1UYWH

Crystal structure of the antiflavivirus fab4g2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
218
structure length
218
Chain Sequence
b'VQLQQSGPELVKPGTSVKISCKTSGYTFTEYTIHWVKEAGGKSLAWIGGIDPNSGGTNYSPNFKGKATLTVDKSSSTAYMDLRSLSSEDSAVYFCARIYHYDGYFDVWGAGTAVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB ANTIBODY HEAVY CHAIN
publication title Crystal Structure of the Antiflavivirus Fab4G2
rcsb
molecule tags Immune system
total genus 39
structure length 218
sequence length 218
chains with identical sequence M
ec nomenclature
pdb deposition date 2004-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uywH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uywH02
2IAMA 2WBJD 2WBKA 1ADQH 4OZHF 5FECA 2FEEL 2QSCL 1RV6X 4APQA 3H7BB 5FCUL 2MNUA 3EOTL 4GAGL 5ACMA 1QP1A 4WU5B 1KOAA 4UNVA 3OKDB 5A43C 3FT3A 1N5YH 5J11C 2Y7QA 5BRZE 3MFFA 4ZFZA 3GMPA 2P24B 4LPWA 2WWKT 2BNRD 4TUOA 2OTUA 1HOCB 2B5IB 2IH1B 4AEHH 1FHGA 1NBYA 2VMFA 4X0KA 2AK4D 4TQEH 3IJSA 3VXMD 4EQ2A 1REIA 1ZKAA 4C83B 5IQ9B 2J5LC 3AROA 5KN5B 4OGAD 2KKQA 4Y4HB 3A6OA 4KJWC 5FGCE 4LHJB 1I4FA 3P3YA 3HE6A 1NCUA 3BEWB 1CFSB 3H42L 1AQDA 4HIHB 3N1FC 3PGFH 4KGLA 1YMHA 2ZCLL 3Q48A 5D1XB 1U3HC 1MCWM 5FKPB 4PJ9B 5H35B 1LEIB 4X4ZA 1MCNA 4G8GD 4LGRB 5DYOA 1RULL 5I19H 5HYSB 1VGKA 4JRYD 4QF1B 3MRRB 1JIBA 3KJ4C 4LVEA 4JKLA 3Q6GH 5T1MA 1KELL 1A6TB 1F00I 1TMCB 5HPOA 3CUPA 2XWBA 1CDGA 4UQ3B 4ELME 3MA9L 2NY3C 2GHWB 3BI9X 4YC2B 1F5WA 3KPTA 4QXWA 5DT1L 5TH2A 1UCBH 4FFZH 1G7HB 1YY9C 1RJZA 4DVRH 2I24N 3F7VB 4JPVL 1AY1L 5ICYB 3QWRA 2Y36H 3NFSH 4LLQA 3FN0L 1HI6A 4EDWH 3WXWL 3NBNA 3MLVH 1A47A 3VJ6A 5GRUH 2HLAA 1FFNA 1KFAH 4QGTA 4I3GA 3HUJA 4ODUA 5IW6A 2QADD 1G7LA 4H5SB 1JTOA 2D9CA 4M7ZB 1DEDA 3QG6A 4LLMB 2B5IC 5T33H 1HKLL 5BQ7A 2F8VA 8FABA 5HXMA 3LZFL 4JY5L 4OD3L 4LP4A 3RHWF 3DROA 3S5LG 2XQBL 1AR1D 3D0VA 3P40A 4Y4HC 2APXA 4BH8B 4HCRL 1RJLB 1JHTA 4UBDD 7CGTA 5E2WL 5GS2H 5I1AB 3HZKB 2H26B 3TBSA 5INCB 1FJ1A 3O3UN 5D71L 4LQFH 4Y2OA 5FK9B 5EORH 1ZS8A 1BWMA 1JRHH 4C59B 5DD0H 2DWEB 5D1XC 4DEPC 4TPRH 4D0CB 4KVNL 4UDTB 4PJ9C 2O93L 3BPNB 1BZ9B 3CX5J 3D18B 4D9RD 4P5MB 4TUKH 1SEBA 5CP3A 5GGSY 4ZNEE 3GMMA 3OF6A 3QCUH 3ROLB 5I76B 4J3UA 5T3ZD 1TZGH 4U1GB 2HG5B 4G7YL 4NGHH 2JB5L 4XPBL 5D7JB 2H9GA 1G9MH 1I75A 3S96B 3VH8A 4OCWL 1L4IA 4YC2C 1FNGA 3ULUD 4P3WA 3FAXA 4PREA 4LCUB 1CG9B 5FYKD 4XP5L 3VFUA 2FB4H 3HZVA 2H6PA 5L8KB 4NQCD 5D7LA 3VXPA 2APWA 1A14L 5L88H 4IHOB 2BHYA 5HHQA 3WUZA 4PYGA 5DJ8A 4OBSA 2SEBB 5L2KB 3GJEA 3PWLB 4XCCH 4NKOA 2OK0L 1C5DB 5C6PB 4M7ZC 1I8KA 1CDHA 5DRZA 4YHNB 1QLFB 3IXAA 1WGOA 4XNZB 3KPQB 2Q3ZA 1P1ZA 4HZLA 3MV8E 2AXFB 1INQB 1VKXB 5C0BD 2AERT 2Z8WC 5FGBA 2CMRL 4JFFD 4YHKH 4RISL 1VGEL 1CXFA 3I84A 3WKML 3RL2B 1MREL 4ZUUA 4JFQA 2HTKD 1NAMB 1VEOA 1G7JB 3GBNH 1FVCB 3UJIL 1R24A 1A7RL 1D5MB 3WIIH 1ZA6A 4I2XB 3QQ3B 3H3PL 2VLJE 2FD6H 3LS4L 2VLKE 2O5YL 5FGRA 5EU7C 1DQDH 3FQUB 5E6YA 4J3SA 4C57C 2PO6B 4W81A 1QKZH 4KWUA 1S8DB 5IMOB 1EVUA 4ALAL 2ATKB 5LAXA 4HS8L 4JFYB 5C07D 5CZXD 4JHAH 5GJSL 4U1GC 1GGUA 1XCTA 4L29B 4DKFH 5T5FL 5I1JL 1XF2A 3HMXH 4PRIE 3ZHLA 1KTDB 4HCRA 4PJGE 1MVUA 4WWID 5HPMB 4PJHE 1I9RL 3TA3D 2YKLH 3CU1A 4KK6D 3BPCA 5BRZB 4CGTA 3BYYA 4TVPH 3VXSD 1SJEB 5EU5B 2FATH 2FR4A 4CNIB 4LRIA 4MS8C 4PJEA 5F1NA 1TJHH 2BSED 4JGUA 7FABH 3KPSD 2VDMH 1RVFH 4YJZL 5JW4Q 2XZCH 3BP5B 1AGFB 1YEIL 5IMKB 2HJFA 5CEZL 1EVTC 2P46B 5IK3B 1I8LA 4KKNA 3CH1A 1HEZB 2YUWA 4ZFFB 3GB7A 5DK0B 3CFJB 3OGCA 4MDJA 2C1OA 4OLYH 1UB6A 2VXTL 1A6WL 1XR8A 5E2VL 5IVXA 4XB7A 2OJZH 1AD0B 2N56A 3TYGH 1WTGT 4TSBL 1I8MB 1YNTB 1LP9A 5IOPA 2D7QA 1IGFL 3IT8D 3VRIA 3FTGA 1QPXA 4N1CA 3RWDA 2APVA 1E6OH 5DJCB 1BREA 4XP6L 3V2AR 3C2AH 3UYRH 4MZ2A 2ARJB 2Z8RA 3SKOB 5GGVY 1FYTB 1CGVA 5TPWL 4G6KL 2DL2A 2EDOA 3R1GL 4U6XB 3U9PH 2PO6C 2ZOLB 4U33A 5CIPB 3DVGB 5I66B 3LSOA 4G3YL 4HK0B 4XWOD 4OKVA 5B38B 1WZ1L 2VYRE 3R8BB 3WFZA 4FOMA 4PJBE 4Y19D 3VXRB 4ONGL 1KNOA 5J1AB 2R8SL 3GEWB 3HCVA 1T2JA 2AJZA 4ZPVA 3BZFA 5EC2A 4BH7B 1HQ4A 3EDDA 1OLLA 2A6IA 3S5LA 4U1NA 4PRAB 4OF5A 4P9HC 1ACZA 1FAIH 2Y5TB 3RU8H 1JZ3A 1KN4L 3D85D 4MXVF 3EO9L 1Q9WB 2Z31D 2AI0L 5DJZA 5FF6B 1N6UA 3CX2A 1TVDA 4R96B 4CW1A 1I3RB 1JVKA 3HZYA 4P2OD 4LIQH 4L3ED 3MYJA 1ZLWH 5SWSD 43C9A 2BDNH 3LKNA 1HDMB 4KHTL 3MBXL 4JAMA 4AEEA 1JNNH 1UT9A 1AFVH 1NAMH 3KG5A 1YUHA 2HVKA 3VWJA 4JKPL 2X4OA 3TIDA 3SDAD 2Z9TA 3WJJA 1JUFB 2UWEB 4JFED 4RMWA 5BW7C 1PX3A 2EYRB 3V0WL 1KB9J 4HHAB 4F8TA 4WJ5A 1RU9H 5LXGH 2EC9T 2X4PA 3V6OA 4OTXH 3RVUC 3RWGA 1MELA 5GJTH 4R4FL 5DUBA 3ALWA 1QVOB 5DFTA 3E8UH 2GSGB 4QHMB 3QI9B 1DN0B 4OLVL 5AAWA 1UJTA 3T08A 1H8SA 1V7ML 5D70H 5LKNA 2A74A 2Y25A 4LEXH 2WBJB 1IC1A 3MLXL 1FVDA 3C6LD 3JV6B 4TTDC 1FE8L 3U4BH 1UB5B 3VWKA 3P4OA 1QNZH 5DRWA 3OAZK 4OCYH 1C5CH 1I9EA 3F7QA 2IPTL 4M7LL 3U36A 5KSBF 1H0DA 3CFKA 3I2CL 4NCC1 5E8EA 3VD7A 5E6IA 4XBGB 1FAKT 4PB0L 3NZHH 2KUTA 3X12B 1YY8A 1MAJA 3JUYA 2EDKA 4O2EA 5D7SL 2BNRB 2EICA 3GSNH 5A2JH 4IRJC 4MNQA 2CQVA 3B2VL 4JDZB 5DRXA 5CEYB 2ZOKB 3LVEA 1MCWW 5EB9A 1NL0H 4YE4L 3A67L 4NJAH 3VXMB 2CRZA 2WIMA 3EYQC 2YMXH 3MUGB 4JPIA 4ENEC 4Z7UE 2R2BB 5DEFB 5E8PA 3HC0B 2VL5A 4BYHA 1V5JA 