  5JPN B;  2XHK A;  3VBH A;  5FP9 A;  1OH4 A;  5GAL A;  2JE8 A;  1X36 A;  1YI9 A;  1AF9 A;  4IET A;  2QDR A;  1ZZ7 A;  1VBB 2;  3VBH B;  3CHX A;  4ZU7 A;  5IT6 A;  3ZR5 A;  1RJ8 A;  3RSJ A;  1UX6 A;  1RUG 1;  3IPV B;  3AX4 A;  2ADD A;  2ZGO A;  3UGF A;  4AR2 A;  5C4W B;  2HBT A;  2WQZ C;  3N9L A;  4GWN A;  4OZO A;  5FQ0 B;  2VD7 A;  4W6W A;  3O5S A;  1IPK A;  1SHW B;  2XL9 A;  3KV5 A;  1MEC 2;  3VBU B;  4Z07 A;  2A6V A;  3IM0 A;  4NJ4 A;  3WDX A;  1FPN 2;  2OPW A;  2VBB A;  1VJ2 A;  4FPF A;  4YW4 A;  2BUK A;  3PUA A;  3EJK A;  1MR5 A;  1P8J A;  5AC9 2;  2VZO A;  3CLP A;  3GYD A;  3MHZ A;  1EV1 2;  3R4U A;  2ZZQ A;  4IEP A;  5C8C B;  2XR4 A;  5DZF A;  2D43 A;  1F35 A;  5AFB A;  4P9W A;  3CJI C;  3DEC A;  3KS7 A;  5JXI A;  5ABJ C;  2F6B A;  2KA3 A;  3OBZ A;  5JIA A;  4CSW A;  1PGL 1;  4XJ8 A;  2PFW A;  4YVS C;  5H9P A;  1N1T A;  4NHY A;  4DQA A;  3I2I A;  3MPB A;  3I2K A;  1MS8 A;  2RE9 A;  5LA2 A;  5JZG A;  3EHK A;  2RVA A;  4NHM A;  3INA A;  4HN1 A;  4RHV 2;  2YHJ A;  5KXC A;  3N9O A;  1MPX A;  2Z69 A;  1DHK B;  1QJZ A;  1XSR A;  2ZAB A;  1LTE A;  4WM7 A;  4BK5 A;  2J1E A;  2VOW A;  4RSU A;  5K0U C;  1CAW A;  1GBG A;  1JOJ A;  4L97 A;  5CIS A;  2IXL A;  1C4R A;  2K0G A;  3GCW A;  2RJL A;  4M0N A;  4MGK E;  1OI6 A;  1QU0 A;  2P17 A;  1ZM1 A;  2RDR A;  2Z79 A;  3VLB B;  4HT1 T;  5AVA A;  4LO4 B;  4AHY A;  1RC6 A;  3R4S A;  1XE0 A;  3T09 A;  3OUJ A;  4AQS A;  4QX5 A;  4FPK A;  4HSJ A;  3WP5 A;  1LJ7 A;  1K5M B;  1GQP A;  3MID A;  3O1T A;  5C4W C;  4QKB A;  3ZXJ A;  2DVB A;  3RMX A;  3LIH A;  3NJV A;  4GQ7 A;  4YWA A;  1TVG A;  1NE4 A;  2A1X A;  2C1F A;  2VXR A;  1BEV 2;  2QE3 A;  2W46 A;  5J3U A;  1ASJ 1;  5JDB A;  1G9B A;  1WCK A;  3AP9 A;  3BYW A;  1T6G C;  3DL3 A;  4O7X A;  4PI0 A;  3RWN A;  3SNM A;  3SEP A;  3WNO A;  4Y1Z A;  5FBJ A;  2HWD 1;  1VBD 3;  1Z78 A;  5EHD A;  4E4Z A;  1EY2 A;  1HXS 1;  4X8P A;  5C3R A;  2BGO A;  2YMZ A;  4ZU5 A;  2RM2 1;  4MOA A;  1GNZ A;  2ZGU A;  5G04 L;  3T2Q A;  4AI1 A;  3WF0 A;  2WSV A;  1AX0 A;  1RUF 1;  3POI A;  1AYM 2;  5BNO B;  4H7L A;  3ZSJ A;  3KWV A;  4XQ4 A;  4PT6 A;  4MXW A;  5DAQ A;  2RS1 1;  4IGO A;  1VBB 3;  4NPM A;  2UWA A;  4AED B;  3J8F 2;  4PIZ A;  4YSF A;  5BXX A;  2JKB A;  3H0O A;  3RZL A;  3ECQ A;  3A4U A;  1QY4 A;  2VGD A;  3SKJ E;  5CFD B;  4QX2 A;  1HRV 1;  2GND A;  4LO7 A;  4CEY C;  2RR1 1;  2B4K A;  2VZ1 A;  1F9K A;  1UPI A;  2YBP A;  3PVN A;  5FK7 A;  3POB A;  4MYE A;  1GZ9 A;  2FCT A;  1QJF A;  1SZB A;  1YQ6 A;  3H42 B;  5FZG A;  5JPM B;  3KQR A;  4ZHN A;  3O1S A;  1FPN 3;  1SPP A;  4U36 A;  5FZL A;  1X82 A;  1TMF 2;  4RR3 A;  1PK6 A;  4DY3 A;  3VN4 A;  3AXE A;  3AMP A;  5AC9 3;  2ET1 A;  2BVV A;  5JSR A;  4ONU A;  5IYY A;  3JCI A;  3GBW A;  3OJB A;  1O3S A;  3UL2 A;  1K5M C;  2LRP A;  4H55 A;  4GXL A;  3BTZ A;  1NLS A;  3NV1 A;  4OFG A;  5IAV A;  1GMM A;  1OLQ A;  3B7M A;  3WDT A;  5JMC A;  1YXW A;  3OD0 A;  5JR7 B;  2ZAC A;  3CL1 A;  1DFQ A;  3MEP A;  2DCK A;  3SH4 A;  1UIJ A;  3MIB A;  2X09 A;  2OXB A;  3I59 A;  1CAV B;  1JYC A;  4LKE A;  1R09 1;  5JI7 A;  4JX0 A;  3WEZ A;  2CU5 A;  3FHI B;  4HKL A;  1V6O A;  2I07 B;  5EQU A;  3DPR A;  1KIT A;  5BNO C;  2QTW B;  3ZSM A;  2Y6F A;  3KCC A;  4D94 A;  4BM8 A;  2WFF 1;  2VNV A;  1RMU 2;  3MFC A;  1PZ7 A;  4LOS A;  5I0T A;  1J58 A;  4B7E A;  5FK8 A;  4BYY A;  2RDS A;  1IZ3 A;  1DP0 A;  2YC4 A;  2EIB A;  4AED C;  4XF1 A;  3S30 A;  1L3J A;  2JDM A;  2WA4 A;  3R05 A;  5FOB B;  1F5F A;  1Q3E A;  2H6C A;  4WV8 A;  3WCR A;  1BEV 3;  1AL2 2;  1XNB A;  2D40 A;  4N53 B;  5H9R A;  3APB A;  4QHO A;  2DCJ A;  3RDI A;  2VZR A;  4QQL A;  4NOT A;  1ODM A;  5LK7 B;  3RRD A;  4EN0 A;  2WYF A;  2XH6 A;  4MO3 M;  1AYN 2;  2ES3 A;  2W68 A;  1BK0 A;  3PVO A;  5A33 A;  1JOD A;  1HRI 2;  1OC1 A;  2QZ2 A;  3JQX A;  3ZM8 A;  1H6Y A;  4AFA A;  3T4V A;  2BBA A;  1ZZ6 A;  4IE6 A;  2CAV A;  4TTG A;  2JDU A;  2JG8 C;  3VHP A;  3D4K A;  4LHS A;  4V1P A;  2E7Q A;  3O1P A;  2VO5 A;  3ZYG A;  3RZJ A;  3AZX A;  3TNQ A;  2WSU A;  2Y34 A;  2MNG A;  3VDD B;  5A3T A;  4YGB A;  3CEW A;  2IXK A;  3GZT B;  4XIL A;  4AGR A;  2C26 A;  2ZGR A;  3A0N A;  4A7Y A;  5JVV A;  1R08 2;  1VBA 1;  2BTV C;  5JUV A;  3F95 A;  4IV1 B;  3RYK A;  5GKA C;  3SCF A;  4NHL A;  4HON A;  5BNP A;  1FMD 3;  1V6L A;  4BQW A;  4AFD A;  1LHV A;  4HPK A;  1YI7 A;  1RHI 1;  2GME A;  2WNV B;  4PF5 A;  1OD5 A;  1MQT A;  1WD4 A;  4OHV A;  4XJW A;  2Q4S A;  2ZHK A;  1RUO A;  1OKQ A;  1MS3 A;  3DEM A;  5IVV A;  4RL7 A;  2ZGT A;  2GC1 A;  3EB7 A;  4R52 A;  1LNS A;  4EN8 B;  2E63 A;  4FP2 A;  4HFS A;  2BFU L;  4IW3 A;  1DGL A;  1RUG 3;  1W8F A;  3OGJ A;  1XPW A;  5F3C A;  3NAP B;  1ULD A;  2QQJ A;  5JOX A;  3E6C C;  4AK3 A;  4MAD A;  1OXC A;  3MDP A;  4PCR A;  4N53 C;  4P14 A;  4XTP A;  2F4P A;  3Q8F A;  3MLJ A;  4ZS2 A;  3SC7 X;  1PM4 A;  2ZJC A;  1AJO A;  1W2A X;  4XIK