1UYWH

Crystal structure of the antiflavivirus fab4g2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
218
structure length
218
Chain Sequence
VQLQQSGPELVKPGTSVKISCKTSGYTFTEYTIHWVKEAGGKSLAWIGGIDPNSGGTNYSPNFKGKATLTVDKSSSTAYMDLRSLSSEDSAVYFCARIYHYDGYFDVWGAGTAVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB ANTIBODY HEAVY CHAIN
publication title Crystal Structure of the Antiflavivirus Fab4G2
rcsb
molecule tags Immune system
total genus 39
structure length 218
sequence length 218
chains with identical sequence M
ec nomenclature
pdb deposition date 2004-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uywH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uywH02
2JJWA 3HE7D 1YEFL 3BQUD 1NCNA 5DVKA 1WTGT 2AJVL 5GIRA 4F9LA 3T4YB 4OCYL 1VDGA 1CWVA 3U0TB 2R1WA 1KJVA 1NDGB 1P4IL 4NNPL 5JQ6L 1SYVA 3FRUA 2KH2B 2JCCE 2XKNA 1ZGLM 4JRYD 2P49B 4JHWH 1AXTH 2CKNA 4L8SC 1HHIA 5IV2A 4N5ED 1M4KA 3RVTC 3UZQA 4J3UA 1YEHL 3PF2A 5ANME 3WFEL 4KU1A 5I1EH 3DIFB 2YZ1A 4C55A 2NXZB 4X5WB 2HKHL 4Y1AB 2HKFH 2EH8H 3QDJB 5FDWA 1LEGB 1ZWIA 1FVCA 3JWNC 2VLRE 5E5MB 5F7EL 2GW5A 1DTUA 1DQQA 2WBJD 3QEQB 5GISL 4Y5VB 4YDVB 1IAKB 3VFTB 4F3FB 4LHJB 1I9IL 1GH7A 1CLOH 1BQLL 2DTSA 2OQJA 3AB0C 1T7ZA 2YPLE 5FUZL 3IXTB 1QSEB 3NZ8B 4WTWA 3UJTH 2Y07L 4KVCH 1JBJA 3UO1H 1I8IA 2BVQA 3FO9B 5DJ6B 2KL6A 1MHHA 3BGFB 1K8DB 5CUSH 1I4FA 5T5NF 3QUZA 4QXTB 1T0PB 5DVMA 2Q8BL 1T2QL 1G7IB 5I1KH 3AVEA 4JFOA 4MNQD 3LB6D 3L7FB 1YEEH 3QJFB 4YFDB 1S7WA 3QEHA 1JF1B 5C7XL 4CBPA 3FO0H 5TGBB 4ORGB 4CN1A 1I9JL 5DZLA 1LNUB 2P42B 4OLXL 3RNQA 3MROB 1VEMA 4MA7L 1FZKB 2YD3A 5DUML 3QFJE 4ZUUB 1H3TA 4KPHL 4AIOA 2PYEB 4YXHL 4NUJA 2N1KA 3PWPD 3V0AC 5MENB 1A6ZA 1OCWH 4YHPB 2Q86B 1Z3GL 3TVMD 2GITA 5DEFA 1T04B 3KJ4C 1R5VA 4HKXB 1WC7A 1MFCL 4G8FB 5D2NB 1YDPA 1ZANL 4I8DA 5GRZA 2B4CL 3KXFA 2WSKA 4PB9L 4YBQD 1CFTB 1XMWA 3T2PA 1T7YA 5CGTA 5IFJA 3WD5L 5I8EA 3VG9C 4GBXB 4MD4B 3MRKB 12E8L 1HZHH 1NGWB 5BZWA 1YQVL 5JOFB 5FCSH 1AGCB 4F7MB 5KBNC 3WXWL 1A1OB 1S9XA 2Q76B 3C5SB 4OLEA 1FSKC 4LMQI 4PRHA 1P7KA 3IJSA 1XCQB 3QEGL 5IMKA 5IOPB 2MFNA 3BW9B 2EDRA 4QHMB 5IBTL 1L4IA 5JOPD 1JHTA 4JPKH 1XZ0A 5BRZB 1BOGB 1J18A 1Q1JL 3O41B 2DIBA 4RBPK 2QKIA 2MMXA 4HGWB 4FQLH 3JWOC 4R9HA 4DAGL 1I9RL 2CKBA 1S7VB 1IGIH 3KPLA 2A73A 3GSQA 4P4RA 3ES6A 4WHCA 4HIJB 1JGEA 2ZKHL 3RKDC 5KOMC 3C8DA 1LO4L 5EN2A 2JF1A 2BCKB 2HFTA 4MAYD 1UKQA 2ZPKL 4X6FB 4JGMA 4FQIH 1V3KA 3ESUF 4ZFOB 4OM1L 2Y72A 4I3SL 4J8RB 4CUCA 2NYYC 1INQA 4G7VH 4NM8H 5EZLB 3RZWA 3J7HA 4L8BB 4G9DA 1W72H 1ZS8A 2BNRA 1H0DB 4D2NA 4LVHB 1IGTB 2LQRA 5D1QD 3OB0H 1EGJA 3NFNB 1K8IA 3PWNA 4PJ9B 3DTXB 1J8HA 4P4KD 3STZB 4AYFA 3TH2T 5BJTA 1A22B 4Z7UA 4BH7B 1WVZA 4EOWH 4PG2C 5EOCH 3QO1A 3VE0B 2J8UA 3WN5C 4RFEB 5EZOL 7FABL 4HCRA 4P3WA 1MFAH 4HBCL 3AXLB 4C56A 1HOCB 5KVEH 2JJTC 5DD1H 5IT2L 4GRMA 3NIGF 2DBLH 1CLCA 3LKRB 4JFFA 4XCYB 1AXIB 3DOSA 3S36X 3VI4E 4NQDD 5MP6L 2EXYC 2NZ9D 3TZVC 3SDXF 3DRQA 2SEBB 3U6RA 1EEZA 4H8WL 1OPGH 1AI1L 1ZLWH 1CDYA 3QUYC 2XZQL 5J6HA 1WV7T 1A4KA 4QCIA 3L3HA 4I9WD 5KW9H 1CVSC 1R5WA 4LQFL 3M17B 1YYML 2WUCL 2JJSA 3DO7B 3X3FL 4DOHE 3AC0A 2IMMA 2GEEA 1NUGA 5FYJU 2NY6B 1XGQB 4F80A 2BSSA 4U1JA 4EXPX 5IB2B 5BV7B 1F4WH 4M6OH 1L9NA 3GNMH 1F4HA 2R2HB 5F7MC 2DF3A 3QIUB 1WK0A 3EYQD 4OD2A 2XQBL 3ARBB 4IJ3C 2OJEB 5EBLB 5C07D 5IJVB 3S5LG 5F3BB 4IS6B 1N6VA 1DL7H 4HUNB 4HPYL 5DJAA 4OF5A 4OZIF 4F9LC 4XNYL 4YHNB 5ITBL 1U3HD 1Z0NA 4KKBC 5AEAA 3SE9H 4PJAF 4D9RE 3QCVL 2FBJL 1RIVH 1TETH 4O00A 3WIFA 2XN9D 4KZDH 3UYPA 4GMSH 5HYJB 1IAII 4NZRL 5C92A 3FAWA 1RURH 1EFXB 1IGJA 3VMPA 5DEGA 3DGGB 2HVJB 3ULUH 3MA9H 3QRFM 1BGXL 3PHQB 1NGQL 5TDNB 1TTFA 3T2OA 2LABA 5ID1A 1DUZB 5IM7B 2GJJA 5EU5A 4HWEH 3MLRH 4UT9H 1YZZA 2VE6B 3KPRA 2BHUA 3L6FB 1WIOA 2V5SA 43C9B 4MD5A 1ZV5A 1KBGL 4YC2B 3O11B 5A2IH 4PRHE 2X4PA 4QTIH 2W0PA 3L5HA 2HRPH 1YPZA 3KLDA 5KZCD 1DBMH 4YPGB 1A9BA 4YHKL 2WUBH 3H8NA 2O93L 2V9TA 3OJDA 4XCFH 4LSQL 1FBIH 5EOQH 3VJ6A 3QO0A 4U1GC 3QUZC 4LIQE 1MF2H 1WAAF 2AJSH 4P49A 4XVTL 1EMTH 2UWEA 4PPTA 4CVWA 1WF5A 1XR9B 2LTQC 5FGRA 1LP9E 1CVRA 1OB1B 3GIZL 8FABA 2ORBH 3VFMA 5J9PB 4QTHA 5E7BA 3VXSE 2NPLX 3B3IB 2FIRT 5DHYB 5DC4B 2ZWLT 2W9EL 2W0FB 4M7ZC 1ZAGA 1ED3A 3MUZ1 3P11H 3AM8A 3JV6B 4OZFH 2F53A 1XIWA 2H6PA 3U4EB 1UXWB 4O2FB 1LEIA 1I8MB 4UT6H 2ARWA 1AD9A 4OM0H 1VEPA 4TULH 4HJJL 3MV7E 3L5WB 3M8OL 3QRGH 1GRWA 5IG7B 4Y4KA 3BEWB 1FO0B 2BNRE 2C3VB 1U91A 2FDBP 2DKSA 2EECA 2NX5A 4NNXA 4LIQL 2AJ3A 2YKLL 1HWHB 4G6KH 3ZKSD 1XF2B 5I19L 1J8HE 5L88L 1PD6A 4M3KB 5IBLC 2B1AL 4Z7UE 4ZYKA 1MJUL 4YZFF 1MCBA 5H35B 2P5EE 5E8NB 4PJ8B 1MRFL 2IBZY 5HHME 2AEIT 2J6EA 1A6TB 2KQNA 1WLHA 2H1PH 2X1QA 1DBJL 1PY9A 4K3EL 4G43A 3TC9A 5DD0L 5I30H 5M95B 4AK1A 2OR8A 3KHQA 4P23C 5KS9B 1J1OH 3U36B 4JCMA 4OGXH 4WUKH 3CVHL 1U93B 2OZ4L 3ZYIA 4Q74A 4F15B 1IVLA 3JXAA 4XBPA 5T1DL 3T3PE 4YHZL 4PJCF 3RJQB 5FM5O 4RWHA 1BBDL 1MCQA 4PJEA 1XR8A 2OMNA 3CDCA 4JZJA 2X4QA 3QUKA 1JGVH 5D2LF 5IBUB 4FFYH 2P8LB 3OJVC 2ADIB 1YYLL 3MNVA 4TOYH 1W0VB 2XYCA 1EEQA 5E99L 4YAQA 4P59H 5SWSE 2YA1A 3DX6B 3WEXB 4KGJA 3LH2H 3VWKA 4D9QD 1TQBC 2GQHA 2WP3O 32C2A 4EIZC 1VFAA 3ARDD 1F90L 4NBZB 