4FXKA 1KGCD 3RHWK 1FRGH 1O0VA 2VAAB 3BISA 4FFVD 4PRPE 4Z7OE 4R97B 4UIKH 4Y1AA 1MOEA 3CC5B 4Z18A 2VLLA 3LV3A 4WUUE 3F65A 3VXTB 4ELMF 3NAAH 3C5ZB 5DGRA 1CVRA 1AO7D 4U6HB 5CIPH 1ZEAL 4G8GB 4LHUD 3PL6C 4PRIB 1MCBA 1X3DA 2BRRH 4JPWL 2LTQB 1C5BL 4LCCC 4KV5E 1MCJA 4KZDH 4R26L 4MXQC 1A0QH 3UJTH 2EDLA 4YBLB 4ONOA 2FEDC 4NUGH 3QI9C 2XV6B 2MJWA 2APBA 5E99H 3TLRA 1H15B 3SGEH 3MRQA 4PGDA 4OLUL 3WO3B 2VDQH 1OTSC 3B9KC 3CSYA 1U42A 3ME0A 1FFRA 4QXGL 3IU3B 3MLWH 2VISA 4XNXL 3U4EB 1M7IB 1RZGA 3BUTA 1B4RA 5EO9B 1L0YA 1X4XA 5EOQH 1J8KA 1AKJB 1XGPA 1FH5H 4FFWC 1A02N 5ACLA 4G5ZL 3EOAA 1BFSA 1U91A 4K94C 3SE4C 1MIMH 1UEMA 2VXVH 3C9NB 1BBDH 1FZKA 5ANMA 1MWAL 4MWFA 5DFVC 4WO4B 4MD5B 5BS0E 1FBIH 1M7DA 1A2YA 5CHNA 4P4RB 3VGDA 1JPGA 3DRQA 4UT6H 3FJTA 4XAWL 3MFGB 3IDXL 1S7VB 1NC2A 2BJML 1NEZB 2A9MH 4IMKC 1VADA 4RZCB 4X6DA 1LO2H 1EO8H 3QIWA 4CVUA 4TOYH 1Y6KR 2ICCA 1DJSA 1GC1L 2YZ8A 3C5ZC 4PJBB 4ZOCA 2XWJA 1MCDA 2LAGB 3VXNB 4M1CC 3MC0A 1YMMA 4LOUD 3CVHB 3N06B 2G5BA 4OLZL 4C56E 2XN9B 2X5PA 4G43B 5DUPH 4DKDC 4N0UA 2DQIL 4OAWB 4YQXH 4HJJH 4AENB 1IGJA 5EUKB 4XP9H 5C09A 1NLBL 3SDXF 5I74B 2R4RL 3T3PE 4EOWH 2W9EH 1IC4H 2GIYA 5CCKL 1ZGLA 2OBGA 1T1YA 5DVNA 1TQCB 3TNNA 3H9SE 4P2RA 1JHLH 4S1QL 3FFDA 2HRLA 1EEZA 4D2NA 2BC4B 2X9WA 3W5NA 3G6AA 1ACYH 1W0YT 2GEEA 4PG2A 3RWCB 3LEYL 1E4JA 1SJVA 3PP3H 1DANT 3MRIB 5KAQF 2F74B 4FFYL 3RUGA 4KKAC 1KBGH 3O0RH 4LKXA 1DUYA 4LFHD 4XBEH 3VDCA 3TGXA 4RBPH 1MEXH 5C0GB 1CGSL 1DBMH 3P4MB 1DBBH 3EGSB 4FQIL 4F7CB 4R7DB 3HZMB 4WO4C 2MTPA 3IFPA 2FO1A 5TDPA 3UTSD 1A7OL 1JWUA 2OM5A 3QZWB 5EU4A 4DGVH 2GTWB 3TEUA 2WANA 3V6FB 5GS0C 5CBAA 4X7TA 5HVHC 2HT4D 3CDGB 4PJ8D 4R90L 5F1IB 2CIIB 5DI8A 3GBML 1EEYA 1I7ZA 1JYVA 2EDHA 4X6EA 4QXTA 3VFRA 1YEFH 5I0DA 5SX4I 3PDOB 3KXFD 4PJGF 3C5JB 1GZQB 4PJHF 1MJ8L 3U6RB 1CL7I 4HUKB 2PETA 1OP3H 4CVXA 4YEFA 3BEVA 1RZ8B 1IM9D 4Q97A 3LPGA 1MWAA 5I1DA 4ELKB 4PYHA 1BVLA 4WI2A 1J8HE 2VNCA 1BWWA 4ZS7H 3BYTA 5E00B 5E5UB 3EYVA 3TO4D 3RVVD 2A0LC 5K33A 5AYUH 5F1SA 3TA3B 2FJFA 1EJOL 3P9WB 3U7AA 3G08B 3OKOB 1KJ3L 1NCNA 5BVPH 5GZND 2VR5A 1AJ7H 5T3XD 2OS7A 4KDVA 1TIUA 1QRNE 2CRMA 3KPSB 1T0NB 3W9EA 1QHPA 4M6OH 3MJ6A 4Z7UB 1SQ2N 4PV9A 2B1HH 2CUHA 3BO8A 1B6UA 1FZMA 4PRPB 3KPLA 5IB3B 3TNMA 4YXLH 3QUZB 2IPUG 1A3LH 2Z93B 4LCIL 1D3CA 2A73A 3QNZA 2R1YB 3OZ9L 1XCQA 2DQJH 1R3IL 3BN9C 5MENE 4TRPH 3ZDZE 1SBSH 5F72S 4LVHC 4ZUWB 4JFPA 1P7KA 1FLRH 4HSQA 2YN3A 5C0AA 4PR5B 4NCC2 1F4XH 1CQYA 12E8L 5DDHA 4KZEL 3MCKB 4KKLC 5BVJA 1NH6A 1IGTB 5T3ZH 3CVIH 5FM4A 2X89D 1F6LL 2PNDA 4O51B 2JB6A 1LEGA 2VDRH 3QPXH 3OB8A 5CGTA 2VH5L 3ULUH 1JF1B 3N0PB 2AV1B 3Q5YA 4Y19B 4NO3A 3NIFE 2DBLH 4ZOBA 1ODAA 5FYKH 4NJ9L 5B3JF 2XPGA 4LSVL 1OAQL 1MI5B 4P3CH 5M95B 4R4BA 5DTFA 5I1EH 1FIEA 2E27H 5HHOD 5IWLC 1E4KA 4ORGB 4L3AA 3TVMC 2BVQB 5D8JL 1U8HB 4OLWL 3VFVB 3D85B 3HG1E 3WNMA 3BIAX 2Z31B 4CU7A 4JO3L 5HGDA 3QG7H 5IFJB 4FS0A 4OB5H 5EOCL 4MAYD 1A7PL 5F6HJ 2Q3AA 1YNLH 4P2OB 4PY7B 1ZHBB 5EU6B 5BZWA 3UPCA 5J6GB 2F53D 5SWSB 4RA0C 5D1ZD 5TE6L 3QUZC 5JHDA 2ATPB 3CU7A 1CLCA 1PGRB 3LMJL 5JORB 1WCBB 4ISVA 1U8MA 4G6MH 3EDEA 3MRJA 4YO0A 2WUBH 3P77A 4QYOB 5IW1A 4BELD 1M05A 4F57H 4JFEB 5DUMH 4NRZB 1XH3A 4JQVA 4C56B 1OGAE 3L6FB 5KVEL 1DBAL 2V7HB 2CKBB 2F5BL 4JFZH 2G60H 3W11D 3TV3H 3MRLB 3MV9D 2EDNA 3K4ZA 4K71B 4WHCA 4NN7B 3FO0H 4HS3B 1MJ7L 1BJ1J 3HUJF 5J06A 3MV01 3ARFA 2G9HB 4IOIB 3BOVA 1N4XH 2IG2L 5BZDA 4DGYH 4ETQA 3FMGL 1P7QB 2JJTC 2H32A 4GFTB 5ID0A 4P5TD 4XI5C 3ABZA 2K1MA 2V17H 3ZMRA 1JYWA 1FGNH 1B0WA 2VDKL 3LEXB 3MMEA 4KI5E 5FUOH 4GMTL 5M7QA 5HYJD 1XEDA 2PXYA 4F2MA 4NP4H 1S7RA 5C0RL 4GMSL 1U8KB 4LRNL 4G42B 3HE7D 3H9HA 2Q76B 3E6FA 3AMLA 2CIKA 2VZSA 2OQJA 1KCRH 2R29H 5FB8B 3L5IA 4PGCB 1LHZA 4LPXA 1A9EB 4XCEB 3KYNA 2I60L 2VDPL 1NMBL 1B6DA 2DD8H 2GITB 4MB5A 1KLUA 3G04B 4XC3H 5D1QD 5H37H 4XPFH 3C60A 2Q87A 3REWB 5INDA 5KW9L 4MJIA 3VFNB 1N5YL 4JN2A 3ZE1F 1HQRA 1RQ5A 2YPKA 3P9MB 5I1GH 3VFGL 1GH7A 1JGDB 4HH8A 3DOSA 3WLWC 1U8IB 5E70A 1AO7B 1RPQA 1UWXK 2Q8AH 5JQ6L 4H8WC 2Q86B 4J3TA 5DJXB 1OAUH 3N1PC 2MQCA 4NN7C 4PLOB 4BK5A 3MLUH 1TNNA 5CJXC 3RGVA 5CAYB 3IYLW 1C7TA 1YEEH 2ITDB 4KY1L 1IT9L 1QRNB 2EH8L 1I8IA 1MFEL 5D6CB 1IQWH 4OM1L 4XNQB 5H2BA 2H3NA 3VD9A 3SE8L 2CUIA 2F9BT 3PDDA 3ALPA 4QRPA 3KJ6L 4PJIE 1M6OB 1Y18B 5D2LE 1FL3B 2R15A 3CXHJ 4PJ5D 2W60B 1PEWA 4FZEH 2CLZA 4U1HB 1Q94A 5I1KH 3U7WH 1SJHB 2XTJD 1IRAY 1AHWA 3MRKA 3RAJL 4JLRB 4OZHB 4JZJB 1G6RB 3HNTL 1ONQA 4Z76A 4YDKL 3N85L 4Y2DA 1NBZA 4L9DA 5E9DE 1HSBA 4KXZI 1A1OB 3MLVL 4QCIA 4M48H 4MCYB 1ZXQA 5D7KE 1HHIA 4WUKL 4QHLA 4U0RC 3LB6C 2CKBH 3O4LE 4HWZB 1I1FB 3CDYA 3N9GL 3OR6A 4P23A 4X5LA 3IJHB 4DZBA 4ODWB 2CGRH 4X8XA 5HI4C 3D9AH 3QXDA 1NSNL 4U0QB 3T3PF 1HXYA 2WWMC 4PJEF 5GGSA 4N8VB 2C1PB 4LASL 1KCKA 4Y4KD 1CICA 1XGRB 2D4DA 2JCCA 1UXWA 3EYUL 2I07A 1ZLVK 3W2DL 3WNPA 3W0WA 4OLXH 3GRWH 3SE3C 5KVMC 4PJDE 3QDHA 5DVKA 4XP4H 1UXSB 1DE4A 4GO6B 4OIIL 4XTRC 3BJ91 5DD5H 3L3GA 4JHWL 1KEGL 2UYLB 5TQ2L 4H25A 1BIIA 3I02B 3WIFA 5IVXF 4GW1B 2HT2C 1XIWB 1I9JH 2VDLH 1LP9F 2VB5A 3QCUL 4JFOB 1RZ7L 5DMIL 1P2CA 5GGVL 4JO2H 3ULVL 2P44B 2GSIA 4P2YA 5GIRB 4TULH 1MSPA 2ED8A 3P4NB 5D5MB 2F54D 2NY5C 