A;  5LBE A;  2B39 A;  1VRH 2;  2C6S A;  4YW3 A;  3GZA A;  2D3S A;  2OZ6 A;  2JDN A;  3OYW B;  4A41 A;  2WJS A;  4DOU A;  4S2F A;  3B5L B;  3D6E A;  3OG2 A;  1GSL A;  3HN1 A;  5LA9 A;  1UN1 A;  1V6J A;  1BJQ A;  2NZ9 A;  2BER A;  3MW3 A;  2UY8 A;  4H3W A;  4UWD A;  3VDD C;  5LW9 A;  3PIJ A;  1ZRI A;  3VZJ A;  4LJH A;  5C8W A;  2W39 A;  3IBM A;  3K75 B;  2RS5 1;  1KQR A;  4D6R A;  1XNC A;  5A7W A;  5ISL A;  2E7A A;  1DLC A;  2IXC A;  4IV1 C;  1JZ8 A;  4CEW A;  1OMI A;  3LSE A;  2WZR 2;  3MIF A;  1OSG A;  1QOO A;  4LPL A;  2Y6L A;  2WNV C;  1UMZ A;  3W9A A;  1WBF A;  1R1A 2;  3UGH A;  3ZMN A;  5FUI A;  1OLR A;  4XET A;  1SLB A;  2WZE A;  4CP2 A;  1GWL A;  3ZFF C;  2VH9 A;  1LGC A;  3OD4 A;  1SCS A;  2FZ2 A;  2ARX A;  3KB5 A;  2P3J A;  3AYD A;  4RS5 B;  5FCC A;  1IS6 A;  1S2B A;  3RS6 A;  3ZSL A;  4BH9 A;  1POV 1;  1YYN A;  4D69 A;  1F15 A;  3WW3 A;  2WT0 A;  1YQ8 A;  1VR3 A;  1W2O A;  3FFQ A;  3KSC A;  1XXN A;  5A32 B;  3LEM A;  4YW5 A;  4QB1 A;  1ASJ 3;  2VOT A;  2YYO A;  2DCY A;  3LEK A;  4L11 A;  2JD4 A;  5CU1 A;  3TN9 1;  4UFK A;  2Y6G A;  3OTF A;  2HWD 3;  2WO1 A;  3GAL A;  1S1A A;  3JBG 2;  3M3E A;  4NHX A;  2WT1 A;  1LOE A;  4RGG A;  4IL7 A;  1JI6 A;  1JZ7 A;  1A6C A;  1HXS 3;  1VBC 1;  4YM1 A;  2GZW A;  1BYH A;  4AFC A;  4XF0 A;  1HW5 A;  1QJX 2;  4X8N A;  5LRR A;  4Q0S A;  3FHA A;  1ZYB A;  5CZK A;  3GZE A;  3IT8 A;  3WF4 A;  4JTO A;  5FYY A;  1TE1 B;  4IE4 A;  2RS1 3;  1W28 A;  1UAI A;  1FT9 A;  2WC2 A;  2WT2 A;  5IAX A;  3MV0 1;  5FZ8 A;  1JYW A;  4OLL A;  5T5L A;  5FWE A;  5FYH A;  3VGI A;  1DQ0 A;  3SHR A;  2A73 B;  1AL0 G;  2AEN A;  1EP0 A;  4RQP A;  3THT A;  5C9A A;  5CBL A;  1GP6 A;  2CGO A;  4QM9 A;  1NT0 A;  4EV0 A;  1HRV 3;  2BOJ A;  4CRQ A;  2CWS A;  2BU9 A;  3R4D B;  1JOP A;  1ENR A;  2BWA A;  1ENS A;  2W92 A;  1LGN A;  1YCI A;  1AHS A;  1AR7 1;  4L2N A;  4M3C F;  5FY0 A;  1VRH 3;  4DRR A;  1CJD A;  3ATG A;  3KGL A;  4LO8 A;  4MLO A;  1ZX5 A;  4XAE A;  1LES A;  1WKY A;  1XYN A;  1LCL A;  3NKT A;  3USS A;  3QH6 A;  4RS5 C;  1Q8S A;  4XUP A;  5C3P A;  4KBZ A;  2GMM A;  2OVU A;  3R6S A;  4MGZ E;  3WDW A;  3SH3 A;  4E4H A;  5FKB A;  1H1M A;  1FXZ A;  3KT4 A;  3OGG A;  2AUY A;  1RUJ 2;  4IEU A;  2E53 A;  1CIY A;  1W6P B;  1WCD J;  1S4C A;  2R04 2;  4I30 A;  1UU6 A;  1HQN A;  1CZV A;  4NRO A;  4HKO A;  1AZD A;  1W8U A;  4Z2A A;  5J09 A;  1E5H A;  5JAX A;  2WWJ A;  1B35 B;  1R09 3;  1BZW A;  1QWR A;  4ZU4 A;  3MIE A;  1R1A 3;  3AL5 A;  4LBQ D;  1PO1 2;  5FXW A;  3TEX A;  4AL9 A;  5BV6 A;  5L36 A;  1C57 A;  3T0B A;  1AX1 A;  1KRI A;  3PIG A;  4E8C A;  4Y26 A;  1Y9Q A;  5B4X A;  2VL4 A;  4YZ2 A;  1ZRD A;  3KVA A;  2C0Z A;  2DDU A;  3AP5 A;  4KU8 A;  1SMV A;  4XDQ A;  1HLC A;  2QFE A;  3ZXK A;  1LU1 A;  1S0C A;  1UXX X;  1WCU A;  5GLV A;  2RDQ A;  3M2M A;  2PAK A;  1KDK A;  5IWF A;  3I3E A;  2HEV F;  3BU7 A;  3GF6 A;  3D8C A;  4DXS A;  4GMP 1;  5FYI A;  3VZN A;  1UZW A;  3CIH A;  2BNM A;  3M3I A;  3T3Y A;  4EN7 B;  3HAG A;  1AX2 A;  3JBG 3;  3CU7 A;  4YRD A;  2EF6 A;  2NPI A;  4XHX A;  3FC0 A;  2VNR A;  3DF0 A;  4JC1 A;  1GQG A;  1QXJ A;  1XU2 A;  2Y38 A;  4A42 A;  1QJX 3;  1HB3 A;  1NOV A;  2NN8 A;  2JG9 B;  3ACH A;  3MO4 A;  5M0T A;  1RUC 2;  1OUS A;  4FTS A;  4MSV A;  4V2V A;  4AHW A;  2FMD A;  4S2D A;  1BVV A;  1NA1 B;  3T1L A;  4DMI A;  2GNB A;  5JI9 A;  5IW0 A;  5FKC A;  4XXA A;  5FPA A;  4CU6 A;  2EAL A;  5GLT A;  2A6X A;  3IPV A;  4IES A;  4LBL A;  5BNN B;  5IJR A;  3VBO B;  3CO2 A;  5HXM A;  4YNI A;  1JN2 P;  1B35 C;  4FXK B;  4HG6 B;  1J59 A;  4R4Z A;  4W6X A;  4LKS A;  1UOJ A;  3QD6 A;  1JW6 A;  1YC6 1;  2ZGP A;  1ODN A;  1L7Q A;  1W2U A;  4JGY A;  4RGK A;  5F6L B;  3I3M A;  3BU0 A;  1RJ7 A;  5IHR A;  1SFP A;  1ULC A;  2H0B A;  2QQL A;  4YGE A;  1WZX A;  1OH3 A;  5D8A A;  3VDA A;  4LHN A;  2F4L A;  2W2I A;  4XUO A;  2BQP A;  5LEK A;  2W1W A;  2YV8 A;  1GZW B;  1BCX A;  3TOJ A;  1S2E A;  1QJY 2;  2BBV A;  4KG8 A;  4S2H A;  4D7T A;  2WA3 A;  1RUJ 3;  3IDB B;  3OEA A;  4QMA A;  3ZN6 B;  2GNM A;  1C8M 2;  3BIW E;  4MGQ A;  4UFI A;  3MF6 A;  2R04 3;  3TRS B;  3IKW A;  1REF A;  1WW7 A;  4I0B A;  3HBK A;  3VKM A;  3AFG A;  1W6N B;  5BYN A;  5JOZ A;  1VMF A;  4AI0 A;  1AR7 2;  2HWC 1;  2VW0 A;  3QLQ A;  4KI5 M;  4CEY A;  4Y20 B;  2EXJ A;  4A4A A;  1CIW A;  1PO1 3;  4DZG A;  2CWM A;  2RMU 1;  1OFN A;  1PM7 A;  5ERL A;  1HV1 A;  4QKD A;  4COU A;  2BYV E;  1US3 A;  4I0A A;  4IE5 A;  1I5P A;  1O3R A;  2OX0 A;  2YDE A;  5E8A A;  4AI9 A;  1W8T A;  2A6Z A;  2ZAA A;  4J1X A;  5IVF A;  4XFA A;  2ID4 A;  1UOG A;  4PDW B;  3M70 A;  1XSQ A;  1NA1 C;  1W3X A;  3AVR A;  2R0F A;  4JV4 A;  1LAJ A;  1UKR A;  5FRE A;  5B4N A;  2GN7 A;  4XFG A;  4ASL A;  4MVT A;  2HWF 1;  4URT A;  4K40 A;  3K3O A;  4QXC A;  4UW6 A;  2Q1Z B;  3GGL A;  1GOF A;  4TN7 A;  1V6K A;  3ON7 A;  1CR7 A;  1K5M A;  4CPB D;  1NXM A;  3NRU