2L7UA 3HAEG 2CGRL 2ED7A 5ESAA 4LEOB 3NCBB 5CKAA 3TT1H 1V3MA 3E8UL 5L2KD 1FFNA 1KB9K 3VXUD 1OAZH 1MH5B 3K8MA 1GHFH 4NQVB 1PG7X 3GSNA 2R2BB 3NH7L 1XH3A 3OZ9L 4M02A 5KANI 3ULVC 3IKKA 5FO8B 2Y6SD 5J7CC 2HLFC 4PD4J 4ZG1A 1AIFA 2GY7B 2FEDC 1BVLB 1X4XA 3MXWH 5DMJB 3TNNB 2YD6A 5HGHB 4UB0H 4ZSOA 1CICD 1S7TA 3TFKD 1CLZH 2YMXH 3ZE2E 2YR3A 4KHTH 1QBLL 1Q9LA 4ZS6C 4DVBB 3VW3L 4ZD3L 4U6YB 4JM2B 3GJFB 5F6IB 3HLAB 3CX5K 5GS0H 1RZKC 2HFFA 4RZCA 4BUGA 2GUOB 1PLGH 3VFOA 3KYKH 3KYOB 3QHZL 4Y2OA 5L0QC 1KGCD 1IM9B 4OCMC 4PJHB 4APQC 4TSBL 3VD3A 1CDUA 3IRPX 5EO0B 3HRZA 3MFGB 5TPWL 3QNXA 2Z8RA 5GRXG 1YPZE 4JFDD 1JHLL 1QSZA 4WJ5A 5DK2A 4PGZA 5DFWH 5C70A 2AJXH 5DTFA 2ATKA 2JJSC 3IFOA 3OKKB 3RWCA 1B0RB 4GW1A 1HYSC 2HP4A 1FZJA 4Z0XA 5EWIL 4U0QB 3GSUB 3RWHA 4P5MA 2HJFA 4RMUA 1IC5H 3SGDI 1S7XB 5HVGB 2FJHB 2NY5H 4ODVH 4N0FB 3DX7A 3IU3B 2CDEA 1MLCB 3GK8H 4G8EB 4WW1A 1T2JA 5IHUL 3RX5A 5TQ2L 1WFTA 3OKLB 4HUMB 2X5PA 1LO3H 5F3HA 1J7VR 5C0IA 3EZ8A 4HWBL 4Z7VF 4OCRH 5I1AB 1CFBA 3QQNA 4LARL 4HIEA 3ULUD 2J4WH 4OUUB 3K8LA 1HIML 4LSUL 3OKOB 4G42A 1N5YH 3T77A 1L0YA 5DWUH 4E9LA 4FQQB 2Z0BA 3D0LB 2XT1B 2CLRA 4LCYB 5D71H 3OAZH 4UIKH 3RZCA 3B9KB 1YA5A 4WI5A 4FXKA 4NZUL 3EOBB 4IRJB 5ENWB 2IG2H 1OGTB 4XC3L 4WU5B 2P45B 1TNMA 3KPTA 2AW2A 5DLML 3ECBB 4XAWL 4QGYA 1WFNA 4Q2ZB 3SKJL 1KB5B 4TYUA 3DVNA 1U3ZA 5EA0H 3WIIH 4IM8A 2W92A 3K74B 4OI9A 3MA7A 4JRXD 2F8VA 1J05B 2BERA 2GHWB 1Q0XH 5T3XL 1I7ZB 5GGRY 2C7UA 2G2RB 1WJ3A 5FB8A 4FTVB 1S5HA 1NEUA 5IR1A 1DEEA 1SEQH 3B5GA 3VXOA 1ODAA 5T3ZE 2FB4L 2X4TB 4U1NA 4LVEA 3T0ED 4PJEE 4L29B 1HH9A 1JPTH 1FE8L 2GIYA 1CD1B 4PJ5A 3QG7H 4K3JH 5GRVL 4WIQA 5ICYB 3R1GH 5C0CB 4L3EB 4NQXA 2YC1B 4K7FB 1P9MC 1AQDB 2RBLA 4I18B 4OZ4B 1N6QH 1CGSH 4X9FA 3AM8C 4XXDA 1UZ8A 2XZZA 3KPMA 5DRXA 1VEOA 2PTTB 3WO3B 1XIWC 3P0VH 1GOGA 1OF2B 4H0GA 2H32H 2V7HA 3SO3C 1EJOL 1TPXC 4BQCA 3TPKA 4M1DH 3EAKA 4Y4KC 3O2DA 4Z76B 4FQ2L 4EBQL 2Y1VA 1MFDH 5K59F 1EHAA 1NEZG 1NC2B 3VDCA 1CFNA 3O9WB 4HG4K 3KR3H 3Q6GL 5HYQB 3VFGH 2QADC 1KIPA 3EFDL 2BOBA 2R39A 3CSBA 1YC8A 4FOMA 1N64H 3SE8H 5MEPA 1WBZA 2ZUQB 1YEDA 2C3XA 4RAVA 3GO1L 1F4YH 4R6UA 4EI6B 3MACL 3WO4B 2UUDH 5DJ2A 1I1CA 1PZ5A 4JE4B 5FOBB 3DURB 5SX5K 3BGAA 5A3IC 1MUJB 2Y5EA 4LVOC 3FOLA 4J23A 1LDPL 3N85L 4HXAL 2A9NH 1RHFA 4R8WH 2EDLA 3PV6A 3CVIL 1LVEA 3DSFH 5DC0A 4WUUD 1XT5A 3OMZA 4JZJC 1HNFA 5D7LD 4HUVB 1IRAY 3DRTB 4AIZB 1A3RL 4K9EH 2J8OA 5FA4B 4M03A 2J1KA 2Z92A 3MFFB 3QUXC 4WO4B 1IBGL 1YEGH 1PEZA 2VRAA 3U30C 1T20A 4XWGL 1TVBA 1PJ9A 1VADA 3MRNB 1KCSH 3QHFL 4BA8A 4LAQL 4LMQE 4Q0XH 1EHXA 3BH8A 1RUAH 3SDAB 4BM7A 1GGTA 3BKYH 3VWKC 4JFQB 5SWZE 1H3VA 4M7LT 4MQ7A 5H94B 2AK4B 3F5WB 3FO1A 2UYLA 4NYLB 1R24B 1AY1H 5HI4D 1JMZA 5CZXC 1DBBL 1P2CA 2WQRA 3V5DA 2D31B 1XEDA 2RFXB 4X9IA 1T7VA 4D94A 3EJYD 2W9DH 3DV4B 4QHUA 3L9RA 1N4XL 3GRWL 1X3DA 3TYFB 3ZT7A 2XQYK 4DEPB 2MCG1 4MNHA 2ZUVA 4PRPA 3LKQA 3D0VB 5GS0D 1NLBH 3OX8A 4I77H 2X4RB 4TSCL 1JPGB 5KSAA 2FO4B 2H2PD 3SDDD 5C0EB 1MFEH 1JYXA 3QI9A 2ZZUT 2ESVD 5T1MB 2XWTA 3O2VL 2F8OA 4WFFE 2BXYA 5TE6H 4GRLD 5MERA 2KUTA 3OR6A 3MC0A 3L1OL 4XPAH 5IHZB 1T4KB 2AKRB 3D25B 1UH3A 1FQ9C 3NIGE 2NY3C 3X14A 3WYRA 4DKDC 2AK1H 1G6RH 3PWVA 5DMGD 1QBMH 1NCTA 3IKCB 1FRGL 2HT3D 4LHQB 4E41D 5JW5B 1ACYH 3HRPA 5JHDA 1I7TB 2DTMH 1MWAA 4QOKE 2FIKB 1T0MA 2IQ9L 1EAPA 5GJTH 1A7NL 1J0KA 1W2KT 4PP1C 4Y16D 3EDEA 4JY6A 2VR5A 1AGBA 3RVWD 3QXVA 2FX9L 2VDOH 4XP5L 3H0TB 5I73B 5MI0B 2V2TA 5I75C 4NO3B 3G6JA 4I2XA 1NAMH 3BT2H 4MS8D 5GHWL 3C09C 5EBGA 5IQ9A 2ICCA 3Q5OA 1HHHB 3MBXH 3OAYK 4G3YH 4M8VA 1GGCL 1NMAH 5ICZB 3IYLW 3H2WA 3TJEH 3FO2A 5B38B 4OFDA 4FG6D 3QWOA 3EFFA 4XNQB 1JN6A 5HD8D 1D5ZA 4KDTC 3UTTA 5F1SA 3V4PH 4PJAE 3RQ3A 3V5HA 2WBJA 1UM6H 2ZCLH 1ADQL 5D72L 5J3HD 3B9AA 5D1XB 3QDMD 4LLYB 1JGDA 4HUUA 5I2IB 2FNBA 4POUB 3VXNB 2VWEE 4JFZL 1YY8B 2GFBB 4HV8B 4U6XB 3SGEH 4YDKH 3OV6A 4NQCD 2GI7A 4HFWA 1KT2B 3MOBL 4DZ8B 1I1YB 4UV4L 2IAMC 5IGXL 1LWRA 1P4LA 4MNQA 3QUML 2EKSA 1T1YA 2QEJA 2KPNA 2JK5B 4LKXB 5I18L 1TDQA 2VDRH 1HHGB 4Q9QH 4WI6A 2HVKA 4XNMA 1B9ZA 4AEHL 3N1FC 4XPFL 1OP5K 1RUML 4JQVA 2AEWA 2XNAB 2FECI 2BZDA 3OXRA 5FO9A 1IZKA 1WAAE 3S6CA 1K9TA 1YEKH 2DQTH 5IW1A 1G7QA 4KTEL 4LDOB 3S34H 5ACMA 3OPZH 1OT1A 1NDGA 5LGKA 5TFSH 5GGQL 5E8PB 2IANE 2F54D 3HE6B 3TVMA 4YE4L 3QCUH 1K6QH 1XFPA 1FGVL 3TWCL 2JKXA 5HHOB 4ODTH 3Q5TA 2VL5A 3B2VH 4Z7VA 3T3ME 4JN1H 1FIGH 4RNRB 3ZT5A 1JZ6A 1BREA 4X5WA 5CLWA 4Y1AA 3FTGA 1X6NA 2NY2D 1LEGA 2NMSA 1KN2L 5E8OB 3MLUL 3FQUA 4FXGB 3QIBB 1O7SA 3C6SB 4F3FA 1X4ZA 5F9OL 3X12B 5HBBA 2XV6B 3RUGB 3IXTA 3SPVB 1TNNA 2VWEC 5KVFH 2EDKA 4JDZA 3NAAH 5GSRB 1GPOL 3U1SL 1DQML 5DJ6A 1HWGB 4OZGA 1KJ2B 4XX1G 1K8DA 4NQED 1BM3L 4K71B 2Z8SA 1CE6A 1U8QA 3MRLB 3ZDXE 4AENB 1IT9H 4ODWA 4JO3H 3WFHB 1PZUB 5DVOA 5CILH 4BFEA 3L7FA 1HQ4A 5KTEL 2R1XB 3O2WH 5DS8A 1CCZA 4TUOA 4MAYA 4PY8J 3T2NH 4XP4H 4ZUWB 3O3UN 2H3NB 3P2TA 1U3YA 1FORL 4P2OA 1H3WM 5JDJA 5DDHB 4LSSH 2VN4A 4JFYA 4JVWA 4PJGF 1Q38A 1L0XA 4JR9H 5K9OA 2NY1B 1G0DA 2QQNH 2QQKH 5D2LE 1FL6B 5I6XB 2PYEA 3CFCH 2N7BA 4JJHA 2IBZX 3LQAC 4RA0C 2R4RL 4EN3D 4ZO6A 5MENA 4Z9KB 1S5IL 5EU6A 2VXVL 4HKXA 3REVB 5D2NA 4JRYE 4PJIB 4MJIB 2NY4D 