1HK6A 5FEBA 1ZWIA 5C7XL 2LABA 4OGXH 5DGQA 3VGBA 1OGAB 1OB1A 2ZP0T 4MDIB 2YOCA 1UM5H 1WIUA 3UTSB 1AI1H 3WN5A 4GRLD 1DVFA 4WTXA 4WW2B 1R3HA 2GFBA 5FA3B 1BAFH 1F3JA 3HPJA 5KSAB 1IC5L 4LGSB 2ITCB 1E4XL 2KZWA 5BOZG 3BKMH 5FUZH 4WI8A 3QBTB 3AU1B 4X7SL 3QUXA 4LDEB 4BFBD 3V4UL 4F7MB 4M7JL 3HPLB 3D69A 4FHBD 2KBGA 5CINL 5FFLA 1RAMA 3F62A 1MFCL 3CFEA 3TPUA 3JV5A 3DGGA 1IEAA 4YHKL 1U8JA 4R0LB 4M62L 5C3LD 1INEH 1IL1B 2HN7A 3VMPA 5DK2B 3ARGB 1FG2A 2YR3A 4FXGA 2IANA 2F15A 3NABH 1KCSL 2FO4A 4D3CL 3A6CL 1LVEA 3GJFB 3MJ9H 4ODSL 4A6YL 1CFTB 2BNUA 4TNVF 4GG6A 6FABH 2XRAL 1V3JA 1G9NL 5IBTL 3BRGC 2MCPH 5CD5D 4Q9QH 1XIWC 4GKSA 1VACB 3T4YA 1CWVA 3DUUB 4OZFB 3FB7B 4ZG1A 1I7TB 3MGOB 1G6RH 3ZDZF 2IBGA 3SQOL 1TNMA 2YA1A 4O58H 5L0QC 3QIBB 3THMH 4MQTB 1IARB 3RPIB 2OI9B 1PBYA 4HV8B 4E41A 3IETB 3SO3B 3LN5B 3NFPA 4M9OA 3STLA 1M71B 5L8JB 2DMCA 3MV8D 4ZPTA 4RFOL 2PYFA 4I18A 1F3DJ 5DQ9B 2DTMH 5F89A 5F7HA 2C4FT 3DXAD 4QKXB 3S7GA 3EO0A 2PR4H 3R06A 2E9BA 2XA3A 1C12A 3B9VA 1U41A 1AP2B 5KSAC 1G1YA 4PRHD 4Z8FH 1DBJH 4JZOB 5HHMD 1V05A 4S11A 4R3SB 2FYYA 3NIFF 3DMMD 4GXUM 1VFMA 5DD3L 1ZA3B 4XVSL 1BFOA 3SPVA 4HUXB 1CFQA 3GIZH 1CZ8L 4CVWA 1FCGA 4WI9A 4P46D 4XGZA 4XBPA 2OJZL 3RWIB 2W92A 5IQ7H 4HX1B 3UTTD 3K74B 4AH2A 1Q0XH 4KI5C 4R0LC 2O5XL 5DJYA 4PJIB 2X7LA 1QFPA 4G80B 3ARGC 3LAFA 4F9LC 1NGWB 5F8RC 1S5IL 1HSAA 1RZJL 1CD0A 1QOKA 1XGTB 1NCBH 4X4ME 5IMMA 1UVQB 2OR7A 5GRWA 1Q9KA 1J86A 3TZVC 3F7PC 4U1JA 1PZ5A 3HNSL 3JTTA 1IM3B 3OKEB 4OF0A 5DHVB 5ICZB 4U1KB 5GGQH 1R3JB 1NDMB 1RJYB 1F2QA 1V7NH 1QHOA 5TFSH 3JWOC 3OAZH 4PTTA 4MQ7B 2DQFA 5E9DB 3FB6B 3PQYE 1EAJA 4MAYB 3BH8A 1NCAL 1RZKC 2HFTA 2F53B 2YPLA 3DO3A 1NFDE 4AEIH 3ARED 4LKCB 4I9WE 2WUCH 3V5DA 1RUKL 3QIBC 1TJIH 1SYVA 2DMKA 2N7AA 2AK1L 4XC1L 3KWWB 4J1UA 1D9KD 1DBKH 4A6YA 2VE6B 2NYYC 1K9TA 1N7MH 5MERA 3GUTA 1HH6A 4IRZL 4H0GA 2O61B 4H20L 1S5HB 3CFCH 1VESA 5BV7L 1ETZA 3SDDA 1MRFL 2DM4A 1FVEB 2EDQA 5DFWH 1RFDL 3ARBB 1J5OL 2FX7H 4P2QA 3IFLL 5D96B 5FYLL 3BUYA 2YBRB 2M26A 3MV9B 2ZKHH 3UMTA 4KQ4L 1UJ3A 4NNYB 4XPGH 4MVBC 2DLEA 3DSFH 1ZVSA 1G9EA 5SX4H 3FOLA 4YFLI 2HWZL 1S7QB 4OUUB 5IHBA 1K8DA 1HNGA 2IAMD 3SEPA 3MLPA 1CL7H 3P30L 1H9VA 4Z0BH 5T3XH 3EOBA 1YN6A 4W68A 4WEMB 5IEKB 2FJHA 4P5TB 2R69H 1CBVH 4DKEL 3O3BB 4DTGL 3PXJA 1T1WB 2P45B 5SWZE 4KK9C 4KK8C 4U1IB 5C08E 4OZFH 3RNQA 4JHBA 3S4SG 3GSVB 3L7FB 3HE7B 1NCDL 1FFPA 4UUJA 3ARZA 1JNHB 4YHIA 4FZ8H 4L4VE 4X6DF 3VGFA 3UZVB 4P3DA 5DMGC 1T83A 4MAYC 2IADB 1ORSB 4ZAKA 4KHXL 3HMWH 3CMGA 2QQLL 3U79A 3VXQA 1ZHNB 3K4AA 4N9GB 1C5CL 4HIXL 3L5XL 4NRXA 3ZYIA 3RZCA 3FB5A 5D1QB 3HE6D 1WBXB 3A6BL 1T80A 3TM6A 1RIHH 1RURH 5DC9B 2BY1A 4DZ8A 2Q20A 5CZKA 3DV4B 3UJJL 1X7QA 5EZIL 1YDPA 2MPAL 4HLZH 5CUSL 3DIFA 3MRNA 3VFTA 3ARBC 4WWKB 4OFVA 3GM8A 3ZSSA 3WDJA 5IB4A 3G5XB 3GO1H 3MRCB 5L9DL 4OM0H 3IB4A 2I25N 1T4KA 2FIRT 4LCWE 3W0WE 2P5WB 4P5KA 2VC2H 4AMKH 1QZ1A 4RIRA 3PUCA 1G0DA 5D2LF 5FXCH 4NO2B 3LHPL 4K8RL 3RUGF 2VSDA 2K3TA 2XG5A 5AUMA 3L5JA 5JW5A 1N2RB 1A7BA 1OSZA 4OCRH 4XHJD 3FO9A 2NY4D 5L2JB 4P5TC 4X6CA 3QWRD 1UC6A 3BW9B 1A1NA 1MRDH 4OSUH 3D25A 3FONB 2BRRL 3BD4A 4JO4L 4K7PH 2FEEI 5LGJA 3MA7B 4HIEB 3WDHA 1S78C 5F6IB 1FZOA 1QSFA 1X44A 1KT2A 3HE7C 1K2DB 1T0MA 1V3MA 2Z92B 2XTJB 4Q2ZA 4O2CA 3ISWA 1SY6L 3TYFA 5IHZB 4PJXE 3DX6A 2J8OA 3L3JA 4Z0XA 3KYOA 5KSBB 1HN1A 4PUBH 3E1F1 4HJGA 1P4IL 2E6PA 4LSUL 5D1QC 4ZUVA 5HDQH 4AIZA 2X40A 2ICWA 5KSUB 3QWOB 2AEQL 4Y5VA 5I8OH 5H94A 5JXAH 1A64A 3T2NH 1S9WB 1MCLA 4GRMA 25C8L 4MA8L 1Q9LA 4WUUD 5GHWL 4LPUA 1BEYL 3DV6B 3HS0B 4MSWA 3IDIB 4WWKC 2BNQE 4PJDF 3UPAA 2EYSA 1JZ6A 3UTZA 4HWBH 1T66D 1U6AL 3OF6D 4GBXB 3OV6A 4S1SH 4ZD3H 3ECBA 1OQOA 3B5HA 4NNPL 4O02H 1SHMA 4UOW1 4Y4KB 3KGRA 3SKUD 4PG9B 5DEGA 3UDWC 2HJKB 4F7TB 4CADA 3BSZL 4Y16C 1D5XA 3WUWG 4UU9A 4L5FH 3B8YA 4YR6A 4QHUB 4MZ3A 3GGWA 1X5AA 1A6UH 2BX5A 3PQYB 1CT8B 1ZTXL 3EW3B 5D7LD 4TNVK 1KYOJ 4ZSOE 5GRVL 4N5EC 1GHFL 1G6VK 5CD3A 4HUUB 4FQ2L 5F6IC 1KUMA 1OPGH 3WS3B 1XZ0A 4X6BB 5JO5A 3UTPD 3OR7A 1FORH 3PF2A 2F54B 4J4PA 3QFJE 4N5UA 5AYQA 4R8WL 1IC4L 2VLMD 2BSTA 5CJBA 3G5ZB 1MCEA 4HC1H 2XZQH 2FIKB 3L9RA 3FL7A 1JHLL 4LEOB 4HH9A 3H3BC 5KTEH 1J10A 4NIKB 3FQTB 4NN5B 4UQ2A 4ZO9A 3BHBB 4XAKE 4NBZB 5C0CE 5BMFH 2OR9H 5TF1H 2E7CA 3QQ9D 1ZHKA 1E0OB 1KTLA 1KBGL 1LD9B 2GI7A 1ES0B 1XGQA 5F9OH 2OTWB 4KJYA 1X9QA 2ESVB 1EFQA 3O4OB 5DD1L 4NC2B 1FNSH 1MUJA 1FO0L 4XCNB 3JZ7A 3S4SA 5E2TH 1SY6A 5EUOE 3MLRL 2E9JA 1EA9C 4GBXC 3DX9B 4Z5RB 4H88L 3HTLX 2ADIB 2X9XA 3RDTC 1T3FA 3L3HA 5SWZB 4DGVL 5AWNL 2Y07L 1PKQE 3BQUB 3UZEA 2A6DB 2G5RA 4YX2L 3P0GB 2EE6A 2E8YA 5D6DA 5DHYA 3KPRE 2RCSH 3FOMA 5ENWB 2WZPD 4OD1H 1MIEL 4POYA 5KVGH 4Y5YA 2YEZB 5D72H 1KIRA 2NX5E 3LY6A 3ILPB 4QRUB 6CGTA 3KNBA 3TN0A 4TUJA 4JGMA 3FQXA 2HFFA 2BOCA 4PP2A 1P4BH 1CU4H 2DJ4A 3GIVA 1MY7A 3MUJA 3ZDYE 1L9MA 2HVJA 1HIMH 4HUMB 4F7EB 3MJ7B 3LIZH 3PWVB 3NFNB 5DR5L 5EBMA 4WI5A 3I9GL 1HH9B 1N64H 4E0RB 3QO0B 4U6VH 3QUMH 5EIVA 1V3KA 2V2WB 5DJAA 3S34L 5K9OA 4IBLT 2FWOB 1DQJA 1PZUB 3D2UB 1YNKL 2X4SA 4L4TA 3M8OL 4NWUH 4IOFD 4NN5C 5E4IA 1Q0YL 3G6JE 4M5ZL 4PRHB 4GG8A 3VI3E 5GGTL 4KXZH 1BLNA 4GLRI 3O4OC 2W0FB 4JKKA 1JGUL 3KDMB 1CLZL 1B2WH 