A;  2JX9 A;  1N1S A;  5HCF A;  4Q4X 2;  3ZYI B;  3S0M A;  3VD4 A;  5IVY A;  2WR9 A;  4C0B A;  5ANN A;  1KXG A;  2W0X A;  2DUR A;  1SBD A;  1RUN A;  2ARC A;  4XQD A;  2FMY A;  1LOA A;  3C8X A;  4MX3 A;  1G6N A;  3BOW A;  3LPG A;  3D3A A;  4KQ7 A;  1CON A;  1CAX B;  1KS5 A;  2RS3 2;  1POV 3;  1RUC 3;  1H6X A;  4ZKT B;  3CKH A;  4N43 B;  2BZD A;  3MYX A;  3WHU A;  1J3P A;  4IND A;  2WQ8 A;  1EUU A;  1MVQ A;  1JXN A;  4XF3 A;  4AFM A;  1I5Z A;  5JOW A;  5KC6 A;  4PI2 A;  1FI2 A;  1J84 A;  2JDK A;  4FT8 A;  3UES A;  5C3Q A;  4F7Z A;  3FMG A;  1SFN A;  3DXT A;  3NST A;  4Q0V A;  4Q4V 1;  3N9N A;  4YG3 A;  3B02 A;  3I3Q A;  4CP9 A;  4ORF A;  4TYS A;  2UUR A;  3HT1 A;  3K3N A;  3MF9 A;  3TN9 3;  5FOJ B;  3I97 A;  4TZD A;  3N4M A;  1GNH A;  1LEC A;  3NV2 A;  1VBC 3;  3OY8 B;  5FZ3 A;  1JH5 A;  4YGC A;  5FYS A;  1TNF A;  3GBG A;  4KH9 A;  2WNU B;  2XOM A;  5FZM A;  5HCB A;  4AVS A;  1WUV A;  1JOB A;  3M4F A;  3UJQ A;  4Y22 B;  2AC1 A;  4QGL A;  3W5N A;  1YFU A;  1MAC A;  1D0G A;  2X53 S;  3NJY A;  4AVT A;  4BU2 A;  5BNQ A;  5KHJ A;  5C6C A;  4XJA A;  1GLH A;  4PDW C;  2Q8D A;  3I49 A;  4XFH A;  3T2T A;  1OOP A;  2JG8 A;  4FFH A;  3AMM A;  1NCR B;  1X33 A;  3ZFE B;  3IB3 A;  5T50 A;  4MG2 A;  1C8M 3;  2D3R A;  1LOC A;  2NQY A;  2RDN A;  4NPR A;  4QHZ A;  4PBO A;  3N36 A;  2FBE A;  1J1L A;  2TNF A;  5J36 A;  1JZ2 A;  2OYZ A;  2WLP A;  4HSL A;  2KD7 A;  3ASI A;  5F2W A;  1VAV A;  3OGV A;  1AR7 3;  1N3Q A;  1FNZ A;  4JZR A;  5A7Q A;  4P9G A;  1UWW A;  2RHP A;  3SMH A;  4DEV A;  4NRQ A;  4CP1 A;  2BV4 A;  1PIV 1;  1TNR A;  1UY2 A;  4GH4 B;  4QT6 A;  3HVD A;  3N7K A;  4GZ9 A;  4AGG A;  4N43 C;  2GNT A;  4N9H A;  1D2S A;  3UET A;  1LHU A;  2N7G A;  3P3N A;  5IK8 A;  1CJP A;  3ZSK A;  1GYK A;  4QXH A;  5I0S A;  3ETP A;  1NX9 A;  2XBO 1;  3HMY A;  2C24 A;  1UF2 C;  4BQX A;  3DN7 A;  1JZ3 A;  5HXV A;  1RIN A;  2A6W A;  3LOB A;  2OUH A;  1V9U 2;  5DDJ 2;  1O6U A;  1OLM A;  1POV 0;  4Q4X 3;  3VZO A;  4L9B A;  5TSW A;  2R06 1;  3B9C A;  4XJZ A;  4BXS V;  1O3T A;  4XMI A;  1W8O A;  4COZ A;  3AJZ A;  1AXZ A;  4OZX A;  4LK6 A;  4BJ0 A;  1PVX A;  2WNU C;  2WZP P;  3BTX A;  3U10 A;  1OVS A;  5GLW A;  3WR0 A;  1U0A A;  2ZAH A;  2G4I A;  4Y1V A;  4DB5 A;  1POQ A;  4K1Y A;  1JMU B;  5T3N A;  3HQU A;  3OBA A;  4WVV A;  2D6O X;  2HH9 A;  1L7R A;  4YYO A;  3GCX A;  2EXI A;  4OI2 A;  2XJQ A;  1QH7 A;  3CZJ A;  5JR2 A;  2Y6J A;  2JKX A;  3W5M A;  2WDB A;  1NCR C;  3RJR A;  1U5X A;  1BLZ A;  4NPL A;  5GJ6 A;  4CDW B;  2GSY A;  1Z0H A;  4UAP A;  4BQY A;  4L99 A;  1F2N A;  1VIW B;  3H7J A;  4GMP 3;  4AQT A;  2D6L X;  4E9K A;  3KLS A;  2JIJ A;  3NMB A;  4DIQ A;  3O12 A;  2A5Z A;  2YC0 A;  2ZKN A;  5IK5 A;  2XQX A;  2EXK A;  5LWB A;  1VBD 2;  1VPH A;  3I54 A;  2X8K A;  4Y3O A;  4J1W A;  4ERO A;  3JD7 1;  2IFR A;  2Q8E A;  4KWU A;  2BRT A;  5FYT A;  4CXW A;  5ACA 1;  4M4P A;  1JS9 A;  1AVB A;  3RZK A;  2XVG A;  1HB4 A;  3J26 N;  4YFW A;  3WZ1 A;  3ZFF A;  5IVC A;  1I1E A;  2R49 A;  3WF2 A;  2V73 A;  5C3S A;  3I2O A;  4BLI A;  1HB1 A;  4BZ4 A;  4KG0 A;  4Q4V 2;  4UXA A;  4AEK A;  4IEW A;  3WP6 A;  2YUE A;  3KCX A;  4WVM B;  1A34 A;  2ZGL A;  3BOD A;  1LOF C;  4NWV A;  1OQD A;  3J7H A;  1F4H A;  1H2M A;  3VHR A;  2ZHL A;  4M00 A;  2PMW B;  2VE1 A;  4BE3 A;  4B7K A;  4EZH A;  2ZX0 A;  3VKN A;  1RGS A;  4Y4Y A;  1YIF A;  2L9L A;  1S0B A;  2HEW F;  3ACF A;  2VTF A;  3ACI A;  3PUQ A;  4ZZ5 A;  5E1R A;  5A3M A;  3LFM A;  2VQA A;  3PUS A;  4NIH A;  3AXD A;  4YVW A;  2Y64 A;  3B9I A;  4IEY A;  5FZI A;  3WNM A;  1D0H A;  5CVR A;  4PIY A;  3WT3 A;  4TLG A;  5FXV A;  3PME A;  3HOB A;  4UW3 A;  4GB3 1;  3ACG A;  4DEQ A;  1H30 A;  3W21 A;  2X29 A;  3POJ A;  3LOI A;  3ZXG A;  4DO0 A;  1W0O A;  2VNG A;  4CDW C;  4XMA A;  4CDQ B;  2FDF A;  3HIF A;  3HD8 B;  1MZF A;  4CVU A;  1V9U 3;  5DDJ 3;  1IS5 A;  1LHN A;  2VZP A;  1CZS A;  1QQP 1;  2GH8 A;  2YU2 A;  2VJX A;  5HCH A;  1MS1 A;  2HWC 3;  2WO3 A;  1DDL A;  3ABZ A;  5FYC A;  2VTX A;  4AI2 A;  2HWE 1;  5KBF A;  4K9S A;  1RXF A;  4GMP 0;  4QQH A;  4FOQ A;  4ZXE A;  4NR1 A;  4QPI A;  3ZXA C;  3SXW A;  3ZYR A;  2W1S A;  3ILF A;  4LEJ A;  3AKS A;  1J3Q A;  1C28 A;  1DQ5 A;  3AMN A;  1O4Z A;  2WAB A;  1IHM A;  1PNF A;  2HWF 3;  5HV0 A;  2XON A;  2GC0 A;  4DUV A;  3WNX A;  3WDY A;  1AUY A;  2QNK A;  1K45 A;  2OII A;  3X29 B;  3RYR A;  1UYP A;  1GP5 A;  4LHL A;  3ZIX A;  3S5Q A;  5J37 A;  4COV A;  3DCQ A;  2ZEW A;  1UZ0 A;  2O8O A;  2QQI A;  2XJT A;  1VBE 1;  4N8M A;  4QPG A;  3VBU C;  4CCC A;  1DQ1 A;  5EIY B;  1NZC A;  4QQP A;  2BPA 2;  1OKO A;  2RJ2 A;  5CKN A;  3VD3 A;  4Q26 A;  3K46 A;  1VRB A;  4HOO A;  2WL1 A;  3TWI A;  2UWB A;  1S2K A;  2WLQ A;  4CDX A;  4AXO A;  3BB6 A;  4OHX A;  2VEC A;  5A80 A;  4IV3 B;  4YZ1 A;  3ELN A;  4YG6 A;  5C8C C;  5K7P A;  2VM9 A;  1PMJ X;  3AJY A;  4L92 A;  1PGW 1;  1A3K A;  3WW4 