3MV9D 1HXMA 3W9DA 1YMHA 2B0SH 2R29L 5CJOL 4TQEH 2VN7A 5HDQL 4GBXA 3MRKA 4ZPTA 4DK6A 2CDFA 4PRID 3VD4A 2VZTA 3FB6B 4TPRL 5HI3C 4F7MA 4X5LA 2DM3A 1S7QA 4Y4HA 4GG8B 4RGMB 9CGTA 4PV8B 3IDGA 1Z2KA 3KJ6L 4U1SA 5DC9B 3PXHA 2YA0A 1CE1H 4OD3L 5D7IB 1BFOA 4NQDA 4AL8H 3LQZA 4JEGB 5KSAC 3BZFB 5BRZA 2EEAA 5C09B 3NABH 3BZEA 2ZJSL 4LFHD 1PKOA 4OB5H 3ZYOA 3S4SB 3FT3B 3N1PC 4JGUA 4RAUB 4HIJA 4R3SA 1IFHH 2EDDA 1JFQH 2ICEB 3BMVA 2ERJB 4X0KB 3U9UB 4JPVH 4JGJA 5K9JL 1MI5D 1X5XA 4LCIH 5C0ND 3PGFL 1FNAA 3OF6D 3CJJA 4KMQA 5HYSB 3RWDB 4MNQE 1OLZA 3V8CA 1NGZB 2I5YL 5CEZL 5TE7L 1HNGA 4ZFOA 1AP2B 2V17L 2ZOLA 4ZFGL 1G0YR 4KJWD 2OS7A 5LBSH 5F7DA 3TF7C 1MHPL 4H88H 5C07A 1MPAH 3JWDH 5DURD 3MLTB 1H0DA 2D7NA 3FQRB 2F19L 1CBVH 3RBGA 1U3HA 4M1CD 3LPFA 4P2RB 5DK0A 2ICES 3BXNB 4OAWA 1WZLA 3NFNA 2LVEA 4MXVE 3PWPE 1B6DA 5HSFA 5FEBA 4G6FB 1FG9C 2IPUK 5IIEB 1FGNL 5D5MF 4M7KL 2EC9U 1NBYA 4KQ4L 1D5MB 3ARED 3TM6A 4BSVA 4Z7VE 1DR9A 1JP5A 1V7NL 2PR4L 2DQEL 5C0DA 3TBYB 4U05A 5DUBB 4M6ML 3RWIA 1VACB 4JFEB 4W4NA 4LLVB 1XF4B 3AXLA 1FNFA 1HQRB 1E6JL 1LILA 4LOUD 1Q72L 3LKRA 1GZQA 2EDFA 2MQCA 2JE8A 1YNKH 2ZSVB 4PJ7B 1L6ZA 2R0ZH 1U2CA 5JOPE 2F15A 4D3CL 1A14L 3E6FB 3TPUB 1RHHB 5GZND 2VQ1A 1JE6A 1Q94B 1VERA 3MR9B 4G80B 4BQ6A 1MIEL 3HS0B 1KC5L 1OAYH 2MHAB 5JW3L 3DO7A 3BKCL 4M7JL 3VXRD 2A1WH 1I1AD 4ELMB 3RIAF 3NCYS 2Q20A 1CLYL 4ZOEA 3UZEA 3WUWB 2CUMA 3TLRA 5IHBA 4UTAH 3G5XA 5FYKL 1LK2B 3QIUA 3DXAD 2DLEA 5JO5B 4JQVC 1KLGA 1DLHA 2WWMD 5EBLA 1H8SA 3RDTD 3SJVB 2YPVH 4U31A 4D0BB 2BFVL 3EHBD 3OKMA 3HC3L 2E27H 4XB7A 3U46B 1KCKA 4K2UH 3BZ4B 3MLWH 2B2XH 4M8QA 1J12A 4LSVH 4CVZA 1KEML 3TO4D 2IH3A 3DGGA 3PWUB 5SWQA 3DMMB 1MJJB 5TDNA 2JJUA 4GXUN 1PQZB 2NXZC 3UYOD 1QFWH 3JV4A 3JWOL 4LF3B 2BMKB 1D6VH 5K59E 1SVZA 3S97C 3L6FA 1D5XB 4Y5VC 3D18B 3BE1L 5IBUG 4RX4D 43C9A 3H6JA 1IE5A 4ODXA 3BPLC 5DRZB 3FAXA 5IESL 5L7XH 2R56L 1RZIB 1H3PL 3G6AA 4NQDE 3JUZA 1TJGL 1RUQH 4TSAH 1WIUA 3OGOE 3QDGB 3MXVL 1OTTD 3I2CL 3BGFC 3D39B 5DGQA 3W9EB 3MRBB 3QEQD 3VXMD 4I9WE 5JPNA 1G9EA 4KKLD 5J9PA 2VH5H 1UA6L 3NPSC 2ZCKL 1QSED 4KTDL 3NZHH 3K4ZA 1HH6B 3FB5B 4OT1L 3P9LA 4P2OC 4NQUA 1S9VA 3UTZB 1UB6B 1OW0A 4BKLB 3GMPA 5IVXB 3G5VB 3LN9A 1UXWA 3ARDA 4KI5C 3NA4A 1CIDA 3QPXL 5C07E 4O2CA 5JA8B 4D9LH 4NC1E 3INUH 2YEZB 5L2KA 2EYRA 5E56A 2Y06H 2EYSA 3QXAB 2VOTA 4PGDA 2YK1H 5GZOC 2XN9E 1U8HB 5D2NC 1GIGH 4OD1H 4CMHB 4FQXA 3F58H 5DQDH 4MCYA 3EDKA 2XI9A 4OQTH 2CR6A 5H35A 5IK3B 1A6TA 4GBXC 5C8JB 1GC1H 3N06B 4GKNA 1OTSD 3RL1A 1RZJC 4Y4HC 4ISVB 2O5XL 4MWFA 1J0YA 3P9MA 1YN7B 5KS9A 5F88B 1FO0H 3GMQB 5K9KB 3MLSH 4NHCL 4Y2DB 4N90D 5I1EL 1G1CA 4L1DA 4M1GH 1IGCH 2YN5A 3KLAA 1I7RA 3WFBH 1FNEA 4JFDA 3C9NA 5ESQA 3K2MC 1J0HA 1NMCB 4DFHA 4WCYH 4KI1A 5JPMB 3C6LA 5I0DA 1CLOL 3GMRA 5HI5D 5GJSL 3MRQA 1AHWB 25C8H 3Q2CA 5HHVL 1QOKA 4LLQB 3BYTA 4G8GA 5EIVA 5KSVA 3VGHA 4PR5B 1FAIL 2YD1A 5LJYH 2P5WD 4EDWL 1RZFH 4OLUH 3OXSB 4N0YH 4XMPH 4LEOA 1IJ9A 4LVHC 4QRSB 4F58H 2EH7H 1MH5A 1RU9H 4YX2H 3NVQA 1Q9OB 1AC0A 8CGTA 4X6DF 3MCLH 3MUHL 5HGDB 3HKFA 3MX0A 4IRSA 4F37K 4X4ME 1BVLA 2XICA 2FJGB 5E24E 2VIRA 1IL1B 4PJFB 2A74B 3VRLF 4AQOA 3Q48A 1S7RB 3CC5B 3K8KA 4QNPF 1NFDF 3EO0A 4PJ9D 4U6YA 3B2UD 4YR6A 3CMGA 1FC2D 4ONFH 2OJZH 3SOBL 1BIIA 2GUOA 1FVEA 1WWAX 3SQOH 4XP6L 3ARGD 4PJHA 2XFXA 4JRXA 4LEXH 4V2CB 5D7JB 1JNLH 4E42B 2R0WH 3Q1SL 4YHOL 3GBNH 3T08A 3DLQR 5IFHH 3CX5J 1C5BH 3HUJA 4I48A 4LVNB 1UACL 3QNZB 4ZNEE 4QWWD 4OZFA 1CF8L 1P1ZA 4DKEH 1F3JA 4JPKL 4RGNB 3SGJC 5T1LA 5F1NB 4BSWA 4JO4L 1S7XA 2FJHA 1IKFL 4FQLL 4D9QE 3QIUC 4JG1L 5JDSA 1EX0A 3CCHA 1J10A 1HCFX 2H26A 2J5LC 5E9DB 4GKSA 1AKJB 4OZHB 4O4YL 1JNHA 4GKZB 2PW1A 1JGUH 2F8XC 4WY7H 5FYKU 4S1DD 4YDJA 2NY6D 4GLRI 3NFSL 3FQNA 3VRJA 1FP5A 2F9BT 4OUUA 5L2KE 5DRNB 5KVMC 1SYSB 3OKOA 4GQ9H 4MCZA 4JPWL 4U7MA 4OTXH 3BESR 4NM8L 1T3FA 3BIBX 3ARBD 2L7JA 2YS4A 3RTQB 4LCYA 2DLTA 3UAJD 4UTBH 3B9KA 5DVNA 4XP1L 3CFBA 4PV9B 5JLZB 1W72L 2C5DC 3EOBA 3QDAA 4IDLA 2IC2A 1OGTA 4P3CL 5GS1B 4M61A 3KS0H 4GW4A 1TZGH 4K7PH 3HG1B 2XZCH 4WW2B 1CR9H 3C08H 1FJ1A 3FB8A 3IXAB 1EFXD 3BH9B 4YC2C 4WTXA 1KGCE 2VXTH 2VLJB 5IMOB 1I7ZA 4EOWL 1BBJA 5SX5H 1CFSA 4HLJA 4AEFA 5C0RH 3CXHK 1VKXB 2A6KB 3V52H 1IEBA 2H45A 1MFAL 5FUCE 1U95B 4JFDE 2X05A 1YEFH 4V1DD 5KVEL 3TBWB 2YD9A 2AJVH 5DD1L 5DJYB 3HMXA 1KENL 4OCYH 4ODBD 1RY7B 2DBLL 4EEEA 2OTWA 3OAUL 4HXBH 1A1NB 4YGVB 3LN5A 1HXYA 5HPOA 1QFUH 1VGEH 2YC1A 5JQ6H 1OPGL 3G6DH 4W4OA 4OZ4A 4PY8I 4OCLC 1NBZA 3SGEI 3ULVL 4NO0B 1OW0C 2LU3A 4NRYA 5KW9L 4PJGE 3ARDC 3ZSTA 3WFEH 3GMOA 3S96A 3UYRL 1L7TH 2HKHH 2GK0B 5ISZD 3WJLA 5BXFB 4BYHA 3ETBF 2DOCA 3ULUE 1NC2A 2DJSA 5F7EH 4H1LG 1F4WL 1I9IH 3D2UB 4M6OL 3GNML 2FLBT 4LASL 1A6UH 3U7YH 1BQLH 1NJ9B 2GKIA 5FKPB 4FQXC 5FUZH 3RP1A 2FHFA 3WSQL 4CL7A 4LCCB 4GS7B 4MNGB 1SJEB 2Y07H 4ZOBA 4XBGB 2P8MA 1IC7L 3GZKA 4JJ5B 1QTYT 4U1KB 4HWZA 1NC4D 3MBEB 3KPSB 3A6CH 2EDYA 1EK3A 3FFCA 4KZDL 2Q8BH 1T2QH 4L8DB 4RRPG 1OP3K 5DI8A 1MCNA 2GTWB 3GIVA 3I6KB 1TCRB 3PGDB 1F5WA 4P2QD 5E2UH 5C7XH 3HPJA 4ZAKB 5D7SH 4F15C 4JRXE 4JKMA 3G5ZA 4PJ8D 2YPKB 2NXYD 1TJHH 4OIIH 3DBXA 1ZT7A 1FG2A 4QY8B 4HWEL 2QR0B 1T5WB 3MLRL 3JBG7 4UT9L 4AIZA 4WV1A 1RULH 