3KLAA 4ZOAA 4KDWA 3VXUE 1RUPL 4JJ5A 2X6MA 1KB9K 3BQUC 4FTVE 1BVKA 4AJ0A 4BJLA 3MCG1 4QHKI 2XNAB 5FDYA 1OP5K 4AEFA 2ID5A 1UKSA 2BSRA 3WE6A 3FHAA 1NFDF 4PJFB 4S0SD 15C8L 3ZL4L 4P59H 3CVIL 1B4JH 3RVXC 2GJ6A 3KR3L 4TSAL 1FO0A 1U8OB 3N1GC 5C2BL 2VDRL 1X5XA 3QXTA 4L3CB 2Z35B 3I6GB 4BM7A 2HKHL 5C3TA 1R0AH 4YHMH 1CGUA 3E3QE 2PYEA 1D6VH 1K8IA 5B21A 1UH4A 2X4RA 5B4MD 3JWNC 4ONHA 5F93C 3QIUD 3O6FB 4YDLC 5EOTB 3TBYB 1C16B 1KJ2L 4J8RA 2HH0H 2AKRA 2IH3B 3VWJD 1I1CA 3FFCA 2PN5A 1DFBL 5HGAB 4FMKA 3IVKB 3MLTA 1IGML 4FABH 3JTSB 2F19H 2DLFL 3WUWA 2WINA 4I5BB 3GI8H 1WAAA 3CH8A 4WY7L 4RAHA 1ZSDA 2R1WB 4M6NH 2AJ3A 4OB5L 5E8NA 3V95A 5CEZD 2YD2A 2R23B 1OW0C 3WMSA 2VABB 4AQ1B 4FQXA 4LSTH 3STZB 4KJPC 4LDOB 1KPVB 5IP4A 4PRDA 3UEZA 3ULSA 5I73C 4U1LA 3BFOA 2HJLB 3LQMA 5GRJL 2CRIA 1UWXH 5K59F 5EO0A 1EAPB 3P0VH 4L8DB 3CLEL 3QDMA 2PW2A 4FMFA 3AAZA 1H3VA 3BIKA 4X6CE 2XQYG 4AL8L 1F4WH 5JIHA 1YPZE 5F88A 4M43L 5FECB 4APQB 3SE9L 3TBTA 5IT2H 5E6ID 5GGTA 4WFGE 1WVZA 2FL5B 3RY6A 2V5YA 3MOBL 4WHYH 3FT3B 3QFJB 4U3HA 2Y7QB 2ZWLT 1XGYH 4ZFZB 5ITFB 1BM3L 4M3KB 5KVDL 3U0PA 5D2NA 2VIRA 3ETBF 2X4TA 4J6RH 4MNQD 4TUOB 2OTUB 1N4XL 5MP6H 4DGYL 3PWNB 1NBYB 4NQSA 5HJ3A 1RSFA 1UYWL 3MRGA 2PCPA 1CFVH 3S6CA 5JA8B 3H9ZA 1S7WA 3CGTA 5IVOA 4GS7B 3O6FC 5ITBH 4HQQL 1NKOA 2C7UB 3U83A 1E6JH 3HE6B 4X98B 3SDCA 5EDXA 4Y1AD 1OSPL 1AQDB 4KDTC 3BGMA 1PG7H 1EK3A 3QDJE 5EUOB 3P2TA 2R4SL 1W72L 5KANG 4EVNB 3EHBD 3CMOH 5EFIA 4RGND 5DYOB 2YXFA 5EBWB 3EOYG 1VGKB 4IS6A 1JF5A 2ZUTA 1GL4B 2AGJL 1E27B 2DKMA 3KPRB 4QTHB 5GRZA 1LK2A 1UQSA 2Y6SC 3CUPB 3MTRA 4N0YH 5F9AC 3IJYA 4XWGL 4OZGE 2AXJA 5HY9A 2P7TB 4M1GH 5CSGA 5TH2B 5H8DA 4PGJA 5DRNA 1RJZB 2EXWC 2OZ4H 3KLSA 2FDBP 4V1DE 4APQC 4W4NA 3LRSB 4LLQB 1HI6B 1WC7A 3JWDC 3BZEA 3VJ6B 1FFNB 1ND0A 3MUY1 3O2WL 3HUJB 2XKUA 4X99B 4ODUB 3TWCL 1G7LB 4DVBA 3CXDH 1JPSH 4PGEB 2DS4A 3QG6B 1VHPA 4YWGH 5FYJE 3ZT6A 2L0DA 5LGHL 3QH3A 3AS2A 4H1LB 4GAJH 2OL3H 1WWCA 3V5KA 4KUCF 4NO5A 3DROB 4IDJL 4XVJL 3SDYL 3WIHH 4GS7C 5CS7A 1AXTL 1QFWL 2ED9A 3NIDF 2VQ1B 1NC2D 3EFFB 1Z3GH 4K23L 3TBSB 4MCZA 1FJ1B 5JTWA 3S36H 1CE1H 5ID1A 4FA8A 4ZQKB 4X5XA 3CSBA 5CJOH 3O41B 3QIWD 1NUGA 1F97A 4PJ7E 3ORJA 4WW1A 1JNLH 5T1DL 2CDGA 5ADPH 3VXUB 4HBCH 1YMMD 1KN2H 2ZCHH 3V79C 4JG1L 3NA4A 5MEOA 3L5HA 4X80H 4C54A 2QQNL 2H9GB 1BD2A 2FGZA 2WNGA 2VDNL 5C09D 4M3JA 1FNGB 4OCXL 4P2CG 5TDOA 1JTPA 3MLSL 1LDSA 3EAKA 1MJJA 4ODHH 4HUVB 4XPHH 3MOAL 4JRXA 2FECL 3HZVB 3RTQA 2H6PB 2QLVB 5I8KH 1W72A 5K9KA 4JFDA 3ELAT 5D7LB 3N50A 3OXRB 1OTTD 1NBVH 3VXPB 1S9XA 2CUMA 2FHCA 4PRBA 4Z7QE 4P99A 1A1MA 2HMID 4QOKE 3QFDA 3U1SH 5DJ8B 2HLFD 1II4E 1UA6L 3GJEB 1RHHA 2R0LH 3TBVA 2VZ1A 2EXYD 2YC1A 1I8KB 1IC7L 3ULVF 5A16A 3BDYL 5AG8A 3MRMA 3EBAA 4DW2H 4I0PA 1RJCA 2HTLC 3FCTA 4HIIB 1ERNA 1Q38A 2DDQH 4HAGA 1CDBA 3HN3A 4X5WA 5KVFH 5GXBB 4KRNA 2R56L 4ZUUB 4JFQB 5TDNB 5J0BA 1QO3B 5IUSA 1IJ9A 5BCAA 4QWWD 1JI2A 5IMLB 5CMAA 1TTFA 1INDH 3RWJA 1I7RB 2A83A 3V4PH 5JXEA 1GJIA 3ARTA 4WGVB 4XVUD 3WHXA 4GH7B 1NFIA 1J1PH 1Z9OA 3O4LD 2VXSH 2VZOA 2Y9RT 3EYOA 3L1OH 3FO2B 2AS5M 1X5KA 1DQQA 3AM8A 4CU6A 4ZMAT 5F3HB 4D8PB 3VFPA 2YK1L 2HT3C 5TQ0L 1XCTB 3QCTL 1T2QH 1FV1A 1GAFL 1CS6A 2WV3A 3OKMB 1I3GH 4F33A 3BWAA 43CAA 3BPCB 4Z7WE 3ZDYF 4JKMA 1D5ZA 1BZQK 4R2GB 3BP6A 5ESQB 5F1NB 3LRHA 2ZG3A 3WYRA 1KCUL 5E4EC 2V6HA 4JM2A 4HS6A 2ADFH 4HEME 1T89A 4HKZB 5HSFA 2HJFB 4TSCL 3RVTC 5B8CA 1NBQA 4XXDB 4QRRA 4NPYA 1WICA 1RIUL 3PV7A 2JJWA 1FSKB 5LBSL 4FXLA 4Z7VA 3Q3GA 2E9IA 3GB7B 2DQGL 3SO5A 1BF8A 2QSCH 4MDJB 2C1OB 5FCUH 1UB6B 3QDJB 1Q9OA 3EOTH 1XR8B 4GAGH 1EGJL 3ZE2F 5IVXB 4UB0L 5LQBL 4ODVL 3DUHA 3B83A 5FGBC 1PEZA 1UZ8A 4QXUL 4YHPA 1LP9B 1URLA 1WT5A 1Q72L 3VRIB 2GQHA 3RWDB 3WD5L 3UPRB 1VSCA 1EMTL 5EA0L 5K9QG 5CP3H 2NNAB 1XF1A 5C0AD 4AIOA 3QO1B 1F11A 4OZGB 1FIGL 5FKAA 5IHUL 5C1MB 2IPUK 2YWYA 3HRZA 4MA3B 3LSOB 4NQEA 4G9FE 1MFAH 4G7VL 4B0MM 2QQKL 4OKVB 2W65B 3NN8B 4V1DB 2V5RA 4K9EL 3NCYP 1QSEE 1YC7A 3H42H 5IB2A 1KNOB 1N3NA 2DBJA 2EZ0C 4POUB 1A7NL 5E2UL 5D9SA 5EC1B 3IDJA 2ZCLH 4DCQA 5EC2B 1HQ4B 5I9QC 3RIAF 3S5LB 3KAAA 3I75B 1RULH 1JN6A 4PJCE 4R2GC 4O5LL 4Y8AA 5I17B 1KELH 3TCXA 4DQOL 1JL8A 2DYPB 3QNYA 5CSZB 4EI6A 3MA9H 5DJZB 3LQAC 2XYCA 4X8JA 1QD0A 4UIMA 1K4DA 4TNWF 5DT1H 3WXVL 1JPTL 1QLRA 43C9B 1JP5A 5IKCB 3LKNB 4YIQA 4Q6IA 4CJ1A 4JAMB 5EBLA 1GRWA 1AY1H 2GAZB 3EDJA 4JPVH 4RX4A 4G8FA 1D7FA 2V7NA 3FN0H 3PP4L 3WXWH 5J8OA 2ZUVA 3X13A 3SOBL 1WBZB 1NGYA 4NZRL 4X9IA 1IEBB 4WJ5B 1R3LA 3FB8A 1Z0MA 1HKLH 4NSKA 4X6CF 1GCFA 2VR4A 4JY5H 4OD3H 5IBLD 3RWGB 2XQBH 3VG0L 3NA9L 5DUBB 2LAAA 4UV4L 5GZOC 4HCRH 4YGVB 1A4KA 1OF2A 4DAGL 3ARFD 3BZ4A 5E2WH 1EGJA 2X2YA 3PWJA 4FP8L 5DMKA 1ITBB 3RWFA 3OKYA 3KPNA 5D71H 1BQLL 2A74B 1CIDA 3DO7B 1BGXL 1FVDB 2BFVL 3VWKB 2R9HD 2VAJA 3P4OB 4GQ9L 4KVNH 5DRWB 3T8XA 2EEDA 1G7QB 5F7KC 1H0DB 1LO0L 5E8EB 3S8WA 5E6IB 2VTFA 3NOIA 3HNVL 3QCVL 3WJLA 5HGHB 1T04A 4H26A 4F3FA 1J1XL 1YY8B 3DTXA 4HMEA 4WFFE 3F5WA 4OD2A 1W2KT 1G1CA 4G7YH 4XPBH 2JB5H 5I1LA 3DSFL 4MNQB 5DRXB 1J05B 4LF3A 2JIXD 4OCWH 5GISL 3KYMA 4HWNA 4Y4FB 1YQVL 4OI8A 5E1HB 4MB4A 3S3SA 4OGZA 5MHSE 4XP5H 2X4QA 1F8TL 1TPXB 4WU7A 1QA9A 4JPIB 