1UZ0A

Carbohydrate binding module (cbm6cm-2) from cellvibrio mixtus lichenase 5a in complex with glc-4glc-3glc-4glc
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
131
structure length
131
Chain Sequence
MVIATIQAEDHSQQSGTQQETTTDTGGGKNVGYIDAGDWLSYAGTPVNIPSSGSYLIEYRVASQNGGGSLTFEEAGGAPVHGTIAIPATGGWQTWTTIQHTVNLSAGSHQFGIKANAGGWNLNWIRINKTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Family 6 Carbohydrate Binding Module from Cellvibrio Mixtus Endoglucanase 5A in Complex with Oligosaccharides Reveals Two Distinct Binding Sites with Different Ligand Specificities
pubmed doi rcsb
source organism Cellvibrio mixtus
molecule tags Carbohydrate binding module
molecule keywords CELLULASE B
total genus 30
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1uz0A00
4MADA 3GM8A 2DCKA 4M4RA 2YFUA 4P08A 3NJXA 5J1XA 2V5DA 1PX3A 2VM9A 4BK5A 2QQMA 4TTGA 3HNBM 3PUIA 2J1RA 5LA2A 3I2KA 1CZTA 3I2IA 4RYDA 3A23A 3GGLA 2BERA 2W1SA 4XUTA 3OG2A 2VCBA 2ZEYA 5G04L 2W46A 2E26A 3I3EA 1CX1A 4DXSA 1US2A 2VJXA 4PF1A 4W4ZA 2VZSA 3I2JA 2WABA 1JYNA 1WKYA 4LKSA 4BDVB 3T09A 2KD7A 2VL4A 4UI9L 3EYPA 2YC4A 1W8OA 2B4KA 2J22A 2CDOA 3C7GA 4QDSA 2QQLA 1UZ0A 2X10A 1PMHX 5A1AA 2V4VA 3A7QA 3P6BA 3WNKA 2XOMA 3SEPA 4MO3M 3WNNA 2WAAA 1RYYA 3A21A 1SDDB 5IHRA 3AC0A 4UAPA 2QQIA 3GXUA 4ZXEA 3HNYM 4QB2A 4CVUA 1GOFA 1EUTA 5JXGA 4OMDA 4QPWA 1ULOA 3VDAA 3ABZA 2BZDA 5IFPA 4BK4A 4JKKA 3DYPA 1R64A 3WNMA 3CZJA 2XQXA 4JHZA 1GQPA 1D7PM 2WN2A 4XVHA 1W99A 2JKXA 4QX0A 1W8NA 4CU8A 3WNOA 3CKHA 1KGYA 4IUGA 4QX3A 3ZM8A 1OD3A 3CIHA 3WEZA 3T0BA 3K46A 2VZ3A 4A3ZA 1H6XA 1JYWA 2YB7A 2J1AA 1CIYA 3I3DA 2W94A 2VR4A 3LEIA 2VCCA 4W8JA 2VQTA 3CDZB 3C7HA 1O59A 3VD9A 2VZUA 4JKMA 2Y6LA 4CUCA 3HN3A 2J1EA 4XUPA 1TG7A 4D0QA 2YC2A 3F2ZA 3VDCA 2C9KA 3C7FA 5C7GA 5JXHA 5B4XA 3I3BA 2W92A 3WF4A 3WQBA 3IIIA 3T0DA 5EJZB 2J1VA 2LS6A 2J7MA 2QQOA 4XURA 1EUUA 2Y6GA 3SEEA 3VDBA 3WF3A 3VD7A 2B9VA 5DQ0A 2YG0A 2RJ2A 5B4NA 1GOHA 1PMJX 4XZUG 3C7OA 1O8PA 1UY4A 2JDAA 2VTFA 4A42A 2DCJA 4OYUA 3HJRA 3MV11 2X05A 3MO4A 1NX9A 2BBAA 2EIBA 2WZEA 5F7UA 4CU7A 2W87A 4Z2AA 2ZEWA 3HNMA 3HEIA 1JZ8A 1J84A 2W1QA 1XNTA 1ULPA 3T08A 3CMGA 4AAXA 2EICA 2C4XA 3SKVA 1W9SA 4GWJA 1KEXA 3LQCA 2VZPA 2Y6KA 2ZXQA 5DN2A 3I97A 3C8XA 4BXSV 1GOGA 4CU6A 1PX4A 2QQNA 2Z4FA 3NJVA 2VMDA 5C71A 4QB6A 2J1UA 4ZY9A 2QBXA 2ZEZA 5HPOA 2OKXA 5LA1A 5IFTA 1NKGA 2WBKA 5IYYA 1OH4A 1JYVA 1CZSA 1W9TA 2V72A 5EIYB 2VZTA 2VMEA 3GDBA 2CDPA 4KWUA 4YPJA 3OGSA 5HXMA 1JYXA 1GMMA 2EIEA 3WF2A 4RN5A 2WZ8A 3MV01 1JZ4A 4ZZ8A 3W5NA 3WSOA 4CU9A 2XHNA 2RV9A 4QDRA 5G05L 2WUHA 3K75B 3HOBA 3LPGA 3K4AA 1K42A 1DP0A 1XPWA 1JU3A 4A45A 3OEBA 1SG3A 1UXZA 2W5FA 2J1TA 2XONA 4GWIA 2BGOA 3FN9A 4P00B 5CYYA 1JZ3A 1W9WA 3T2OA 1UMHA 3NNGA 1O8SA 1OF4A 3DECA 4W50A 3K4DA 1YQ2A 2E32A 3ACFA 4L0PA 4OZOA 1UMIA 1UY1A 4JKLA 4QAWA 5EJ1B 3P1IA 3VD5A 1UWWA 3K77A 1UXXX 1OF3A 3WNLA 4E8CA 2E33A 5DMYA 2VO5A 1DLCA 2EIDA 1MPXA 3HPNA 3IAPA 3C7EA 3I2GA 3ACIA 4D8MA 4DUVA 1W0NA 1LNSA 1OT5A 2W1UA 1K12A 4DEQA 2ZEXA 2W95A 1TVGA 2WDBA 4ET7A 4E8DA 1F4AA 4AG4A 3ECQA 3LEKA 2Y6JA 2YFZA 2VC9A 4LHSA 2C26A 4MGSA 4PT6A 2WO2A 3LE0A 3CZUA 1T2XA 1JI6A 4MOAA 2W47A 3FL7A 2ORXA 4XUNA 2LW8A 5DPNA 3JXSA 1DYOA 3THCA 4TXWA 1BHGA 4DXRA 2W91A 1J83A 1UYXA 3UETA 3IB3A 5C70A 4XUQA 3FHAA 3EB7A 4FI9A 1I5PA 3ETPA 3SKJE 1L7QA 2VMFA 3DYOA 3OB8A 3I2FA 2W1WA 3IAQA 1XNAA 3OGVA 2J1SA 3CQOA 1NAEA 4MGQA 2VZRA 3THDA 3MUZ1 1WCQA 4CUAA 2ID4A 1K3IA 4DUXA 1NUKA 4PQQA 2VOTA 4A41A 2QQJA 2Y8KA 3OEAA 1SHWB 3I2HA 4A4AA 4ARXA 1F4HA 1IQDC 5JMOA 5JXJA 3IDAA 1UY3A 4CUBA 2ORZA 4JX0A 3VD4A 2VZQA 2W3JA 2JD9A 4A44A 1CZVA 2Y6HA 3T2QA 3E1F1 1UY0A 4BJ0A 4KMQA 4ARYA 1JZ7A 1UYYA 3D3AA 4XUOA 4A6OA 5JXIA 2RVAA 4UOJA 2L9LA 3W5MA 1HN1A 3MBWA 4HG6B 4KI5M 4GZ9A 4QB1A 3FHQA 3VD3A 2VCAA 1H6YA 4DEVA 1K45A 3NRUA 2WAOA 5LCWL 2WO3A 5JR2A 3OBAA 2VZOA 3LEGA 4QX2A 1UYZA 3WF1A 3PUHA 3OGRA 2E31A 3J7HA 2HYXA 3U37A 3DYMA 1P8JA 3K4ZA 1GUIA 3BGAA 2VZVA 2WO1A 3MUY1 2QQKA 4P02B 5CZKA 2R7EB 5I0DA 1GU3A 3T0AA 4OUEA 3UNPA 2WQ8A 3T2PA 1US3A 2BGPA 1JZ6A 4LQRA 1JZ2A 2Y64A 2VQUA 2VMCA 2JE8A 3ACGA 4DUWA 4ZZ5A 3UESA 1JZ5A 1GNYA 5IJRA 4DXTA 2W9XA 1L7RA 2PQSA 1XC6A 3ACHA 3A22A 3WNPA 1JU4A 4QX1A 4P5YA 2X09A 2HLEA 3WF0A 1JHJA 5JUVA 1UY2A 5FUIA 3LPFA 4OMCA 2DDUA 2WYSA 4M4PA 5LA0A 2WN3A 3BN6A 3NQHA 4LPLA 1UX7A 2VZ1A 4QDQA
chains in the Genus database with same CATH superfamily
4XHXA 1MZFA 4Y1UA 1RHI3 2VOKA 5A3TA 4EQVA 1YQ8A 1QF3A 2WO7A 2ZOEB 1F5JA 2ARCA 5FFOC 1VBD2 3WP5A 1SPPA 2ET7A 4JGZB 2HEWF 5B2GB 5JLVA 2ZGPA 1PX3A 2VM9A 3K2OA 2OZ6A 2WA3A 3HNBM 4QM9A 4K1YA 3WQ1A 4PI2A 3PUIA 2J1RA 4O7XA 4QPGB 2G4IA 1VLNA 1VBD3 1SDWA 3POJA 1F2NA 2ES3A 3I2KA 4M00A 2EXHA 4YM1A 1VBC3 4RYDA 2HBTA 3KV4A 3KHBA 3MEPA 3MIBA 2BERA 1QJY2 5FZAA 1W6PB 1H1MA 3CJXA 4JQTA 5ANNA 3S5AA 2PLV3 3FLRA 4XUTA 1TMF2 2GALA 2VCBA 4IL7A 1ULEA 1W39A 1JHNA 2ZEYA 3TN92 1HRI1 3T3YA 1UPSA 4Q0QA 1C3HA 5HI0A 2WFF3 4M3CF 5JI7A 4E9KA 1PHMA 2W46A 3NKGA 1CX1A 1UU4A 1US2A 2VJXA 3NAPB 4CDQC 1R092 4W4ZA 4FPKA 5FP4A 1GFF2 5FXXA 3VBRC 3AMQA 1HB4A 1YLLA 4LHNA 4BDVB 4D69A 1W6OB 1QJFA 1GWLA 5FQ0A 2KD7A 3LKJA 4Y22A 5H9RA 1IQAA 3AJYA 2W0XA 2ZMKA 4PLOA 4UI9L 5FZBA 2IUWA 3GCWA 4UFLA 2B4KA 4HVRA 2BUKA 3U10A 2P4EA 4R52A 2QDRA 1NXD1 4KU8A 5FY9A 3C7GA 5BNNA 3BTXA 1UZ0A 2DUPA 3CJIC 1RUH3 5FYYA 4WM8A 3A7QA 3B9IA 4YZ4A 5FP9A 2XOMA 3SEPA 3GHMA 2VAUA 5BNOB 3WNNA 5A3MA 2HWF1 3JB8A 4HK9A 5I8SA 3WDUA 1RYYA 3DGTA 4WM8B 1A3KA 1BMV1 3EMRA 2JDMA 1SDDB 3A21A 2RDQA 3RMXA 4CDUB 4RFRB 5C3PA 4UAPA 1Z78A 4UBGA 4C0BA 1W03A 4QGLA 4ZXEA 3ZN6A 1MEC1 5FZEA 3RQ0A 2CAUA 1EUTA 1X50A 4YWAA 3EBRA 1U5ZA 4Z07A 1F31A 1QOOA 4WM7C 5KWRA 5GLZA 4J1WA 4ZU4A 3ZR5A 1U5YA 4MHRA 1M4WA 1OC1A 3BOPA 3LIHA 1GKBA 4YGDA 5IFPA 5FTTC 1OUXA 4JDNA 3AKSA 3I3QA 4Q4X1 3ZPOA 3DYPA 1R64A 1ZRCA 4LBLA 3ZSKA 3BUCA 3SXWA 1HRV1 3PJQA 4E27A 2RS53 4CA9A 1G6NA 2D93A 4JHZA 1RUC1 3ZDSA 4DO0A 5I8TA 4UFHA 3MPPG 1X82A 1GQPA 2JJ6A 3KGLA 3KV5A 3VBFB 3TBDA 2NM1A 3KVAA 4XVHA 5DAXA 1W9YA 3D6EA 1W99A 3KZ4C 1YFUA 3AXDA 2XGXA 4NPRA 4Y26A 5FZOB 4B8EA 4CU8A 5A3LA 4XJAA 1J3PA 2K9ZA 4N43A 1OD3A 2R071 3WEZA 3T0BA 3ZR6A 1ACCA 4Q4Y2 1N1TA 3LA2A 5CVRA 1W6MA 2VZ3A 4Y4YA 1AYM2 3B69A 5K4LA 3E6CC 4XPVA 1H6XA 2YB7A 3N7LA 2XH6A 1CIYA 1UOGA 4D3WA 4NOTA 2KM2A 1AF9A 1QU0A 3USUB 2VW0A 3C3VA 4AFAA 2VCCA 4W8JA 3BOWA 1AL21 3KQRA 4D94A 2VQTA 3MF9A 3H8UA 4PCRA 1PO13 4XDPA 1HKDA 5DAPA 2DU1A 3O1VA 2UURA 2WFF1 3BVCA 1LEMA 3B5LB 4FVVA 4Q1RA 4CUCA 4YVWB 4FO9A 1B35B 5FMOL 1D2QA 4Z8BA 5JPNB 4NIHA 2P37A 1YIPA 3OYWA 5A7WB 5KBFA 3VN4A 3ORJA 4AYUA 3RYPA 1AR61 5FZHA 1JOBA 2ZGOA 1ZZCA 2OW4A 4F7ZA 1W2UA 1NCRB 4YM0A 2VMGA 3I3BA 3MF6A 3B01A 3PIJA 2QQOA 2PHTA 5APAA 4BWOA 4MGIE 3KM5A 4AAPA 3WF3A 2GH2A 2XVKA 4CDQA 1OH3A 3VD7A 2YG0A 2RJ2A 4JDOA 3J26N 1AYN1 1GOHA 2ZCWA 1PMJX 4UBHA 5FZ6A 4K1ZA 1NYWA 1UL9A 3KT7A 4XZUG 1UY4A 2QQWA 1FPN1 4COVA 1GNZA 1YI9A 2RMU1 3THPA 2Q8DA 4FAHA 3KSCA 3N36A 2VG9A 4IV3A 1D2SA 4PBOA 3NVCA 1SEFA 5A6YA 2EIBA 2R073 3AVSA 1BVVA 1ZRFA 2BVBA 3EHKA 1RMU2 4Y1XA 3WG2A 2P1BA 2ZKLA 4Q2FA 1LGCA 3HNMA 1J84A 4HBNA 1FOD2 4C8DA 1J3QA 3BALA 4AAXA 5LWBA 1O3QA 1LHVA 1UZYA 2E7QA 1V9U1 1H30A 1NA1B 2ZZQA 3LQCA 2VZPA 3AL6A 2Q1ZB 1WD4A 3AZXA 2ZXQA 1W2NA 2WNVC 5JOZA 2GAUA 4WZCA 4CU6A 1EY2A 2XWBB 2QQNA 5LB6A 2HWF2 4Z1VA 3N9LA 1ZA4A 5DG2A 3NJVA 2PXJA 3I7DA 2GH8A 2ZX0A 3HR9A 2GC1A 4HK8A 3WQ7A 5FXZA 2QZ2A 1UX6A 3WT3A 4OI0A 2ZGSA 1ULFA 2VNRA 4XTMA 1IHMA 1CAWB 1G86A 5GLVA 5IYYA 1OH4A 3CNAA 5C33A 4RHV1 5T5OA 1JYVA 3LEMA 3TEXA 1R082 3GDBA 1LHWA 1WMFA 4XBNA 1H8TB 2ZHNA 4YPJA 3OGSA 1RUC3 2YBKA 2A3XA 4Q4X3 1HXS2 5HXMA 1ENXA 1MR5A 2XBO2 2Y38A 1DBNA 2EIEA 3OUHA 3WF2A 2ZZJA 1SLIA 1BYHA 1UKGA 3IT8A 4YW6A 4WVMB 3FUOA 1JZ4A 2J42A 4HSJA 4ZZ8A 4HONA 3WSOA 4YG0A 2WNUA 1QQP1 4MGKE 2XJSA 2A6XA 1APNA 3ZYGA 3K4AA 4ASMB 2QUOA 4BLJA 1FOD3 1YIFA 1ZBE2 2A75A 4JVAA 1AR91 1KFUL 1JU3A 2P2KA 3OEBA 2PELA 5LASA 1X36A 2X53S 1UXZA 3IMMA 4QXCA 2D43A 2J1TA 2RS32 2BP6A 3ROUA 2BRTA 3IKWA 2R072 4GJYA 1W9WA 3N9NA 4Q29A 4Q4W2 4I0AA 5FPBA 1ZBE3 4CE8A 2DWRA 1Q56A 2I45A 1DQ5A 1UMHA 5FQ0B 1H9PA 