4KRNA 5DUMH 3T0EE 3O6MH 4WO4A 3C6LC 3HUJE 1V7ML 5B38G 3OKDA 4YXHH 3RWGB 1E4KA 1KTDA 2XRAH 1U42A 3SDAA 1Z3GH 4PTTA 4F33A 2HRPL 1VESA 3GMLA 1DBML 4GAYB 3WUZA 3GSVA 1MFCH 1FBIL 4RIRA 1ZANH 3SDYH 5EOQL 2B4CH 5JMRA 4PB9H 5C1MB 1PSKL 1CXFA 4P48A 4YHLL 3OAYH 2XWJA 3GBLA 3V0VA 2RR3A 3D48R 1YY9C 4XZUB 4HIXL 1YQVH 3VD9A 1V3JA 3TYFA 3WXWH 4X98B 5I1DB 1CGYA 4S1SH 2BNQD 1BZ7B 2HYMA 4NNYB 4LCWD 2E7LA 5KOVC 2AEQL 3D0VA 5D5ME 1FZMA 5IBTH 4IRSC 1IGYB 1Q1JH 2FO4A 4NJ9L 2UV3A 5C0EA 1FL3B 3QNYA 5EORL 4KV5E 1I9RH 3QRGL 4DAGH 1AH1A 2ATPA 3VRIB 1JWSA 4F7PA 3CX2A 5DD6A 4Y19A 3C8HA 1I85A 1YQ2A 1JHKL 1MAKA 5F6IC 2OTPA 2ZKHH 4H1LA 4NQCA 2F74B 3O6FB 1T21B 4MMZC 5EU3B 4Z77A 1NGYA 1E4JA 1T4KA 1U8OA 2AKRA 1A6PA 3AB0B 3PP4L 3JTTB 4RDQG 2ZPKH 5DYOB 5A2LH 4FXLA 4HUKB 2H2SD 3MLZH 4OM1H 3IKCA 4I3SH 5EDXA 1HKLL 1I7TA 4JM2D 1RSFA 5EU7E 2H1PL 4KJPC 4E0RA 3PJSA 2ADJB 1ES0A 1DQJA 4WUUE 5EIQA 3RHWF 5D7LE 1OP5H 3G08A 3HI5L 1IM9D 3HZVB 4U1HA 2JTDA 5A16B 4RFNC 3HNTL 5D1ZB 3TJHD 2H32A 4OGXL 3ARWA 4NO3A 4U0RB 4KRPD 5IEHB 2CRZA 2D7QA 4JVPA 2X6MA 2CO6B 1HHHA 3NCJH 3OBAA 4WWKA 5JIHA 3L3OA 4JO2H 4HIIB 4XC1L 1P7QD 1GYAA 2V9RA 3AS0A 5D7KD 3RWEB 1OAUL 2CH8A 5ETUB 5EZOH 7FABH 2RB8A 1I1FB 1LO2L 4B53A 3UPRA 1QKZL 5I1JL 1R5IA 2VDNL 1C1EL 4OGAC 4FQHA 4YPJA 4EUPG 1ZGLP 3NMEA 5IT2H 2G60H 4M4PA 2VC2L 3HR5A 1QEWB 2OCFD 3MRHB 4LNRA 5ANMB 4KXZH 5D1XA 4XMLL 3OQ3B 3B9KC 4HLZH 4B50A 2R8SL 5EZJA 4IRJC 3DROB 5JNYB 4BZYA 4X7DC 3VXNA 1LDSA 2VLRB 2FCBA 4D8PA 5TDPA 4HV8A 4LQFH 3S35H 1WGOA 1YYMH 2GTZB 2WUCH 1AGDA 1RJZA 2ESVE 3X3FH 4DZ8A 5B4MC 2YPLB 2X2YA 5CEYB 1I1YA 1NCCL 4ZO7A 3T1FB 5I0ZA 1A21A 3O81A 4LKXA 3MXWL 3CFIC 4UB0L 4G8IB 3KYMA 4KHTL 3S3JA 4E41E 1RK1B 2XNAA 5I1IH 3OKEB 5J1SC 1U8MA 4XNYH 1M7DB 2J3SA 5ITBH 3D3VB 4A6YB 4LPCA 3KYKL 3QBTB 3QCVH 2OTUA 4NO5B 1UQSA 4J12A 3CSYB 1ULVA 2FWOB 4C58B 2ARJA 4ZODA 5FGBA 1JNJA 3MRCB 4KK5C 3F6IA 2D7MA 3C87A 4HHAA 3AGVA 2VAAA 4HKBA 2PW2B 2XTJD 4L1HA 1BGXH 1KXQE 4JFXA 1AR1D 3QFJB 5HHOA 5HI4C 3VFSA 1NSNL 4WFGD 3F12B 4P46B 3CGTA 5C0CD 3WJLC 3S4SG 2AXJA 5DO2C 2EZ0C 2X9YA 1T5XB 1TXKA 1U58A 3O9WC 4O9HL 1ZVHA 1IC5L 3TIDA 4PRDA 3QH3B 1KBGH 4ODVL 3ZKNC 4ENEC 3SKMB 1FVDA 5DJ0B 5TDOB 3WHXA 3RUGA 1CGVA 1RJLA 1V5JA 3S37H 1LO3L 3VGAC 2A9MH 4L4TD 3QR2A 4OCRL 4AH2B 3O4LD 3QDME 4YHKH 1BZ9A 4LSQH 5GSRA 2ZUQC 2KBGA 1CGTA 1TVHB 5F8QC 3CFDB 1PGRB 2WNGA 4EUPA 1H8NA 4M9PA 5E08L 1DDHB 1VSCA 4XVTH 2HJLA 4K94C 1ZA3A 3WO4C 3MRLA 3GIZH 1MI5A 1PAMA 4NQCE 3WFHA 3V5KB 5DWUL 3TZVB 2R1XA 5L2JB 4QRTB 5D71L 2MWCA 4UIKL 3VGGA 4WVRA 1F4XL 1ITBB 5DZNA 4ZUWA 3QUYB 2H3NA 4ZOCA 1WEJL 4YFLI 5GGTA 1NAMA 2EYTA 1M7IB 4UILL 3WFCL 3U0PA 4HJJH 4G6JL 2FJFB 3IS0X 4WO4C 3D69A 3DUUB 3CZJA 1FL6A 3BIKB 1DANU 1S9WA 3ARXA 3WIIL 4ZDHA 2FEEL 3SDAC 5E5UB 1KJ2H 3EZJB 1Q0XL 5D96C 3IGAB 5HDBE 4QYOB 4RMRA 2XPGB 2GJ6D 4X6BA 1FFOA 1SEQL 2F54E 5L88H 3H9ZA 3REVA 2B8OT 3ME0A 1DVFB 5E00B 5IEKA 4Q9RH 1I1RA 4YFLF 1JPTL 1G9NC 1QSFD 2EXWC 2JELL 3BWAA 2XIDA 5KAQF 2P48B 1IMHC 3QG7L 1MRFH 1KIUA 4HQQL 2CLZB 1DBJH 4AEIH 2R1WB 1KJVB 1PEWA 3IDNA 3FB6A 5DD0H 1HSBB 1SYVB 2XKNB 2XA8L 2IEPA 2AK4D 1CGSL 2L4OA 1NH6A 2E7LC 5CD5D 1EO5A 2RHEA 1F2XK 4XB8A 1CTOA 1HHIB 5IV2B 4KK8D 5ILTH 3L3DA 2DDQH 5D7IA 1AGFB 1ONQB 4FP8L 4NN6C 3CVHH 2OZ4H 2WBWB 2R23B 4L4VD 4TNWF 5LG1A 4YHZH 3VRLE 5HGBA 1BBDH 3V0WL 2COQA 1MFDL 1ZWIB 1FVCB 2NY0B 4HC1A 5FDWB 1KULA 2LU4A 4QNPE 1NFDE 1DQQB 3SY0B 5ACZA 4X0KA 1EEUA 1RUPL 3U9UA 4NQEE 3RX7A 5JZ7D 3VXRA 1I1AA 1QFOA 5E99H 1BD2D 4N8PA 5E2VH 2OQJB 4N9GB 3OKYA 1T0NB 3PABA 1U9KA 2DIAA 4KVNH 4POYA 4QHKJ 1J0JA 1I8IB 1AP2A 3SE8L 4NRZA 2BVQB 1MHHB 5DQJA 3DXAA 2W65B 1F90H 4U1GB 2WAHA 4N0UE 5H37H 2WZPD 1F4YL 3QUZB 4B7IA 1BVZA 2CGRH 4HKZB 5GRWA 3MLTA 4PLKD 1DBKL 4JFOB 1NBVL 4TN9A 3E8UH 1D9KD 4FFWD 5I73C 3QEHB 1OVZA 5MI0C 3WKML 2GK2A 1KEGH 1ROWA 3MJ8B 3OZ9H 4M5ZL 2A9NL 4R8WL 4PTUA 5IIEA 3K80A 4B0MM 4WWKC 1LQSR 4RMQA 3DSFL 2DMBA 5HY9A 1D5MA 2NNAA 1WQVT 3MV9E 1UKSA 1QBLH 4NUJB 3ZYJA 4H0HB 1BVKA 4PY7A 5DUBA 4EQ2A 4ZD3H 5J89A 3VW3H 4LLVA 1XF4A 1JL8A 5I1GH 1HQRA 4PRIE 1R5VB 3QHZH 1WC7B 3H9SD 5GGSA 1AY1L 5D1XC 2J88L 1EUTA 2EIZA 5IFJB 4KROD 5I8EB 5D8JL 2W9DL 2E6PA 3WFDL 5BZWB 4NFCA 1S9XB 3MR9A 1A6WL 3ZKXB 3HS0A 2MHAA 4PRHB 3IJSB 5CIPA 5FGCE 5IMKB 1H3GA 3P40A 1MI5E 1NLBL 1JHTB 3LEXA 4W6WB 5EWIH 3W39B 1HYRC 1XZ0B 4X8JA 2G75A 2QKIB 2GJZB 3PDOA 1MFEL 1NFIB 2CKBB 2FX8L 1LK2A 3KPLB 2A73B 3GSQB 4P4RB 4Q7DA 5DA0B 5GGVY 5IHUH 4U1LB 5TQ2H 1RFDH 1JGEB 1LP9B 4J2XA 1G9MC 4HWBH 5EN2B 3B5TA 4LARH 4S1QL 1SJXA 2NLJA 4IHOB 1RZ8A 4QRRA 2BX5A 1MNUH 4X83A 3U83A 3U46A 4GRWH 5DT1H 4S0SD 4NKOA 1G6RL 1HIMH 4QHNA 1QBML 2RQ8A 3SKUD 5FGBC 3NIDE 5J6GA 1ACYL 3IETB 2XY2A 3MV7B 2D0FA 1PKQE 5GJTL 1ZS8B 2BNRB 4OIAA 3QWRA 3BUTA 1T7WA 2VDOL 4XC3H 1MY7A 4LF3A 1OL0A 4CVUA 4KFZC 1K8IB 1LO5A 4WU7A 1I3UA 1JUFB 1RVFL 3HE6D 1J8HB 4WHYH 1D5XA 3BT2L 3D18A 4LU5H 3SKJH 5BJTB 5JW4M 5DRZA 2HFGH 3MBXL 4Z7UB 4DJMA 3IF1B 1NMAL 3EYSL 1X5HA 1G7LA 1T22B 4X8XA 3TJEL 5T3XH 4LAJH 1RZIA 5HHMB 3QO1B 1MFBL 2BSRB 3ZTJG 2E9IA 2FB4H 5CP3A 4JM2F 4C56B 2D7TL 1WCBB 3T1WA 4GRMB 2VABB 4MVBC 5DK3A 4JFFB 5INDB 3BUYB 5ABDE 3VXRE 3U6RB 