4JM4L 3OKNB 1MHHB 1NCWL 4WTZG 5D7IE 2VL5B 4I9WD 3TH4T 2BHZA 2VKXA 1FL6A 3EJZC 4Q58C 1A14H 1TXKA 1UCTA 1VPOL 3C60D 1EBPA 4Y1AB 4MJID 3IFOA 1AIFA 3BAEH 3V7MA 2A1WL 2D2OA 2OK0H 1U93A 2WP3O 3RJQB 5I1HL 2JJSA 2Z91A 3MXWL 5EZLA 4AT6A 4RGNB 4JY6A 1UWGL 3OJ2C 5CGYC 4M9PA 3T0WA 2CMRH 5I1CL 5T1LA 1VGEH 3IDYC 4KAQL 3WKMH 1L6ZA 1MREH 3MBEC 5EIIA 1EEQA 3F7YA 5A3IC 3UJIH 1NCCL 3K7UA 4XCYA 1A7RH 1WJ3A 3H3PH 4GLRH 3MRQB 1AXIB 3LS4H 1G7PA 4PGDB 3WNNA 2O5YH 4R6UA 1R5IA 5JIIA 3CSYB 1WUNT 5K93A 3D3VE 3JV4A 4PJAE 4LARL 4MX7A 3VWKC 1IKNC 5TE4L 4QRPD 2VISB 3C8HA 4NQVB 4ALAH 1RZGB 5GPRA 4HS8H 1HCVA 4OM0L 1ZAGA 4PD4J 1XGPB 3IDNA 4KU1A 5GJSH 1TQBC 5C08D 5T5FH 5I1JH 3ILQC 4XPTL 3HA0A 32C2B 5CLWA 1U91B 1I9RH 1BOGA 4NT6A 4EKXA 3X3FL 1FZKB 4Y4FC 3P4LA 4L4VD 4N0CC 1F02I 1TPXC 5J6HA 1M7DB 4FQ1L 5CHNB 4Y2DD 1I1AB 4QTIL 3KXFA 1JPGB 3CFBA 3DRQB 2X10A 3N1QC 1OQXA 5ICXB 2MHAA 1NC2B 1LMKA 1IM9A 4G6AD 1FNFA 5ACZB 4OGYL 2VLRE 1VADB 1YEIH 2YZ1A 4G9FB 5CEZH 4X6DB 3V4VL 1U3YA 3C09B 4P23D 1U3HA 4WHTA 2JELL 4XCFL 4LLAA 1QSEB 2IALA 4WIQA 1YMMB 2VXTH 1A6WH 5E2VH 5KOMC 4N0UB 4TSBH 1CICD 2XWTB 4U1MA 1NGQL 3ARYA 5FO9B 2IMNA 3MPCA 1IGFH 4PJCB 3W0WD 1IGJB 5C09B 4XP6H 2B4CC 2PUQT 1ZGLB 3EDKA 5TPWH 3TNNB 4MQSB 4G6KH 4I4WB 4P2RB 3R1GH 3QSKB 4XZUB 2NW3B 1K4CA 1EEZB 2IQAA 3ES6B 2NY0B 4G3YH 5KZCB 5GQBA 3QHZL 2DQDL 4ZS6D 5FYJU 5KSVB 1MCCA 1WZ1H 2Z0BA 3UAJC 5I18L 2D7MA 2P24A 3RUGB 2XXCB 4OI9A 1VERA 4ONGH 2IWGA 1HHGA 2R8SH 2V2TB 1HOCA 5DO2D 3CDFA 1A4JB 1U8PB 5EZOL 4FG6C 2NZ9D 4YNYA 5DURD 3T1FA 1T0PB 3IFPB 1LEKA 1I1AC 3HC3L 5HVGB 5TDPB 4YFEA 4Y7MA 4NC0B 3MLYH 1KN4H 4EI5B 5EU4B 3B8SA 4DGIL 2BY0A 1DVFD 1ZT1A 1RI8A 2X89A 3EO9H 5CBAB 4LVNB 4X7TB 5E08L 3SKMA 2AI0H 5DI8B 4QXTB 4NKMA 1F2XK 2AJXL 5C2UB 1BFTA 5DJ6A 3C09C 5D1XA 5JPMA 3QUXD 3O6KL 2IGFL 5FKPA 2D7TH 4PJ9A 5H35A 4KHTH 3BKJL 3MBXH 4KUCD 4F15B 2GCYA 4CVXB 4YHYB 1BMGA 3V52H 4HLJA 3OKLA 3IKKA 3WFDH 1MWAB 1CDJA 5I1DB 4JKPH 3MR9A 4MA7L 3HAEG 4KK5D 5E1AB 1MF2L 2BSSB 4RMSA 3QUYB 2IAND 3V0WH 1OTUD 1VEMA 2FJFB 1HINL 4IRSB 1J7VR 4XRCB 1G7HA 4WTZA 2MWCA 4LMQI 2W0LA 1P9MC 5ICYA 3RIAK 5IB5B 2D7PA 5KS9E 4R4FH 1IBGL 4GRWE 2NY0C 1A7QL 3W9EB 4PG2C 4XMLL 3T0EE 4OLVH 1YN7A 4DN3L 3G9VA 4PV9B 1V7MH 2X42A 1MFNA 2FCBA 3BO8B 4N68A 5IFAH 1CFNB 3OHXA 4LLMA 1FZMB 3MLXH 3QPQD 4JN1L 1FE8H 4KQ3L 3TNMB 4NM4L 1YJDC 3OPZH 3QEHA 4TNWK 4E41D 5ISZA 2IPTH 4M7LH 1MQKL 2A73B 3I2CH 3IDMA 3QNZB 1XCQB 1MH5A 4BH8A 4EI5C 4PB0H 5C6TL 4R4NC 5HGGS 5D7SH 4LVOB 4JFPB 1P7KB 2AEIT 2ZUQC 3B2VH 4P9HL 5FO7A 3PGDB 4OZIA 5C0AB 3ULVD 4XVUC 4XMPL 1HIML 1FNEB 5DDHB 5CBEB 4YE4H 3A67H 5BVJB 1E4XI 1QRKA 3L95B 4P5MA 4BSWB 1EH9A 4F15C 1LE5A 4AZ8A 3O3DA 3MJGX 2JB6B 5I6XB 1LEGB 5HYJA 5I76A 4PJAB 4HKJA 3NIGE 4RQQB 4MD0B 1LWRA 2XPGB 2VUYA 3S96A 1O7SA 3VGGA 3QUYC 1IMHC 4R4BB 3MV7A 5DSCA 4IRSC 1CG9A 1ZEAH 3WLBA 5IR1A 3UBXG 1Z9LA 4JPWH 1C5BH 3I50L 3CZFA 1GC1C 2V2XA 4R26H 2B8OT 3T0VA 4K3GA 5HGDB 2GJZA 2NX5D 5C0IB 3NTCL 4KJQC 3PWLA 1NQBA 1I1YA 2P8PA 4OLUH 4OQTL 1QLFA 4YXHL 3ARXA 4JE4B 3V8OA 5JHDB 4QXGH 4P57B 2AXFA 4XNXH 4ISVB 3MRJB 4YO0B 3O2DL 1T22A 4YBQD 1M05B 1FVCA 1XH3B 1N8ZA 4XP1L 1LO3L 3SDDD 4I2XA 3QQ3A 1OAZL 1SBBA 4G5ZH 5T1KA 3V5HA 4LVOC 3DI3B 1U8QA 4XPAL 1KACB 4K2UL 5BO1L 3FQUA 1MWAH 2B2XL 5KAQG 2R2CA 5HHPA 2JJUA 4LK4A 2PO6A 1X5IA 2D0FA 4LSQL 3X3GL 1S8DA 3C6SB 3IDGA 4XAWH 2ATKA 3D5OF 2FX8L 5I6XC 3IDXH 2BJMH 5IVZA 1IAOB 3QJFA 5MI0B 5IG7B 3VG9B 5BZDB 5JOFB 1HHJB 4ETQB 1KTDA 4ZTPL 1TFHA 4RWYL 2H32B 5HPMA 2D4FA 3ZDXF 5GS3A 5BRZA 3MZTA 2XFXB 5EU5A 1QBLL 1R5VB 1GC1H 2PXYB 1VFAA 4D9LL 4F2MB 5FDWB 3OG6B 1S7RB 2ZZUT 4LSTL 3KHQA 1FL5B 3VI4E 3FZUC 4NO0A 1FC2D 2QHRL 2DQIH 2WBWB 2ZCKL 3GMNA 3H9HB 1LK3L 2RJMA 1AGFA 5LCVL 5IMKA 4LNRA 2OQJB 4S0TD 1LDPL 3PWPE 4ZXBB 1NLBH 1JGLL 3B2UD 4HFWB 5HHVL 4HPOL 2R4RH 1JZ8A 2XA8L 3SCMC 3JBG7 5CCKH 3KYNB 5DK0A 3CFJA 3BGFC 1BQHG 1Q8MA 4S1QH 3RZCD 3WFHB 1KLUB 4WVRA 3ZE0E 5CEXB 2D03L 3HAEA 4PPTA 2ZG1A 3WCYA 1I8MA 3LEYH 5HHXL 3EO1A 4JN2B 5BW7A 4RGOL 3S37X 4FFYH 5DJCA 1I1RA 4BKLA 4JO1L 3NACL 1K3IA 2ARJA 4GSDL 4WFEE 1CGSH 4ELMA 2DJUA 3QXWA 4FQIH 4U6XA 5C0NC 4HK3N 1CI5A 4IDLA 5I66A 3LKRB 1SM3L 4OQTA 3WFBL 5J3HD 1B88A 1A7OH 4K94L 5E24E 3RGVB 1U0QA 4QEGA 4NZTL 3LKQB 1KB5L 4HG4K 2IPKA 2Q8BH 4R90H 2E8ZA 3VG9C 1I8IB 3GBMH 3O2DA 4GRWB 3OKKA 3QA3A 5H2BB 1GOGA 2H3NB 3RNKA 3QUKB 4BH7A 1FYHB 1F90L 2F8XC 4NM8L 1MJ8H 4PLJC 4Y8DC 2YXMA 4PRAA 2EDRA 1MAML 1TVBA 3TFKC 2PXYC 2ICES 4L8CA 5FYLD 3QJHB 2CLZB 4LSPL 2YD1A 1Q9WA 4GW5A 1Q94B 2ICWI 3M1BA 2QL1A 4IRJA 5FF6A 1AHWB 2CKNA 3MRKB 5GRVK 3SJVE 1I3RA 4ZXBC 1EJOH 1KJ3H 3DUSB 4Z76B 1HDMA 5A2LH 5ESVB 4Y2DB 1NBZB 5E95B 1EO5A 5HDBE 1HSBB 3FRPG 2H8PA 1YEDA 1QR1A 3FQRB 1YYLL 1QBBA 4L8SC 3U0TA 1HHIB 4QHLB 5DD6B 1JUFA 3IAPA 3PE9A 4ZNEA 3OR6B 4P23B 4DZBB 4HHAA 5IFHL 3UBXA 3RJDA 2XKNB 3PL6A 4JZNA 3D39E 3VRLE 2IFFL 5GGSB 3I85A 4LCCA 5TJWK 3RL1A 4LCIH 4UMGA 4JVWA 3OZ9H 4JM2F 2MOVA 1CICB 1QVOA 1R3IH 2QTEA 2YSSB 4NQDE 2JCCB 1UXWB 2H32H 1CD9B 2DI7A 4QHMA 3RGVC 2I07B 2PW1B 4A2MA 4YUEL 1A9BA 3IU4L 4LLUB 4HKXB 1HE7A 1L7TL 4H0IA 3K80A 1DE4B 3B9KA 4TVPE 1NMCC 2DLIA 3L3GB 12E8H 1OAXL 4H25B 3T0EC 