1XU1A 3NNGA 1OF4A 2PMWB 1TME2 5JZGC 5FCCA 4G4FA 4WVMA 4W50A 3WINE 3LDBA 1UKRA 4BQ1A 4L0PA 1Q8PA 2XKOA 4OZOA 1AXZA 5EJ1B 4QAWA 4XF4A 4X8PA 5FJHA 1RUNA 4XOGA 1UZWA 3RFRA 3AP9A 4ZONA 4Y1VA 2PFWA 3WLUA 3KLSA 1C5HA 1O91A 1WW4A 4DRRA 2ZS6B 4XAEA 5JR7B 1CAWA 3ZFGC 2WZR1 2HEYF 2O0OA 3WZ1A 2D6OX 2XVLA 2HWD2 2VO5A 2JDKA 1DLCA 3WOGA 2EIDA 3FJSA 3ZSLA 1JOJA 4B1LA 3ZFFA 3IAPA 4DZGA 5KXEA 2WNEA 3ZXDA 2PYTA 4XQWA 4CUGA 4D8MA 3SC7X 3OUJA 4F3JA 4FFIA 1JODA 3L2YA 1JH5A 1DGLA 2W1UA 4M0NA 5F32A 1IS4A 5DZEA 3W20A 2XPJA 4K6BA 1OVSA 1OOPC 1FPN3 2YHJA 5I0TA 4AXOA 4O9EA 3T2TA 4UXAA 4JRLA 4IGOA 4BMEA 3ZXKA 4YZ2A 4NIIA 3OTFA 2IWGB 3M3QA 1J59A 1HN0A 3LB9A 1D0GA 4K7JA 2VC9A 4LHSA 4LULA 4XBQA 2F17A 4AR2A 5C8CB 4Y4RA 4MGSA 4XFBA 4M3CE 3AZZA 1GWKA 4IEWA 1X8MA 4BE3A 1T2XA 2TNFA 2H0BA 1LJ7A 4XXAA 3FL7A 2FMYA 1RHI1 3ZX7A 1KS4A 2DBIA 4I0WB 4LBQA 3JD73 4CDXC 5C9AA 1YFWA 2Y0IA 4XUNA 5IK7A 1BCXA 4CSWA 3VZNA 2I07B 1C57A 2WNOA 3ILNA 4XJZA 1PMIA 4DB5A 1E5RA 1EAH3 5F9TA 1TEIA 5FY8A 4P9GA 3GZUC 4UYBA 1BHGA 1UD1A 2VQAA 4COYA 2YV8A 5ACA2 1CAVB 4HXCA 3MGUA 2OXBA 3GNEA 3UETA 4LUMA 4YW2A 5A3WA 4GB32 2BW8A 2ATFA 4AHYA 5LK7B 1SMVA 1AJOA 2BFUS 1QMJA 1W8TA 4EJRA 1L7QA 4CEWC 4P9XA 4PF5A 1HRI3 5KHHA 5FP3A 1HW5A 2W1WA 4FPHA 3OGVA 1WW6A 1OA3A 2JICA 1ND2C 3HBZA 4NHYA 4YVWC 2R32A 4Y24A 3ZXGA 2ADDA 4H2AA 4PLMA 1NLRA 5FZ1A 4IGPA 4Q1PA 5IUQA 4CUAA 4ORFA 4NHMA 5FXWA 1AYN2 1ND2A 4PQQA 3RZHA 2XL7A 4Q0PA 1UF2C 5FYIA 4A41A 1PGL1 2UWBA 1NCRA 4FPLA 4UWDA 1QQP3 3S30A 2VVDA 4ISRA 3OEAA 4B4PA 4JV4A 4A4AA 1UAIA 5JXJA 5JMOA 3W21A 3VBOB 3IDAA 5L7OC 1CAXA 1DIWA 2XDVA 3IDEA 2ORZA 3VD4A 2W3JA 1IS5A 3ZYRA 2EAKA 3SH3A 1Y9QA 2WC2A 4N53A 3BCWA 5BPXA 3K3OA 3MLKA 5BNNC 1W6MB 4O61A 1JUIA 4ARYA 1JZ7A 3LF7A 3D3AA 5C8WA 4TWTA 4FAGA 2R061 1C5IA 2RVAA 3ZMNA 1AYM3 1UPIA 4V1PA 5A1FA 2WT1A 1QNYA 3W5MA 3ZFGA 1HN1A 5KHJA 4TZDA 1CJDA 1NE4A 4IE5A 1C28A 4OHWA 3WW4A 3FHQA 3NL1A 4N43B 1JS9A 4YG6A 1H6YA 2IVIB 2SLIA 3WDYA 2VUJA 3NAPC 2B45X 1L7LA 2ZHKA 4HN1A 5ERLA 1W8UA 3VBRA 4DMIA 3NRUA 2D3PA 3GJBA 2WS93 2FQPA 2JDPA 1IS6A 2HWE3 3LEGA 4XCAA 2JKBA 2DTWA 4YZ3A 2YGLA 2OUJA 2VE1A 5CA6A 4C1XA 1UYZA 4LE4A 1GBGA 2RE9A 3M8LA 4EN8B 1PO23 1PVC2 3FMGA 2P3KA 1GUIA 5CZKA 3TEWA 3MUY1 1SBEA 1UN1A 1Q8VA 3JD71 4HT1T 2G1MA 2R7EB 1GU3A 3ENRA 1URXA 3KV9A 4IV1B 4JC1A 3UNPA 3T2PA 3ETQA 2ENRA 1US3A 1DFQA 3AYCA 1Y43B 2BGPA 3ASIA 3IBMA 4LQRA 5AVPA 3V56A 4NO4A 1S0EA 5DDJ1 3IN9A 4DY3A 2KR2A 5IAXA 5LZ6A 1C8M2 1UOJA 4DQAA 3ACGA 5C9AC 1UO9A 2JIJA 2FDGA 1IKQA 3L9JT 4N53C 4LBQB 3ZSEA 5C9AB 2VD7A 3GYDA 3S7EA 1VB4A 4AW7A 5JSRA 2VVFA 1L7RA 5JZGA 4NN0A 2JDZA 5IATA 4IXLA 4MG2A 2BFUL 1JU4A 2DBNA 3LDKA 4IE0A 4PDWA 4MXWA 4Z2WA 4AQTA 2NZ9A 1VBA2 2EVXA 5KHIA 3ZFEA 4LOTA 1SPPB 2RDSA 1B35A 4FTBA 5JUVA 4PDWC 1UY2A 4BLIA 4H3WA 3IMNA 2QQUA 2W68A 1T6BX 4CEYB 4M4PA 1OXCA 5EP9A 3USSA 2ZKNA 3ON7A 4A7ZA 2YXSA 4QQPA 3JCIA 1YC61 2WN3A 3T1LA 3BKZA 1R1ZA 4FP2A 1ULCA 4GQ7A 1JZ8A 2VNVA 4QDQA 1O5LA 2A70A 1VBD1 2P3JA 3WP6A 3NV2A 4AHXA 2DTYA 2DCKA 4AGVA 3NKTA 2IXJA 2YFUA 4FPEA 2CGOA 2RJLA 1SACA 3WNXA 4BOWA 1DQ0A 2FCUA 3V0BA 2QQMA 4XIOA 3GBWA 2ZABA 2DUOA 3N7JA 3BPSA 1BK1A 4OVEA 5KC6A 3ACLA 2PN5A 3NW4A 5IW0A 3I2IA 3VKOA 2D6NA 2CTVA 2VUDA 2ZX1A 3A23A 2XLAA 5L9BA 5F3CA 2WNUB 5I0SA 4AI1A 1MZ6A 3UV9A 1HV1A 4BIFA 2R49A 4HANA 5BNNB 4M01A 2VULA 5G04L 5FREA 1HB1A 2IXLA 3IM0A 3JUUA 4NAMA 1FYUA 5LW9A 1A78A 1POV1 1D4M1 4XJ8A 3ZIXA 4DXSA 3DL3A 5J96B 2HWE1 4FFHA 4PF1A 1BJQA 2HWB1 3J7NA 5C3QA 1MVEA 1XOYA 3HN1A 1QOSA 2PAKA 2WABA 3D8CA 5FP8A 1RUF2 5JSOA 1XE7A 1YFXA 4NIGA 4NVPA 1KITA 1YJKA 4XQ4A 2F4LA 2R30A 3VL8A 3RDIA 1AR73 3AM2A 1AL23 1W8OA 3ZN6B 4M3CA 3BU7A 2XMLA 1YQ5A 3M3EA 4Y3OA 4QDSA 4LO8A 3OY8A 5BNPC 1QKQA 2X10A 5CFDC 2Z42A 3ILFA 1IPKA 4J1XA 5A1AA 3LCPA 1AZDA 5LK5A 1RC6A 1QH6A 2FMDA 3ZKYA 5FZ0A 3WUCA 4YYOA 5C8CA 1VRH1 4AZZA 2X29A 3CU7A 5HV4A 3AC0A 3N9OA 2B5HA 1ASJ2 2Y33A 4P9WA 5FZ9A 2QQIA 1SBFA 1HQWA 3GXUA 3VKLA 4QB2A 4AGGA 1QH7A 3MDPA 1QY4A 2AEYA 4CVUA 5J7MA 1BXHA 1XRUA 2XJUA 5DUVA 1D0HA 4OMDA 4W65A 3FFQA 1S4CA 5JAXA 3JBG1 4QPWA 3VDDB 1ULOA 2GU9A 3ES1A 4YG3A 4XQDA 5GZEA 2EALA 5EPAA 5L9VA 3ABZA 4J6GA 1NE6A 4Y33A 4X6RB 1VAMA 3O12A 3POWA 2P5BA 2WQZC 3AKTA 4BIOA 5FO8B 4JKKA 5FMOS 3ZYPA 2NLRA 1RUC2 4BPZA 3WNMA 1OUSA 2VPVA 5K0UB 5T3NA 5C3SA 3B02A 5FYCA 4CEWA 4I30A 2C24A 1S55A 3RNSA 1HJFA 4GB31 1QNWA 1Z7S1 5F6LB 3N7KA 3M7AA 4Y20A 1D7PM 4AVTA 4CZSA 3AL5A 1R1A1 1ST8A 4FPOB 4RR3B 4OCTA 2JKXA 4QX0A 5FRAA 1N3QA 1VBE1 1FMD2 1W8NA 4KGGA 4DXZA 3CKHA 4Y20B 2PLV2 3O14A 3CLPA 2XJQA 4QX3A 5FPXA 3CIHA 3MFCA 2LROA 3WDTA 1V6KA 3TAYA 1QHDA 2FHRA 2ZGKA 4LLFA 5D2AA 3I54A 1LR5A 4A3ZA 3PLQA 3NV1A 2WZPP 1JYWA 1Y3TA 2BU9A 4QKDA 2VCMA 1Q8QA 5LBFA 4AFCA 3ZPYA 3PURA 4AFBA 1DU3D 2BTVC 2ZACA 1XXNA 4AVAA 2Z5WA 1WCUA 1VB2A 1YJLA 3CDZB 1PVXA 3VZKA 1VBA1 2C5DA 1BEV1 1VBB2 1CJPA 2JB4A 3VHOA 1QIQA 5FWJA 4JKMA 2Y6LA 4OUSA 4F8AA 1HQLA 2J1EA 4XUPA 1S0GA 1CIWA 1TG7A 2HWC3 4H7MA 4ZXKA 5JOYA 1YWKA 3F2ZA 2ADEA 3JBG3 3VDCA 3RZLA 2ETEA 1JYCA 3IPVB 3MI8A 2JDHA 3C7FA 4YGCA 5EV7A 4QHBA 3SNMA 4Q0UA 5FYUA 2VW1A 1RGSA 3T0DA 2LS6A 3QLQA 2J7MA 2GNMA 4XURA 2FDHA 1T6GC 3O5SA 5A6QA 4MVTA 2IFWA 1PZ7A 3CO2A 2B9VA 3M1HA 5DQ0A 1VE0A 1ZZ7A 1EV12 5A3UA 3AMNA 3I59B 4GB33 4RL7A 4DIQA 3PVBB 4CPBA 5EZWA 1GYKA 4V2VA 3SHRA 3ZDVA 5FK7A 4AEDA 5L36A 4COUA 2BDRA 1KDMA 2D5FA 3IDBB 4P9JA 4BH9A 1R093 2CWMA 2DCJA 3N4MA 1NCRC 2X05A 2I74A 5IVFA 1VMJA 2E9QA 1PNFA 5F7UA 1OA4A 2VBBA 5E6HA 2OX0A 1GANA 1CAVA 3BIWE 1NT0A 2K0GA 2HWC1 5F3IA 4BMBA 1YO8A 2OPKA 3TN91 1ND2B 1FV3A 5DDJ3 5BV6A 5A7NA 5HCFA 5CBLA 4KWJA 1XNTA 1C4RA 3PUSA 4FPJA 3CMGA 1I9RA 3B93A 5A33A 4YM2A 3ZYFA 4QQHA 2GP5A 3RJ2X 2ZX4A 1VRH3 1W9SA 3AFKA 1XSQA 4B1MA 1KEXA 4QXKA 2FCTA 4FPCA 3RZKA 1O4YA 3UK9A 1ENRA 3BTZA 1R1A2 1BQPA 3LGRA 2QDNA 1PX4A 1XBFA 1XE8A 3WV6A 2A6VA 4RQPC 4C90A 1NLSA 5FY0A 5C71A 2JXAA 2A1XA 4QQOA 4UFMA 2JG9A 2WNVB 4RQPB 3AZVA 4H14A 1XE0A 5E16A 5FWEA 4ZY9A 3WW3A 4AOCA 4GKYA 1LHNA 5FIXA 3WDXA 5FOBB 1J1LA 2RS12 5LA1A 4XW3A 3OBTA 2C6SA 3RI9A 3OGGA 1NKGA 4Q4V3 1UQXA 4NRMA 4YVSB 2WLPA 2JG8A 2V72A 2VMEA 3H1MA 5CADA 5LEKA 1IKPA 3N3HA 5F3GA 2O8OA 2H6BA 2IXCA 2CYFA 3D5OA 2Q8EA 1JYXA 1GMMA 5A70A 1O3TA 4NIAA 4INDA 3RRDA 1W0PA 3PUAA 1BEV2 1VBB1 4BQ5A 4CEYC 4OI4A 4LEJA 3MV01 2E7AA 1HJGA 4NHXA 4EN6B 1SQ4A 2EA7A 4CU9A 2XHNA 4QT6A 4YVWA 2OS2A 2CHHA 3E6DA 5F3EA 5G05L 3ZXAC 2MHFA 2VOVA 1AR62 1V9U2 4Q0VA 1REDA 4UFJA 1S2KA 4Y5Z0 5T52A 2WLQA 4BU2A 5H9QA 1VBC1 2UY9A 1RINA 2VH9A 3J4UH 5CYYA 3SISA 4XFIA 3QBQA 2YUEA 1RUI3 2ZGUA 5JOXA 1O3RA 2RDNA 1TE1B 5GLWA 4O9GA 2GP3A 2AREA 3TNQA 1UMZA 1HRI2 1VAKA 3M3OA 3MIEA 1A6CA 1CD3G 1BEV3 3K51A 4JZRA 4N9HA 3WHTA 2D44A 5JZGB 1AR71 2NPIA 4CRQA 5M0TA 1PK6C 5T55A 1NXMA 1LTEA 1O6UA 4BQ3A 4ES9A 3NNJA 5FPUA 3VD5A 3K77A 2WYFA 3M70A 4H55A 2DFBA 1HXS3 4M3CB 1OVPA 1PGW2 3DXUA 1H2LA 4I09A 4E8CA 2E33A 1R083 3TN93 1OKQA 4NR1A 3VBHB 2WFF2 3DXTA 4ASLA 4DPNA 1LRHA 1AR83 1MQTC 4FOYA 1CWPA 3I2GA 5GLTA 3WY6A 1WA6X 3JQWA 4DUVA 4UW3A 2VMIA 2YC0A 2PQQA 2HWF3 1OT5A 5A32A 4DEQA 1G9AA 1QWRA 2XWJB 1RTVA 3IWZA 3WDWA 5CKQA 3S0MA 4ET7A 1FNZA 2WDBA 3NJZA 3E5QA 3UT0A 4HZFA 2O8QA 2DFCA 4NHKA 5A32B 4AI3A 1H1IA 1FATA 2GZWA 3RVHA 4CCOA 5IAVA 5FOJB 3H8RA 1W2AX 1MS0A 3ECQA 4LO5B 3PTYA 3LEKA 4OQ9A 2YFZA 2DVDA 3ZXEA 4B29A 4OI1A 1KS5A 5GJ6A 2C26A 5FXVA 2JG9C 1LU1A 1MS4A 3HWJA 2WO2A 3LE0A 5F2WA 4LR4A 1JI6A 3D0JA 4JRAA 4FOQA 4MOAA 1W90A 2DCTA 3PMSA 3EJKA 5CEHA 5JPMB 3LA3A 4YZ1A 2LW8A 4UT5A 2O14A 3ZLIA 2RG4A 2PHLA 2RS51 1GZTA 3ZYBA 3BU0A 4BYYA 1DYOA 1OI6A 3ZYHA 4AI0A 4CCJA 2D7FA 2JG8C 1HRV2 2G9ZA 2GC3A 1OFNA 2XQRA 3I8TA 3M4FA 4NHLA 2JE7A 4QMAA 4BISA 1RITA 1VMHA 5J36A 5K9YA 1UYXA 4RGKA 3LAGA 2UU8A 2X8KA 2EXKA 4C1WA 3PMEA 4QHOA 5AVAA 4OHYA 4COWA 1OURA 1ZBA1 3EB7A 3OY8B 2CAVA 4W6XA 4I01A 5H9PA 1JXNA 1PIV2 3SKJE 3H3LA 4BA6A 1DLLA 1UOBA 2HBUA 3L2HA 3N7MA 3VB9A 3OJBA 2BVVA 2CGNA 1L3JA 4MYEA 4URTA 3I2FA 4D6SA 4XCBA 1COV2 1W6NA 3FE5A 4Q4W1 5FUNA 3I59A 3U4SA 1DQ4A 3CQOA 3RYRA 4RS5C 3THDA 5FPAA 3U75A 1I5ZA 3UJOA 1ND3C 3MUZ1 5I91A 1K3IA 2ID4A 4DUXA 3RZJA 1MVQA 1YFYA 1OQEA 3GBGA 1NY71 4CP1A 