A;  4UFM A;  1N1V A;  2R0H A;  1O5U A;  2H0V A;  4MZU A;  2VME A;  4QXB A;  3LB9 A;  4HKW A;  1UZV A;  1W06 A;  1G8W A;  1ND2 B;  3FLP A;  5IFP A;  1YJL A;  2GC3 A;  1EUT A;  1GNY A;  2CL2 A;  3M8L A;  4Q4V 3;  3L2H A;  1LU2 A;  5CIR A;  3QH7 A;  2WN3 A;  3KT7 A;  1PO2 1;  5E6H A;  1NUK A;  1ZZ8 A;  3AKP A;  2DWR A;  1BQP A;  3VBF B;  4C1X A;  1OF3 A;  4KBB A;  4Y4R A;  1FV3 A;  2BVB A;  1D4V B;  2EAK A;  1YUD A;  3FHQ A;  3U37 A;  1FMD 2;  5FP7 A;  1W6O A;  2DVA A;  5IFT A;  2ZML A;  3IN9 A;  3MW4 A;  5GZF A;  3RNS A;  1V6I A;  1RYY A;  1RL3 A;  2JDH A;  1X8E A;  3NL1 A;  3TEY A;  3H3L A;  4QPW A;  2WS9 1;  4S2G A;  2JIG A;  2BGP A;  3C3V A;  4D6Q A;  5FYM A;  2ZX2 A;  5ACA 2;  4LK7 A;  1HJG A;  3NV4 A;  1LOG A;  2LM3 A;  4ITC A;  4UI9 L;  1TZO A;  5KC5 A;  5APA A;  2FQP A;  3CJX A;  4QX8 A;  3U78 A;  3EBR A;  2VU9 A;  3GHM A;  2W9X A;  5FZF A;  4OHZ A;  1RUG 2;  2ORZ A;  3POF A;  1PX4 A;  1DCS A;  3QAC A;  4PLM A;  4QQO A;  1JUH A;  3OOX A;  4XCA A;  3FX3 A;  1ZRF A;  4FPY A;  3KV6 A;  2DUP A;  1XNT A;  4RD7 A;  1H2N A;  3LZZ A;  4NRM A;  4RYD A;  5DG2 A;  4Q5O A;  4PLO A;  5DXD A;  2XJP A;  2NLR A;  3ZFG A;  4O61 A;  3NVC A;  2QQW A;  1WMF A;  4CCM A;  2NMO A;  2GP3 A;  2G9F A;  4TXW A;  4AOC A;  2YRO A;  4DUX A;  2RV9 A;  4I09 A;  4Q1R A;  3T08 A;  3VBR B;  1CX1 A;  4P9J A;  4AQ6 A;  4PIX A;  3RVH A;  1LED A;  4WM8 B;  4XUN A;  4WZF A;  2X5I B;  2XDV A;  3O14 A;  4Q4Y 1;  4HBN A;  5FR3 A;  2XBO 3;  1ND2 C;  4NID A;  1PGL 2;  2QQO A;  2XGX A;  3U1X A;  3VBS B;  3ZYH A;  1CD3 G;  3LDR A;  4MV2 A;  3U14 A;  3WNL A;  1BMV 1;  4LR4 A;  5CFD C;  1U5Z A;  4GWI A;  4XE9 A;  5CNA A;  4YGD A;  3NJX A;  2R06 3;  5C3O A;  3AP7 A;  2ARE A;  3VBF C;  5EZW A;  2G9Z A;  3N3H A;  2R1D A;  2K46 A;  1XQN A;  2Y0I A;  1X9T A;  2VY0 A;  3BPZ A;  4W8J A;  3RPQ A;  3VZL A;  3WQ1 A;  3AK0 A;  4K21 A;  5LBB A;  5FUP A;  4WZC A;  4FOY A;  5L9B A;  1H8T B;  4PF1 A;  1RUE 1;  5FLJ A;  4DNY A;  3RZG A;  3BVC A;  3OSD A;  2A75 A;  1ONA A;  1GOH A;  1VMJ A;  5FZ9 A;  3UGG A;  3WW2 A;  1QDC A;  2YB7 A;  3VZM A;  3BN6 A;  2XJR A;  4KNC A;  2KM2 A;  3T0A A;  4QGM A;  4OMC A;  1ND3 B;  2ZEY A;  4GJY A;  5JXH A;  3KF3 A;  1ASJ 2;  1GAN A;  1XJA A;  3JZV A;  1VBE 2;  2UYB A;  4IUG A;  3RG0 A;  4EE2 A;  3U0Z A;  3NWK A;  2HWD 2;  1YFX A;  2DUO A;  2WII B;  1X50 A;  4IEV A;  1HXS 2;  4CCK A;  1MZE A;  5CA6 A;  4Q0U A;  3VBR C;  3NKG A;  2MEV 1;  2RM2 2;  4XIO A;  5D2A A;  3SCH A;  4CUC A;  4WM8 C;  2DU1 A;  3OBR A;  1FOD 1;  1RUF 2;  2X5I C;  5A70 A;  5ACA 3;  1UOF A;  1ZBE 1;  1QJU 1;  1N3P A;  1XB9 A;  2RS1 2;  2JXA A;  4M3C A;  4QU2 A;  2CYF A;  3ETQ A;  2XUE A;  3HQR A;  5DQ0 A;  2X05 A;  1W6M A;  3RZH A;  1AR6 1;  1EPW A;  3HR9 A;  1JU4 A;  1SCR A;  4P9Y A;  5IVE A;  3GM8 A;  4QDS A;  1LGB A;  2YU1 A;  3JQW A;  4JHZ A;  4Q8K A;  1Q8P A;  1W8N A;  1JYT A;  3ILN A;  3SKV A;  1LB2 A;  1HRV 2;  2PHW A;  3L2Y A;  2RR1 2;  1NLQ A;  2ZHN A;  5FZ0 A;  4ZXK A;  4YPJ A;  2VCC A;  4BIO A;  5JXG A;  3WP4 A;  1NAE A;  3POS A;  1G86 A;  2P5B A;  2XVK A;  2WO2 A;  2Q5T A;  3PU3 A;  1PVC 1;  1VAL A;  1W6N A;  4FPO B;  2R07 1;  1GKB A;  1NG0 A;  5FY7 A;  2WS9 2;  1OLM E;  2CSG A;  3B69 A;  3KMH A;  1H8T C;  4QD2 A;  3S6P A;  4AI3 A;  3PU8 A;  4CCN A;  4GB3 3;  4Y1X A;  4MET A;  5L7O B;  2ZBJ A;  1UMI A;  3GDB A;  1VAM A;  4HVQ A;  3S5A A;  1HB2 A;  1RUH 1;  1VLN A;  1VP6 A;  3IAP A;  4CCO A;  3VKL A;  4TWT A;  4P5H A;  5SV5 A;  3RMY A;  1ND3 C;  4HL0 A;  1E5I A;  3OGS A;  4K6B A;  2R6Q A;  4LUM A;  3J7N A;  3WUC A;  3ITQ A;  4J25 A;  4BA6 A;  4FFF A;  3RQ0 A;  4Z2W A;  4QU1 A;  4NRP A;  4K7J A;  1KFU L;  3WY6 A;  1HKD A;  4G4F A;  4IEZ A;  4D7S A;  1R1Z A;  4YLZ A;  2Z4F A;  3P6B A;  1R09 2;  2VZT A;  2FDH A;  2HWE 3;  3JUU A;  1AR9 1;  4HZF A;  1XBF A;  1CPN A;  4NN0 A;  5CFC A;  2E31 A;  3D82 A;  3HBZ A;  1OT5 A;  4A6S A;  2R30 A;  1CWP A;  1BKZ A;  4LBN A;  2JDA A;  1W9T A;  2ETE A;  4B4Q A;  2WFF 2;  5HCA A;  3VD9 A;  2V72 A;  1W03 A;  4Q4Y 2;  4AFB A;  2JEM A;  2ORX A;  5I8S A;  5T52 A;  4FBF A;  5JZG B;  2D98 A;  4N43 A;  2GC2 A;  1NCQ B;  3AL6 A;  5ANQ A;  1CN1 A;  4Z92 B;  2VTX J;  3NAP C;  2QCS B;  1DZT A;  4WM7 B;  1CAU A;  1WW6 A;  1JHJ A;  1XND A;  1CAW B;  2DFC A;  1VBE 3;  2A7A A;  3OB8 A;  4EWA A;  4E4D X;  2LUW A;  3A0K A;  1YO8 A;  3M3Q A;  1YFY A;  2R7E B;  1W05 A;  4R9B A;  3O0W A;  2RM2 3;  3OY8 A;  2OKX A;  4ATF A;  1GUI A;  4KL1 A;  1K12 A;  1MS9 A;  1RUF 3;  1KDM A;  5L7O C;  2G19 A;  3T30 A;  3M3C A;  1DYK A;  4RN5 A;  5LA1 A;  2DFB A;  3VKO A;  1H1A A;  1ALY A;  4COW A;  3JXS A;  1NY7 1;  2ZGM A;  2ZKL A;  1FAY A;  2IUW A;  3CZU A;  1S0D A;  3K51 A;  1TQ5 A;  4MUV A;  1PO2 3;  1V0A A;  1W8Z A;  1TME 1;  5GZD A;  5LAS A;  3JB4 C;  2P4E A;  1VBA 2;  4Q29 A;  3HWJ A;  2RR1 3;  1Y9G A;  4XZP A;  2VMH A;  3J9S A;  2E9Q A;  