4KZEH 3WIFB 1L0QA 4ZUSB 2JKXA 3CFIC 5DEZA 5GS0L 5I75B 2IJ0C 4M7KL 3MRDB 1JPFB 2VH5H 1P2CB 1C7SA 1J0IA 4MQXD 3MV8A 4NBXB 4ODXB 4MB3A 4WGWB 2GSIB 4NJ9H 1OOAA 4L1DA 4LSVH 1OAQH 4J4PD 4JDZA 2M8XA 4KROC 3SE4A 5JLZB 5CEYA 4K8RD 1KB5A 1ROWA 3CVHL 3PHSA 35C8L 3MREB 4PBVC 1YA5A 1X5JA 1ED3A 5D8JH 1GPOL 2R2BA 2VLJA 3DMMA 4Y2DC 5J9PB 2VLKA 3HC0A 1NUNB 4OLWH 1MHPL 1U8NA 2JK5B 2VAAA 1PD6A 1R3HB 2GFBB 3PXHA 1F3JB 4Q6YA 4MHHG 4JO3H 1A7PH 3V0VA 1H8OA 2I5YL 4PY8I 4P23C 2YUZA 4OFKA 3C5ZA 3OX8B 2VWEE 3BD3A 2J3SA 1WFTA 3EIFA 5TE6H 5I0ZA 3QDGE 4PRIA 1KXQE 1TLKA 3BMVA 4PJGA 3KLHD 3MGTA 2DRUA 4PJHA 1MRCL 3LMJH 3VW3L 4OUOA 5F1OB 3CFEB 1LE9A 3TPUB 2EECA 3DGGB 1IEAB 4PLKD 1N0XL 4NDMA 5KS9F 1CICC 2HN7B 1ZT4A 3IFNL 1FNLA 4XNYL 2X1QA 1FG2B 2DQTH 4WV1A 2FRGP 2IANB 2FO4B 5KVEH 1EHAA 3LDBB 2YD3A 5F21B 2DM2A 1DBAH 1BQHA 2F5BH 2BNUB 4K3EH 3WO4C 4GG6B 3IU3A 4G8IA 3Q1SL 3PWPB 4ZO6A 2EO9A 2ZNXA 3U4EA 4IIQC 2VERN 1M7IA 4X7EC 5L2KE 3EUUA 1MJ7H 2P5EE 3TN0D 5EO9A 2YD8A 1AKJA 3V6BR 3BVNA 3EZJB 5LGKA 2IG2H 1NEUA 4C55A 2E7LA 3FMGH 4QOKD 2CDFB 2AEWA 2OJEB 2E7MA 4LIQE 1L0XA 3HB3D 1S7XA 4N1EA 5ADOL 3BPOB 1G0XA 4Y5XB 1T21A 3ARVA 1YECL 2VDKH 4WO4A 2NZ9C 3BDBA 4GMTH 3NFPB 1CDYA 4P4RA 3TP4A 3DRTA 1UZ6F 1KTRL 5C0RH 1PQZB 3O3AB 4L4TD 5J57B 4I18B 4GMSH 5F89B 3MV11 1ZE3C 4O9HL 1S7VA 3GSWB 4LRNH 4KTDL 3CPLA 3U48A 4B7IA 1C12B 3G6DL 3S37L 1BJ8A 1CGXA 1T7WA 4JQIL 2FYYB 4ZDHB 3S88L 5C71A 1N59B 4PJBA 1UG9A 1BFOB 2I60H 3SPVB 4E42A 4YHZL 3RKDD 1CF8L 2VDPH 3VXNA 4NQXB 1NMBH 4QRTA 4F7PA 1D5IL 5DJ2A 3CVHA 4XBPB 3HI1B 2XN9A 3X17A 2GY5A 5KW9H 3O9WB 2X7LB 4N8PA 5EUKA 4C4KO 3QEGL 3VFGH 3LD8C 4XMKL 2Z8VC 2J2ZA 3LDBC 5IMMB 1WFOA 4G8EA 3T3ME 3MGAA 3FRPA 1Q9KB 5JQ6H 1JMZA 1C8PA 5IBUG 4U1JB 1PZ5B 2XXMB 3F8UB 3SJVB 2BC4A 2GJ6D 5HBBA 1MFAL 3MNVB 2PTTB 4I48B 4PTTB 4N90D 3C8KA 3O6ML 4YBHA 2DQFB 3MRIA 4KY1H 4HXBL 4X9FA 1IT9H 2EH8H 3ARDC 3BH8B 1MFEH 2PYED 4OM1H 2YPLB 5E5MA 5GS1A 3V5DB 4YDIL 3SKJL 5C0GA 3P4MA 1Z5LB 3SE8H 3EGSA 3BPOC 3O8XB 4Y5XC 4R7DA 1K85A 3WKNA 4B41A 4J1UB 3KJ6H 5CJQL 4A6YB 3FFCD 4Z77A 5MERB 3ZKND 3GUTB 1HH6B 3D39B 2GTWA 3V6FA 3WHE0 1YEGL 1FYTE 2A2QT 2AJYL 2CIIA 3SDDB 3P11L 4P4KC 3RAJH 3QEQE 4NQDB 3SBWC 4WHDA 4D9QD 2WQRA 3C5JA 4P2QB 3HNTH 4FQXD 1G9MC 1XGUB 4YDKH 3N85H 3U6RA 5CLTA 1DZBA 1YEJL 2ED7A 1J18A 1S9VA 2P8MA 3VXRE 3TBWA 1ZVSB 5B39G 3GSRA 4WUKH 1KJMA 3FOLB 3QDMD 2WW8A 5E00A 3O9WC 1K8DB 4YLQT 3N9GH 2GK0B 3EOBB 1YN6B 3DGCR 4KKBC 1F6AB 4AM0B 3OKOA 1I7UB 5KJRL 3IDUA 4UNTA 1NSNH 3TVMA 1F4YL 2X70A 3LS5L 2NXYD 4NNXA 4LASH 5E6ZA 4OLEA 1T0NA 5J56B 4UUJB 4YHIB 3EYUH 4Z7UA 3W2DH 4H8WL 2XQYK 4P3DB 3EDFA 3WDIA 3G5YB 4OZ4A 4S1DD 4ZAKB 4PRPA 5JZ7D 2X4UA 4OIIH 5IB3A 3QUZA 4JHWH 1IAIL 4WCYL 5TQ2H 1KEGH 4GKNA 4NRXB 4WUUA 3RZCB 3O8XC 4Q9BA 2EDBA 2Z93A 3FB5B 2UWEE 4M8VA 3GMOB 5DQDL 2R1YA 3SDCD 2BVYA 2BXZA 2GT9B 3RIFF 2RFXB 1RZ7H 3QDGB 4DZ8B 5DMIH 5GGVH 3ULVH 1V3LA 3PHOB 2CLRA 4ZUTA 1ZT7A 3VFTB 4PR5A 1T5WA 1MY5A 1H8NA 2CR3A 2NY1D 5C7XH 3MCKA 1FFQA 3GHBL 4KMTL 4RIRB 3KPPA 3WNOA 2VQUA 2AV1A 1IC5H 5AUMB 5ETUA 2CR6A 1MFDL 1E4XH 1I85C 5JW5B 3BAEL 2P5EB 1OSZB 1TZHB 4X7SH 1MI5A 2DOCA 3W5MA 1QSZA 1HCFX 1A8JH 5BV7B 1Z9MA 3CDCA 3V4UH 1QQDA 2BVQA 4M7JH 1A1NB 3D25B 5CINH 4MNGE 4JFXB 1MFCH 3VFVA 2BNRE 1TCRA 1FZOB 5HDBF 1QSFB 4N8VG 4M62H 1T7XA 1KT2B 5BS0A 2J8UE 1T0MB 1S9KC 4POZD 2AK4E 5IFJA 1H3PL 1EHLL 3VXME 1CYGA 1KCSH 3HFML 4Q2ZB 5DA4A 4D3CH 3A6CH 4PY7A 4NOFA 1ZHBA 4RMUA 3ZHKA 3TYFB 4ODSH 4ZAKC 4A6YH 3NGBB 3L3JB 4LLDA 3TF7C 1RMFL 2XRAH 2EC8A 1G9NH 3BPNC 5IBTH 5HD8D 5HI3D 5JORA 3OAUL 4ZTOL 1WCBA 1KTKE 4Q0XL 2VWEC 4QYOA 4M4PA 4AIZB 3DYMA 2DWDB 2ICWB 4Y5VB 5J1TC 1CCZA 1VA9A 3ROOA 4G8GE 4C56A 1KPRA 1Q9LB 4JQXC 5D7JC 3SQOH 3U30B 4JRYE 2B0SL 3HLAB 5E8OB 4QNPF 2EYSB 2NZIA 3UTZB 5C9JB 3MRLA 4KUZL 2G75B 2NXZD 2NPLX 4HS3A 1K6QL 4RFOH 5CJXA 2JLLA 1VFUA 1NMAL 1BD2D 5DEGB 2NY5L 5IJVB 3H9SA 3BP4A 4IMLA 2JF1A 5F7LB 4UU9B 1P7QA 2VXUL 3LH2L 1N6QL 1OAKL 4YR6B 2I9TB 1YC8A 2VL4A 1EFXB 4JRXD 4CRPA 4LLVA 2EDDA 2EEBA 1YZZA 2EIDA 3RTQD 5DD3H 4JFDD 4XVSH 3GSNB 3LEXA 1KV3A 4XNZC 1CZ8H 1ZANL 3TT1H 2YRPA 4G42A 2O5XH 4RWHA 2GW5A 5F9WB 5JO5B 1XZ0B 3OR7B 4YPJA 4OZIF 1QBML 1S5IH 5FB8A 3U46A 4G6JL 1RZJH 2XZAL 2WAHA 4I0PD 4PGZA 4E5XB 4PGCA 5I15L 3HR6A 5EZJA 1PY4A 3NGBC 2BSTB 2AXGA 3EJYD 5IEHA 5LJYH 3HNSH 3QEQB 5B39A 4O4YL 4HH9B 2DIAA 2Y4SA 4UQ2B 1ORQA 4KRMB 3VD4A 3VFNA 1UH2A 1TITA 5JXED 3QXVA 1QFWI 5B22A 5F7DB 2ZJSL 1QLEL 4FQLL 2E5EA 2NY6D 1NCAH 1XGQB 4KJYB 1J8HA 3GM0A 1RUKH 2XN9E 1MUJB 1PFCA 3RA7L 2Q86A 2AK1H 3FO1A 4XC1H 5T3ZE 3S4SB 4HW6A 5DJXA 4RAVA 1T3FB 3MLYL 4IRZH 4H20H 3ULUE 2DICA 2ITDA 1MPAL 1QRNA 5IGXL 5BV7H 1NGZA 4NOBA 3SE3A 4HJ0D 1MRFH 2O26U 3BPLB 3L5WA 5D6CA 5F7NC 4XNQA 1DDHA 1RFDH 1J5OH 4NQCE 4OI7A 2D7TL 3IFLH 5FYLH 4I1NB 3PABA 1M6OA 1Y18A 3QIUA 4KQ4H 1EEUA 1KIRB 3V52L 4JM2D 3KNBB 1S7SA 2IMMA 3MYZA 5FIEA 1WZLA 3WFDL 2FECI 4TUJB 4YHOL 1N5AB 3WSQL 3FQXB 2HFFB 2BOCB 2KDGA 1MCQA 3GIVB 5DC4B 4BFGA 4QRRD 2HWZH 5F9WC 2RR3A 2GKIA 1SJHA 1DLHB 3P30H 5MENA 5C0BE 4JLRA 3WL9B 4JFFE 3RI5F 4B50A 2VITB 4DKEH 2YD7A 4DTGH 3NH7L 3ESUF 2NY2D 4JDVB 4KKCC 5DJAB 4NKIL 1GGIL 5K9OB 