2G19A 1MEC2 1Y9GA 2QQJA 3A4UA 4S2GA 2XVGA 3I2HA 3SITA 4YLZA 1F4HA 1UY3A 4MGYE 4CUBA 4JX0A 2VZQA 1SZBA 4BM8A 3MICA 1VAVA 2YU2A 4FT8A 4L97A 3T2QA 1HV0A 4I3GA 2ARBA 5GZDA 5J37A 3Q9OA 5AC93 1WGPA 1XB9A 2XBO3 1N3PA 4TSVA 2QVSB 3H8XA 1M06G 3U11A 2FZ1A 1GP6A 5JXIA 4E4SA 4EYUA 3CJIA 3J7LA 1DG6A 4ATFA 1O4ZA 1FMD1 2R041 2ZGRA 4YARA 2CY6A 1RVF2 2GNTA 4KBZA 5CIRA 5FPZA 2XB6C 1DGRN 3CL1A 4QB1A 5EIYB 3UKNA 4N8MA 4KNCA 4D6QA 1OOPB 2E6VA 3FZ3A 5FYSA 4XDOA 2X5IC 3POYA 1QJX1 4DEVA 1K45A 1K5JA 1V00A 5GM0A 3DF0A 3MIHA 3URFA 1BK0A 3VZMA 4BQ4A 1WCDJ 4XMIA 1VALA 4RR3A 4AHWA 1G9DA 1S0CA 2WO3A 4QPGA 2KXLA 4CCCA 5JR2A 2JD4A 2QTWB 3E5XA 4DOUA 1S0FA 5JMCA 5I93A 2C0ZA 4YW1A 3OD0A 1O4TA 4QX2A 2VY0A 1CX4A 2BV4A 2WS91 3WF1A 4Z82A 4E4ZA 4CEWB 3J7HA 5BNPA 4FBFA 1I6XA 3I49A 1Y7BA 4HKOA 3ZFGB 5EWSA 4WVZA 4FFGA 2JDUA 4FOWA 3VBFA 2EF6A 2QQKA 4UW5A 3MIFA 4AF9A 4OUEA 4X8NA 4XEZA 2PHRA 4YSFA 1V6OA 3MIDA 2D6LX 1DZTA 2XLFA 5A3OA 2D6MA 2H0VA 1W8HA 3AP6A 2Q0AA 2WWJA 1AVBA 3GZTB 1IG0A 3ZSMA 1JZ2A 3OF1A 2BQPA 4YM3A 1JW6A 1HX6A 3HT1A 2Y64A 3NNFA 2BPA2 2OA2A 1WD3A 2VMCA 4JGYC 5T54A 1JTZX 3UESA 1VMFA 1GNYA 3LD8A 5IJRA 1RUD3 4E2QA 4IE4A 5FZOA 2PAEA 2PQSA 2ARXA 3WW1A 1YUDA 1XC6A 3ACHA 1NCQA 3Q8CA 2RS11 2OT7A 4QX1A 5DAWA 2E7TA 4J25A 2QJVA 4ES8A 4BQYA 5BNQA 5F1RA 4HKLA 2RMU2 4BCUA 1S0DA 2OQ7A 4QGNA 3AP5A 2BOJA 4KWLA 1OA2A 4MGZE 4XACA 2GSYA 4AEMA 2E53A 3Q8BA 1RUE1 2VOXA 1PZ9A 2EXIA 4IV1C 1CPMA 2JB8A 4QU2A 4CDUC 1IGOA 5JSPA 3LPFA 4Q4V2 4OMCA 3WG3A 1RB8G 2DDUA 2AZ5A 4B7KA 5C3OA 3V0AA 4QXHA 1OLRA 2D3RA 2VXJA 1MS8A 2WFPA 5LBEA 3BN6A 1CPNA 1H2MA 4IV3B 2VZ1A 1UIJA 5A7PA 1PO12 3WD5A 2D40A 2RHPA 2HWD1 4RR3C 1OPMA 3V0AB 1YQ2A 2DCZA 2HEVF 2GC0A 2RM21 4HFSA 4QPIB 1ZBA2 1ZYBA 5ABJB 3H3ZA 3MZHA 5LA0A 4CCKA 1CESA 4M4RA 4EN9B 3KGZA 3H0OA 2YGMA 4G3YC 4BQXA 3WDVA 3TEYA 2Q1FA 5J1XA 1VBC2 1W8WA 1HIXA 1RVF1 4NAOA 4XFCA 4BK5A 1F5FA 5K0UC 2FDIA 1RUI1 1H4GA 4GMP3 4JCKA 1GLHA 1PZ8A 5DUUA 1CZTA 4XBLA 1CQ9A 3VDDC 1TME1 1ZBA3 2R16A 4XABA 5CG8A 1QXRA 1A8DA 2IFRA 3OSDA 4I2OA 2VW2A 1COV1 4R4XA 3VV1A 4QWNA 5J48A 5HCHA 1LEDA 3ES4A 4V2WA 1S0JA 1OLME 2G9GA 1LOFC 2YY1A 1GP4A 1K5MB 2JE9A 5CISA 1E57A 1VIWB 2CWSA 2D97A 5ABJA 3I3EA 3TRSB 3ZXJA 1G9BA 1JYIA 1XSRA 2HYKA 2G9FA 2P3IA 4FQZA 4QX8A 4QQ2A 1YQ6A 2DF7A 5A6XA 3BODA 3I2JA 1YI7A 1JYNA 2C1FA 4HSLA 4DS0A 3T09A 1AR93 4LA2A 2VL4A 4ZU5A 4HETA 2FDKA 3N9PA 1EV13 4CCEA 3LWCA 3C2UA 2F4PA 5IK5A 4PI0A 1TNFA 1Y4WA 1PMHX 2MNGA 3H7YA 2V4VA 4LO7A 5KXCA 2W2IA 3W59A 1TME3 2GMEA 4PIXA 4R8HA 2ILMA 3AYDA 5I0UA 4MO3M 5LBBA 1ZRDA 1BMV2 2FD8A 4QPIA 3AJZA 4LUKA 1VJ2A 1QJU2 1H8TC 1WMDA 2WAAA 4IEUA 3VL9A 3WW2A 2YPJA 1MEC3 5IHRA 3O0VA 1VBB3 3IIAA 1U5IA 3HNYM 2YDEA 1GOFA 1ZVFA 1TMF1 4ZHNA 3BTYA 4PHZA 4K8RB 1JBCA 3MHZA 2RR11 4SBVA 3LZZA 5EYXA 5FP7A 3POIA 3K3NA 2P17A 5C4WC 1N47A 2A7AA 3FLPA 3PVOA 3AVRA 3VDAA 2R063 1W2TA 1WUVA 1E5IA 3ITQA 2BZDA 1SFYA 1XQNA 1RUG2 1Z7S3 4QKNA 5EYYA 1W8FA 4BK4A 4WVVA 1ZREA 4CEYA 3T30A 2VECA 1ZA7A 3P3PA 4OZXA 4CDXB 4L11A 1N1SA 2WSUA 3AMPA 5K7PA 5L9RA 4Q4X2 4IEVA 5FK8A 2XQXA 4AL9A 4IE6A 2Z79A 1CAXB 5KC5A 1H9WA 1U0AA 4AGRA 4FFFA 1YXWA 4GA9A 1TZOA 3AZWA 1SBDA 4OQ8A 1MZ5A 4LBNA 4ZS2A 2OIIA 4WVWA 1V6NA 2VUAA 1DDLA 1KGYA 5CB7A 3ZM8A 4LLOA 1OOPA 2BOIA 1K5MC 3K46A 2I2SA 1YNAA 4PDWB 5F2SA 3ZN5A 2BEOA 3HIFA 2A73B 2J1AA 4U36A 3I3DA 3MLLA 3PU8A 1ZX5A 4D7SA 5FYZA 2WT2A 2VR4A 3AMHA 3LEIA 4IEZA 4ISQA 5FO7B 1RHI2 1NZCA 4LITA 4QPIC 3RGBA 4DINB 3C7HA 1O59A 3Q8FA 3R0RA 4GD4A 3U1XA 5AC91 1I1EA 2YU1A 3VD9A 4RGAA 2OYZA 4LE3A 1UW8A 3R05A 1QJZA 4IW3A 3WCRA 3ZOIA 4D0QA 4WM7B 4FXKB 5ABJC 2P34A 4FTSA 4LHLA 5EJ3A 2Z2SB 3FX3A 5C7GA 5JXHA 5B4XA 2XKPA 3BTAA 4XJ9A 2FDFA 3WQBA 3WF4A 1WMEA 5EJZB 5C4WA 5GZFA 3P5BA 2Y6GA 2VTXA 1W06A 1AX2A 1NA1C 3QH7A 5D1IA 5LRRA 3WHUA 5BNOC 3VUOA 1UZZA 5A6ZA 1PIV3 4B4RA 3OCPA 2V73A 4IEXA 5CU1A 2ET1A 2JDAA 4FSJA 4A42A 2UYBA 2MEV1 2ZMNA 3AZYA 2IZWA 3HJRA 3MV11 2W08A 3MO4A 4NPMA 1EAH2 4PBPA 4ZU7A 5ACA3 4M0HA 4JHTA 5DABA 2BBAA 2WZEA 3CEWA 4LA3A 3WP4A 3JBG2 1BKZA 2JDNA 2OPWA 4KWKA 4R9BA 1RJ8A 3RWKX 1TMF3 5L7OA 1RUG1 4N43C 3PDQA 1F15A 2DVGA 2W1QA 1V9U3 2OZJA 3SMHA 1FI2A 3HT2A 5J98B 1D4M2 3T08A 4HKWA 4AFDA 3PL0A 1EP0A 4P14A 5LA9A 1Q8SA 1OQ1A 1UU5A 4XF9A 3O1MA 3HQRA 1N1YA 4GWJA 3UGGA 1AL0G 4FOVA 2WWUA 2OVUA 3I97A 2RS31 1E5SA 3C8XA 1GOGA 4BXSV 2UY8A 4EN0A 3JB4C 4XAAA 1HDKA 2BNOA 1QJX2 3ME2A 1ND3A 4TYSA 4CDWB 5T5JA 3B3QE 1LOBA 5FMCA 4AVSA 5DAQA 2DV9A 3ZO0B 5FAXA 5E1RA 5L7OB 3VBOC 5FZ8A 5CFCA 2AH2A 4UF0A 3U14A 4MSVA 3I3MA 4IETA 1QJU1 4K9SA 2WBKA 4MLOA 1XNKA 1W9TA 1UOFA 4JTOA 1XNCA 2A3WA 2VZTA 3KCYA 4AEKA 4D6RA 4EZHA 2XBO1 5L19A 2DU0A 2IVJA 2Q30A 2LRPA 2QQVA 2RM23 2VQ0A 3W9AA 1LECA 4D7TA 1BBT1 2QQPA 4MV2A 3QCWA 2R043 4RN5A 3CJIB 3RJRA 5F5AA 2WZ8A 3VHPA 3UKTA 4XJWA 2PHWA 3GBFA 4G9SB 2RV9A 3CF6E 3LFIA 4Q27A 3VZJA 3K75B 2ZMLA 3HOBA 2HKXA 3FWEA 4GH4A 3VBUA 1DP0A 1K42A 4I0BA 2LUWA 2ZGLA 1FNYA 2FBEA 3J8F1 4A45A 4GAZA 5FBZA 1SG3A 2QCSB 4QGMA 1S1AA 3KS7A 1NZIA 2GDFA 4P9LA 5FKCA 2XONA 2WL1A 4IGQA 2V09A 3FN9A 2R0HA 2BNNA 4P00B 4CP0A 5IK4A 3I2DA 4RS5B 3X29B 5HCAA 1AR63 3T2OA 1BZWA 5FZ4A 2V5YA 3M3IA 4Q8LA 3DECA 2XJRA 5FLIA 5FO9B 1AXYA 1NLQA 4YGEA 4KQ7A 1RUD1 1PO22 1PVC3 1W6QA 3D4KA 4C91A 5F6KA 5DAVA 1W6NB 4AE2A 4HOOA 3HD8B 4XFFA 3LIGA 5BNOA 3P1IA 4GJZA 4ZS3A 3A0KA 2X5IB 2WZR2 3QOPA 1X7NA 4L99A 1PGW1 2WJSA 3V0BB 1UWWA 2Q1MA 5A7SA 4MXWB 1R091 3NWKA 2RM22 1ZZBA 4FPGA 3WR0A 5DZFA 3UGFA 4LK7A 4WM8C 1OF3A 2YROA 2D3SA 2R1BA 3A0NA 3WG1A 5IVJA 2DVAA 3H42B 3KD4A 5DMYA 2NYYA 2CGPA 4CDWC 2B7YA 1MPXA 2XJPA 3NO8A 4MXVA 3FBYA 1DQ1A 2NMOA 4CXWA 3C7EA 1WBLA 4IEOA 1W0NA 5FYMA 5FUPA 4B7EA 4EV0A 1K12A 2BBVA 2ZEXA 2TBVA 3H50A 1QJY3 4NROA 4LHKA 4Z92B 1TVGA 3KF3A 1YQCA 4LJHA 1ZZ6A 2JIGA 4QPYA 4RD7A 5JCTA 3O7OA 3S6PA 3ZFEB 4HVQA 1W3VA 1ASJ1 3GZAA 4CYDA 5FZGA 2HJIA 2WRAA 4AG4A 1S0BA 2A6ZA 2Y6JA 1LAJA 4CDQB 1D4VB 2NQYA 5JDBA 4Q4Y3 3EXUA 1H8VA 1MS5A 4A3XA 3CZUA 1WBFA 2IXKA 2B8MA 4XFHA 3RS6A 2W47A 5C3RA 1V6JA 4U2AA 5ANQA 5FZLA 2VTXJ 1LHOA 5CFCC 4XHBA 1RUE2 2Y6FA 2VU9A 5FY4A 4AVVA 2WWSA 3EQEA 1ODNA 2D5HA 4KU7A 4FQ4A 4PLNA 2QE3A 4Q0SA 3S5QA 1YHFA 3GALA 3POBA 4I3PA 4TXWA 3THCA 2RDRA 1BBT3 3KV6A 4DXRA 4Q8KA 3ZXLA 4ASKA 1KD7A 1G7YA 1PO11 2VVEA 1EYBA 3IB3A 5DZGA 3AMMA 1TNRA 1FV2A 5SV8A 3SLIA 3V64A 3MW3A 4FI9A 4QX7A 3VKFC 1VBE3 3DPRA 3BYWA 4LIUA 4XF1A 1LHUA 4XTPA 1I5PA 3ETPA 2WQ4A 1XYPA 5T50A 4IESA 2XXZA 4I02A 2VMFA 3GHNA 3DYOA 4RQPA 4Y5SA 4CXXA 1DQ6A 4YZ5A 3OB8A 4CP2A 1GSLA 1XNAA 3B94A 4XC9A 3VBSB 1MS9A 4UW4A 1XU2A 1XJAA 1NAEA 4MGQA 4LK6A 2VZRA 5LATA 3WCSA 2LTNA 1WCQA 3MW2A 4GWMA 4RSUA 3B9CA 5GLUA 3VHRA 2RS33 4Q4W3 2VNGA 1C8M3 4FXGB 1SLBA 4W6YA 2A5ZA 2SBAA 2VOTA 2YZ4A 5AFBA 4LBOA 2Y8KA 1SHWB 1ZZ9A 2ZTNA 4ARXA 2BWAA 4E2GA 2CNAA 3BPZA 4PIZA 5JI9A 3D0SA 1DZRA 3N9QA 2EXJA 4MGTA 1WCKA 1MZEA 1CZVA 2TEPA 2Y6HA 1UY0A 1W9FA 2FDJA 1RXGA 4KMQA 5A3PA 2K2SA 3H3UA 1UYYA 3AK0A 4S2HA 4XUOA 3VDDA 3PNAA 4A6OA 4XJUA 3UKVA 4UOJA 2PHDA 1MQTB 3HVDA 4IDZA 1X33A 3VBHC 2L9LA 4L2NA 3KHCA 4OHVA 3IDCB 4YVSC 4B3NA 4KI5M 4GZ9A 2E51A 2VNOA 4E4DX 4YFZA 5C8CC 1V6MA 4CDWA 3T4VA 2ZX3A 2VCAA 1W6PA 5FZ3A 3ELNA 4FTEA 2JX9A 2WAOA 3I4IA 1KFXL 4UW6A 5LCWL 3H8OA 3G6JB 4LKFA 2ZGTA 2VZOA 4BXFA 4NRPA 1CVNA 4OUMA 4R9CA 3R4UA 1XNBA 1AJKA 3VBSA 5AC92 5A7OA 2CV6A 4NPLA 3PUHA 2RR12 3OGRA 4AI2A 2E31A 3GZEA 5FYHA 2HH9A 5GZCA 1F8VA 2HYXA 2B39A 3DYMA 3LSDA 1WLTA 1REFA 1KDKA 4ONUA 4Y22B 1UZVA 4EWDA 4LT5A 3K4ZA 4HMZA 3BGAA 4P02B 2VZVA 2WO1A 5A80A 3H1YA 1E5HA 3T0AA 1WLWA 2OUHA 3MPBA 5FMDA 4K21A 5GZGA 4QD2A 2D98A 5DDJ2 3AP7A 5A7QA 1JZ6A 1LCLA 1IS3A 3G7DA 5D8AC 3RWNA 1ZBE1 4GH4B 3FC0A 1EPWA 1Q43A 4L92A 3VBUB 5I0RA 3SCGA 2CL2A 2PA7A 3E5UA 4QHZA 1AYN3 1S2EA 2VQUA 2JE8A 1GP5A 2YMZA 1GQHA 1QJU3 3OUIA 4Q4Y1 4N90A 1COV3 5F39A 4HL0A 1QEXA 1RUH2 4HVOA 4WM7A 2JWPA 1JZ5A 5FZKA 1FX5A 1EV11 2W9XA 2A6WA 4HLTA 5FPVA 1DYPA 5F8PA 2ZGQA 3T1MA 2A3YA 4XDQA 4AWDA 2QKDA 3DPRC 4TLFA 5FYVA 1POQA 4A7YA 1TQ5A 2ZHLA 4QKBA 4P5YA 1SCRA 2X09A 4K3UA 2YBPA 1WA4A 2E63A 4DFSA 1RJ7A 2JENA 3VKNA 2Y0OA 1RXFA 3WF0A 5JVVA 1RUD2 2Q5TA 1BBT2 1JHJA 2ZHMA 4Y1ZA 