1EEZB 4JREC 5F1KC 1MCPL 5J6HB 5J1AB 1HH6A 3FB5A 2VISA 3HB3D 2JIXD 2MKLC 1R3IL 4QCIB 5IJKA 3P0YL 4LLMA 1Q9WA 3O45A 3I3DA 3VCLA 3RVXD 1YUHA 1T1WA 2P5WA 5J0BA 2OL3L 1WBXA 4PUBL 3DXAE 1EJOH 4MDIA 5SWSB 5BQ7B 5FHAH 5I6XC 4EBQH 4M1CC 4FNLL 4XTRD 2PTUA 3QXAA 2BSSB 4TTDC 4U1JB 4GJTB 2G9HB 2VDRL 1J1PL 4RAHA 4CVXB 3GHBH 4MXQC 4OBSA 3Q6GH 2DM2A 4Q9QL 4X80L 4GKOA 4OD2B 3WMSA 2YSSA 4R2GC 4LRNH 5FV1L 4OLZL 4ZFZA 3MLVH 1EBAA 1MHCA 3LRHA 2DQGL 4KKAC 5GS2H 5FHBL 4ZXBD 4BSJA 5IK3A 1R6VA 3QZWG 4FMKA 4QRPA 5D93C 4D0DA 1YN6B 3GO1H 4DUXA 3WIFB 3S34L 1ZMYA 3OPZL 2QJDA 3ZZ1A 5TFSL 5FF6A 4CJ1A 4RGMC 4I0PD 5CKGA 2Y23A 1OGAD 3QB7C 1IGJB 5DEGB 3ARGA 4GW5A 4NSKA 1BAFH 3K2UH 4WGWB 3N85H 4HXAH 5HDLA 3GMQA 3B2VL 3ALPA 3UDWA 4JN1L 5C6TL 4KWUA 2FL5B 4S10A 4XP9L 3CVIH 4F8TA 5GZNC 5JIPA 5CCKL 2DJ4A 3H3BC 3KPRB 2XWBA 2B1HL 2ERJC 4IMKA 1ZT1A 4YFEA 2XOTA 3QEQE 4MD5B 3VXME 4XWGH 1I1AC 3QHFH 2X4PB 4LAQH 3DI3B 3QDHA 1AHWA 4MAUL 1YPZB 2R9HC 1FL5A 1QSEE 1A9BB 2VLKD 4WI3A 3OJDB 1GOHA 3NAAL 5FAAA 1UCBL 3VJ6B 3QO0B 2GYSA 1DBBH 3K0WA 1ERNA 4UMGA 2UWEB 4K3HA 5TJWK 4MJ4A 4PRBA 4AT6A 3OXSA 2DI8A 8FABB 4HW6A 3L3IA 4HAFA 4QTHB 5LGJB 1N4XH 1NLDL 3P4MA 4QRSA 1XF5B 4YDLB 4GAFB 1WISA 5J12B 3T2NL 4XP4L 3GSOB 5E6IA 4UOW1 1HEZB 4ONOA 3V6BR 1LEIB 1DQLL 4MQXD 1AE6H 3SO3B 2QQKL 2QQNL 4Y4KB 2A6DA 1U91B 3CFCL 3CC5A 4WI4A 5C0AD 4NNXB 4G9FD 1E4XL 2AJ3B 4H25B 2ZNWA 1J87A 2VSCA 3L1OH 3FFDA 5F9JA 4FRWA 1YJDL 4ZFFA 4YHMH 4HK3J 2ID5A 1X6LA 4ZYKB 4CN4A 3NA9L 1FRGH 1RMFL 2Z8VC 1LE9A 3QZWA 5D7JA 3RL2A 4N90E 2UZIL 5I1HH 4JFED 1OAQH 1IQWL 4XI5D 2N4IA 3MNWB 3V4UH 2IQ9H 5A2FA 1A7NH 1RAMA 5DMIL 4V1DA 2VR9A 4KKCD 2FX9H 2VDLL 4KKLC 4XP5H 3D85B 5FECB 3LSOB 2CIIA 4AL8L 2DM7A 1DUYA 1OOAA 5F1NA 4XBPB 3JSSA 5TE4L 4X4ZA 4CU7A 4PJEB 1BWWA 1GGCH 1W8OA 1XR8B 3MYZA 4JZJB 2X4QB 5EBMB 3BD5A 3QULA 3TIEA 3QJHB 2Q6WB 5EU4A 2P5WE 1JFQL 4LHUB 3MNVB 1F97A 4YAQB 2M8XA 5ISZA 4Y4FD 5IWLA 3GI8L 5JW4N 4XPBL 3VWKB 1SYSA 1ADQH 1NCWL 1RZJL 4M00A 5D72H 2RJMA 1QNZL 1A3LH 2DMCA 3DGCR 5LBSL 3C2SA 4JQIH 4OGZA 5TH2B 3DMMC 4H88L 1SQ2N 1MPAL 1H5BA 2D0HA 5KSBA 4JFZH 2Z31B 1CBVL 4PYGA 4KJQD 1FFNB 5T3XD 1NC4A 3V6ZA 5GS1A 2Y36L 3GSNB 2Z93A 3HZMA 3LEYL 1XH3B 3MOBH 4OKDA 4WW2A 2CXKA 3BFOA 5IGXH 1D5IH 1UXSA 1G0XA 4OFPA 5I8CB 3V7AE 1AIFB 3I9GH 4BELD 5I18H 5J57B 2H9GB 5IMOA 4YK4C 5EC2B 3CSGA 1MLBB 4ZQKA 5HVHB 4ZFOL 1Q9LB 4AEHH 1NMBL 1RUMH 2A6KA 2Y5TA 2YUWA 4NJAH 4GT7A 4X7SL 2HFFB 3MJ9H 4DQOH 3ILQC 3RWFA 4R0LA 2OK0L 4NFDA 2P24B 3EOYG 1QYGH 2NY3B 3ZKMD 3OR7A 4OF6A 3HRZB 5FGSA 5GGQH 1X5JA 4YE4H 3QDGD 3BO8B 3TWCH 5B39G 5JW4R 1BJ1H 2AV7B 2XKUA 4WJ5B 5DK2B 2Y25A 3EKCA 2ATKB 4K3GA 3IFOB 3WV0A 2L0DA 3MUGB 3RWCB 4DZBB 3K1DA 3I02A 5BS0D 1OAYL 4Q9CA 3VDBA 1CL7L 1BX2B 4UT7H 1QPPA 4J6RH 3QISA 4PREB 3U7AA 1FZJB 5BXFA 2HWZH 3FB7A 5SWZB 1KN2H 3RWHB 4P5MB 5GS2D 2HJFB 3QPQD 4Z7OF 2BNQA 3C09B 1PG7L 4LCWA 3PDDA 2P7TA 5F9OH 1NJ9A 3DX7B 4BQ9A 1WIPA 2CDEB 4WW1B 2DQHL 4HH8A 4CMHC 1NKRA 4LCCA 4MNGA 4CGTA 1J1XL 2CUHA 4HIEB 2FH8A 1DQMH 1HSAA 4U1KA 3DX9A 2CMRL 3WS3A 1T66D 1JCKA 3IRZA 4JM4L 1JPFB 1JPSL 1BM3H 3KPSA 1VFMA 4CADA 3MRIA 4G42B 2B2XL 3T77B 1U92B 3B8YA 4LSVL 2GTWA 5KTEH 3ARGC 3OGCA 1U8NA 1ZTXL 3NCCB 3RZCB 3UDWC 1FORH 4FZ8L 5DRWB 5F7NC 5BV7L 4PRNB 3P73A 4XBEL 4X5XA 2QR0A 3NIFF 1T5WA 1A0QH 3QQ9D 5JA9A 3N1GC 4IMKC 1ZHKB 2PXYD 2VB5A 1KN4L 4V1DE 3DVNB 5DXWA 2FZ3B 3CFJA 3MA7B 3R0NA 1AHWC 5BVPL 4PG9A 2EE2A 3W11D 2C7UB 4X7TB 1S5IH 4F7CA 3JV0A 1S5HB 1KTLA 4TSAL 4ODHH 5IR1B 1DEEB 3MRDA 4QHKI 3TNMB 2X4UA 4ORZC 3HA0A 4U1NB 3M45A 1HH9B 3HZKA 1P7QA 1GL4B 1WFOA 1TLKA 4KRLB 1XF1A 5ISZE 2DMKA 4TPRH 4X98A 1BJ1J 5ADOL 2HT2C 5I1DA 1DP0A 5E6IC 4URTB 1MREH 1BZ7A 4XXDB 1UZ8B 3KPMB 5B39A 5DRXB 4R97B 4UAOB 3ARFD 3QIWD 3RGVD 2A0LD 3LVEA 4LPYA 4HJGB 2ZJSH 3LKSA 4PJAB 4HT1L 1F6AA 3INUL 4EI5D 3C2AL 2Y06L 4H20L 5I8OH 1CFNB 3RVUC 4GAGL 3W81A 1INEL 2YK1L 1T21A 3O6FA 2V2WB 1TTUA 5FUOH 1KIPB 3O3DA 2IPTH 1GIGL 3JTTA 1FCGA 4HKJA 4N0RA 2BOBB 2I24N 1F00I 2WLYA 2I5YH 5CEZH 5TE7H 4OQTL 5LCVL 4P2QE 5DHVA 1NFKA 5MEPB 5D7JC 5F72S 4RAVB 3RPKA 4PJBA 1GC1L 1FN4A 3TN0D 5E2WL 5DJ2B 4EQ3A 1DEDA 1PZ5B 4OI7A 1ZHLA 2WK2A 1HILA 1SY6H 1FO0L 3FOLB 2A6JB 4AZ8A 4YJZL 4RGNC 2BVYA 1CG9A 3F8UB 35C8H 1FGNH 4M7KH 4UDTA 1UEYA 2AI0H 3WFBL 2HT4C 5F1IA 1V8HA 1MFNA 2VLLA 4HIIA 4TRPH 1TCMA 3C60B 1OWRM 3RWEA 4WCYL 2DQJL 4U3HA 5I71B 1OAKL 1T20B 1V7NH 1G84A 1TVBB 2PR4H 1VADB 2DQEH 5EBWA 2YUVA 1F6FB 3BH8B 2JCCA 4XCEA 5BMFL 1Z5LB 3FOMB 25C8L 4TNVK 1U0QA 1E6JH 5C0BD 2J2ZA 1Q72H 2BNQE 2UYLB 5CZVL 5E9DD 1C16B 4LCWE 1AKJD 4PJIF 3RTQC 3IFLL 1P2CB 1H5BC 4MDJA 4HS6A 4L4TA 1RZFL 3DVFA 3JVGA 4OLUL 5JNYA 3PL6D 4OLYH 4D3CH 1VCAA 3BHBA 3FQXA 4QHUB 2VLRA 4LDEB 4F58L 5GS1C 4HMCA 5BVJA 1MIEH 4MNHB 1KC5H 1NGXA 3LRSB 3KPQB 4WW2C 3H7BA 4M7JH 4KY1L 4PRPB 2YPLA 3FONB 2DL9A 3MCLL 2ADFH 3CH1A 4YXLL 1CLYH 2NTSP 3WBDA 1Q8MA 2GT9A 2X10A 5KSAB 5C3TA 4P5TD 2CR3A 1CD8A 1BFVL 4ONGL 5FYKH 3QI9B 4ACPA 3MCG1 1FNGA 1I75A 4AIXA 1P6AB 3GB7B 2VXQL 3ROLB 4OF0A 5MERB 3OR6B 2BFVH 4AMKL 4A6YA 3BJ91 1PY4A 3GKZA 3X14B 1OAXH 1H9VA 1MRCL 2VLJD 3PWVB 2XKSA 4CN6A 1UG9A 2FWOA 3I3BA 3FN3A 1KEMH 3FQWA 