4E4S A;  3PDQ A;  3NW4 A;  1DG6 A;  1D4M 1;  2VMI A;  3BUC A;  4DY5 A;  1RHI 2;  2LW8 A;  2NYY A;  4MXW B;  3RI9 A;  5I0U A;  5A6X A;  2WS9 3;  4A7Z A;  5F8P A;  1FOD 2;  4UW5 A;  5F5A A;  3RJ2 X;  4UYB A;  1G7Y A;  1KS4 A;  1VAK A;  3ZO0 B;  4BOW A;  4BXF A;  1GZT A;  4LBQ A;  4LLO A;  5CB7 A;  3SQO A;  1PX3 A;  3U4X A;  2VUL A;  4QX3 A;  1XE7 A;  1NCQ C;  4B4R A;  2AAC A;  4JGZ B;  4OVE A;  3IMN A;  5EJZ B;  1AR6 2;  3TEZ A;  3AKT A;  2BOI A;  1H8V A;  2WIN B;  4FP3 A;  2Q1M A;  5L9R A;  4WM7 C;  4AVA A;  1G9D A;  3ZYF A;  4PQQ A;  5I93 A;  2LAL A;  4XEZ A;  1GIC A;  5FY5 A;  4FAG A;  2GDF A;  3MI8 A;  1LOB A;  2PYT A;  2VVD A;  3QOP A;  4LO5 B;  4IEO A;  4PLN A;  4Y1Y A;  5A7N A;  1SPP B;  3AZV A;  4BQ2 A;  1W6Q A;  1PK6 B;  2J1R A;  2R16 A;  5I8T A;  5FAX A;  4AYU A;  2TEP A;  3I7D A;  1HDK A;  4IGP A;  3WIN E;  1IPJ A;  3OPW A;  4ATE A;  2C9K A;  4AW7 A;  5FZO A;  3ENR A;  1N47 A;  3T2O A;  3PJQ A;  4C0H A;  2WFF 3;  4SBV A;  1SDD B;  4BQ3 A;  5FPU A;  4Q4Y 3;  5F5I A;  4BB3 A;  3B94 A;  4R9A A;  1UMH A;  2E7T A;  2RJK A;  5IVJ A;  4AEM A;  4KGQ A;  4BPZ A;  1M06 G;  5F37 A;  3NNL A;  3RZM A;  3UT0 A;  5FPV A;  5FYB A;  4GWM A;  2OQ7 A;  1DGR A;  3CJI A;  3I59 B;  1DLL A;  2RS5 2;  3N7L A;  3POY A;  4NIG A;  5ABJ A;  3K4A A;  4CDW A;  2B42 B;  2JE7 A;  4YVS A;  3ZIW A;  3CF6 E;  5FYU A;  2WWS A;  3NNM A;  3DPR B;  4XCB A;  5F3G A;  2JB4 A;  2ENR A;  4E8D A;  5KHG A;  1KD7 A;  1Q43 A;  4AWD A;  1U5I A;  2VMC A;  3A23 A;  3IAQ A;  3BTA A;  2VUA A;  5K0U A;  2OA2 A;  1S0I A;  1RUE 3;  3FWE A;  3WDU A;  1OA2 A;  4HET A;  3RWK X;  3HN3 A;  1UY3 A;  1L7L A;  2HWB 1;  3I2F A;  1VE0 A;  3V0B A;  1Q8V A;  4JGZ C;  1C1L A;  4CXY A;  1UIK A;  1DYP A;  2XWJ B;  4P9I A;  5AVP A;  4Q4W 1;  4BLJ A;  4HK8 A;  1BHG A;  2QQN A;  1D2Q A;  5BY5 A;  3I2H A;  1RUI 1;  1VBA 3;  5A33 B;  1PK6 C;  3TN9 2;  2JB8 A;  5C4W A;  5FZB A;  4JKL A;  1WMX A;  3LAG A;  3KV4 A;  3WG3 A;  5FQ0 A;  1VBC 2;  2NMN A;  4LBO A;  1RHI 3;  1RVF 1;  1Y9M A;  3V0A B;  3IWZ A;  1DGR N;  2Y33 A;  5LEJ A;  4L0P A;  2GU9 A;  1EAH 1;  1ULO A;  3KV9 A;  4FFG A;  2W94 A;  4GIQ A;  1FOD 3;  3ME2 A;  5GLU A;  3IDA A;  4J6G A;  2AGS A;  3AKQ A;  3HNB M;  1OQ1 A;  1IG3 A;  3PL0 A;  5FY1 A;  4A2U A;  1QJU 3;  1GR3 A;  3ZX7 A;  4CUB A;  2VZQ A;  2GAL A;  2AEY A;  5L73 A;  1AR6 3;  2KR2 A;  4KWJ A;  5C8C A;  1LEM A;  1W3V A;  1DZQ A;  1JU3 A;  1UY1 A;  3AFK A;  2WNE A;  2YGL A;  5BNP B;  4A3Z A;  1O4Y A;  1B09 A;  3S57 A;  4DUW A;  4YW1 A;  2XB6 C;  4HPK B;  4BQ5 A;  4MGI E;  1E57 A;  3WNK A;  4A7K A;  1MQT B;  4OI0 A;  3ES1 A;  4OUM A;  1O7F A;  4CPB A;  4XZU G;  3BOP A;  1BK1 A;  1UO9 A;  5I8Y A;  2OPK A;  4N7U A;  1JZ4 A;  1SBE A;  3GNE A;  2ZS6 B;  4TLF A;  4OHY A;  2JG9 C;  2IFW A;  3R0R A;  4XDP A;  2ZX3 A;  1N1Y A;  5T5J A;  2BWC A;  4QDQ A;  1Y7B A;  2JD9 A;  5DAX A;  4P02 B;  4K1Z A;  3K4Z A;  5A7S A;  3NJZ A;  1RUH 3;  1UZZ A;  2OQ6 A;  1IQD C;  1J3R A;  2X10 A;  4DFS A;  5FO8 B;  3LIG A;  5FYV A;  5F7U A;  1F5J A;  4UFL A;  1ENX A;  5JLV A;  5DUV A;  4XW3 A;  2CV6 A;  2RS5 3;  1J1T A;  3VUO A;  5BNN C;  3VBO C;  2J1T A;  2IC1 A;  5JSP A;  5DUU A;  3T1M A;  1ZA7 A;  2CTV A;  1AXK A;  4Y24 A;  1S0J A;  3UV9 A;  1JZ6 A;  4FPG A;  2V4A A;  3D0J A;  4N90 A;  4FOV A;  5EP9 A;  3BGA A;  4QKF A;  2BNN A;  5LRS A;  1ULF A;  1OD3 A;  5FMO S;  3G6J B;  3VHO A;  2XKP A;  1DGW A;  1W8W A;  3WNN A;  3ZYP A;  4W6Y A;  5DAW A;  4G9S B;  4Q0Q A;  3VD7 A;  4AGV A;  3TYJ A;  5F5C A;  5B2G B;  4RFT 0;  4UF0 B;  1COV 1;  2YPJ A;  2YZ4 A;  3MUY 1;  5BNO A;  1MZ5 A;  1ZBA 1;  2XLG A;  1V00 A;  1MS0 A;  4CEW B;  5BNP C;  4FTB A;  5FP3 A;  5DPN A;  1UU4 A;  3ZVX A;  1UU5 A;  2V5D A;  2ZA9 A;  4AED A;  5DAV A;  3ZYB A;  4M3C E;  3LQC A;  4BQ1 A;  3VZK A;  5CKM A;  3FBM A;  5CFD A;  1RIT A;  2WRA A;  2YGM A;  3IZO A;  5FZA A;  4ARY A;  4D3W A;  2J1U A;  2AYH A;  3H8R A;  2PHU A;  5FIX A;  1QMJ A;  5A3W A;  4OQ9 A;  5A7P A;  3VBF A;  4PHZ A;  3WNP A;  1YFW A;  4R9C A;  3SIS A;  2C4X A;  2NM1 A;  2A71 A;  4QDR A;  4C8D A;  1PZ8 A;  5CYY A;  4IXL A;  1WCS A;  1HV0 A;  1VBB 1;  2PHD A;  4P9X A;  4LBM A;  2E51 A;  1OA4 A;  3B01 A;  1M4W A;  2IXH A;  4M0H A;  1O91 A;  1JHN A;  4I3P A;  4LKF A;  2PHF A;  2VXJ A;  4XUQ A;  1TME 3;  2PAM A;  3NV3 A;  3PUR A;  5HV4 A;  1X8M A;  2VMF A;  1UCX A;  4FPH A;  4K8F A;  2WAO A;  5A6Q A;  1NLR A;  5F3E A;  4XF9 A;  4AEJ A;  5JWP A;  1MEC 1;  3NNF A;  3KD4 A;  3MIC A;  4N7I A;  5FXX A;  5BPX A;  2D6M A;  1D4M 3;  2FCV A;  3I4I A;  3I2G A;  1WGP A;  1FPN 1;  3FUO A;  1S0G A;  3THD A;  2J1S A;  2HYK A;  1UYZ A;  4CZS A;  3N7M A;  1ZRC A;  5AC9 1;  5FJH A;  3LA7 A;  4JHT A;  1CAV A;  2FCU A;  3I2D A;  5K9Y A;  1EV1 1;  3VHN A;  2YC2 A;  4Z82 A;  4FTE A;  1PHM A;  2NP0 A;  5F3I A;  4JDN A;  2XQR A;  5FPB A;  2XJV A;  2IWG B;  1OQE A;  5F32 A;  