5CKMA 1JMUB 2P3YA 3B00A 5FUIA 1U5XA 1VP6A 1H8TA 5DUXA 3FLTA 4AQ6A 5F37A 3PU3A 1SLCA 2R6QA 3NQHA 1UX7A 4OHXA 4CCLA 5IWFA 3JD72 2W39A 5CFCB 4MADA 4XILA 3GM8A 5IVBA 1V70A 2N7GA 3OPTA 5FY5A 5LRSA 4AK3A 1S0IA 4P08A 3NJXA 1C8NA 2YBSA 3LDRA 2P6HA 2V5DA 1GZCA 1NCQC 4TTGA 3RYKA 1OMIA 4RFT0 5LY1A 5F5QA 1LOCA 4X6QB 2ZJCA 1B09A 1VRH2 5LA2A 3NNLA 4XFGA 4K8FA 3T4HB 1KJLA 5GKAC 1MS3A 2ZGMA 5IT6A 5KXBA 2WA4A 3GGLA 1GZWB 4HPKB 3QD6A 3HAGA 4YW4A 3D82A 5CAZA 2W1SA 1OHFA 3U78A 2DCYA 5FZDA 1HQNA 3FFZA 3OG2A 4D7YA 4RHV2 1GZWA 3H1WA 4AFMA 1YCIA 4IV3C 2GN7A 4LBMA 5TSWA 4CDXA 3EO6A 3TYJA 1WMXA 3J7MA 2E26A 4WZFA 1HXS1 1S2BA 5E8AA 4BB3A 1IZ3A 1PGSA 1RUJ2 1W6OA 1WLDA 2HWD3 3OBZA 1DHKB 4KG0A 4OHZA 3ZFFC 2LM3A 4CPBD 4EROA 1X9PA 2VZSA 4Q4V1 2RS52 3N9MA 3NNMA 4EZ4A 1WKYA 4LKSA 2RMU3 2PHXA 1OD5A 2DVBA 2XJVA 3AKPA 2H6CA 4LTAA 2CSGA 5K0UA 3EYPA 1RUF1 3J8F2 2YC4A 1Z7S2 2J22A 2CDOA 5FMBA 1J1TA 4NMIA 1GNHA 1CAUB 2QQLA 3SCFA 1YRZA 4LKDA 4CCNA 4Y1YA 5HV0A 3Q8EA 3P6BA 3WNKA 1ASJ3 4XETA 2VXRA 3TEZA 4YRDA 2KA3A 5E88A 2AEZA 3VBRB 3RSJA 5IVVA 2B9UA 4Q5OA 3AFGA 4META 1LULA 4IEYA 4KH9A 3AP4A 4LMFA 1ALYA 4NWVA 1CR7A 3SH5A 2R0FA 4CP9B 2ERFA 1UNBA 2B42B 2Z69A 3M3CA 4MH0E 4XFAA 1PGL2 4LORA 4LNVA 5JXGA 4BZ4A 2ZBJA 1K5MA 4MUVA 3OPZA 5BNPB 4AEDB 1F9KA 1Q5OA 4CP9A 3AX4A 1AHSA 3W58A 1AR72 1RMU1 4Y5TA 1ND3B 5CG9A 3MIGA 3MYXA 1W2OA 4URAA 1U12A 3DN7A 2EIGA 3J8F3 3FHIB 2HWE2 2HWB2 1B35C 1OLQA 2WS92 2XUMA 3HQXA 3WQ0A 1HLCA 1H0BA 1G9FA 3IZOA 4R9DA 4S2DA 4YW5A 5FV3A 3WVJA 5CFDB 3CZJA 5KR7A 2AYHA 3TWIA 3J9SA 1FT9A 1ONAA 3VBOA 1OLMA 4GH4C 3VBUC 2BJSA 2IXIA 3ZFEC 2WN2A 5LBCA 2V4AA 4JAAA 4E2SA 3MLJA 2PHFA 3O0XA 5FZFA 1QJEA 3OOXA 4WV8A 3WNOA 2IXHA 4NWWA 4IUGA 4AVBA 1RVF3 3LOBA 1NOVA 4S2FA 1OPOA 3VLBB 5FZIA 1EPZA 4P9YA 4AQSA 3E97A 2VUCA 3ZXFA 4ZKTB 3WG4A 5CNAA 1R1A3 5FY7A 1RUG3 1KRIA 5CFDA 2A71A 3PUQA 5FJKA 2JG9B 2WNVA 4AHZA 3ILRA 2W94A 2XHKA 4PJYA 3VBFC 4IV1A 1C1LA 3H7JA 3KF5A 4A2UA 3BI3A 1LU2A 2WR9A 2Y60A 4IE7A 4LOSA 1WWYA 3RG0A 2UWCA 1POV0 2VZUA 1ZNPA 2XUEA 5FDBA 3HN3A 5L73A 2YPDA 4NJ4A 4WBBA 1XYNA 3R4DB 4JTNA 4N9IA 1QQP2 2YC2A 5FYTA 3THTA 4E4HA 2DURA 1KQRA 1RMU3 5FBJA 4PIYA 5K8SA 2C9KA 2WKKA 2XR4A 4RGGA 1VR3A 5LEJA 4XE9A 2W92A 3IIIA 4LKEA 2AC1A 2J1VA 2ZX2A 3H9AA 4NIDA 1JOPA 1EUUA 3SEEA 2Y26A 3DV8A 3VDBA 1ULGA 1JN2P 1GZ9A 4UFIA 2NMNA 4EN7B 4UFKA 5BUVA 1VBE2 3U0ZA 2BNMA 5IVCA 5B4NA 4JGZA 1AXKA 1PK6B 5JWPA 3C7OA 1O8PA 1QXJA 4N53B 2VTFA 4QKFA 3UJQA 3POEA 2XG3A 4OYUA 1MQTA 5BXXA 5A1LA 1O3SA 1RUJ3 4QXBA 1NX9A 4LXLA 2JG8B 1O7FA 2HWC2 1NQJA 1GR3A 1BVP1 3K48A 1HRV3 4GMP0 4B4QA 3U07A 3DKQA 2FZ2A 1AR81 1GWMA 4LBKA 3O1PA 3RZMA 3OGJA 4CU7A 2ARAA 1UYPA 2W87A 4Z2AA 1LGNA 2ZEWA 5HCBA 3HEIA 1PVC1 2NN8A 5EFUA 3I2OA 4QQLA 1ULPA 3JQXA 4MHUA 3GF6A 3HBKA 3PVNA 1QOTA 2C4XA 2EICA 5J09A 3SKVA 4YGBA 4K40A 1WCSA 5D21A 1IOAA 1LESA 3S57A 2TUNA 2R1DA 2Q4SA 2Y6KA 4HN0A 4OFGA 3SCHA 3UL2A 1ZM1A 5DN2A 5BYNA 1DGWX 1DZQA 2A6YA 2QNKA 4IEQA 3TOJA 4COZA 4OI2A 4NUBA 2GNBA 1WLCA 2Z4FA 5JIAA 2VMDA 1OSGA 1SLAA 2ZA9A 2AR6A 3BB6A 3KMHA 4QB6A 2J1UA 4KL1A 1FAYA 3POGA 1FMD3 2QBXA 2ZEZA 4NRQA 5DG1A 5HPOA 3AYEA 5HBAA 4SLIA 1W28A 2OKXA 3Q8AA 1W3XA 5IFTA 2MEV2 1CZSA 1DGRA 4R9AA 3U4XA 1XNDA 2CDPA 4KWUA 2EAAA 3LOIA 3M2MA 4UF0B 1XYOA 4EWAA 5C6CA 1R081 1AX1A 4IERA 5FPLA 3LA7A 3BIEA 4CTEA 2R062 4AVCA 1Z0HA 2ZAAA 1RUJ1 3INAA 1FXZA 1ULDA 3W5NA 1CGPA 2YYOA 4ZPIA 1PNGA 1Q8OA 2QFEA 4QDRA 4A7KA 4EWEA 2WUHA 3KCXA 3LPGA 1XPWA 1H2KA 4XIKA 1GV9A 1RUI2 3AYAA 2W5FA 3ZVXA 5BY5A 3USUA 1SCSA 2AENA 1UCXA 3AB0A 3NAPA 5EHDA 4GWIA 4QM8A 2BGOA 4BQ2A 3WUDA 3RI8A 1JZ3A 3CBNA 5IVYA 4CXYA 4XF0A 4LIVA 1ENQA 1AYM1 1MS1A 1HB3A 1O8SA 4XXPA 2Q8OA 4XZPA 1PM7A 1LODA 2GN3A 1IPJA 4P5HA 4XYXA 3K4DA 3S7IA 2E32A 4DRVA 3ACFA 5KXDA 1W8ZA 2RJKA 1UMIA 1A8MA 3R4SA 1G8WA 3FUQA 1UY1A 1LOEA 1AX0A 4JKLA 4AEDC 5JIUA 5ISLA 1AL22 3JU9A 1SFNA 1RUF3 1REEA 4C0HA 2O1QA 4N7UA 1WW5A 4XMAA 2F6BA 2WINB 4LO6B 2MEV3 1UXXX 1RUOA 2X5IA 3WNLA 2PTMA 2VOWA 1LOFA 1SLTA 3KT4A 5FLJA 3HPNA 4GMP1 3AXEA 1CONA 3ACIA 2IC1A 5H9SA 1W04A 4ATEA 1LNSA 3OYWB 3QACA 4KG8A 5A7WA 2B46X 1IPSA 4A6SA 2W95A 3ZYJB 1A34A 4TN7A 2VBDA 3OBRA 3PIGA 3ST7A 4QPGC 4RA0A 1RUH1 5C5UA 3CHXA 1I3HA 4E8DA 1F4AA 3VHNA 1FPN2 2C9AA 2WSVA 1VPHA 3VKMA 3GJAA 3GCXA 5EXOA 4JGZC 4L9BA 3NSTA 2GC2A 3PVEA 4Q26A 3SH4A 5FY1A 3VBHA 1D4M3 3POSA 3VZOA 4H7LA 3ZFFB 4PT6A 1PO21 2JDYA 5T5PA 1YEWA 3DUIA 3MFAA 1G9CA 1AR82 2ORXA 4JDMA 4JGYA 1DYKA 1GQGA 3UGHA 2P6CA 4DY5A 3RMYA 5DPNA 3JXSA 2WT0A 4FP3A 3KVBA 1LOAA 1YYNA 3FBMA 2D6KA 4N7IA 5SV5A 5DUWA 4CCDA 1DF0A 2JECA 2VBPA 5JOWA 1BLZA 1Y9MA 5IK8A 2BYVE 2W91A 1J83A 2AUYA 3NMBA 1VBA3 2OQ6A 3SQOA 2GNDA 2K46A 5C70A 3MW4A 2WZR3 1CAUA 2HWB3 3FHAA 1H4HA 4GULA 4XUQA 5E89A 1RL3A 5LY2A 1ZZ8A 4QU1A 1C8M1 5FLHA 3WX5A 2LALA 3PJYA 2ZGNA 4OLLA 3VBSC 2DUQA 3RZZA 4L8QA 1C1FA 3DCQA 1OFSA 3IAQA 3WP3A 1LOGA 4O65A 4OULA 2J1SA 4CDUA 1ODMA 2XL9A 1J3RA 4K20A 1V0AA 1SFPA 1NUKA 2BWCA 2AGSA 1DCSA 1QDOA 1GICA 5T5LA 3O1UA 5A3NA 3LSEA 1STMA 4R4ZA 4YNIA 1NY72 4YW7A 1IQDC 2GMPA 2W52A 4LO4B 3ZYIB 3UYJA 1MACA 5KHGA 1LKNA 5J3UA 4AI9A 3F95A 4FPFA 1V6IA 4P9IA 2JD9A 3OPWA 1PM4A 2RR13 4A44A 1POV3 4FPYA 2XLGA 2DYCA 3AKQA 2PAMA 3ATGA 3E1F1 3ZMOA 4BJ0A 5F5CA 1W6QB 2AACA 4W6WA 2R042 3RPQA 1UU6A 4EE2A 1AR92 2D6PA 1LENA 3O0WA 3VGIA 1H1AA 1OKOA 1J58A 3PHMA 3AKRA 3MBWA 4HG6B 2RS13 1N1VA 1CN1A 5FKBA 1PIV1 1PK6A 1ZRRA 4FCAA 3ZSJA 5FR3A 5D8AA 3VD3A 4NE9A 3O1RA 2PLV1 2Y34A 1IG3A 2QZ3A 2ZAHA 5DXDA 4RHV3 4YW3A 5CKNA 2PHUA 3KWVA 1W0OA 1QJY1 3DKWA 3APBA 1NCQB 4YFWA 4IQPA 4JQRA 4GKXA 2VGDA 4LBQD 1EAH1 4MZUA 2UWAA 1NA1A 1W05A 1QJX3 3OBAA 3PTRB 3WXPA 4DNYA 1X9TA 1KJRA 1DGWA 3NV3A 4KGQA 4AQ2A 1AUYA 3IPVA 1ENSA 3O1SA 3RZGA 3R6SA 4MX3A 3TB0A 2WNUC 3KQ4B 5FYBA 4QX5A 3N35A 1DQ2A 3E6BA 5HXVA 4GIQA 3O1OA 3LFMA 3U37A 1O5UA 4KBBA 1H2NA 2Q8CA 3NV4A 1P8JA 1OBNA 3JZVA 3VZLA 5I0DA 3KCCA 4YVSA 4IEPA 4LBJA 2VMHA 2WQ8A 3DEMA 3HQUA 1KXGA 4CCMA 4PQ9A 5EQUA 4GWNA 1V6LA 4XF3A 2CU5A 4GALA 3O1TA 3ZN4A 3V65A 1OQDA 2GMMA 3DPRB 4DUWA 3QH6A 1ZRIA 2MPFA 4ZZ5A 1LB2A 1JUHA 5KHKA 4JGYB 3ZKUA 4AEJA 4DXTA 2JEMA 3ZIWA 4ITCA 1NQDA 3A22A 5FZ7A 5IVEA 3OD4A 5C4WB 1WW7A 3WNPA 4BQWA 4AI8A 1QXPA 2DVFA 4TLGA 1NG0A 5F5IA 1N3OA 5FZMA 5I8YA 1WZXA 3ALQA 2HLEA 5D8AB 5GALA 1RIRA 2WIIB 2XJTA 1SLLA 5A33B 2NP0A 4F83A 1JYTA 2FCVA 1QDCA 3KB5A 1Q3EA 2UYAA 3P3NA 1VRBA 1QGLA 3TNPB 4RS5A 1X8EA 2ZPXA 4GXLA 1FOD1 2WYSA 3KT1A 1LGBA 3NJYA 1RUE3 5FZCA 5AFEA 5C5TA 4BHPA 2BGCA 3HMYA 3POFA 5ACA1 1HB2A 4LPLA 4HPKA 3B7MA 1UIKA 1F35A
chains in the Genus database with same CATH topology
4MADA 3GM8A 2DCKA 4M4RA 2YFUA 4P08A 3NJXA 5J1XA 2V5DA 1PX3A 2VM9A 4BK5A 2QQMA 4TTGA 3HNBM 3PUIA 2J1RA 5LA2A 3I2KA 1CZTA 3I2IA 4RYDA 3A23A 3GGLA 2BERA 2W1SA 4XUTA 3OG2A 2VCBA 2ZEYA 5G04L 2W46A 2E26A 3I3EA 1CX1A 4DXSA 1US2A 2VJXA 4PF1A 4W4ZA 2VZSA 3I2JA 2WABA 1JYNA 1WKYA 4LKSA 4BDVB 3T09A 2KD7A 2VL4A 4UI9L 3EYPA 2YC4A 1W8OA 2B4KA 2J22A 2CDOA 3C7GA 4QDSA 2QQLA 1UZ0A 2X10A 1PMHX 5A1AA 2V4VA 3A7QA 3P6BA 3WNKA 2XOMA 3SEPA 4MO3M 3WNNA 2WAAA 1RYYA 3A21A 1SDDB 5IHRA 3AC0A 4UAPA 2QQIA 3GXUA 4ZXEA 3HNYM 4QB2A 4CVUA 1GOFA 1EUTA 5JXGA 4OMDA 4QPWA 1ULOA 3VDAA 3ABZA 2BZDA 5IFPA 4BK4A 4JKKA 3DYPA 1R64A 3WNMA 3CZJA 2XQXA 4JHZA 1GQPA 1D7PM 2WN2A 4XVHA 1W99A 2JKXA 4QX0A 1W8NA 4CU8A 3WNOA 3CKHA 1KGYA 4IUGA 4QX3A 3ZM8A 1OD3A 3CIHA 3WEZA 3T0BA 3K46A 2VZ3A 4A3ZA 1H6XA 1JYWA 2YB7A 2J1AA 1CIYA 3I3DA 2W94A 2VR4A 3LEIA 2VCCA 4W8JA 2VQTA 3CDZB 3C7HA 1O59A 3VD9A 2VZUA 4JKMA 2Y6LA 4CUCA 3HN3A 2J1EA 4XUPA 1TG7A 4D0QA 2YC2A 3F2ZA 3VDCA 2C9KA 3C7FA 5C7GA 5JXHA 5B4XA 3I3BA 2W92A 3WF4A 3WQBA 3IIIA 3T0DA 5EJZB 2J1VA 2LS6A 2J7MA 2QQOA 4XURA 1EUUA 2Y6GA 3SEEA 3VDBA 3WF3A 3VD7A 2B9VA 5DQ0A 2YG0A 2RJ2A 5B4NA 1GOHA 1PMJX 4XZUG 3C7OA 1O8PA 1UY4A 2JDAA 2VTFA 4A42A 2DCJA 4OYUA 3HJRA 3MV11 2X05A 3MO4A 1NX9A 2BBAA 2EIBA 2WZEA 5F7UA 4CU7A 2W87A 4Z2AA 2ZEWA 3HNMA 3HEIA 1JZ8A 1J84A 2W1QA 1XNTA 1ULPA 3T08A 3CMGA 4AAXA 2EICA 2C4XA 3SKVA 1W9SA 4GWJA 1KEXA 3LQCA 2VZPA 2Y6KA 2ZXQA 5DN2A 3I97A 3C8XA 4BXSV 1GOGA 4CU6A 1PX4A 2QQNA 2Z4FA 3NJVA 2VMDA 5C71A 