5JHDB 1QUNA 1MWAB 3M1BA 4AY0A 4DGIH 3GBNL 5I16A 1EAPB 3QFJA 5IFHL 4IOIA 1C5BL 3BQUB 4JY6B 1AGBB 1YNLH 1REIA 1CZ8L 5EG6C 5D7KE 3JWOH 3RY5A 2V2TB 3G6JB 2X70A 2E9WA 4I2XB 5HJ3B 1M71A 4JRYB 3PHSA 3R4DA 2CSPA 5DZOA 3O3EA 1GJIA 4NM4H 5TDOA 4WWID 3PWLB 2R56H 4LCCC 4GS7C 1H3PH 1TJGH 5K9QG 4L4VA 1JGUL 4AH2A 1RPQA 3QWOB 1BJ8A 4MB3A 2E7HA 1EZVX 1D5ZB 2HMIC 3I2CH 3MBEC 3CFDA 1OSZA 4J4PD 4ZTPH 1HN1A 4QRQA 5CLTA 5HVWA 2WBJB 3PUCA 3IDIB 2FH6A 3V6OA 3SEPA 5J13B 3BP7A 4NWUL 5L6YL 1F42A 2E6JA 1U6AL 5L2JA 4QRTA 4KTDH 1JGDB 4HUUB 4UTBL 2K3TA 4PJ7F 2H2SC 1AFVL 4OT1H 2XXMB 3WIHL 2EEDA 3MV8D 4GRWF 1J0IA 4PGEB 3V9FA 4HJ0C 1CR9L 1QA9A 3C08L 3QPXH 1TFHA 4MNQB 4ELMF 3BIKA 2WIMA 3F6LA 4L9DA 1T1YB 1NKOA 3MLXL 4ZAKD 1MCDA 4FABH 2DL2A 1T6VN 1S78C 3TGXA 3EDFA 2XPGA 1XGYL 2HVKB 4XNMB 5B8CA 2HTKD 1QRND 2BVPA 5E03A 4YO0B 3OXRB 5FO9B 2NR6D 4HZAA 2XTJE 3TA3D 4F2MA 1XCTA 1FYTD 3QA3A 5IW1B 4LLUA 4UUJB 4WFGE 1G7QB 2CLZA 3VXTA 3PWPB 2PO6D 4HXBL 1B0GA 5C0CE 1LMKA 1QFUL 1VGEL 1HSBA 1YMMD 1QG3A 3G6DL 3TVMB 2ILLA 2O5XH 1WICA 1YECL 5IVNA 3PQYD 4XPGL 3H9SA 4Z7WF 1EO8H 1AGFA 1KB5L 1ONQA 4TTGA 2VL5B 5IB3A 4Z7VB 4NHCH 4G6AC 2R69H 2R23A 4HK0B 1B0WA 3DUHA 1L7TL 5JORA 3T4AA 3FTGB 4L4TE 5IB1A 3O4LE 1SM3L 4H26A 5CEZD 2C4FT 1GGYA 3SY0A 1NCBL 3CD4A 3FQUB 4XNXH 1K85A 3O6FC 2VR4A 3WKNA 1DANT 3U7YL 5DQ9B 1A6UL 3BPLB 1R3LA 5GJSH 3RVTD 3UBXB 1S7UA 3IDYB 4N9GA 5E0QA 1T0NA 3E6HA 5HHVH 4GQPH 5JUEL 2BP3A 1AO7D 4LGPB 4JDZB 4FQ1L 1FAIH 3AU1B 4P9ML 2DLGA 2W65A 4OZGB 2VZSA 3A6CL 2IALA 5D9SA 4EDWH 1CE6B 1U8QB 4HKZA 3GMNB 1TZHA 4ODWB 4RWYL 5JXAL 1A7RH 1HQ4B 1M7XA 5D1ZC 3NPSB 4TUOB 5DS8B 4MAYB 4WNQB 5E2UL 5FM8A 3MJ8A 4U0RC 5D7SL 2OP4H 4C4KT 4P2OB 4F37F 4JFYB 1PW3A 1TJHL 4QKXB 4OIIL 5CSZB 3U82B 2DWDA 5IVXF 5K9OB 1AR1C 4DCQA 3FN0L 2GJ6E 3T0BA 2QSCH 4KC3B 1RULL 1MVUA 2LU7A 3O6ML 3RA7L 2X1WL 1I8LA 1QSFE 1FYHB 1N8ZA 2XRAL 4GAJL 5CHNB 2BOCA 3CPLA 2EDWA 3SOBH 5EU6B 1NDMB 3VGFA 2NCMA 4K94L 3G04A 1U36A 4XP6H 2W60A 5LAXB 3SDYL 2AK4E 2BRRL 2CJUL 4YIQA 5C3LD 2CRYA 1HXMB 3W9DB 3LMJH 1YMHB 2AP2A 5JR1L 5HXMA 3JVGC 2IQAA 3Q1SH 4L4VE 4YHOH 4R4NC 4ZPTB 1MCOH 1JZ2A 2VJXA 1F8TL 3ARYA 2CDFB 2VXSL 4HIHB 4OLWL 5FYKD 1UACH 1S7QB 4S1SL 4Y4HB 1PYWB 3IDGB 1CF8H 3CU1A 4U1SB 2E7CA 1RK0B 5T5FL 2HTLC 3V6OE 1BFOB 4NQDB 3LQZB 3PNWB 3W39A 5AG9A 1G7JA 1BD2E 5F70A 5EUOF 4JO4H 1CU4L 4UIMB 2P47B 5TF0A 2GJZA 2PTVA 3BZEB 1IM3A 1IKFH 3ZDZF 1NFIA 4IOFD 4JG1H 2OYPA 4NHUA 2J8HA 3W82A 1OD9A 4U1LA 1BZQK 1RJCA 4O4YH 4R3SB 5BCAA 1LP9A 5C0JA 2IFFL 1FH5L 5BW7A 3VXSA 1FCCA 1LEKA 4IHOA 3NFSH 5SX4H 4ZTOH 1XAUA 3H9HA 2EEBA 3MLZL 4RCAA 4JPWH 3ZYZA 2ZOLB 2GAZA 1EH9A 3IETA 3MV7A 5F7DB 3QWQB 3RKDD 3CFEB 2XA3A 3EJJX 4Z18A 4XP1H 5C07B 4NGHH 2D9QB 3RX8A 3D3VD 4P46C 3WS6C 4P3CH 1U3HB 5FO7A 5EFIA 3CVHA 3BEVA 5DK0B 3RHWK 2OZ4A 5T1KA 4QGTA 4OAWB 5DFVD 3STLA 2XN9B 2BJMH 5C71A 1JUFA 2WBKA 2NYYD 1P4BL 4LGSB 4K23H 1OGAA 2VDKL 1RUKL 1NBYB 3GUTB 3NCJL 3IF1A 3S88H 4JO2L 2P5EA 1T22A 3H9SE 5DEZA 4PJFF 4BSVB 2BSRA 5C0DB 3HTLX 2ICWJ 3RWIB 2AQ2A 1OLLA 2OSLA 1WCBA 3SN6N 1KENH 1ND0A 2G60L 2VABA 4I13B 5INDA 1GZQB 4NQSA 3OAUH 1JNNL 3BUYA 3FQTA 2BVTA 1T89A 5AZ2L 4YUEH 3T0VA 4EJ1C 5KZCB 3MUJA 5J1AA 4XCCL 2VLKA 2YD7A 3ULVH 2VQ1B 3SBWC 3UTSD 2WWKO 3S35L 1DJSA 3U2SA 3UYRH 2PCPA 4P9HL 5SWSA 2VDQL 5BQ7A 1FIEA 3W5NA 2EXYD 3TZVD 1UCTA 1LK3H 3LV3A 2XG5A 5JW4Q 4PLJC 4HCRH 4J3SA 1F3DH 3IFNH 4NRXB 2W38A 4R96A 3QUYD 1UH4A 2G9HA 2AABH 1RZKH 1JWMA 5DD5L 1A5FL 4CVXA 4LASH 3G5XB 1E28A 1A7PH 5B8CC 2J5LB 3ARUA 1DVFC 3WSQH 1KLGB 3UTQB 1DLHB 3T0AA 3Q6FA 2ICWB 4OZHF 5I1IL 1SBBA 1IC7H 1F11A 3OKMB 2BDNH 3T0XA 5F9DC 4H8WC 1KSRA 1YN6A 4Q9BA 5C0AA 3SKOA 4G9FA 1NCUA 1I3GL 4M8QB 3I6GA 3EO1A 5K33A 4CVZB 2IF7A 3TBTB 2IH3B 3G9AB 1WZ1H 3MODL 5SWQB 3ZHLA 3PIQA 3EDJA 5LKNA 2FL5A 3JV4B 3S8WA 4FQPA 3BMWA 5DJ8B 2NY0C 5T5NG 2BY1A 2EIDA 2EICA 1JTPA 4Q97A 2UZXB 3WNPA 4ODXB 4LHUG 1V7MH 5EOCJ 1EXUB 5AWNL 4HWBA 3VU2A 3ZL4H 5AYQA 3G6AB 2W59A 3S37L 1EEYA 2X44D 4G5ZH 2A9ML 4UNUA 4K8RC 4HWNA 1EIBA 1X5AA 3MGTA 1PSKH 4KTYA 1KLUA 3BN9C 5H2BB 2APVA 1IAIM 4YHLH 1BFSA 2ITDB 3J8F7 3NN8B 4HK3N 3RY4A 5JPNB 3KGRA 4KMLB 4XGZA 5LGJA 1RIHL 4Y4FA 4HIXH 4RGOL 1XF5A 4CW1A 4HGMA 3GSOA 5JXEA 1JJUA 3SQBA 3P9LB 3UMTA 4MA3B 1G1YA 2AEQH 1HEZA 1S9VB 3FMGH 3GMPB 3QUZD 3ARDB 5C9KA 4NJ9H 1V3LA 1ZT4A 3CXDH 5EORH 4O2CB 4RISH 3HN3A 1C08A 1I8LC 2QLVB 3VWJD 5L2KB 2EYRB 1NBQA 1JHKH 2EYSB 4WEMB 1KJ2L 4JZOA 4PGDB 3MV11 4H25A 4UQ2A 3SDCA 4Z7WA 1U3JA 3PP4H 3ZT6A 3BP4A 4FQXB 1OGAE 2FHCA 4Q9RL 4MCYB 1HKLH 2ZP0T 2O5YH 1CICB 4ZO9A 3AMKA 3BI9X 4AEIL 2X1PA 2QV2A 3MNWA 4GKNB 4YWGH 3RL1B 3ZKXC 4KGLA 4MWFB 3HI5H 3P9MB 3VA2C 3KXFD 3D85A 5FECA 3HNTH 5ILTL 5IBLD 2DDQL 3BRGC 3LSOA 2K9UA 5F9WC 3O6LL 1U2HA 2GCYA 3N50A 3KLAB 1I7RB 1FNEB 3VDAA 4JFDB 4TNWK 3C9NB 5ESQB 2VLKE 2F5AL 4XC1H 4NUGH 5F1OB 4FFVC 2C1OB 4I5BB 5EBMA 1N2RB 3QJHA 2Q6WA 1OAUH 1INDH 3DETC 5EO9B 4LHUA 5BW7C 5BS0A 3C6LB 1JI2A 4P23D 3GMRB 1LO2H 1QKZH 3L3JA 3MPCA 5I1JH 5E2VL 4LSDA 2VDNH 3MRQB 1C1EH 3MRPB 5HHQB 4LP5A 4G8GB 4KVNL 5KSVB 3ZHKA 2VC2H 3FHAA 2X9WA 3VGBA 4C59B 4XMLH 3ILPB 1ORQB 1BEYH 5TH2A 3CDFA 1OHQA 2R8SH 4XHJC 4KKNA 4QLRA 