3MCLL 2AXHA 3LN9A 4CVZA 5ALBL 4D0DB 4L4TB 4DN4L 4LP5A 5DVMA 4MCYA 1NCDH 4WDIB 3STBA 3I6KA 1A21A 2AJVL 1I1FA 5I1IL 1OD9A 4GG8B 1AD9A 1B9ZA 4ODWA 4UOW0 4KHXH 5IFAL 4UILL 5JOPD 2QQLH 4PBXA 5JR1L 3RVWD 3OPZL 4NQED 3JWOL 5C07E 5CILL 4HIXH 1B90A 3L5XH 1U3ZA 1HWGB 4N8VA 3KLAB 3A6BH 1RZFL 4U7KA 3TJEL 1J0ZA 3C5SB 3VXSE 3CSGA 4MNGB 3I3BA 3UJJH 1PX4A 3LKPB 3HI5L 5EZIH 3TJHC 1P84K 2MPAH 5CUSH 3HG1A 3BPLC 4NHUA 1U58B 3DX8B 2FBJL 3X11B 2J8UB 4Z7NE 3WE6B 4HDIA 2AK4B 3KPSE 4MXWL 3UO1L 5L9DH 1K3ZA 2C3VA 1XIWA 2GJ6B 1FO0B 5IROC 4WFHD 1HYSC 3LHPH 4K8RH 1OVZA 3UTQB 1EHNA 4I3SL 2PYEB 3QXAA 3LN4A 4ONHB 4RX4D 4B7LA 1U9KA 4NFDA 2A77L 4JEGB 1GGBL 1V8HA 4J8RB 1OGAA 5D4QA 5HI5D 2AKRB 4MDIA 4JO4H 3ZLQC 4JRYB 4ZOEA 3MLTB 1BX2B 3BN3B 4KRPD 1NGPL 1JGEB 1WEJL 1IVLA 3WUWB 2WINB 2YRZA 3MLZH 1T6WA 2ITCA 1ZSDB 3K3QA 2AJ3B 5E8NB 5LVEA 3AU1A 1SY6H 5SX5K 2WBJC 4FQXB 1IGIL 4J23A 4DFIA 4PRDB 3HPLA 1Z2KA 3GSUB 5C70A 3ULSB 4Y19E 1T5XB 1T1ZB 1P4IH 4LSUH 4JG0H 5EO0B 1MI5E 3WFEH 5C86A 3QDMB 2PW2B 2AEQH 3AAZB 3PWUA 4KVCL 5DK2A 4F9LA 1XF4A 4G6FD 4UTAL 2QADB 2GUOA 3K1KC 25C8H 4MA8H 5AZ2L 3GJFA 3SKNA 5GHWH 3WEXB 1BEYH 1CFTA 3TBTB 1WQVT 3TZVA 5ERWA 2NXYB 1U6AH 4NNPH 3MUZ1 4Q9RL 2G2RB 4UV7H 4OGAC 1UENA 2D0GA 5D2NB 2VIRB 5EU6E 1VACA 3O6LL 4L3EE 1X5LA 2NR6D 3NCFB 1W0VA 3FB7A 1IAKA 3MNWB 5SWSE 1FN4B 3BSZH 2VDOL 3GSQA 4R97C 4ZODA 3DYPA 3VRJB 1A6ZB 1BBJA 5HJ3B 5CGMA 3QIBA 3RPIA 2BERA 1JJUA 4HV8A 1ZTXH 2H2PD 3LN5A 3VFWB 4M4RA 4JFEE 2CO7B 3SDCB 2IFGA 3U2SB 2LTQC 3ZKNC 4YAQB 1GHFH 4UT9L 3BGMB 4FQ2H 5TF0A 5ELIA 4YBLC 4W4OA 4KPHL 3RFZC 1DLFL 3CNKA 2CK0L 4R8WH 1P5UA 1ZA3A 4BQ8A 4UT7L 4HUXA 5T1LD 4OT1L 3TT3L 1UQSB 1P7HL 5IJKA 3NPZB 1KG0A 4QT5A 3IJYB 3RWIA 4NQCB 1UKQA 4IOSD 4RAUB 5K9QI 4Y88A 4PJIA 5D2LA 4WI6A 2QADC 4EUPG 5C0DB 5DRNB 2DTSA 1TDQA 5DD1H 4YDVA 4D0BB 1FO0H 1X4YA 3OKEA 3MLRH 3BT2L 4YH6A 5DHVA 5C0BB 5ICZA 1KIPA 4JFFB 4H88H 4GJTB 1R3JA 1AR1C 3ZZ1A 2D7OA 5DS8B 3BKYL 5AWNH 2Y07H 4UBDC 4RMRA 5E9DA 2DIBA 2Q8BL 4W6WB 4YX2H 2X1PA 1RIVL 3QH3B 1D5BB 4LKCA 3V5KB 3O4LA 3MUHL 1MIEH 1CGTA 4KJWD 4HPYL 2VE6A 2AJSL 1AGCA 5ID1B 3AFLA 5C07B 4X5XB 1AO7E 4WI7A 1U3HD 3O2VL 2CDGB 5DR5H 3ARBA 1HXMB 3I9GH 3ULUC 1WZMA 2XOTA 3VXSB 5I74C 4GUPA 3CCHB 3T2PA 3S34H 3FQNB 1AXSA 1TQCC 5MEOB 1KULA 4RFEA 4PJDA 3LEVL 1YNKH 4NNYA 5IESL 1XR9A 2NY3D 3M8OH 3MXVL 3MOQA 2F58L 1PY9A 1S7QA 1Q0YH 4OUUA 1U2CA 4M5ZH 5TDOB 5C0FA 1YY9D 1E28B 1WIOA 4CN6A 3B5TA 4M8QB 5GGTH 1C08B 3FAWA 3RTQB 4OF8A 5J1SC 3INUL 3O3BA 4JFDB 3SN6N 1UH3A 4X9GA 1JGUH 1S9XB 4U1IA 2ADGB 1CLZH 2KQNA 4LSDA 5F70A 4J3VA 3L7FA 2YHGA 2BVPB 1RUPH 3TBVB 1JNHA 2FH8A 2EEAA 4OZHE 2HTKC 1FDLL 2YC1B 1G84A 4HGKC 5K9JL 3AGVA 5A16B 1IFHL 3MRMB 4PJBF 1ZHNA 3RI5K 2ZSVA 4X5WB 4R7NA 4Y4HD 5GGRB 15C8H 2J7LA 3ZL4H 1T20B 2I27N 1WBXA 3KR3H 4TSAH 5JNYA 5CMAB 5C2BH 2VRAA 2A83B 3ARWA 5CZXC 1AC6A 2HKHH 3WHXB 5D1XD 1DQTA 1G7IB 1EO7A 1PLGL 4PJ9D 3EYOB 1J1OL 3VGAB 3TA3C 1DUZA 5J4MA 4KK6C 1KJ2H 1RUAL 1WTLA 3PIQA 4RA3A 3VFPB 3K8KA 4U2YA 2DMBA 4NUJA 3LKSB 1DFBH 5HYIA 1IGMH 4MAUL 2DAVA 3UDWA 2DLFH 1FV1B 4JGJA 3UC0L 4Y16A 4KC3B 2ZSWA 3BWAB 43CAB 4WY7H 1JGVL 1N2RA 3DJ9A 1FFOA 1D5ZB 4QO1A 5L2JA 4L3EB 4JPKL 4J3WA 4HWUA 3ZTJG 2BK8A 3RQ3A 3MNZB 4K3JL 4OF3A 3BW9A 5HYQB 3FONA 4JM2B 1S7TB 5GRJH 2K9UA 3GHEL 3SDAB 5D5ME 5B8CB 4QRRB 3CLEH 3GDBA 4NPYB 4OKDA 3ZSTA 5DJ0B 5DLML 4Z7VB 2DQTL 4AL8H 4YPGB 4NKDA 4JCLA 4M43H 4OJFL 5ISZD 3SE9H 1ZK9A 3UTSE 3VFSA 2NY2B 5FHAL 4K3EL 3K8LA 1UM4L 1UZ8B 2Y06L 4YHPB 4OCSL 3EJYC 3MOBH 3GI9L 2R0KL 3KYKL 1JWSA 4ZFOB 1BM3H 5BJTA 5KVDH 3MSPA 4XWOC 1MLBA 4EUPA 1YEHL 1MLCA 4KTEL 3V7AE 1S3KL 3NPSB 3KLDA 1EBAA 3C6LB 3HS0A 1UYWH 3IDIA 3VGAC 3HRZB 3AM8C 3D87B 2EDJA 2O5ZL 4HQQH 4DUXA 3M45A 5FYKU 4GBXA 3RDTA 4X4MA 4C4KT 1OSPH 4Z7UF 3MJ8B 2C26A 5D9SB 1I9IL 1WIPA 2R4SH 4DCQB 1W72H 2Z31C 3MV7D 3U9UB 5T3XE 4Z7OF 1MCSA 2JIXA 2BCKA 4MS8D 4P2OC 3RX8A 3PQYA 2AGJH 3VU2A 2VZVA 1NFDA 1HHHA 1KJVA 1XFPA 3SGJC 4XWGH 2UZXB 2J12B 4HUUA 4X8JB 3SDAC 4KV5F 1KPUB 4UIMB 5B8CC 3QXUA 4LCYA 5L8LB 4X6BA 3C08L 1L6XA 2NCMA 2V9RA 4Q6IB 2CDEA 5FA4A 1O7VA 4G8FB 5F96L 5HDLA 2JE8A 3G5ZA 4LHUB 4UZGA 2FIKA 3X13B 4X4YA 3KPOB 3O2WH 5JW4M 5EWIL 4K71C 1KF9B 2W9LA 1SYSA 4MJ2A 2IEPA 4X6FB 4XX1E 3TWCH 4LLWA 1NGYB 5T1KD 4EBQL 1R3LB 3NPSC 5LGHH 2H45A 4NSKB 4LLYB 4MJ4A 1TZIA 2OTWA 2FBOJ 3F58H 2PO6D 3C6LC 1QPPA 1PJ9A 4IDJH 4NZUL 2H2SD 1FCCA 1GGCL 4XVJH 3SDYH 1YEKL 3I6LE 1AXTH 1QFWH 2ICEA 1A4KB 1OF2B 4WEBL 3DX9A 3BZ4B 3PWJB 4K23H 3OWEA 3RWFB 3KPNB 5E7BA 5SWZA 5DJDB 4BSVA 2AV7A 5HHOE 5C08A 5BRZD 5GSVA 1OY3B 5C6WH 3S9DB 1PSKL 5T1DH 5ENWA 3T8XB 5GRYA 4L4VA 2BVOB 2FJGB 2VN7A 5CWSA 3P0YL 1JWMB 4JG1H 4PS4L 4F3FB 4NO0D 4EJ1C 3DTXB 4QRUA 2QQNH 4OD2B 2EE3A 2N1KA 5I1LB 3IF1A 2F53E 3HKFA 4XT1C 2VDNH 4FFVC 4LF3B 2DN7A 4OCXH 3KYMB 4F7EA 3HC4L 2LV4A 2X4QB 3MLSH 3T04D 3PWVA 4WU7B 2R39A 1QA9B 1QUNA 3MOAH 1D6EA 4E0RA 3ALXA 3L3KA 3QO0A 2ZUXA 1FL6B 5DWUL 1A6AA 5MEQA 3FQWB 3K2UL 3BWUC 3IFOB 2V5TA 1AIFB 3BRFA 1AGDA 1UA6H 1B0GA 1ZMYA 1U93B 2J4WL 3JWDL 4LCWA 2CLVB 4AT6B 1IC7H 3GSXA 4NRYB 3BDYH 3MV9E 1OW0A 1P6AB 5C9KA 2E9WA 3IS0X 3RVUD 2UY7A 3W9DB 3X14A 1IE5A 2W0FA 3UXFA 