4QB6A 2J1UA 4ZY9A 2QBXA 2ZEZA 5HPOA 2OKXA 5LA1A 5IFTA 1NKGA 2WBKA 5IYYA 1OH4A 1JYVA 1CZSA 1W9TA 2V72A 5EIYB 2VZTA 2VMEA 3GDBA 2CDPA 4KWUA 4YPJA 3OGSA 5HXMA 1JYXA 1GMMA 2EIEA 3WF2A 4RN5A 2WZ8A 3MV01 1JZ4A 4ZZ8A 3W5NA 3WSOA 4CU9A 2XHNA 2RV9A 4QDRA 5G05L 2WUHA 3K75B 3HOBA 3LPGA 3K4AA 1K42A 1DP0A 1XPWA 1JU3A 4A45A 3OEBA 1SG3A 1UXZA 2W5FA 2J1TA 2XONA 4GWIA 2BGOA 3FN9A 4P00B 5CYYA 1JZ3A 1W9WA 3T2OA 1UMHA 3NNGA 1O8SA 1OF4A 3DECA 4W50A 3K4DA 1YQ2A 2E32A 3ACFA 4L0PA 4OZOA 1UMIA 1UY1A 4JKLA 4QAWA 5EJ1B 3P1IA 3VD5A 1UWWA 3K77A 1UXXX 1OF3A 3WNLA 4E8CA 2E33A 5DMYA 2VO5A 1DLCA 2EIDA 1MPXA 3HPNA 3IAPA 3C7EA 3I2GA 3ACIA 4D8MA 4DUVA 1W0NA 1LNSA 1OT5A 2W1UA 1K12A 4DEQA 2ZEXA 2W95A 1TVGA 2WDBA 4ET7A 4E8DA 1F4AA 4AG4A 3ECQA 3LEKA 2Y6JA 2YFZA 2VC9A 4LHSA 2C26A 4MGSA 4PT6A 2WO2A 3LE0A 3CZUA 1T2XA 1JI6A 4MOAA 2W47A 3FL7A 2ORXA 4XUNA 2LW8A 5DPNA 3JXSA 1DYOA 3THCA 4TXWA 1BHGA 4DXRA 2W91A 1J83A 1UYXA 3UETA 3IB3A 5C70A 4XUQA 3FHAA 3EB7A 4FI9A 1I5PA 3ETPA 3SKJE 1L7QA 2VMFA 3DYOA 3OB8A 3I2FA 2W1WA 3IAQA 1XNAA 3OGVA 2J1SA 3CQOA 1NAEA 4MGQA 2VZRA 3THDA 3MUZ1 1WCQA 4CUAA 2ID4A 1K3IA 4DUXA 1NUKA 4PQQA 2VOTA 4A41A 2QQJA 2Y8KA 3OEAA 1SHWB 3I2HA 4A4AA 4ARXA 1F4HA 1IQDC 5JMOA 5JXJA 3IDAA 1UY3A 4CUBA 2ORZA 4JX0A 3VD4A 2VZQA 2W3JA 2JD9A 4A44A 1CZVA 2Y6HA 3T2QA 3E1F1 1UY0A 4BJ0A 4KMQA 4ARYA 1JZ7A 1UYYA 3D3AA 4XUOA 4A6OA 5JXIA 2RVAA 4UOJA 2L9LA 3W5MA 1HN1A 3MBWA 4HG6B 4KI5M 4GZ9A 4QB1A 3FHQA 3VD3A 2VCAA 1H6YA 4DEVA 1K45A 3NRUA 2WAOA 5LCWL 2WO3A 5JR2A 3OBAA 2VZOA 3LEGA 4QX2A 1UYZA 3WF1A 3PUHA 3OGRA 2E31A 3J7HA 2HYXA 3U37A 3DYMA 1P8JA 3K4ZA 1GUIA 3BGAA 2VZVA 2WO1A 3MUY1 2QQKA 4P02B 5CZKA 2R7EB 5I0DA 1GU3A 3T0AA 4OUEA 3UNPA 2WQ8A 3T2PA 1US3A 2BGPA 1JZ6A 4LQRA 1JZ2A 2Y64A 2VQUA 2VMCA 2JE8A 3ACGA 4DUWA 4ZZ5A 3UESA 1JZ5A 1GNYA 5IJRA 4DXTA 2W9XA 1L7RA 2PQSA 1XC6A 3ACHA 3A22A 3WNPA 1JU4A 4QX1A 4P5YA 2X09A 2HLEA 3WF0A 1JHJA 5JUVA 1UY2A 5FUIA 3LPFA 4OMCA 2DDUA 2WYSA 4M4PA 5LA0A 2WN3A 3BN6A 3NQHA 4LPLA 1UX7A 2VZ1A 4QDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MAD A;  3GM8 A;  2DCK A;  4M4R A;  2YFU A;  4P08 A;  3NJX A;  5J1X A;  2V5D A;  1PX3 A;  2VM9 A;  4BK5 A;  2QQM A;  4TTG A;  3HNB M;  3PUI A;  2J1R A;  5LA2 A;  3I2K A;  1CZT A;  3I2I A;  4RYD A;  3A23 A;  3GGL A;  2BER A;  2W1S A;  4XUT A;  3OG2 A;  2VCB A;  2ZEY A;  5G04 L;  2W46 A;  2E26 A;  3I3E A;  1CX1 A;  4DXS A;  1US2 A;  2VJX A;  4PF1 A;  4W4Z A;  2VZS A;  3I2J A;  2WAB A;  1JYN A;  1WKY A;  4LKS A;  4BDV B;  3T09 A;  2KD7 A;  2VL4 A;  4UI9 L;  3EYP A;  2YC4 A;  1W8O A;  2B4K A;  2J22 A;  2CDO A;  3C7G A;  4QDS A;  2QQL A;  1UZ0 A;  2X10 A;  1PMH X;  5A1A A;  2V4V A;  3A7Q A;  3P6B A;  3WNK A;  2XOM A;  3SEP A;  4MO3 M;  3WNN A;  2WAA A;  1RYY A;  3A21 A;  1SDD B;  5IHR A;  3AC0 A;  4UAP A;  2QQI A;  3GXU A;  4ZXE A;  3HNY M;  4QB2 A;  4CVU A;  1GOF A;  1EUT A;  5JXG A;  4OMD A;  4QPW A;  1ULO A;  3VDA A;  3ABZ A;  2BZD A;  5IFP A;  4BK4 A;  4JKK A;  3DYP A;  1R64 A;  3WNM A;  3CZJ A;  2XQX A;  4JHZ A;  1GQP A;  1D7P M;  2WN2 A;  4XVH A;  1W99 A;  2JKX A;  4QX0 A;  1W8N A;  4CU8 A;  3WNO A;  3CKH A;  1KGY A;  4IUG A;  4QX3 A;  3ZM8 A;  1OD3 A;  3CIH A;  3WEZ A;  3T0B A;  3K46 A;  2VZ3 A;  4A3Z A;  1H6X A;  1JYW A;  2YB7 A;  2J1A A;  1CIY A;  3I3D A;  2W94 A;  2VR4 A;  3LEI A;  2VCC A;  4W8J A;  2VQT A;  3CDZ B;  3C7H A;  1O59 A;  3VD9 A;  2VZU A;  4JKM A;  2Y6L A;  4CUC A;  3HN3 A;  2J1E A;  4XUP A;  1TG7 A;  4D0Q A;  2YC2 A;  3F2Z A;  3VDC A;  2C9K A;  3C7F A;  5C7G A;  5JXH A;  5B4X A;  3I3B A;  2W92 A;  3WF4 A;  3WQB A;  3III A;  3T0D A;  5EJZ B;  2J1V A;  2LS6 A;  2J7M A;  2QQO A;  4XUR A;  1EUU A;  2Y6G A;  3SEE A;  3VDB A;  3WF3 A;  3VD7 A;  2B9V A;  5DQ0 A;  2YG0 A;  2RJ2 A;  5B4N A;  1GOH A;  1PMJ X;  4XZU G;  3C7O A;  1O8P A;  1UY4 A;  2JDA A;  2VTF A;  4A42 A;  2DCJ A;  4OYU A;  3HJR A;  3MV1 1;  2X05 A;  3MO4 A;  1NX9 A;  2BBA A;  2EIB A;  2WZE A;  5F7U A;  4CU7 A;  2W87 A;  4Z2A A;  2ZEW A;  3HNM A;  3HEI A;  1JZ8 A;  1J84 A;  2W1Q A;  1XNT A;  1ULP A;  3T08 A;  3CMG A;  4AAX A;  2EIC A;  2C4X A;  3SKV A;  1W9S A;  4GWJ A;  1KEX A;  3LQC A;  2VZP A;  2Y6K A;  2ZXQ A;  5DN2 A;  3I97 A;  3C8X A;  4BXS V;  1GOG A;  4CU6 A;  1PX4 A;  2QQN A;  2Z4F A;  3NJV A;  2VMD A;  5C71 A;  4QB6 A;  2J1U A;  4ZY9 A;  2QBX A;  2ZEZ A;  5HPO A;  2OKX A;  5LA1 A;  5IFT A;  1NKG A;  2WBK A;  5IYY A;  1OH4 A;  1JYV A;  1CZS A;  1W9T A;  2V72 A;  5EIY B;  2VZT A;  2VME A;  3GDB A;  2CDP A;  4KWU A;  4YPJ A;  3OGS A;  5HXM A;  1JYX A;  1GMM A;  2EIE A;  3WF2 A;  4RN5 A;  2WZ8 A;  3MV0 1;  1JZ4 A;  4ZZ8 A;  3W5N A;  3WSO A;  4CU9 A;  2XHN A;  2RV9 A;  4QDR A;  5G05 L;  2WUH A;  3K75 B;  3HOB A;  3LPG A;  3K4A A;  1K42 A;  1DP0 A;  1XPW A;  1JU3 A;  4A45 A;  3OEB A;  1SG3 A;  1UXZ A;  2W5F A;  2J1T A;  2XON A;  4GWI A;  2BGO A;  3FN9 A;  4P00 B;  5CYY A;  1JZ3 A;  1W9W A;  3T2O A;  1UMH A;  3NNG A;  1O8S A;  1OF4 A;  3DEC A;  4W50 A;  3K4D A;  1YQ2 A;  2E32 A;  3ACF A;  4L0P A;  4OZO A;  1UMI A;  1UY1 A;  4JKL A;  4QAW A;  5EJ1 B;  3P1I A;  3VD5 A;  1UWW A;  3K77 A;  1UXX X;  1OF3 A;  3WNL A;  4E8C A;  2E33 A;  5DMY A;  2VO5 A;  1DLC A;  2EID A;  1MPX A;  3HPN A;  3IAP A;  3C7E A;  3I2G A;  3ACI A;  4D8M A;  4DUV A;  1W0N A;  1LNS A;  1OT5 A;  2W1U A;  1K12 A;  4DEQ A;  2ZEX A;  2W95 A;  1TVG A;  2WDB A;  4ET7 A;  4E8D A;  1F4A A;  4AG4 A;  3ECQ A;  3LEK A;  2Y6J A;  2YFZ A;  2VC9 A;  4LHS A;  2C26 A;  4MGS A;  4PT6 A;  2WO2 A;  3LE0 A;  3CZU A;  1T2X A;  1JI6 A;  4MOA A;  2W47 A;  3FL7 A;  2ORX A;  4XUN A;  2LW8 A;  5DPN A;  3JXS A;  1DYO A;  3THC A;  4TXW A;  1BHG A;  4DXR A;  2W91 A;  1J83 A;  1UYX A;  3UET A;  3IB3 A;  5C70 A;  4XUQ A;  3FHA A;  3EB7 A;  4FI9 A;  1I5P A;  3ETP A;  3SKJ E;  1L7Q A;  2VMF A;  3DYO A;  3OB8 A;  3I2F A;  2W1W A;  3IAQ A;  1XNA A;  3OGV A;  2J1S A;  3CQO A;  1NAE A;  4MGQ A;  2VZR A;  3THD A;  3MUZ 1;  1WCQ A;  4CUA A;  2ID4 A;  1K3I A;  4DUX A;  1NUK A;  4PQQ A;  2VOT A;  4A41 A;  2QQJ A;  2Y8K A;  3OEA A;  1SHW B;  3I2H A;  4A4A A;  4ARX A;  1F4H A;  1IQD C;  5JMO A;  5JXJ A;  3IDA A;  1UY3 A;  4CUB A;  2ORZ A;  4JX0 A;  3VD4 A;  2VZQ A;  2W3J A;  2JD9 A;  4A44 A;  1CZV A;  2Y6H A;  3T2Q A;  3E1F 1;  1UY0 A;  4BJ0 A;  4KMQ A;  4ARY A;  1JZ7 A;  1UYY A;  3D3A A;  4XUO A;  4A6O A;  5JXI A;  2RVA A;  4UOJ A;  2L9L A;  3W5M A;  1HN1 A;  3MBW A;  4HG6 B;  4KI5 M;  4GZ9 A;  4QB1 A;  3FHQ A;  3VD3 A;  2VCA A;  1H6Y A;  4DEV A;  1K45 A;  3NRU A;  2WAO A;  5LCW L;  2WO3 A;  5JR2 A;  3OBA A;  2VZO A;  3LEG A;  4QX2 A;  1UYZ A;  3WF1 A;  3PUH A;  3OGR A;  2E31 A;  3J7H A;  2HYX A;  3U37 A;  3DYM A;  1P8J A;  3K4Z A;  1GUI A;  3BGA A;  2VZV A;  2WO1 A;  3MUY 1;  2QQK A;  4P02 B;  5CZK A;  2R7E B;  5I0D A;  1GU3 A;  3T0A A;  4OUE A;  3UNP A;  2WQ8 A;  3T2P A;  1US3 A;  2BGP A;  1JZ6 A;  4LQR A;  1JZ2 A;  2Y64 A;  2VQU A;  2VMC A;  2JE8 A;  3ACG A;  4DUW A;  4ZZ5 A;  3UES A;  1JZ5 A;  1GNY A;  5IJR A;  4DXT A;  2W9X A;  1L7R A;  2PQS A;  1XC6 A;  3ACH A;  3A22 A;  3WNP A;  1JU4 A;  4QX1 A;  4P5Y A;  2X09 A;  2HLE A;  3WF0 A;  1JHJ A;  5JUV A;  1UY2 A;  5FUI A;  3LPF A;  4OMC A;  2DDU A;  2WYS A;  4M4P A;  5LA0 A;  2WN3 A;  3BN6 A;  3NQH A;  4LPL A;  1UX7 A;  2VZ1 A;  4QDQ A; 
#chains in the Genus database with same CATH topology