1Q9KA 1DN0B 2LVCA 4HF5H 2Z31A 4KH2A 3GEWB 3H7LA 4P99A 2XXCB 1KEGL 3EYOB 2D2OA 4QT5A 5C0AE 4TUKH 3TBSA 4G9FE 4BZ2H 4JKLA 1NCCH 2Z35B 3H3KA 4IRSB 5I8CA 1C8PA 2H9GA 2VIRB 2Q3ZA 5EC2A 1MLBA 4NC2B 2IPKA 4GXVH 4LLDA 3CDYA 4UNTA 2DLFL 3EO0B 2I60L 1OM3L 4YR6B 3ULVD 4JFEE 4K3DL 1BOYA 5I1GL 1BIIB 1FVEB 2HLFD 2P24A 2DKUA 3BGMA 2FEDD 3ZO0A 2XFXB 3RU8L 4ELKA 4JRXB 4XAKD 3PE9A 3GMMA 3DYPA 4PJDF 3GRWA 4IIQA 1JV5A 3BO8A 3RWJA 4ZS6D 5CBEA 3V95A 2AV7A 4C56D 2C9AA 1XGUB 4XWOC 5EIIB 5F89A 2IWGA 4GRWE 4N8CH 1JYVA 1NSNH 3HUJB 4I48B 3MUGA 4OZFB 1DQTA 2R0LL 4DZBA 1WT5A 4JFFD 5HGGS 5EC1A 3OL2A 1BX2A 4APQD 4PREA 5FKAA 1AXSB 5IF0B 4RFNB 1P1ZB 4ELME 5SWZA 1QLFA 1UADC 3OHXA 1F3JB 1K4DB 5IROA 5T1LB 4O9HH 4BSWB 2QQLH 4GMTH 5GGVH 2LAGB 1FNSL 3EJZC 3UBXI 5JDSB 1JF6A 3CCHB 1KYOJ 2H26B 2J7LA 4GKSB 3ROOA 5I66B 1ZE3C 1RFDL 1JNHB 2ITCA 2PW1B 5A2KH 1HYSD 1HE7A 2DBJA 4C4KO 4M5YL 4M6AA 4KQ3L 4YDJB 3FQNB 3VRJB 1MNUL 1MJ8L 4HDIB 1JPFA 4EI5A 5E08H 5DT1L 4OCXH 3IJHA 3MYJA 5T3XE 5D5MB 4C54A 4MCZB 1OTUC 1U92A 1T3FB 3HI6L 3MOAL 1E27A 2O5ZH 4KK9C 2DLHA 4Z7WE 3U9PL 4DK3A 1F4XH 3VXPB 3CFBB 3TV3L 4NO2B 5DRWA 4M7LL 1WEJH 4PRNA 3NCYP 4JZNA 1CQYA 3O8XA 4UILH 4M61B 3WFCH 4GW4B 4G6JH 3TN0A 4CKVX 1VB9A 4W81A 3E3QE 1FJ1B 3FB8B 1ZHKA 4PJXF 3HC4L 4LU5L 4C83A 5LQBL 2HFGL 3SDXA 2FZ3A 4RFOL 1EHLL 1C7TA 1BBJB 5IB5B 4X7TA 3R0MA 1CFSB 4QOKA 3IAPA 3TNMA 3VFPB 1IEBB 4WUUB 4FFZH 5D7LB 3KPRD 3HAEH 4Z8FL 3LKOB 1ADQA 3DUSB 5IMMA 2JELH 2VZ3A 3GJFK 1E6OL 4HQQH 3VFUB 3G5YB 5BS0E 2OTWB 3TP4A 5FYLL 4MXWH 5DMKB 2DKMA 1HXYB 3LN5B 4YDLC 5J12C 2XA8H 5JXEC 3CH8A 1NBZB 1URLA 1WWCA 4MZ3A 4PP2A 5C0BA 2V5MA 4NRYB 5J06A 1Q0YL 4FP8H 1U8PB 2GSIB 3GMOB 3REWA 3S96B 4OZIA 4WI7A 3QUMA 4HJGA 3V0WH 1OSPL 5FHAL 3PL6A 1PDKA 4PJAA 1MVFA 1RUPH 1ZHBB 3PP3K 3GHBL 5EPMA 2F53D 1XIWD 3SDCC 2BRQA 4PD4K 2V2WA 4JPIB 1BF2A 4LRNL 3MLVL 2BVOA 5LXGL 5M7QA 3TH4T 3VGAB 2P8MB 1N7ML 5ACLA 4Y4KD 3LPWA 4BZ1H 1UVQA 1N59B 3C8KA 4HWZB 4OFVA 1VFBB 2NX5D 4YEFA 2ESVB 1HINH 3P9WB 1MJ7L 3FFCB 1MCSA 1DBKH 1NBVH 2WMPA 1B3JA 2QADD 3WLWC 5DI8B 3FCTB 3GIVB 3O2DH 4HZLB 1UYWL 1BAFL 4N0CC 3K2UL 3WKMH 5FDYA 2A6JA 1BQHA 3GGWA 3HPJB 4S1RH 4W6YB 5CJXA 4M5ZH 2AEPH 3LPGA 3G5ZB 5EUOE 3MCKA 4M4RA 3DBXB 1ZT7B 3ZDZE 1FG2B 4MJ5A 4HUWB 1WAAA 1FV1B 3ARRA 4WV1B 4Y16B 3C60A 2O61A 4U49A 3OKDB 5A3ID 3S98A 2IADA 1KTDB 3B9VA 2IANA 1Z5LA 3FOMA 5F7YC 4Z95L 5IKCA 3LEVH 4PTTB 5D96B 4F33B 3GMLB 3UPCA 3GSVB 4M62L 4RIRB 4LDLB 1C16A 2J88H 5DVLA 1XGRA 1IZJA 1GAFH 3QUXD 1IEAA 3K7UA 4F7TB 3LS4H 4KMTL 3AAZA 2XWJB 5D8JH 2Z31C 4YDIH 3V0VB 3WFDH 1P69B 3P4OA 1A6WH 4J4PA 3BP6B 3LRSA 3KPQA 4KUZL 3FONA 5KANG 2F58L 4J3WA 3UTPD 1FZMB 4PB0H 3O6KH 5CZXD 4NN6B 5AZEL 4PGCA 3QDMB 1JF5A 3V8OA 3LQAH 4LLWB 1AE6L 1M05A 3CLFL 5DR5L 3QNYB 2ATPB 2FX8H 1JWSB 4X6CF 4F7PB 3A6BH 5HVHC 1GGIL 5DD6B 4Y19B 2V7NB 3MV8A 3MMEB 4H1LB 2ICWI 1UENA 4NQCB 2I07B 3GB7A 3ROLA 1SBSL 3T2QA 5GGSY 4Z77B 4S1QH 1NGYB 4KK6C 4R26H 3E1F1 1U8OB 4R7NB 4YHML 5DHXB 2CUIA 5MHSD 3SDXE 2HLAA 3O0RH 1KPRA 4PJCA 4U2YA 5HGAA 3ZE0F 2Q8AH 3SCMA 2X4OA 1KIQA 4Z0BL 3BPCA 4J3XA 5I1HL 1OT2A 4E0RB 1HDMA 3N1QC 1OAQL 3L7EB 3PJSB 5D2LA 3EW3B 3V4UL 1CIUA 1QRNA 1ES0B 1DQJB 3HE7A 3BQUA 1WT5C 3ARTA 3G08B 2VL4A 1FYTA 1QR4A 2HAZA 4U1HB 2CK2A 3TO2A 2BHZA 2Z8WC 2H32B 4NP4L 4LP4A 5MEQA 1X7QA 2PO6A 5E8EB 1RVFH 2DJUA 3PHOA 5HJ3A 4JRYA 4HULB 1ZHNA 4WWKB 5C08D 3PQYA 4BQ8A 3L3OB 3EYSH 5C0BE 3UBXG 4JVUA 3RNKB 5A40E 4PP1D 3PWLA 5E9DE 1MFBH 4DTGH 5SX4I 4F7EA 4OZIE 3UPRB 4LPWA 1R5IB 2NY2B 4G7YH 1RZ7H 4U1IA 4FQHB 1RQ5A 2D7TH 2JJVA 3VMNA 1QQDA 3MGAA 1QR1B 3IDIA 4L8SA 3HR5B 4LNRB 1A3LL 1S9YA 2BSED 1A64A 1ZLSH 1P7HL 5EUKA 3RZCC 4JQIL 3HMWL 5I15L 1MCPH 5EZJB 1B4RA 1JZ3A 4JN2A 1R3IH 3KPNB 4S2SA 3P0YH 6FABH 5I76A 5JIKA 3U4BH 1NFDB 4D8PB 5TDPB 2QHLA 3O8XC 2OL3H 4PGEA 4PUBH 4NQEB 1AGDB 1RJZB 2WM0A 3TN0C 4WFHD 4FN0A 1BJMA 4M48L 4JHAL 1UWEL 1D5IL 2R4SH 4M6NH 3PGCA 1MIMH 4FNLH 3I9GL 1UT9A 4MJ6B 5BOZG 1J1PH 1NUFA 4PJDA 2VLJE 3E0GA 4X80H 3KYMB 2ZUXA 4N0UB 2X4SA 4DWHA 2V2XA 3QQ4A 1WZMA 4OLZH 3KLHC 4NJAL 3CNKA 1C5CL 3D6GA 3HFMH 4DQOL 3MJ9L 4YO0A 1U8MB 2CLVB 2DQGH 2AERT 2IAMD 5FHBH 3X11B 5B21A 2P46B 4U3CA 1U8LB 4UUJA 1WBYA 1TJIL 1P5VA 1QYGL 2OTUB 3PWPA 1UQSB 4EN3B 5F71A 2XY1A 4YNYA 2ARJB 1I3VA 2MQ3A 2X7LA 2DYPD 4R97C 1T6WA 4HHAB 2VAAB 4HKBB 4UAOC 4U3XA 5BZDA 1WUNT 4JFXB 2PUQT 2NY4B 1NAKL 3MV9B 4U7SA 3MRFA 3S36H 3VFSB 5C6TH 4HK0A 4PJ5D 4XP9H 4ESKA 4UT7L 1MCCA 4J6RL 2EDBA 4NT6A 3LZFL 2HWZL 1N6UA 5CCKH 2RCSL 3TEUA 4PRIB 4ODUB 1U58B 2B1HH 4X9HA 3TIDB 4PRDB 3ULVF 1DSFL 5DQ9A 3F7YB 1FVDB 2K7PA 3UBXA 4Z7UF 2ZUWA 2P43B 3WHXB 1UZ6F 2DQIL 5GSVA 1RJLB 3IU4H 4MAUH 1CK0L 2J8UF 1BZ9B 4YZFE 4N68A 1FNLA 2G5RA 1UCBH 3AU1A 3KLSA 4EUPB 1T03H 5CJBA 4DUVA 1F45A 2HJLB 5FGCB 1KFAL 3MV8E 1ZA3B 4PJXA 5D70H 3GMNA 1MI5B 1NLDH 4U7KA 2QSVA 1AJ7L 4WNQA 4JREB 5CJXC 4OJFH 4UOW0 5ICXA 1D5BA 1H15B 3TYGL 4PJCE 5CSZA 1NAMB 2EYTB 4BK4A 5C0FA 1FPTH 1DQLH 1A0QL 3U0PB 3C60C 3BD3A 5DURB 3D69B 3KYAA 5DSCA 5I71C 3O4OB 1QRNE 2OX5A 5E1HB 1XGPA 1S9WB 4XVUC 3MLYH 5D1QA 4ZDHB 5HYEA 1FYTE 2EKJA 1ZSDB 1E4XH 5CHNA 1KELH 4MD0A 5I74B 3QFDA 4P4KA 1DQDH 1NDMA 2OXHA 