1ACC A;  2J22 A;  3HQX A;  2YY1 A;  3CNA A;  3AZW A;  3H8O A;  3WLU A;  4CEW C;  3N35 A;  2EID A;  4W50 A;  3W59 A;  2FDJ A;  1R64 A;  3CBN A;  4WVZ A;  1HN0 A;  4RHV 1;  2DUQ A;  4DXT A;  2B8M A;  5DAB A;  5KR7 A;  3UKV A;  1HN1 A;  2OT7 A;  3POE A;  3PVB B;  2HWC 2;  3SIT A;  4N53 A;  4EN6 B;  3ZXL A;  5FDB A;  2P34 A;  2XKO A;  4I3G A;  4Q4X 1;  5EYY A;  1UYX A;  1EYB A;  1W99 A;  1KJR A;  1W9Y A;  2RMU 2;  4U2A A;  1UX7 A;  1OPO A;  3WG1 A;  2W95 A;  1WME A;  4D7Y A;  3O1R A;  1ULP A;  2W52 A;  3AZZ A;  5EYX A;  5HBA A;  1ZRE A;  3FL7 A;  5A3U A;  2ARB A;  1SEF A;  1U12 A;  2WFP A;  3NNJ A;  1AJK A;  1DIW A;  1H8T A;  4ZZ8 A;  3VDC A;  3AMH A;  3GZU C;  4OUL A;  2DTW A;  2HWF 2;  3I3B A;  3ZFE C;  1LR5 A;  3MPP G;  1YNA A;  4JKM A;  4Q27 A;  3D0S A;  2QQU A;  1NXD 1;  1BEV 1;  2I74 A;  5IK7 A;  3A7Q A;  4XPV A;  2FDG A;  3LF7 A;  1X7N A;  3AMQ A;  5IK4 A;  2JEN A;  3VDD A;  1YLL A;  2MHF A;  3C7F A;  4HAN A;  1ND3 A;  4LTA A;  2VVF A;  1Q8Q A;  1AXY A;  4GJZ A;  2MPF A;  5J1X A;  5FZ7 A;  1O4T A;  3C7H A;  4QAW A;  4SLI A;  5FMC A;  5GZC A;  1W90 A;  2J7M A;  4I02 A;  2DVD A;  4IV1 A;  4LHK A;  5L19 A;  1DQ2 A;  2WNO A;  4GH4 C;  1SAC A;  1AYM 1;  5C5T A;  2UU8 A;  2B45 X;  2QKD A;  2VC9 A;  2ZEX A;  3C7E A;  1UZY A;  2A3X A;  3F2Z A;  2WNV A;  3DYP A;  2ZCW A;  3K4D A;  5F2S A;  4BDV B;  4Y1U A;  5T5P A;  5FBZ A;  4QHB A;  1COV 2;  4HK9 A;  5FPL A;  4B8E A;  4D6S A;  2CNA A;  4ZON A;  4ASM B;  3J8F 1;  3Q8A A;  4Q1P A;  4UT5 A;  5GM0 A;  5CEH A;  4Q4W 3;  4EWD A;  3WW1 A;  2ADE A;  4DIN B;  5LCW L;  2DVF A;  4UBH A;  4K3U A;  1RUI 3;  5FJK A;  5FYZ A;  2Z2S B;  2D6K A;  3NAP A;  1JYN A;  3OGR A;  4E2Q A;  2CAU A;  4LE3 A;  1QOS A;  3QCW A;  2TUN A;  2ZPX A;  3WF1 A;  1OVP A;  4NE9 A;  1E5S A;  1TMF 1;  2JEC A;  3LGR A;  4NO4 A;  4XYX A;  5CG8 A;  3ZN5 A;  3USU B;  2YPD A;  5CKQ A;  5KXB A;  2VW2 A;  4BCU A;  3FE5 A;  4DXZ A;  3T4H B;  1GP4 A;  3PTY A;  1DGW X;  3EQE A;  3E1F 1;  3OYW A;  1V6N A;  4FSJ A;  5C7G A;  2Y6H A;  1A8D A;  3ZKU A;  1O3Q A;  4A3X A;  3AKR A;  4A44 A;  4CU9 A;  1ZZB A;  1H2K A;  1PNG A;  1UL9 A;  4FQZ A;  4P08 A;  5A3O A;  3WD5 A;  5J48 A;  1RTV A;  2QDN A;  4CUA A;  4BME A;  1SLL A;  3DXU A;  4W65 A;  3AM2 A;  1T2X A;  3AZY A;  4H7M A;  4HXC A;  4HMZ A;  1SG3 A;  1ZA4 A;  3VB9 A;  4JGY B;  3E5U A;  1YQC A;  5FLH A;  4CCL A;  4FAH A;  1OFS A;  1T6B X;  3TAY A;  5FY4 A;  1YQ5 A;  2W1U A;  4A6O A;  3E5Q A;  4FPL A;  2V4V A;  1JBC A;  1WW4 A;  5D8A B;  4MHU A;  4COY A;  4I2O A;  1F31 A;  1WLC A;  2RMU 3;  3ST7 A;  3WHT A;  1PIV 2;  1YQ2 A;  1WLD A;  2PA7 A;  1H2L A;  2VVE A;  3IIA A;  4IDZ A;  3EO6 A;  1RMU 1;  4JVA A;  3UYJ A;  2VG9 A;  1C1F A;  4GKY A;  3PLQ A;  2XBO 2;  4RS5 A;  2WO7 A;  2YG0 A;  5FZD A;  3SEE A;  2A70 A;  1W0P A;  4CU7 A;  1UYY A;  2FHR A;  2Q8C A;  4LO6 B;  4WVW A;  1NCQ A;  1UKG A;  1AL2 1;  3E5X A;  4LA2 A;  3UKN A;  5FWJ A;  3LKJ A;  4CEY B;  3H8X A;  3ORJ A;  2R06 2;  2Y0O A;  1CX4 A;  3LA3 A;  5A32 A;  2XVL A;  5FZC A;  5BUV A;  4XBN A;  1AYN 1;  1DZR A;  3KHC A;  5KXE A;  1HRI 1;  4LUK A;  4NMI A;  3P5B A;  1SBF A;  2J1A A;  3PTR B;  2PHX A;  2YFZ A;  3DKQ A;  4AE2 A;  4A45 A;  5DMY A;  4Q2F A;  1IQA A;  1WCQ A;  1F4A A;  2ZGK A;  3FN9 A;  2O0O A;  5CAD A;  2DBI A;  3W20 A;  4CDU B;  1COV 3;  4YAR A;  1QXP A;  1ULG A;  2PLV 1;  4FPJ A;  4RA0 A;  5FZE A;  1ZBA 3;  3GJB A;  2O1Q A;  3ZR6 A;  4CDQ C;  1FYU A;  3JB8 A;  3MW2 A;  3OF1 A;  2LS6 A;  4IGQ A;  4W4Z A;  2DYC A;  1MS4 A;  4Q0P A;  2XXZ A;  3MLK A;  2XPJ A;  1R08 1;  3HEI A;  4JGY C;  4NII A;  4AQ2 A;  2FD8 A;  5A7O A;  4UFJ A;  4JAA A;  4AF9 A;  3I8T A;  3OUI A;  4XFI A;  2HKX A;  1ENQ A;  5D8A C;  3C7O A;  1H4G A;  1QKQ A;  2WBK A;  1JYV A;  1DF0 A;  3JD7 2;  2W91 A;  1XU1 A;  3N9Q A;  4FPE A;  4YG0 A;  5EFU A;  4YZ5 A;  2O14 A;  1LRH A;  1UXZ A;  1HJF A;  4XBQ A;  2ZMN A;  2ZGS A;  4KWK A;  2ATF A;  5T54 A;  1IOA A;  1PGS A;  5FO7 B;  2JE9 A;  2QJV A;  4FVV A;  4MXV A;  4CP9 B;  1WD3 A;  3LPF A;  3DUI A;  4LIV A;  5FFO C;  1O59 A;  5LBF A;  1CES A;  4JGZ A;  1OA3 A;  5FRA A;  1E5R A;  3C7G A;  3KZ4 C;  5F9T A;  2Z5W A;  1MEC 3;  3MGU A;  3AYC A;  3U11 A;  1H4H A;  1W6P A;  3BI3 A;  5LA0 A;  2VZU A;  3P1I A;  1QHD A;  5F6K A;  2JDZ A;  4C1W A;  1VRH 1;  3SLI A;  4ISR A;  2DU0 A;  2R1B A;  2V09 A;  1A78 A;  1KGY A;  5FMO L;  1B35 A;  1VB4 A;  1XOY A;  1EV1 3;  2AZ5 A;  2BP6 A;  1PIV 3;  2H6B A;  2VQT A;  4HVO A;  1W8H A;  4URA A;  1OOP B;  2JG8 B;  1MVE A;  1D7P M;  4IV3 C;  3WV6 A;  2ILM A;  3LEG A;  3O7O A;  4CDU C;  3H8U A;  1DQ4 A;  4GB3 2;  3THC A;  3T2P A;  2XJS A;  3MBW A;  5GZG A;  2KXL A;  5H9Q A;  1YJK A;  3AYA A;  3DKW A;  1RED A;  2VOX A;  4V2W A;  2TBV A;  2VOK A;  5FZ1 A;  2VAU A;  4F83 A;  1KJL A;  2CGN A;  1UQX A;  1QNW A;  3E97 A;  4RHV 3;  3ZLI A;  3PMS A;  4BIS A;  1QQP 2;  