 4XHX A;  1MZF A;  4Y1U A;  1RHI 3;  2VOK A;  5A3T A;  4EQV A;  1YQ8 A;  1QF3 A;  2WO7 A;  2ZOE B;  1F5J A;  2ARC A;  5FFO C;  1VBD 2;  3WP5 A;  1SPP A;  2ET7 A;  4JGZ B;  2HEW F;  5B2G B;  5JLV A;  2ZGP A;  1PX3 A;  2VM9 A;  3K2O A;  2OZ6 A;  2WA3 A;  3HNB M;  4QM9 A;  4K1Y A;  3WQ1 A;  4PI2 A;  3PUI A;  2J1R A;  4O7X A;  4QPG B;  2G4I A;  1VLN A;  1VBD 3;  1SDW A;  3POJ A;  1F2N A;  2ES3 A;  3I2K A;  4M00 A;  2EXH A;  4YM1 A;  1VBC 3;  4RYD A;  2HBT A;  3KV4 A;  3KHB A;  3MEP A;  3MIB A;  2BER A;  1QJY 2;  5FZA A;  1W6P B;  1H1M A;  3CJX A;  4JQT A;  5ANN A;  3S5A A;  2PLV 3;  3FLR A;  4XUT A;  1TMF 2;  2GAL A;  2VCB A;  4IL7 A;  1ULE A;  1W39 A;  1JHN A;  2ZEY A;  3TN9 2;  1HRI 1;  3T3Y A;  1UPS A;  4Q0Q A;  1C3H A;  5HI0 A;  2WFF 3;  4M3C F;  5JI7 A;  4E9K A;  1PHM A;  2W46 A;  3NKG A;  1CX1 A;  1UU4 A;  1US2 A;  2VJX A;  3NAP B;  4CDQ C;  1R09 2;  4W4Z A;  4FPK A;  5FP4 A;  1GFF 2;  5FXX A;  3VBR C;  3AMQ A;  1HB4 A;  1YLL A;  4LHN A;  4BDV B;  4D69 A;  1W6O B;  1QJF A;  1GWL A;  5FQ0 A;  2KD7 A;  3LKJ A;  4Y22 A;  5H9R A;  1IQA A;  3AJY A;  2W0X A;  2ZMK A;  4PLO A;  4UI9 L;  5FZB A;  2IUW A;  3GCW A;  4UFL A;  2B4K A;  4HVR A;  2BUK A;  3U10 A;  2P4E A;  4R52 A;  2QDR A;  1NXD 1;  4KU8 A;  5FY9 A;  3C7G A;  5BNN A;  3BTX A;  1UZ0 A;  2DUP A;  3CJI C;  1RUH 3;  5FYY A;  4WM8 A;  3A7Q A;  3B9I A;  4YZ4 A;  5FP9 A;  2XOM A;  3SEP A;  3GHM A;  2VAU A;  5BNO B;  3WNN A;  5A3M A;  2HWF 1;  3JB8 A;  4HK9 A;  5I8S A;  3WDU A;  1RYY A;  3DGT A;  4WM8 B;  1A3K A;  1BMV 1;  3EMR A;  2JDM A;  1SDD B;  3A21 A;  2RDQ A;  3RMX A;  4CDU B;  4RFR B;  5C3P A;  4UAP A;  1Z78 A;  4UBG A;  4C0B A;  1W03 A;  4QGL A;  4ZXE A;  3ZN6 A;  1MEC 1;  5FZE A;  3RQ0 A;  2CAU A;  1EUT A;  1X50 A;  4YWA A;  3EBR A;  1U5Z A;  4Z07 A;  1F31 A;  1QOO A;  4WM7 C;  5KWR A;  5GLZ A;  4J1W A;  4ZU4 A;  3ZR5 A;  1U5Y A;  4MHR A;  1M4W A;  1OC1 A;  3BOP A;  3LIH A;  1GKB A;  4YGD A;  5IFP A;  5FTT C;  1OUX A;  4JDN A;  3AKS A;  3I3Q A;  4Q4X 1;  3ZPO A;  3DYP A;  1R64 A;  1ZRC A;  4LBL A;  3ZSK A;  3BUC A;  3SXW A;  1HRV 1;  3PJQ A;  4E27 A;  2RS5 3;  4CA9 A;  1G6N A;  2D93 A;  4JHZ A;  1RUC 1;  3ZDS A;  4DO0 A;  5I8T A;  4UFH A;  3MPP G;  1X82 A;  1GQP A;  2JJ6 A;  3KGL A;  3KV5 A;  3VBF B;  3TBD A;  2NM1 A;  3KVA A;  4XVH A;  5DAX A;  1W9Y A;  3D6E A;  1W99 A;  3KZ4 C;  1YFU A;  3AXD A;  2XGX A;  4NPR A;  4Y26 A;  5FZO B;  4B8E A;  4CU8 A;  5A3L A;  4XJA A;  1J3P A;  2K9Z A;  4N43 A;  1OD3 A;  2R07 1;  3WEZ A;  3T0B A;  3ZR6 A;  1ACC A;  4Q4Y 2;  1N1T A;  3LA2 A;  5CVR A;  1W6M A;  2VZ3 A;  4Y4Y A;  1AYM 2;  3B69 A;  5K4L A;  3E6C C;  4XPV A;  1H6X A;  2YB7 A;  3N7L A;  2XH6 A;  1CIY A;  1UOG A;  4D3W A;  4NOT A;  2KM2 A;  1AF9 A;  1QU0 A;  3USU B;  2VW0 A;  3C3V A;  4AFA A;  2VCC A;  4W8J A;  3BOW A;  1AL2 1;  3KQR A;  4D94 A;  2VQT A;  3MF9 A;  3H8U A;  4PCR A;  1PO1 3;  4XDP A;  1HKD A;  5DAP A;  2DU1 A;  3O1V A;  2UUR A;  2WFF 1;  3BVC A;  1LEM A;  3B5L B;  4FVV A;  4Q1R A;  4CUC A;  4YVW B;  4FO9 A;  1B35 B;  5FMO L;  1D2Q A;  4Z8B A;  5JPN B;  4NIH A;  2P37 A;  1YIP A;  3OYW A;  5A7W B;  5KBF A;  3VN4 A;  3ORJ A;  4AYU A;  3RYP A;  1AR6 1;  5FZH A;  1JOB A;  2ZGO A;  1ZZC A;  2OW4 A;  4F7Z A;  1W2U A;  1NCR B;  4YM0 A;  2VMG A;  3I3B A;  3MF6 A;  3B01 A;  3PIJ A;  2QQO A;  2PHT A;  5APA A;  4BWO A;  4MGI E;  3KM5 A;  4AAP A;  3WF3 A;  2GH2 A;  2XVK A;  4CDQ A;  1OH3 A;  3VD7 A;  2YG0 A;  2RJ2 A;  4JDO A;  3J26 N;  1AYN 1;  1GOH A;  2ZCW A;  1PMJ X;  4UBH A;  5FZ6 A;  4K1Z A;  1NYW A;  1UL9 A;  3KT7 A;  4XZU G;  1UY4 A;  2QQW A;  1FPN 1;  4COV A;  1GNZ A;  1YI9 A;  2RMU 1;  3THP A;  2Q8D A;  4FAH A;  3KSC A;  3N36 A;  2VG9 A;  4IV3 A;  1D2S A;  4PBO A;  3NVC A;  1SEF A;  5A6Y A;  2EIB A;  2R07 3;  3AVS A;  1BVV A;  1ZRF A;  2BVB A;  3EHK A;  1RMU 2;  4Y1X A;  3WG2 A;  2P1B A;  2ZKL A;  4Q2F A;  1LGC A;  3HNM A;  1J84 A;  4HBN A;  1FOD 2;  4C8D A;  1J3Q A;  3BAL A;  4AAX A;  5LWB A;  1O3Q A;  1LHV A;  1UZY A;  2E7Q A;  1V9U 1;  1H30 A;  1NA1 B;  2ZZQ A;  3LQC A;  2VZP A;  3AL6 A;  2Q1Z B;  1WD4 A;  3AZX A;  2ZXQ A;  1W2N A;  2WNV C;  5JOZ A;  2GAU A;  4WZC A;  4CU6 A;  1EY2 A;  2XWB B;  2QQN A;  5LB6 A;  2HWF 2;  4Z1V A;  3N9L A;  1ZA4 A;  5DG2 A;  3NJV A;  2PXJ A;  3I7D A;  2GH8 A;  2ZX0 A;  3HR9 A;  2GC1 A;  4HK8 A;  3WQ7 A;  5FXZ A;  2QZ2 A;  1UX6 A;  3WT3 A;  4OI0 A;  2ZGS A;  1ULF A;  2VNR A;  4XTM A;  1IHM A;  1CAW B;  1G86 A;  5GLV A;  5IYY A;  1OH4 A;  3CNA A;  5C33 A;  4RHV 1;  5T5O A;  1JYV A;  3LEM A;  3TEX A;  1R08 2;  3GDB A;  1LHW A;  1WMF A;  4XBN A;  1H8T B;  2ZHN A;  4YPJ A;  3OGS A;  1RUC 3;  2YBK A;  2A3X A;  4Q4X 3;  1HXS 2;  5HXM A;  1ENX A;  1MR5 A;  2XBO 2;  2Y38 A;  1DBN A;  2EIE A;  3OUH A;  3WF2 A;  2ZZJ A;  1SLI A;  1BYH A;  1UKG A;  3IT8 A;  4YW6 A;  4WVM B;  3FUO A;  1JZ4 A;  2J42 A;  4HSJ A;  4ZZ8 A;  4HON A;  3WSO A;  4YG0 A;  2WNU A;  1QQP 1;  4MGK E;  2XJS A;  2A6X A;  1APN A;  3ZYG A;  3K4A A;  4ASM B;  2QUO A;  4BLJ A;  1FOD 3;  1YIF A;  1ZBE 2;  2A75 A;  4JVA A;  1AR9 1;  1KFU L;  1JU3 A;  2P2K A;  3OEB A;  2PEL A;  5LAS A;  1X36 A;  2X53 S;  1UXZ A;  3IMM A;  4QXC A;  2D43 A;  2J1T A;  2RS3 2;  2BP6 A;  3ROU A;  2BRT A;  3IKW A;  2R07 2;  4GJY A;  1W9W A;  3N9N A;  4Q29 A;  4Q4W 2;  4I0A A;  5FPB A;  1ZBE 3;  4CE8 A;  2DWR A;  1Q56 A;  2I45 A;  1DQ5 A;  1UMH A;  5FQ0 B;  1H9P A;  1XU1 A;  3NNG A;  1OF4 A;  2PMW B;  1TME 2;  5JZG C;  5FCC A;  4G4F A;  4WVM A;  4W50 A;  3WIN E;  3LDB A;  1UKR A;  4BQ1 A;  4L0P A;  1Q8P A;  2XKO A;  4OZO A;  1AXZ A;  5EJ1 B;  4QAW A;  4XF4 A;  4X8P A;  5FJH A;  1RUN A;  4XOG A;  1UZW A;  3RFR A;  3AP9 A;  4ZON A;  4Y1V A;  2PFW A;  3WLU A;  3KLS A;  1C5H A;  1O91 A;  1WW4 A;  4DRR A;  2ZS6 B;  4XAE A;  5JR7 B;  1CAW A;  3ZFG C;  2WZR 1;  2HEY F;  2O0O A;  3WZ1 A;  2D6O X;  2XVL A;  2HWD 2;  2VO5 A;  2JDK A;  1DLC A;  3WOG A;  2EID A;  3FJS A;  3ZSL A;  1JOJ A;  4B1L A;  3ZFF A;  3IAP A;  4DZG A;  5KXE A;  2WNE A;  3ZXD A;  2PYT A;  4XQW A;  4CUG A;  4D8M A;  3SC7 X;  3OUJ A;  4F3J A;  4FFI A;  1JOD A;  3L2Y A;  1JH5 A;  1DGL A;  2W1U A;  4M0N A;  5F32 A;  1IS4 A;  5DZE A;  3W20 A;  2XPJ A;  4K6B A;  1OVS A;  1OOP C;  1FPN 3;  2YHJ A;  5I0T A;  4AXO A;  4O9E A;  3T2T A;  4UXA A;  4JRL A;  4IGO A;  4BME A;  3ZXK A;  4YZ2 A;  4NII A;  3OTF A;  2IWG B;  3M3Q A;  1J59 A;  1HN0 A;  3LB9 A;  1D0G A;  4K7J A;  2VC9 A;  4LHS A;  4LUL A;  4XBQ A;  2F17 A;  4AR2 A;  5C8C B;  4Y4R A;  4MGS A;  4XFB A;  4M3C E;  3AZZ A;  1GWK A;  4IEW A;  1X8M A;  4BE3 A;  1T2X A;  2TNF A;  2H0B A;  1LJ7 A;  4XXA A;  3FL7 A;  2FMY A;  1RHI 1;  3ZX7 A;  1KS4 A;  2DBI A;  4I0W B;  4LBQ A;  3JD7 3;  4CDX C;  5C9A A;  1YFW A;  2Y0I A;  4XUN A;  5IK7 A;  1BCX A;  4CSW A;  3VZN A;  2I07 B;  1C57 A;  2WNO A;  3ILN A;  4XJZ A;  1PMI A;  4DB5 A;  1E5R A;  1EAH 3;  5F9T A;  1TEI A;  5FY8 A;  4P9G A;  3GZU C;  4UYB A;  1BHG A;  1UD1 A;  2VQA A;  4COY A;  2YV8 A;  5ACA 2;  1CAV B;  4HXC A;  3MGU A;  2OXB A;  3GNE A;  3UET A;  4LUM A;  4YW2 A;  5A3W A;  4GB3 2;  2BW8 A;  2ATF A;  4AHY A;  5LK7 B;  1SMV A;  1AJO A;  2BFU S;  1QMJ A;  1W8T A;  4EJR A;  1L7Q A;  4CEW C;  4P9X A;  4PF5 A;  1HRI 3;  5KHH A;  5FP3 A;  1HW5 A;  2W1W A;  4FPH A;  3OGV A;  1WW6 A;  1OA3 A;  2JIC A;  1ND2 C;  3HBZ A;  4NHY A;  4YVW C;  2R32 A;  4Y24 A;  3ZXG A;  2ADD A;  4H2A A;  4PLM A;  1NLR A;  5FZ1 A;  4IGP A;  4Q1P A;  5IUQ A;  4CUA A;  4ORF A;  4NHM A;  5FXW A;  1AYN 2;  1ND2 A;  4PQQ A;  3RZH A;  2XL7 A;  4Q0P A;  1UF2 C;  5FYI A;  4A41 A;  1PGL 1;  2UWB A;  1NCR A;  4FPL A;  4UWD A;  1QQP 3;  3S30 A;  2VVD A;  4ISR A;  3OEA A;  4B4P A;  4JV4 A;  4A4A A;  1UAI A;  5JXJ A;  5JMO A;  3W21 A;  3VBO B;  3IDA A;  5L7O C;  1CAX A;  1DIW A;  2XDV A;  3IDE A;  2ORZ A;  3VD4 A;  2W3J A;  1IS5 A;  3ZYR A;  2EAK A;  3SH3 A;  1Y9Q A;  2WC2 A;  4N53 A;  3BCW A;  5BPX A;  3K3O A;  3MLK A;  5BNN C;  1W6M B;  4O61 A;  1JUI A;  4ARY A;  1JZ7 A;  3LF7 A;  3D3A A;  5C8W A;  4TWT A;  4FAG A;  2R06 1;  1C5I A;  2RVA A;  3ZMN A;  1AYM 3;  1UPI A;  4V1P A;  5A1F A;  2WT1 A;  1QNY A;  3W5M A;  3ZFG A;  1HN1 A;  5KHJ A;  4TZD A;  1CJD A;  1NE4 A;  4IE5 A;  1C28 A;  4OHW A;  3WW4 A;  3FHQ A;  3NL1 A;  4N43 B;  1JS9 A;  4YG6 A;  1H6Y A;  2IVI B;  2SLI A;  3WDY A;  2VUJ A;  3NAP C;  2B45 X;  1L7L A;  2ZHK A;  4HN1 A;  5ERL A;  1W8U A;  3VBR A;  4DMI A;  3NRU A;  2D3P A;  3GJB A;  2WS9 3;  2FQP A;  2JDP A;  1IS6 A;  2HWE 3;  3LEG A;  4XCA A;  2JKB A;  2DTW A;  4YZ3 A;  2YGL A;  2OUJ A;  2VE1 A;  5CA6 A;  4C1X A;  1UYZ A;  4LE4 