4ODHL 3ARVA 2HJKA 1FFOB 1YMME 4X6BB 1PKQB 3WDIA 1JZ7A 1BWMA 1YJDH 4R2GB 5LAXA 5IEKB 3GKWH 3PQYE 2YUZA 3BWAB 3NA9H 3NTCL 1RMFH 3AREB 3ULSA 1A47A 1YEIH 3C5JB 2UZIH 5E6YA 1DFBL 4UINL 5D93B 2ZSWA 1IQWH 3NACL 5EO1A 1S7SB 1O5DT 3IDNB 4HIHA 5HPMB 5DMIH 4J4PC 3BKJH 4ZUSA 1MREL 5CEZE 2VDLH 1PYWA 2R0KL 5IHLB 1RK0A 1KJ3L 1KPVA 3L3DB 2IMNA 5AD0A 3EYUL 1H3XA 1FDLL 3D9AL 3PNWA 3BYYA 2G5BB 2HG5A 4UU9B 1I8KA 3L3GA 3WN5A 5TE4H 4UIMA 3C5ZD 3GM0A 4S11A 5HGBB 1K4CA 3QI9C 1AO7E 3W5MA 5HI3D 5F7WC 3IAQA 5I8OL 5ACZB 2DS4A 3WLBA 4ALAL 4PRPD 2GSGB 2Y7QA 1IAMA 4Z7NF 3VXRB 1I1AB 5E8DL 2NW2A 5FUOL 3GI8H 2IPTL 5KSAD 4XPBH 3PABB 2NQCA 4NN7B 1YPZF 1N3NA 1NCWH 1RZJH 1HHKB 1QNZH 4NRZB 3SCMC 4PJDE 5DQJB 3DXAB 1Z0MA 3IVKA 2QBWA 3CFEA 2NY7L 3RDTB 3HE7C 3BQUC 1W0WA 2UWEF 1KLFA 2HFEB 2WP3T 1W0YT 1SY6L 3QCTL 2Y36H 1T7XA 2PO6C 4JB9L 3LEYH 4X6EA 3TESA 2XN9A 3IDJA 4HH9A 35C8L 4PTUB 4KDVA 4TUJB 5JHDD 2AI0L 3GUTA 4N5EC 4Z78A 1U8JB 5HY9B 3ZSSA 3L3KA 4TRPL 2NNAB 4MLSA 3T0WA 1M6OA 2VUYA 3KHOA 4U6VL 1NMBH 2UVFA 2X40A 4FS0A 4PY7B 1BVKB 3DNKA 1JTTA 4X7SH 1U8KA 2WBJC 5CMAA 2OK0H 4J3OC 4AG4L 3MRMA 5J13C 5FYKE 3DI2B 4S0TD 5GGSB 2BXZA 1ITCA 4QXGH 4POZD 5I9QB 2EIZB 4X6CA 3TBVA 4FQJL 1KIRA 1IAOA 4OLYL 3UTTD 5ERWA 2BSTA 1LO0L 4OFIA 3VXMB 3U0WH 3W0WD 4BFIA 3KVQA 1CL7H 1CXIA 3NFPA 1A7OL 5CIPB 4L9LA 1F4AA 1UWGL 2M26A 3LB6C 4PJXE 2ADFL 2BNUA 5TQ0H 3LEXB 4GOSA 4M93B 4NRXA 4X8JB 2G75B 3LN4B 4WEBL 1PG7H 3PDOB 4U1MB 2XACC 1WWWX 3LAFA 3OJ2C 4PJEF 2DQHH 2ZOKB 3UTQA 2B5IB 4ZO8A 2RAMA 2ICWA 3UXFA 1J1XH 4XVSH 3P30L 4LSRH 2NLJB 2CQVA 3M07A 1JRHL 1NCDL 2CMRH 1RZ8B 4QRRB 3TCLA 5LVEA 3D3VE 2ENSA 4JM4H 3VWJA 1CFQB 1JPSH 1OAXL 4NKOB 4QRUA 4QHNB 3TVMC 5J6GB 3CFKB 4X4MA 3TBTA 5I1CL 4NZTL 4DGIL 1ZTXH 1ORSA 4KJYB 4YBQC 5DJXA 1IC4L 4FZ8H 5BV7H 1YNLL 2Z9TA 3QEUB 4GG6F 3KPPA 4XBEH 4R4FH 4N5UA 4WU7B 1LO5B 5DJ8A 4YH6A 3GJEA 4Y0GA 2EDOA 4IEFB 3B43A 1KN4H 3GFUA 3JTSA 4A6YL 3IDYC 1EXUA 1G7LB 4NM4L 5BVPH 2X1OA 5I17A 1YNTA 2X4NA 1CT8A 1VGKB 4YK4B 5DFTA 3HHRB 2NXZD 3EOAB 4K07A 2EDXA 4Y1AD 3R8BB 3QDJD 4IOFC 4OSUL 3MSPA 1BLNA 4OFYD 5H2BA 2FSEA 4ZNEA 2JLLA 4ZTPL 2ITDA 4NIKB 3UTSE 4EZMA 3NN8A 3GSWA 4MQTB 4P23A 1G7HA 3P4NB 1A6VH 1R3JA 2LAAA 1W72A 4MAYC 3GI9L 5ADOH 2DIJA 4N1CA 2VISB 4MA3A 5GS3A 4HMEA 1AQKH 2QQQA 4XXCA 4LLMB 1Q9WB 3O45B 3VCLB 4IDJH 5E4IA 1YUHB 1T1WB 2P5WB 1WBXB 2IH1B 4MDIB 1XF3A 5DGRA 1UJ3A 2FEEI 4HT1H 5D1QC 1D3CA 4AM0A 3C2AH 3VXUA 4H20H 2R15A 1Y0LA 5DFVC 1FZOA 4FABL 4GAGH 1INEH 4P2OD 4WEUD 4P4KC 2YSSB 2FD6H 2APXA 4KI5D 1ZEAH 1KPUA 4ZFZB 2HH0L 4YXKL 1MHCB 4XCNA 5LCVH 3DARA 3L5XL 2PYED 1CICA 3AS1A 4QRPB 4D0DB 5C0GA 5MEND 5E2WH 5ESVA 4A2LA 4XMKL 5GZOD 1UGNA 1TZIB 5EU6D 5DJDA 5FF6B 3RPIA 4XPTL 43CAA 2EDJA 4K7PY 4OZFG 2JB6B 2V6HA 3O3AA 3ARGB 4GW5B 4NSKB 4HWUA 2NZ9C 1EO8L 2FHBA 4A2MA 5J56B 2R69L 2Y4SA 3I50H 2APBA 1X44A 5EH1A 5T33H 4GBXD 4XH2B 1D6EB 4X6CE 2C1OA 4I5BA 4Y4HD 1N2RA 2XWBB 2DQJH 1ZT1B 4XNXL 1OAKH 5EO9A 4L8CB 2MCPL 3GHEL 5FV2A 2LE9A 3ISWA 4TNVF 4APQA 3VXQB 4CU6A 5BMFH 3MRPA 5BRZD 5KJRL 5HHQA 1MCKA 1ZLVK 2LFGA 1FL5B 3IS1X 3V6FA 3K4AA 2NW3A 1L0QA 4PJGA 1ZA6B 2VXUH 5CZVH 3ZE0E 4JANA 4R4BA 3EYQC 2FGWL 3IFLH 3GSXA 3MJ7B 3ILPA 1ORQA 4JFPA 4PRBB 4AT6B 4NC1C 1MCRA 5FCUH 1DN0A 1HKFA 1G7PA 3L3IB 1VPOL 1U3HC 1AC6A 3P4MB 1A7RL 2YN3A 3CZFA 4I3RH 4EIGB 1QLEL 3UJIL 5E6IB 3EYOA 2OP4L 4CNIA 4KY1H 1S3KH 4YXLH 2YWYA 1B2WL 2Z35A 3A67L 4KAQL 1EFQA 1Y6NR 1RZGB 1KG0A 2ZNXA 2QSCL 1BFVH 3LKNA 4ONGH 2A6DB 3I75A 4NWTL 5EOTB 3I6LD 4K8RL 5BO1L 1KB9J 4LCUA 4KHXL 5INCA 2VXQH 4JQXA 3VFRA 2HN7B 2IFGA 4AMKH 5FOJA 3FFDB 5F9JB 3OSKA 4F57L 4ZFFB 1MRCH 4I4WA 3KXFE 4NKMA 3LMJL 3BN3B 2WIIA 1LE9B 2AJYL 3D87B 3QZWB 3RL2B 4N8VG 4ZUVA 3RAJL 4RMTA 4P2YA 1MCOL 3T0EA 1XGUA 5EIIA 4V1DB 1JMXA 1CZ8H 4Y8AA 3LDBC 1DZBA 4NN5B 2X1XR 4L9LC 1AXSA 5IF0A 2CIIB 3U4AA 3MUY1 2VAJA 3U48A 1K4DA 3GJFH 1DUYB 2F5BL 4JHZA 5DJZA 1KCRL 3Q5YA 1X5FA 1F13A 3RGHA 3T65A 4NCC1 5I66A 3DX8B 3QULB 3TIEB 1MCFA 5EU4B 1S8DA 3P0GB 1QHOA 1EDQA 5CJ5A 5ISZB 5LWYL 4CU8A 4EKXA 4PRAA 3VWJC 4ZTOL 4LKCB 4HDIA 1P9MA 2DAVA 5D6DA 3WNOA 1EUUA 2DQDL 3DYOA 3VXUE 5D5MA 4JKWA 1K5NB 3QIUD 4CDGC 1ZGLA 3PWJA 1CYGA 4NWUH 5L6YH 1KUMA 2APFA 3T3MF 1U6AH 3PP3H 5GRUH 4PLNC 4BH8A 3VXPA 1AFVH 1H5BB 4NGHL 3WIHH 4Z7QF 4OI8A 2AGJH 4NO2A 5KSBB 3LY6A 2AXFA 2CKBL 1NC4B 4OV5A 3V6ZB 1FNHA 1C5DA 4U6HB 2D7PA 3ARQA 3UC0L 2C3GA 2Z93B 3HZMB 5HYJD 4PIRF 2BJML 3IDMB 4MSWA 1UXSB 2X42A 3ULVE 4K23L 1BQUA 2JB5H 2D4FA 3S5LA 1ETZA 2AVGA 3BSZL 3MLXH 4M43L 4NKIL 4P2QB 3S88L 1UZ6E 4WI9A 1MHEA 3UX9B 3UZVB 5IB5A 4XAKE 5F9AC 4ZQKB 2J8UE 5IP4A 1XGYH 2NXYB 3CU7A 5AYUL 3VFPA 2Y5TB 3EYFB 4WUUA 5CJQH 2EDNA 5D7LA 3ZDXF 2CO7B 3LKOA 4DN4L 5E7FA 3DUSA 3RWFB 4C56E 4JLRB 4R0LB 2OR7A 5ID0A 3VFUA 1KF9B 3I84A 3G5YA 2LV4A 1T1ZB 1VA9A 3OR7B 4JFFE 3QSKB 4UOJA 4DKFH 1XGTB 5DMKA 3FT4A 3T8XA 1EGJL 4YUEL 4DVRL 3CDGA 1R3KA 3CMOH 1X5YA 1YECH 3OTTA 3PDGA 3GSRA 4N8VA 5CSBA 4XXCC 1A4JB 1CDIA 1P84K 4XPGH 1KB5H 3WDJA 1U8PA 2GSIA 3QUXA 3I02B 5ITFB 5L8JB 1UJ3C 3FB7B 1LK3L 1SM3H 1MRDH 4HCRL 1K3IA 4JO1H 4WGVB 4HFUH 3IFNL 3G6JF 4P5KA 1NCBH 2BNQB 2AABL 4RQQB 1RZKL 1OP9A 1ZHBA 2BHYA 4LCWB