2CDP A;  3J7M A;  3KT1 A;  2WZR 1;  4ISQ A;  3NO8 A;  4OUE A;  2QUO A;  3WQ0 A;  4DRV A;  2P1B A;  1R1A 1;  1H9P A;  2HWE 2;  2VBD A;  3CMG A;  3LSD A;  1WA4 A;  2IZW A;  1XRU A;  1ULE A;  4CE8 A;  2PTM A;  3NNG A;  1XYO A;  4B1L A;  2DVG A;  3ZKY A;  3C2U A;  1URX A;  1REE A;  3KVB A;  2RG4 A;  2JG9 A;  2SLI A;  4Y5Z 0;  2OS2 A;  2DCT A;  1GU3 A;  2LRO A;  4CYD A;  5C33 A;  3VV1 A;  4C91 A;  2G9G A;  2QZ3 A;  2XUM A;  1NA1 A;  5FP4 A;  4XAA A;  4GKX A;  5FY9 A;  2ZOE B;  2A6Y A;  1JUI A;  4LMF A;  1Z7S 1;  5EV7 A;  1AR8 1;  1X9P A;  2QQK A;  3JBG 1;  3MZH A;  2VBP A;  2WUH A;  5BNN A;  1QGL A;  3VBO A;  1WLT A;  4LXL A;  1A8M A;  1QJX 1;  2BJS A;  4R9D A;  3DGT A;  4XXP A;  3JD7 3;  3POG A;  2FDI A;  1AYM 3;  1OOP C;  3OBT A;  3RYP A;  3V0A A;  2Z42 A;  1WMD A;  4GAL A;  1XE8 A;  4X6R B;  1W9S A;  5A1F A;  4QPY A;  2QQP A;  2PLV 2;  1DQ6 A;  1PGW 2;  2VCB A;  2VQU A;  2W08 A;  4CA9 A;  3V56 A;  4E2G A;  5J7M A;  3J8F 3;  1QNY A;  3VBS C;  3MLL A;  3ZSE A;  5KHK A;  3HT2 A;  1UOB A;  1W39 A;  1GZW A;  2E33 A;  2IVJ A;  2P37 A;  4QB2 A;  4RGA A;  4XVH A;  1PO2 2;  1RIR A;  2VR4 A;  2XLF A;  5FZH A;  4P00 B;  2DTY A;  2HBU A;  3AB0 A;  1CZT A;  1I6X A;  3ZN6 A;  1WW5 A;  2P3K A;  2ZX4 A;  3AC0 A;  4JQR A;  3W58 A;  4QKN A;  5GLZ A;  3SCG A;  2VW1 A;  1TMF 3;  4Y5T A;  5LB6 A;  4GAZ A;  5C70 A;  1FNY A;  3S7E A;  1CQ9 A;  1RUD 1;  3A21 A;  2XJU A;  3H7Y A;  3ZFF B;  5JMO A;  2BEO A;  4JDO A;  4LBK A;  3LA2 A;  3K77 A;  4QX7 A;  3J4U H;  3OCP A;  4XUR A;  4Y20 A;  4BHP A;  2IVI B;  4ZPI A;  2D6P A;  2B5H A;  2XML A;  5G05 L;  4AG4 A;  2OW4 A;  4BIF A;  4E2S A;  4UFH A;  2GN3 A;  2DV9 A;  4FI9 A;  4XUT A;  1H0B A;  1RUJ 1;  1K3I A;  2BW8 A;  4QWN A;  5FPZ A;  2WAA A;  1YWK A;  4PDW A;  1WBL A;  2XHN A;  3B00 A;  1H1I A;  2C5D A;  2R04 1;  2QVS B;  5E89 A;  3WCS A;  4EYU A;  1O8S A;  4NHK A;  4KMQ A;  1QQP 3;  1QJE A;  3ZXD A;  1US2 A;  4MGT A;  1S55 A;  3H3Z A;  4YVW B;  3O0V A;  2Y26 A;  4JDM A;  1OHF A;  4XQW A;  4LE4 A;  5FZ4 A;  5A1L A;  5FZK A;  3HNY M;  3KHB A;  2EIC A;  3MIH A;  3THP A;  1SLT A;  3FZ3 A;  1PO1 1;  2JDP A;  4B29 A;  4YW2 A;  2YFU A;  1GV9 A;  4JCK A;  1QDO A;  1RMU 3;  1UNB A;  2VNO A;  3I3D A;  3MV1 1;  1UD1 A;  5L7O A;  2PHL A;  3OUH A;  4FQ4 A;  3ZN4 A;  1CAX A;  3MUZ 1;  3WQB A;  4TSV A;  2DBN A;  5FMD A;  4CCJ A;  4UF0 A;  4EN9 B;  5I0D A;  1AL2 3;  2I45 A;  1IKP A;  4HN0 A;  1BMV 2;  3P3P A;  5LK5 A;  1Y3T A;  1DBN A;  1LOD A;  1NKG A;  1QF3 A;  4MGS A;  4GUL A;  2ERF A;  5HPO A;  4IE0 A;  4G3Y C;  5FXZ A;  1AYN 3;  4QPI B;  4H2A A;  4GWJ A;  4AVB A;  3VBH C;  1N3O A;  1HRI 3;  4BMB A;  4XF4 A;  1GWM A;  3H1W A;  2GH2 A;  5A3N A;  3H3U A;  3Q9O A;  1SDW A;  3PVE A;  4XJU A;  1NE6 A;  1UY0 A;  5FY8 A;  2WNU A;  4ZY9 A;  2DF7 A;  4AVV A;  1RUC 1;  3KF5 A;  5FMB A;  1RUE 2;  1MZ6 A;  3J7L A;  2PLV 3;  2GP5 A;  3ACL A;  4Y22 A;  3OPT A;  2QQV A;  3WX5 A;  2HEY F;  2ZXQ A;  4WBB A;  2Y60 A;  5DN2 A;  3BTY A;  5EPA A;  2GAU A;  3HJR A;  2P3Y A;  1NZI A;  2WZ8 A;  4QPG B;  1R08 3;  1GQH A;  2BDR A;  2YXS A;  5DUX A;  5JSO A;  4Z1V A;  1NCR A;  4GD4 A;  1Z7S 2;  3GBF A;  5KHI A;  4YVW C;  1AR8 2;  3ZFE A;  2I2S A;  2HYX A;  3ZDV A;  1HQL A;  4IE7 A;  4LLF A;  4LOT A;  4CDX B;  1U5Y A;  5FV3 A;  2FDK A;  2P2K A;  2VMD A;  4H14 A;  4YM3 A;  4XJ9 A;  4HVR A;  2MEV 2;  2VUJ A;  2R32 A;  4LT5 A;  4DS0 A;  3III A;  4AVC A;  1C5I A;  1ZBE 2;  2Q0A A;  3UNP A;  3KQ4 B;  5LY2 A;  2B9U A;  1QJU 2;  3AP6 A;  4E27 A;  3PJY A;  2LTN A;  4GH4 A;  1QJY 1;  3TBD A;  5HI0 A;  5CAZ A;  2UWC A;  2PAE A;  3O1O A;  5JZG C;  1CVN A;  4UBG A;  5IUQ A;  1XNA A;  1LUL A;  2GMP A;  4F8A A;  5JXJ A;  3BIE A;  5FZ6 A;  1CGP A;  4D8M A;  1C8M 1;  2ZTN A;  5C5U A;  4LBJ A;  1W6O B;  4UW4 A;  3ZMO A;  1CPM A;  2EIE A;  4QPI C;  1ST8 A;  3CDZ B;  4B3N A;  3DYM A;  4RR3 B;  4AAX A;  2HJI A;  2ZHM A;  4OYU A;  3T0D A;  2EIG A;  1JYX A;  4GA9 A;  4AHX A;  1LOF A;  1PVC 2;  1STM A;  2B9V A;  3DV8 A;  1RUD 2;  2R07 2;  3EYP A;  4CCE A;  4DXR A;  1ZVF A;  1OUX A;  1UPS A;  1UW8 A;  5JIU A;  3EXU A;  4EWE A;  2PQQ A;  4R4X A;  1K5J A;  2D5F A;  4LA3 A;  1G9C A;  2D7F A;  1LHO A;  2OUJ A;  4NIA A;  3U07 A;  3WP3 A;  1W0N A;  4PQ9 A;  1YRZ A;  1GOG A;  1RUH 2;  1Q5O A;  4QXK A;  2K9Z A;  3WOG A;  4IEX A;  4QPG C;  2W5F A;  3ZFG B;  2O8Q A;  2D5H A;  1O5L A;  1XC6 A;  3H50 A;  1ZRR A;  3QBQ A;  5LAT A;  1JZ5 A;  2CGP A;  3FLT A; 
#chains in the Genus database with same CATH homology