A;  1GBG A;  2RE9 A;  3M8L A;  4EN8 B;  1PO2 3;  1PVC 2;  3FMG A;  2P3K A;  1GUI A;  5CZK A;  3TEW A;  3MUY 1;  1SBE A;  1UN1 A;  1Q8V A;  3JD7 1;  4HT1 T;  2G1M A;  2R7E B;  1GU3 A;  3ENR A;  1URX A;  3KV9 A;  4IV1 B;  4JC1 A;  3UNP A;  3T2P A;  3ETQ A;  2ENR A;  1US3 A;  1DFQ A;  3AYC A;  1Y43 B;  2BGP A;  3ASI A;  3IBM A;  4LQR A;  5AVP A;  3V56 A;  4NO4 A;  1S0E A;  5DDJ 1;  3IN9 A;  4DY3 A;  2KR2 A;  5IAX A;  5LZ6 A;  1C8M 2;  1UOJ A;  4DQA A;  3ACG A;  5C9A C;  1UO9 A;  2JIJ A;  2FDG A;  1IKQ A;  3L9J T;  4N53 C;  4LBQ B;  3ZSE A;  5C9A B;  2VD7 A;  3GYD A;  3S7E A;  1VB4 A;  4AW7 A;  5JSR A;  2VVF A;  1L7R A;  5JZG A;  4NN0 A;  2JDZ A;  5IAT A;  4IXL A;  4MG2 A;  2BFU L;  1JU4 A;  2DBN A;  3LDK A;  4IE0 A;  4PDW A;  4MXW A;  4Z2W A;  4AQT A;  2NZ9 A;  1VBA 2;  2EVX A;  5KHI A;  3ZFE A;  4LOT A;  1SPP B;  2RDS A;  1B35 A;  4FTB A;  5JUV A;  4PDW C;  1UY2 A;  4BLI A;  4H3W A;  3IMN A;  2QQU A;  2W68 A;  1T6B X;  4CEY B;  4M4P A;  1OXC A;  5EP9 A;  3USS A;  2ZKN A;  3ON7 A;  4A7Z A;  2YXS A;  4QQP A;  3JCI A;  1YC6 1;  2WN3 A;  3T1L A;  3BKZ A;  1R1Z A;  4FP2 A;  1ULC A;  4GQ7 A;  1JZ8 A;  2VNV A;  4QDQ A;  1O5L A;  2A70 A;  1VBD 1;  2P3J A;  3WP6 A;  3NV2 A;  4AHX A;  2DTY A;  2DCK A;  4AGV A;  3NKT A;  2IXJ A;  2YFU A;  4FPE A;  2CGO A;  2RJL A;  1SAC A;  3WNX A;  4BOW A;  1DQ0 A;  2FCU A;  3V0B A;  2QQM A;  4XIO A;  3GBW A;  2ZAB A;  2DUO A;  3N7J A;  3BPS A;  1BK1 A;  4OVE A;  5KC6 A;  3ACL A;  2PN5 A;  3NW4 A;  5IW0 A;  3I2I A;  3VKO A;  2D6N A;  2CTV A;  2VUD A;  2ZX1 A;  3A23 A;  2XLA A;  5L9B A;  5F3C A;  2WNU B;  5I0S A;  4AI1 A;  1MZ6 A;  3UV9 A;  1HV1 A;  4BIF A;  2R49 A;  4HAN A;  5BNN B;  4M01 A;  2VUL A;  5G04 L;  5FRE A;  1HB1 A;  2IXL A;  3IM0 A;  3JUU A;  4NAM A;  1FYU A;  5LW9 A;  1A78 A;  1POV 1;  1D4M 1;  4XJ8 A;  3ZIX A;  4DXS A;  3DL3 A;  5J96 B;  2HWE 1;  4FFH A;  4PF1 A;  1BJQ A;  2HWB 1;  3J7N A;  5C3Q A;  1MVE A;  1XOY A;  3HN1 A;  1QOS A;  2PAK A;  2WAB A;  3D8C A;  5FP8 A;  1RUF 2;  5JSO A;  1XE7 A;  1YFX A;  4NIG A;  4NVP A;  1KIT A;  1YJK A;  4XQ4 A;  2F4L A;  2R30 A;  3VL8 A;  3RDI A;  1AR7 3;  3AM2 A;  1AL2 3;  1W8O A;  3ZN6 B;  4M3C A;  3BU7 A;  2XML A;  1YQ5 A;  3M3E A;  4Y3O A;  4QDS A;  4LO8 A;  3OY8 A;  5BNP C;  1QKQ A;  2X10 A;  5CFD C;  2Z42 A;  3ILF A;  1IPK A;  4J1X A;  5A1A A;  3LCP A;  1AZD A;  5LK5 A;  1RC6 A;  1QH6 A;  2FMD A;  3ZKY A;  5FZ0 A;  3WUC A;  4YYO A;  5C8C A;  1VRH 1;  4AZZ A;  2X29 A;  3CU7 A;  5HV4 A;  3AC0 A;  3N9O A;  2B5H A;  1ASJ 2;  2Y33 A;  4P9W A;  5FZ9 A;  2QQI A;  1SBF A;  1HQW A;  3GXU A;  3VKL A;  4QB2 A;  4AGG A;  1QH7 A;  3MDP A;  1QY4 A;  2AEY A;  4CVU A;  5J7M A;  1BXH A;  1XRU A;  2XJU A;  5DUV A;  1D0H A;  4OMD A;  4W65 A;  3FFQ A;  1S4C A;  5JAX A;  3JBG 1;  4QPW A;  3VDD B;  1ULO A;  2GU9 A;  3ES1 A;  4YG3 A;  4XQD A;  5GZE A;  2EAL A;  5EPA A;  5L9V A;  3ABZ A;  4J6G A;  1NE6 A;  4Y33 A;  4X6R B;  1VAM A;  3O12 A;  3POW A;  2P5B A;  2WQZ C;  3AKT A;  4BIO A;  5FO8 B;  4JKK A;  5FMO S;  3ZYP A;  2NLR A;  1RUC 2;  4BPZ A;  3WNM A;  1OUS A;  2VPV A;  5K0U B;  5T3N A;  5C3S A;  3B02 A;  5FYC A;  4CEW A;  4I30 A;  2C24 A;  1S55 A;  3RNS A;  1HJF A;  4GB3 1;  1QNW A;  1Z7S 1;  5F6L B;  3N7K A;  3M7A A;  4Y20 A;  1D7P M;  4AVT A;  4CZS A;  3AL5 A;  1R1A 1;  1ST8 A;  4FPO B;  4RR3 B;  4OCT A;  2JKX A;  4QX0 A;  5FRA A;  1N3Q A;  1VBE 1;  1FMD 2;  1W8N A;  4KGG A;  4DXZ A;  3CKH A;  4Y20 B;  2PLV 2;  3O14 A;  3CLP A;  2XJQ A;  4QX3 A;  5FPX A;  3CIH A;  3MFC A;  2LRO A;  3WDT A;  1V6K A;  3TAY A;  1QHD A;  2FHR A;  2ZGK A;  4LLF A;  5D2A A;  3I54 A;  1LR5 A;  4A3Z A;  3PLQ A;  3NV1 A;  2WZP P;  1JYW A;  1Y3T A;  2BU9 A;  4QKD A;  2VCM A;  1Q8Q A;  5LBF A;  4AFC A;  3ZPY A;  3PUR A;  4AFB A;  1DU3 D;  2BTV C;  2ZAC A;  1XXN A;  4AVA A;  2Z5W A;  1WCU A;  1VB2 A;  1YJL A;  3CDZ B;  1PVX A;  3VZK A;  1VBA 1;  2C5D A;  1BEV 1;  1VBB 2;  1CJP A;  2JB4 A;  3VHO A;  1QIQ A;  5FWJ A;  4JKM A;  2Y6L A;  4OUS A;  4F8A A;  1HQL A;  2J1E A;  4XUP A;  1S0G A;  1CIW A;  1TG7 A;  2HWC 3;  4H7M A;  4ZXK A;  5JOY A;  1YWK A;  3F2Z A;  2ADE A;  3JBG 3;  3VDC A;  3RZL A;  2ETE A;  1JYC A;  3IPV B;  3MI8 A;  2JDH A;  3C7F A;  4YGC A;  5EV7 A;  4QHB A;  3SNM A;  4Q0U A;  5FYU A;  2VW1 A;  1RGS A;  3T0D A;  2LS6 A;  3QLQ A;  2J7M A;  2GNM A;  4XUR A;  2FDH A;  1T6G C;  3O5S A;  5A6Q A;  4MVT A;  2IFW A;  1PZ7 A;  3CO2 A;  2B9V A;  3M1H A;  5DQ0 A;  1VE0 A;  1ZZ7 A;  1EV1 2;  5A3U A;  3AMN A;  3I59 B;  4GB3 3;  4RL7 A;  4DIQ A;  3PVB B;  4CPB A;  5EZW A;  1GYK A;  4V2V A;  3SHR A;  3ZDV A;  5FK7 A;  4AED A;  5L36 A;  4COU A;  2BDR A;  1KDM A;  2D5F A;  3IDB B;  4P9J A;  4BH9 A;  1R09 3;  2CWM A;  2DCJ A;  3N4M A;  1NCR C;  2X05 A;  2I74 A;  5IVF A;  1VMJ A;  2E9Q A;  1PNF A;  5F7U A;  1OA4 A;  2VBB A;  5E6H A;  2OX0 A;  1GAN A;  1CAV A;  3BIW E;  1NT0 A;  2K0G A;  2HWC 1;  5F3I A;  4BMB A;  1YO8 A;  2OPK A;  3TN9 1;  1ND2 B;  1FV3 A;  5DDJ 3;  5BV6 A;  5A7N A;  5HCF A;  5CBL A;  4KWJ A;  1XNT A;  1C4R A;  3PUS A;  4FPJ A;  3CMG A;  1I9R A;  3B93 A;  5A33 A;  4YM2 A;  3ZYF A;  4QQH A;  2GP5 A;  3RJ2 X;  2ZX4 A;  1VRH 3;  1W9S A;  3AFK A;  1XSQ A;  4B1M A;  1KEX A;  4QXK A;  2FCT A;  4FPC A;  3RZK A;  1O4Y A;  3UK9 A;  1ENR A;  3BTZ A;  1R1A 2;  1BQP A;  3LGR A;  2QDN A;  1PX4 A;  1XBF A;  1XE8 A;  3WV6 A;  2A6V A;  4RQP C;  4C90 A;  1NLS A;  5FY0 A;  5C71 A;  2JXA A;  2A1X A;  4QQO A;  4UFM A;  2JG9 A;  2WNV B;  4RQP B;  3AZV A;  4H14 A;  1XE0 A;  5E16 A;  5FWE A;  4ZY9 A;  3WW3 A;  4AOC A;  4GKY A;  1LHN A;  5FIX A;  3WDX A;  5FOB B;  1J1L A;  2RS1 2;  5LA1 A;  4XW3 A;  3OBT A;  2C6S A;  3RI9 A;  3OGG A;  1NKG A;  4Q4V 3;  1UQX A;  4NRM A;  4YVS B;  2WLP A;  2JG8 A;  2V72 A;  2VME A;  3H1M A;  5CAD A;  5LEK A;  1IKP A;  3N3H A;  5F3G A;  2O8O A;  2H6B A;  2IXC A;  2CYF A;  3D5O A;  2Q8E A;  1JYX A;  1GMM A;  5A70 A;  1O3T A;  4NIA A;  4IND A;  3RRD A;  1W0P A;  3PUA A;  1BEV 2;  1VBB 1;  4BQ5 A;  4CEY C;  4OI4 A;  4LEJ A;  3MV0 1;  2E7A A;  1HJG A;  4NHX A;  4EN6 B;  1SQ4 A;  2EA7 A;  4CU9 A;  2XHN A;  4QT6 A;  4YVW A;  2OS2 A;  2CHH A;  3E6D A;  5F3E A;  5G05 L;  3ZXA C;  2MHF A;  2VOV A;  1AR6 2;  1V9U 2;  4Q0V A;  1RED A;  4UFJ A;  1S2K A;  4Y5Z 0;  5T52 A;  2WLQ A;  4BU2 A;  5H9Q A;  1VBC 1;  2UY9 A;  1RIN A;  2VH9 A;  3J4U H;  5CYY A;  3SIS A;  4XFI A;  3QBQ A;  2YUE A;  1RUI 3;  2ZGU A;  5JOX A;  1O3R A;  2RDN A;  1TE1 B;  5GLW A;  4O9G A;  2GP3 A;  2ARE A;  3TNQ A;  1UMZ A;  1HRI 2;  1VAK A;  3M3O A;  3MIE A;  1A6C A;  1CD3 G;  1BEV 3;  3K51 A;  4JZR A;  4N9H A;  3WHT A;  2D44 A;  5JZG B;  1AR7 1;  2NPI A;  4CRQ A;  5M0T A;  1PK6 C;  5T55 A;  1NXM A;  1LTE A;  1O6U A;  4BQ3 A;  4ES9 A;  3NNJ A;  5FPU A;  3VD5 A;  3K77 A;  2WYF A;  3M70 A;  4H55 A;  2DFB A;  1HXS 3;  4M3C B;  1OVP A;  1PGW 2;  3DXU A;  1H2L A;  4I09 A;  4E8C A;  2E33 A;  1R08 3;  3TN9 3;  1OKQ A;  4NR1 A;  3VBH B;  2WFF 2;  3DXT A;  4ASL A;  4DPN A;  1LRH A;  1AR8 3;  1MQT C;  4FOY A;  1CWP A;  3I2G A;  5GLT A;  3WY6 A;  1WA6 X;  3JQW A;  4DUV A;  4UW3 A;  2VMI A;  2YC0 A;  2PQQ A;  2HWF 3;  1OT5 A;  5A32 A;  4DEQ A;  1G9A A;  1QWR A;  2XWJ B;  1RTV A;  3IWZ A;  3WDW A;  5CKQ A;  3S0M A;  4ET7 A;  1FNZ A;  2WDB A;  3NJZ A;  3E5Q A;  3UT0 A;  4HZF A;  2O8Q A;  2DFC A;  4NHK A;  5A32 B;  4AI3 A;  1H1I A;  1FAT A;  2GZW A;  3RVH A;  4CCO A;  5IAV A;  5FOJ B;  3H8R A;  1W2A X;  1MS0 A;  3ECQ A;  4LO5 B;  3PTY A;  3LEK A;  4OQ9 A;  2YFZ A;  2DVD A;  3ZXE A;  4B29 A;  4OI1 A;  1KS5 A;  5GJ6 A;  2C26 A;  5FXV A;  2JG9 C;  1LU1 A;  1MS4 A;  3HWJ A;  2WO2 A;  3LE0 A;  5F2W A;  4LR4 A;  1JI6 A;  3D0J A;  4JRA A;  4FOQ A;  4MOA A;  1W90 A;  2DCT A;  3PMS A;  3EJK A;  5CEH A;  5JPM B;  3LA3 A;  4YZ1 A;  2LW8 A;  4UT5 A;  2O14 A;  3ZLI A;  2RG4 A;  2PHL A;  2RS5 1;  1GZT A;  3ZYB A;  3BU0 A;  4BYY A;  1DYO A;  1OI6 A;  3ZYH A;  4AI0 A;  4CCJ A;  2D7F A;  