4H1LG 1FGVL 3KDMA 2R56H 5EIIB 3BH9A 3ZKSD 5E8DL 4XCYB 3LRGA 3O81A 5ALCL 1R5IB 3DVNA 3WNLA 4HF5L 2B1AL 4MX7B 3BXNA 1NAKL 1JF6A 2DQUL 3JVGC 1OWRM 2P49B 4JZJC 4PJFA 2Y1VA 5J11B 2LU3A 3WJLC 3CK0L 4FQQA 2YK1H 4PJXA 1IZKA 1YYML 3SGKC 5TQ0H 5FO8A 1VCAA 2RBLA 3QCTH 4F80A 4IRJD 1GAFH 4L3CA 2Z35A 3GKWL 4OIBA 1BOGB 4PJ8B 5DK3A 4K9EC 3UBXI 3EYQD 4JB9L 4ENED 1CD1A 1KLGB 3KXFB 4NYLA 3CFBB 5JUEL 5EOTA 3TBYA 3WHE1 1KCUH 2IH3A 2YUXA 3V6ZA 1IM9B 2BVEA 4LOUC 1W0WA 2LQRA 3IKCA 2BNQA 1BFVL 1LO5A 4TSCH 3I3DA 4I5BA 1OCWL 5AD0A 1NFKA 4JRWA 1RIUH 1LILA 5LBSH 3TO4B 2R1WA 2JJSC 2DQGH 3PL6D 3K1DA 2R23A 2P5WE 2VABA 1GIGL 1EGJH 5LQBH 4UB0H 4QRSB 4ODVH 1KPVA 3Q6FB 4MXQD 4QXUH 2P43B 3NVQA 4F9PC 3QB7C 4U6TA 5JMRA 4U1MB 3T09A 2HJLA 2FEDD 1Q72H 2NY3B 1PG7W 3QI9D 4M5YL 3RWHB 5I8EB 3MRBA 3WD5H 4PB9L 3GMRA 4IM8A 1EMTH 4L8DA 4XNMB 5EA0H 1E4WL 2KL6A 4ZSOA 5F9JB 2FGWL 4MJ5A 1OTSD 3B9KD 3Q5TA 1A5FL 1G0YR 1FIGH 3CZJA 5TE7L 4DUVA 5LWYL 4PJ5E 5IHUH 3L3IA 3GNML 1K4CB 3B9AA 1BZ7A 4RCAA 2IQAB 5KBNC 3AS1A 4G7VH 2FL5A 2QQKH 2VO5A 3QFJA 2IQ9L 2H41A 3T65B 4FFWD 5ITFA 2XTJE 4K9EH 4BZ2L 1HHGB 4CDHA 1HILB 4WW2C 5E2UH 1A7NH 2R2HB 2NW2B 3KPMB 3PWNA 2HT4C 4DKAA 4PJ8C 1BQUA 2ERJB 3VD5A 5DFVD 5KSBE 4YNYB 3ZO0A 3T1FB 2H1PL 5C0CA 2VLJD 1LEKB 4AG4L 2VLKD 1CK0H 3MO1A 4O5LH 3ZT5A 1B3JA 2HFEA 2C7UA 4LU5L 1X5YA 3AY4A 2Q1EA 1ZT1B 3DVIA 3NCYS 5A2KH 4YHLH 4DQOH 4X98A 4XNUH 1BOYA 3TT1L 3SKMB 5IV2B 4AY0A 4NKMB 1MJUL 5EUOA 1TJGH 5DJ6B 4DEPB 5JPMB 3WXVH 3C5ZD 3TO4C 1JPTH 4EVNA 2QEJA 2RIKA 5DXWA 3RVVC 2ZPKL 3GSOA 4M1CD 4PRID 2GCYB 1PKQA 5EBWA 3IS1X 3OKLB 1MHEB 5HHOB 3PP4H 5GZNC 3EZ8A 1E27A 3KPRA 4QTHA 5D93B 1IILE 2EIEA 3MR9B 4FQHA 1R3KA 3SOBH 3DYOA 4OFIA 2D31B 4NZRH 2P7TA 4U05A 3BRDA 2NX5A 5D5MF 3MRPB 1KCLA 2QV2A 1KCVL 2FZ3B 3O3EB 2DQCL 5D1ZB 3LRSA 3IRPX 3VG0H 2OI9C 3NA9H 3MACL 3T2OA 1TTGA 3GMLA 4UV4H 5F7YC 3SO3C 4DAGH 1AKJD 4X99A 1YN7B 4FP8H 4WW2F 3E6HB 4KKAD 2F54E 4WRLA 1IKFL 1BQLH 4M02A 3EYFA 2LFGA 2R1XB 4PGEA 3OHXB 3TCLA 1BGXH 1U92A 2BFVH 1LNUA 1M1SA 4GAYA 1AGEB 3QEHB 3W39A 1VENA 4GQ9H 3B6SB 2ERJC 2D9QB 5DF0A 3CFDA 4WO4D 5ISZB 4H1LA 3G6JA 4LHQB 3IDMB 1LO0H 4KTYA 3M07A 1MH5B 3HNVH 1SEQL 3QCVH 4EDXA 2VQ1A 3AUVA 1J1XH 5GS0D 3EFFA 4LGPB 4KI5F 1QFUL 1CQKA 4ZQKA 3T0BA 5FO7B 2ESVE 4OZIB 2WIIA 3O41A 5GISH 1YQVH 2BP3A 2K7QA 4FNLL 1JV5A 1F8TH 3B3IB 3VXUA 2F5AL 2XT1B 5L7XL 4HFUL 2DLHA 4JM4H 1LE5B 1NCWH 2EE9A 3LPFA 3O3DB 4HMDA 1QACA 2OXGA 3LQAL 4FTVA 4GKZA 4OIAA 2XN9D 5HYJB 2Q7YB 1VPOH 4HKJB 5D93C 2C3XA 5SX5H 4M1DL 1KC5L 2A0LD 4PIRF 2OP4L 3BD5A 2A1WH 3MV7B 5DSCB 5I1HH 2ENYA 4M03A 3MXWH 3WLBB 4HUVA 5IR1B 1U36A 2APFA 1UWGH 3MRHA 3EFDL 3CZFB 5D1ZC 2BMKB 2AABL 5I1CH 4JR9L 3OXRA 2V2XB 2W9DL 4KAQH 3SDXE 1JK8B 1NCCH 2GJZB 1MCKA 4GQPH 4X4XB 2BRQA 5ESAA 3FRUA 1I1YB 2P8PB 4L8BA 5E2JA 1DQML 2J6EL 1MCOL 2MFNA 4LARH 4HIIA 5TE4H 2EYTA 2J88L 3DXAE 3BN9D 5D96C 3W11C 3DX7B 5FHBL 1T22B 4UTBL 5TDNA 4EIGB 1QO3A 4UDUA 4PRHE 1N26A 1N8ZB 5HHME 5A40E 1CLYL 5IMLA 1WBYB 4XPTH 1I7RA 4PJIF 5T1KB 3V5HB 1F4AA 1NC4A 5BXFB 1U8QB 1A6VL 3X3FH 4M00A 1JZ4A 3G5VA 5FYJL 5HHPB 4KKLD 4QHKJ 4WNQA 1AGBB 3FO2A 1QBAA 4FQ1H 4QTIH 5CJ8A 2HRPL 3UTTE 3CX5K 3IDGB 1YPZA 5F3HA 3W81A 4D8PA 1GXEA 4P49A 5JMOC 5IVZB 4MHHI 2CXGA 1OGTA 3QJFB 4PJ5B 4YK4B 3QISA 4OGYH 3U7YL 1CXHA 2ADJB 3U0WL 5F7UA 3V4VH 3MLZL 4XXCA 3OKMA 2EKSA 1PYWA 3ZTNL 1LO4L 2JELH 4XCFH 4PJFE 1GGTA 1NJ9A 3TVMD 1R5WA 3VFMB 4NFCA 5CP7A 5AZEL 5ESQA 1O5DT 1VFAB 2FLBT 4NO0B 4NFBA 3GMNB 4WENB 4PGBB 1NGQH 4CN4A 4HXAL 4QGYA 2AQ3A 3QUMB 1KEML 4HKZA 4JG0L 4UOJA 3L7EA 2W38A 3HI6L 2HFGL 4LNRB 2NQCA 4XXDA 3WFEL 1L7IH 5HVFB 5FGCB 3IGAA 4AYFA 4PRPD 3QUZD 2WK2A 4P48A 1OM3L 3QDJA 1RUML 2HYMA 2BOBB 2E6JA 3HAEB 3R0NA 2R2EB 4KMQA 1ZGLP 3QHZH 2X9YA 2DQDH 1T1XB 3EO1B 3BP7A 3GBLA 1ZGLM 4UV7L 5I18H 3WFCL 3HR5A 3UPRA 3SHSA 3ZYOA 4BKLB 1FPTL 2NNAA 3VGEA 4MMZC 3QO1A 1MFBL 3NZ8B 5EZOH 4ELMB 4OZGA 2XIDA 2BY3A 3SGDH 1CDIA 4MA3A 2DI8A 3HC3H 3WV0A 2H2SC 1IQDA 2J6EA 3K0WA 3FN9A 4DGIH 3CJJA 5HHNA 2W65A 3IAQA 3NN8A 4V1DA 5E08H 2IPKB 4YK4C 1NGXA 5T5NG 5I16A 4Y0GA 1T2XA 4FQCL 3OKKB 2HKFL 2AJXH 3KS0H 3QA3B 5EC1A 1MI5D 3RNKB 4XI5D 3O6KH 2IGFH 2XTJC 3WS6C 1Y6MR 3BKJH 2YA2A 3I75A 1TVBB 2YA0A 3AXLB 4L8CB 3F7RA 4O00A 4K7FA 5B3JE 5I17A 4MA7H 2DYPA 5CSZA 5BS0D 4GW5B 1MF2H 4GRLB 3M1BB 3V9FA 4IRJB 4G9DB 4S1RL 2NTFB 3FT2A 3PHQA 4M93B 1KLFA 1A3RL 5EU6D 1HINH 2RGSA 5IF0B 1TETL 5F97E 5IB1A 5IKCA 5FUCE 4BQ6A 4M6ML 3PV6A 2GAZA 4JDTL 2H8PB 3B9EA 2CPCA 4JANB 1YEDB 4PJ7A 1DEEB 1IBGH 1QR1B 1EERB 1A7QH 2B4CL 1IAII 3P73B 3U0TB 4I3RL 4XMLH 4DN3H 2VQTA 4RDQG 1WBZA 4U7MA 4ESKA 4Y4KC 4C56D 3WLWD 1IEBA 1QYGL 3QR2A 4LDLB 4P9ML 2D3VA 3RWEB 3UBXB 4I77L 4U1SA 5IHLB 4JN1H 4MNHB 4KQ3H 4NM4H 5EPMA 3PL6B 4XVTH 4QY8A 4JZNB 1ZLUK 2AEPL 1AE6L 4LCCB 3RL1B 1MQKH 1F58L 3MBEA 4YGVA 2J8HA 3H9SD 1M7XA 5C6TH 4JHZA 1A9BB 1KXTB 4ERSL 3VCLA 1P7QD 3DO7A 3NCJL 4P9HH 4QRQB 3C87A 3B9KB 3VE0A 4XMPH 4QOKA 3SDXB 1IKNA 4EN3A 1BVZA 5E94B 1G7QA 3HUJE 4CUCA 3BJLA 5ILTL 1MHCA 1KIUA 4Z78B 5HGHA 4WEUD 3ZKMD 2AQ2A 3MV8B 1A3QA 1NPUA 2EIBA 4GRLC 4U6YB 3DXAB 1SJXA 2X1XR 1J05A 1VEPA 3REVA 4M93C 1KB5B 2L4OA 4Y4FA 3HAEH