 2HLE A;  4XUQ A;  2WAB A;  2VMF A;  2WAO A;  2XON A;  4DUV A;  3I2J A;  4UOJ A;  3EB7 A;  1LNS A;  1K45 A;  5A1A A;  2CDO A;  3I2G A;  3THD A;  1XPW A;  2J1S A;  2ZEW A;  2QQJ A;  1UZ0 A;  1UYZ A;  2QQI A;  4MAD A;  5EIY B;  2YC2 A;  2RJ2 A;  3VD3 A;  3K46 A;  2J22 A;  4QB6 A;  2VM9 A;  1PMJ X;  2EID A;  4W50 A;  2VME A;  1R64 A;  4A41 A;  5IFP A;  1EUT A;  1GNY A;  4DXT A;  2Y8K A;  3OG2 A;  1HN1 A;  2WN3 A;  4OMD A;  4ET7 A;  2BER A;  1NUK A;  1UYX A;  1W99 A;  1OF3 A;  3U37 A;  1UX7 A;  3K75 B;  2W95 A;  3FHQ A;  1ULP A;  1DLC A;  3FL7 A;  2VZ3 A;  5IFT A;  1JZ8 A;  1RYY A;  4QPW A;  4ZZ8 A;  4LPL A;  2Y6L A;  2BGP A;  3VDC A;  1PMH X;  2PQS A;  3I3B A;  4UI9 L;  5FUI A;  2WZE A;  4JKM A;  2E26 A;  3LE0 A;  3A7Q A;  2W9X A;  3NQH A;  3C7F A;  2ORZ A;  1PX4 A;  2Y6K A;  1O8P A;  1KEX A;  5J1X A;  3C7H A;  4QAW A;  1XNT A;  4RYD A;  2J7M A;  4P5Y A;  4QX1 A;  4QB1 A;  2VOT A;  3C7E A;  2VC9 A;  2ZEX A;  3LEK A;  3K4D A;  3F2Z A;  3DYP A;  4TXW A;  4BDV B;  4BK4 A;  4DUX A;  2RV9 A;  1TG7 A;  2Y6G A;  4QX0 A;  3T08 A;  2WO1 A;  1CX1 A;  1JZ7 A;  1JI6 A;  4XUN A;  3VD5 A;  4JKK A;  3VDB A;  3FHA A;  5LCW L;  5CZK A;  3WF4 A;  2QQO A;  4LQR A;  1JYN A;  3OGR A;  1JYW A;  3MV0 1;  3WNL A;  4GWI A;  3A22 A;  3PUH A;  3NJX A;  3WF1 A;  3WSO A;  4W8J A;  3E1F 1;  4D0Q A;  5C7G A;  2Y6H A;  2W92 A;  4A44 A;  4CU9 A;  2VCA A;  4PF1 A;  4P08 A;  4CUA A;  1T2X A;  1WKY A;  3OEB A;  1GOH A;  4XUP A;  2W3J A;  1SG3 A;  1J83 A;  2YB7 A;  3BN6 A;  2W47 A;  3T0A A;  3LEI A;  4OMC A;  2W1U A;  2ZEY A;  4A6O A;  5JXH A;  2V4V A;  4IUG A;  1CIY A;  3DYO A;  1YQ2 A;  1K42 A;  3WF3 A;  1CZV A;  4ARX A;  4Z2A A;  4CUC A;  2WYS A;  2YG0 A;  4CU7 A;  1UYY A;  5DQ0 A;  3T0B A;  2X05 A;  4E8C A;  4M4R A;  5B4X A;  2VL4 A;  2WN2 A;  1JU4 A;  3GM8 A;  1UY4 A;  2DDU A;  3GXU A;  4QDS A;  4JHZ A;  1UXX X;  1W8N A;  3SKV A;  4YPJ A;  2VCC A;  2J1A A;  3I3E A;  2YFZ A;  5JXG A;  1NAE A;  4A45 A;  5DMY A;  2WO2 A;  4DXS A;  1WCQ A;  1F4A A;  2W1Q A;  3FN9 A;  3CIH A;  5EJ1 B;  1OF4 A;  4A42 A;  1UMI A;  3GDB A;  2LS6 A;  4W4Z A;  2E32 A;  3ACH A;  3MO4 A;  2VZS A;  3HPN A;  3HEI A;  3IAP A;  2QQM A;  3OGS A;  1DYO A;  5C71 A;  3C7O A;  3PUI A;  2WBK A;  3CQO A;  1JYV A;  2W91 A;  4CU6 A;  2Z4F A;  3P6B A;  2VZT A;  5IJR A;  5HXM A;  1UXZ A;  3SEE A;  2J1V A;  2E31 A;  4HG6 B;  2W87 A;  1OT5 A;  4LKS A;  2JDA A;  1W9T A;  3LPF A;  3VD9 A;  1L7Q A;  2V72 A;  1O59 A;  2VZV A;  5IHR A;  2ORX A;  2QBX A;  2QQL A;  3VDA A;  3C7G A;  4CU8 A;  4XUO A;  2W1W A;  5LA0 A;  2VZU A;  3P1I A;  1JHJ A;  3OEA A;  1KGY A;  3OB8 A;  4MGQ A;  2VQT A;  3HNM A;  1D7P M;  2R7E B;  3LEG A;  2OKX A;  3THC A;  3T2P A;  3MBW A;  1GUI A;  1K12 A;  4KI5 M;  4A4A A;  4RN5 A;  1US3 A;  2ZEZ A;  1I5P A;  5LA1 A;  2CDP A;  2ID4 A;  3JXS A;  3CZU A;  1W9W A;  4OUE A;  5B4N A;  1OH4 A;  2JE8 A;  3GGL A;  1GOF A;  3CMG A;  3NRU A;  3VD4 A;  3NNG A;  2LW8 A;  4OZO A;  1GU3 A;  3C8X A;  1SHW B;  3LPG A;  3D3A A;  1PX3 A;  4QX3 A;  5EJZ B;  1H6X A;  3CKH A;  2BZD A;  2QQK A;  4PQQ A;  2WQ8 A;  1EUU A;  1P8J A;  2VZO A;  2WUH A;  3UES A;  1J84 A;  2J1R A;  3DEC A;  5JXI A;  3I2I A;  1W9S A;  3I97 A;  3I2K A;  2VQU A;  2C9K A;  2VCB A;  5LA2 A;  3T2O A;  2RVA A;  2XOM A;  1SDD B;  1MPX A;  2E33 A;  1UMH A;  4QB2 A;  3W5N A;  4BK5 A;  2J1E A;  4XVH A;  2VR4 A;  4P00 B;  1CZT A;  3AC0 A;  3K4A A;  3T09 A;  5C70 A;  3IB3 A;  3A21 A;  5JMO A;  3K77 A;  4E8D A;  4XUR A;  1GQP A;  5G05 L;  4AG4 A;  1JZ2 A;  2VMC A;  3A23 A;  3IAQ A;  3NJV A;  2KD7 A;  1TVG A;  4FI9 A;  3OGV A;  4XUT A;  2W46 A;  3WNO A;  3SEP A;  1K3I A;  1UWW A;  3HN3 A;  1UY3 A;  4DEV A;  2WAA A;  2XHN A;  1UY2 A;  3I2F A;  1O8S A;  4GZ9 A;  2BGO A;  4KMQ A;  3UET A;  4MOA A;  1US2 A;  5G04 L;  3T2Q A;  1BHG A;  2QQN A;  3WF0 A;  3ETP A;  1NX9 A;  3HNY M;  3I2H A;  2EIC A;  1JZ3 A;  4PT6 A;  4JKL A;  2YFU A;  3I3D A;  3MV1 1;  4BXS V;  1W8O A;  3ECQ A;  4L0P A;  1ULO A;  3SKJ E;  2W94 A;  4BJ0 A;  3IDA A;  4QX2 A;  3HNB M;  3MUZ 1;  3WQB A;  2B4K A;  2VZ1 A;  4CUB A;  2VZQ A;  5I0D A;  3OBA A;  1L7R A;  1NKG A;  4MGS A;  5HPO A;  3CZJ A;  5JR2 A;  3W5M A;  2Y6J A;  2JKX A;  1JU3 A;  1UY1 A;  2WDB A;  4A3Z A;  4DUW A;  4GWJ A;  3WNK A;  5IYY A;  4UAP A;  4XZU G;  1UY0 A;  4ZY9 A;  1GMM A;  1JZ4 A;  2XQX A;  2ZXQ A;  5DN2 A;  2DCK A;  4QDQ A;  3HJR A;  2JD9 A;  2WZ8 A;  2X09 A;  4P02 B;  3K4Z A;  4KWU A;  4JX0 A;  1IQD C;  2X10 A;  3WEZ A;  4M4P A;  5F7U A;  2HYX A;  3WF2 A;  2VMD A;  2J1T A;  1JZ6 A;  1DP0 A;  2YC4 A;  2EIB A;  3III A;  3J7H A;  3BGA A;  1F4H A;  3UNP A;  1OD3 A;  2L9L A;  3ACF A;  3ACI A;  2VTF A;  1XNA A;  3WNN A;  4ZZ5 A;  5JXJ A;  3VD7 A;  2DCJ A;  3WNM A;  2Y64 A;  4D8M A;  2VZR A;  3MUY 1;  4MO3 M;  3HOB A;  2EIE A;  3ACG A;  3ZM8 A;  4DEQ A;  1H6Y A;  2BBA A;  3CDZ B;  3DYM A;  4AAX A;  5DPN A;  3T0D A;  4OYU A;  4TTG A;  2V5D A;  1JYX A;  2B9V A;  4LHS A;  4DXR A;  3LQC A;  3EYP A;  2VO5 A;  4CVU A;  2VZP A;  4ARY A;  1CZS A;  2J1U A;  2VJX A;  3WNP A;  2C4X A;  2C26 A;  4QDR A;  2WO3 A;  3ABZ A;  1W0N A;  1GOG A;  5CYY A;  5JUV A;  2W5F A;  1XC6 A;  4ZXE A;  1JZ5 A;  2W1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...