2JG8 C;  1HRV 2;  2G9Z A;  2GC3 A;  1OFN A;  2XQR A;  3I8T A;  3M4F A;  4NHL A;  2JE7 A;  4QMA A;  4BIS A;  1RIT A;  1VMH A;  5J36 A;  5K9Y A;  1UYX A;  4RGK A;  3LAG A;  2UU8 A;  2X8K A;  2EXK A;  4C1W A;  3PME A;  4QHO A;  5AVA A;  4OHY A;  4COW A;  1OUR A;  1ZBA 1;  3EB7 A;  3OY8 B;  2CAV A;  4W6X A;  4I01 A;  5H9P A;  1JXN A;  1PIV 2;  3SKJ E;  3H3L A;  4BA6 A;  1DLL A;  1UOB A;  2HBU A;  3L2H A;  3N7M A;  3VB9 A;  3OJB A;  2BVV A;  2CGN A;  1L3J A;  4MYE A;  4URT A;  3I2F A;  4D6S A;  4XCB A;  1COV 2;  1W6N A;  3FE5 A;  4Q4W 1;  5FUN A;  3I59 A;  3U4S A;  1DQ4 A;  3CQO A;  3RYR A;  4RS5 C;  3THD A;  5FPA A;  3U75 A;  1I5Z A;  3UJO A;  1ND3 C;  3MUZ 1;  5I91 A;  1K3I A;  2ID4 A;  4DUX A;  3RZJ A;  1MVQ A;  1YFY A;  1OQE A;  3GBG A;  1NY7 1;  4CP1 A;  2G19 A;  1MEC 2;  1Y9G A;  2QQJ A;  3A4U A;  4S2G A;  2XVG A;  3I2H A;  3SIT A;  4YLZ A;  1F4H A;  1UY3 A;  4MGY E;  4CUB A;  4JX0 A;  2VZQ A;  1SZB A;  4BM8 A;  3MIC A;  1VAV A;  2YU2 A;  4FT8 A;  4L97 A;  3T2Q A;  1HV0 A;  4I3G A;  2ARB A;  5GZD A;  5J37 A;  3Q9O A;  5AC9 3;  1WGP A;  1XB9 A;  2XBO 3;  1N3P A;  4TSV A;  2QVS B;  3H8X A;  1M06 G;  3U11 A;  2FZ1 A;  1GP6 A;  5JXI A;  4E4S A;  4EYU A;  3CJI A;  3J7L A;  1DG6 A;  4ATF A;  1O4Z A;  1FMD 1;  2R04 1;  2ZGR A;  4YAR A;  2CY6 A;  1RVF 2;  2GNT A;  4KBZ A;  5CIR A;  5FPZ A;  2XB6 C;  1DGR N;  3CL1 A;  4QB1 A;  5EIY B;  3UKN A;  4N8M A;  4KNC A;  4D6Q A;  1OOP B;  2E6V A;  3FZ3 A;  5FYS A;  4XDO A;  2X5I C;  3POY A;  1QJX 1;  4DEV A;  1K45 A;  1K5J A;  1V00 A;  5GM0 A;  3DF0 A;  3MIH A;  3URF A;  1BK0 A;  3VZM A;  4BQ4 A;  1WCD J;  4XMI A;  1VAL A;  4RR3 A;  4AHW A;  1G9D A;  1S0C A;  2WO3 A;  4QPG A;  2KXL A;  4CCC A;  5JR2 A;  2JD4 A;  2QTW B;  3E5X A;  4DOU A;  1S0F A;  5JMC A;  5I93 A;  2C0Z A;  4YW1 A;  3OD0 A;  1O4T A;  4QX2 A;  2VY0 A;  1CX4 A;  2BV4 A;  2WS9 1;  3WF1 A;  4Z82 A;  4E4Z A;  4CEW B;  3J7H A;  5BNP A;  4FBF A;  1I6X A;  3I49 A;  1Y7B A;  4HKO A;  3ZFG B;  5EWS A;  4WVZ A;  4FFG A;  2JDU A;  4FOW A;  3VBF A;  2EF6 A;  2QQK A;  4UW5 A;  3MIF A;  4AF9 A;  4OUE A;  4X8N A;  4XEZ A;  2PHR A;  4YSF A;  1V6O A;  3MID A;  2D6L X;  1DZT A;  2XLF A;  5A3O A;  2D6M A;  2H0V A;  1W8H A;  3AP6 A;  2Q0A A;  2WWJ A;  1AVB A;  3GZT B;  1IG0 A;  3ZSM A;  1JZ2 A;  3OF1 A;  2BQP A;  4YM3 A;  1JW6 A;  1HX6 A;  3HT1 A;  2Y64 A;  3NNF A;  2BPA 2;  2OA2 A;  1WD3 A;  2VMC A;  4JGY C;  5T54 A;  1JTZ X;  3UES A;  1VMF A;  1GNY A;  3LD8 A;  5IJR A;  1RUD 3;  4E2Q A;  4IE4 A;  5FZO A;  2PAE A;  2PQS A;  2ARX A;  3WW1 A;  1YUD A;  1XC6 A;  3ACH A;  1NCQ A;  3Q8C A;  2RS1 1;  2OT7 A;  4QX1 A;  5DAW A;  2E7T A;  4J25 A;  2QJV A;  4ES8 A;  4BQY A;  5BNQ A;  5F1R A;  4HKL A;  2RMU 2;  4BCU A;  1S0D A;  2OQ7 A;  4QGN A;  3AP5 A;  2BOJ A;  4KWL A;  1OA2 A;  4MGZ E;  4XAC A;  2GSY A;  4AEM A;  2E53 A;  3Q8B A;  1RUE 1;  2VOX A;  1PZ9 A;  2EXI A;  4IV1 C;  1CPM A;  2JB8 A;  4QU2 A;  4CDU C;  1IGO A;  5JSP A;  3LPF A;  4Q4V 2;  4OMC A;  3WG3 A;  1RB8 G;  2DDU A;  2AZ5 A;  4B7K A;  5C3O A;  3V0A A;  4QXH A;  1OLR A;  2D3R A;  2VXJ A;  1MS8 A;  2WFP A;  5LBE A;  3BN6 A;  1CPN A;  1H2M A;  4IV3 B;  2VZ1 A;  1UIJ A;  5A7P A;  1PO1 2;  3WD5 A;  2D40 A;  2RHP A;  2HWD 1;  4RR3 C;  1OPM A;  3V0A B;  1YQ2 A;  2DCZ A;  2HEV F;  2GC0 A;  2RM2 1;  4HFS A;  4QPI B;  1ZBA 2;  1ZYB A;  5ABJ B;  3H3Z A;  3MZH A;  5LA0 A;  4CCK A;  1CES A;  4M4R A;  4EN9 B;  3KGZ A;  3H0O A;  2YGM A;  4G3Y C;  4BQX A;  3WDV A;  3TEY A;  2Q1F A;  5J1X A;  1VBC 2;  1W8W A;  1HIX A;  1RVF 1;  4NAO A;  4XFC A;  4BK5 A;  1F5F A;  5K0U C;  2FDI A;  1RUI 1;  1H4G A;  4GMP 3;  4JCK A;  1GLH A;  1PZ8 A;  5DUU A;  1CZT A;  4XBL A;  1CQ9 A;  3VDD C;  1TME 1;  1ZBA 3;  2R16 A;  4XAB A;  5CG8 A;  1QXR A;  1A8D A;  2IFR A;  3OSD A;  4I2O A;  2VW2 A;  1COV 1;  4R4X A;  3VV1 A;  4QWN A;  5J48 A;  5HCH A;  1LED A;  3ES4 A;  4V2W A;  1S0J A;  1OLM E;  2G9G A;  1LOF C;  2YY1 A;  1GP4 A;  1K5M B;  2JE9 A;  5CIS A;  1E57 A;  1VIW B;  2CWS A;  2D97 A;  5ABJ A;  3I3E A;  3TRS B;  3ZXJ A;  1G9B A;  1JYI A;  1XSR A;  2HYK A;  2G9F A;  2P3I A;  4FQZ A;  4QX8 A;  4QQ2 A;  1YQ6 A;  2DF7 A;  5A6X A;  3BOD A;  3I2J A;  1YI7 A;  1JYN A;  2C1F A;  4HSL A;  4DS0 A;  3T09 A;  1AR9 3;  4LA2 A;  2VL4 A;  4ZU5 A;  4HET A;  2FDK A;  3N9P A;  1EV1 3;  4CCE A;  3LWC A;  3C2U A;  2F4P A;  5IK5 A;  4PI0 A;  1TNF A;  1Y4W A;  1PMH X;  2MNG A;  3H7Y A;  2V4V A;  4LO7 A;  5KXC A;  2W2I A;  3W59 A;  1TME 3;  2GME A;  4PIX A;  4R8H A;  2ILM A;  3AYD A;  5I0U A;  4MO3 M;  5LBB A;  1ZRD A;  1BMV 2;  2FD8 A;  4QPI A;  3AJZ A;  4LUK A;  1VJ2 A;  1QJU 2;  1H8T C;  1WMD A;  2WAA A;  4IEU A;  3VL9 A;  3WW2 A;  2YPJ A;  1MEC 3;  5IHR A;  3O0V A;  1VBB 3;  3IIA A;  1U5I A;  3HNY M;  2YDE A;  1GOF A;  1ZVF A;  1TMF 1;  4ZHN A;  3BTY A;  4PHZ A;  4K8R B;  1JBC A;  3MHZ A;  2RR1 1;  4SBV A;  3LZZ A;  5EYX A;  5FP7 A;  3POI A;  3K3N A;  2P17 A;  5C4W C;  1N47 A;  2A7A A;  3FLP A;  3PVO A;  3AVR A;  3VDA A;  2R06 3;  1W2T A;  1WUV A;  1E5I A;  3ITQ A;  2BZD A;  1SFY A;  1XQN A;  1RUG 2;  1Z7S 3;  4QKN A;  5EYY A;  1W8F A;  4BK4 A;  4WVV A;  1ZRE A;  4CEY A;  3T30 A;  2VEC A;  1ZA7 A;  3P3P A;  4OZX A;  4CDX B;  4L11 A;  1N1S A;  2WSU A;  3AMP A;  5K7P A;  5L9R A;  4Q4X 2;  4IEV A;  5FK8 A;  2XQX A;  4AL9 A;  4IE6 A;  2Z79 A;  1CAX B;  5KC5 A;  1H9W A;  1U0A A;  4AGR A;  4FFF A;  1YXW A;  4GA9 A;  1TZO A;  3AZW A;  1SBD A;  4OQ8 A;  1MZ5 A;  4LBN A;  4ZS2 A;  2OII A;  4WVW A;  1V6N A;  2VUA A;  1DDL A;  1KGY A;  5CB7 A;  3ZM8 A;  4LLO A;  1OOP A;  2BOI A;  1K5M C;  3K46 A;  2I2S A;  1YNA A;  4PDW B;  5F2S A;  3ZN5 A;  2BEO A;  3HIF A;  2A73 B;  2J1A A;  4U36 A;  3I3D A;  3MLL A;  3PU8 A;  1ZX5 A;  4D7S A;  5FYZ A;  2WT2 A;  2VR4 A;  3AMH A;  3LEI A;  4IEZ A;  4ISQ A;  5FO7 B;  1RHI 2;  1NZC A;  4LIT A;  4QPI C;  3RGB A;  4DIN B;  3C7H A;  1O59 A;  3Q8F A;  3R0R A;  4GD4 A;  3U1X A;  5AC9 1;  1I1E A;  2YU1 A;  3VD9 A;  4RGA A;  2OYZ A;  4LE3 A;  1UW8 A;  3R05 A;  1QJZ A;  4IW3 A;  3WCR A;  3ZOI A;  4D0Q A;  4WM7 B;  4FXK B;  5ABJ C;  2P34 A;  4FTS A;  4LHL A;  5EJ3 A;  2Z2S B;  3FX3 A;  5C7G A;  5JXH A;  5B4X A;  2XKP A;  3BTA A;  4XJ9 A;  2FDF A;  3WQB A;  3WF4 A;  1WME A;  5EJZ B;  5C4W A;  5GZF A;  3P5B A;  2Y6G A;  2VTX A;  1W06 A;  1AX2 A;  1NA1 C;  3QH7 A;  5D1I A;  5LRR A;  3WHU A;  5BNO C;  3VUO A;  1UZZ A;  5A6Z A;  1PIV 3;  4B4R A;  3OCP A;  2V73 A;  4IEX A;  5CU1 A;  2ET1 A;  2JDA A;  4FSJ A;  4A42 A;  2UYB A;  2MEV 1;  2ZMN A;  3AZY A;  2IZW A;  3HJR A;  3MV1 1;  2W08 A;  3MO4 A;  4NPM A;  1EAH 2;  4PBP A;  4ZU7 A;  5ACA 3;  4M0H A;  4JHT A;  5DAB A;  2BBA A;  2WZE A;  3CEW A;  4LA3 A;  3WP4 A;  3JBG 2;  1BKZ A;  2JDN A;  2OPW A;  4KWK A;  4R9B A;  1RJ8 A;  3RWK X;  1TMF 3;  5L7O A;  1RUG 1;  4N43 C;  3PDQ A;  1F15 A;  2DVG A;  2W1Q A;  1V9U 3;  2OZJ A;  3SMH A;  1FI2 A;  3HT2 A;  5J98 B;  1D4M 2;  3T08 A;  4HKW A;  4AFD A;  3PL0 A;  1EP0 A;  4P14 A;  5LA9 A;  1Q8S A;  1OQ1 A;  1UU5 A;  4XF9 A;  3O1M A;  3HQR A;  1N1Y A;  4GWJ A;  3UGG A;  1AL0 G;  4FOV A;  2WWU A;  2OVU A;  3I97 A;  2RS3 1;  1E5S A;  3C8X A;  1GOG A;  4BXS V;  2UY8 A;  4EN0 A;  3JB4 C;  4XAA A;  1HDK A;  2BNO A;  1QJX 2;  3ME2 A;  1ND3 A;  4TYS A;  4CDW B;  5T5J A;  3B3Q E;  1LOB A;  5FMC A;  4AVS A;  5DAQ A;  2DV9 A;  3ZO0 B;  5FAX A;  5E1R A;  5L7O B;  3VBO C;  5FZ8 A;  5CFC A;  2AH2 A;  4UF0 A;  3U14 A;  4MSV A;  3I3M A;  4IET A;  1QJU 1;  4K9S A;  2WBK A;  4MLO A;  1XNK A;  1W9T A;  1UOF A;  4JTO A;  1XNC A;  2A3W A;  2VZT A;  3KCY A;  4AEK A;  4D6R A;  4EZH A;  2XBO 1;  5L19 A;  2DU0 A;  2IVJ A;  2Q30 A;  2LRP A;  2QQV A;  2RM2 3;  2VQ0 A;  3W9A A;  1LEC A;  4D7T A;  1BBT 1;  2QQP A;  4MV2 A;  3QCW A;  2R04 3;  4RN5 A;  3CJI B;  3RJR A;  5F5A A;  2WZ8 A;  3VHP A;  3UKT A;  4XJW A;  2PHW A;  3GBF A;  4G9S B;  2RV9 A;  3CF6 E;  3LFI A;  4Q27 A;  3VZJ A;  3K75 B;  2ZML A;  3HOB A;  2HKX A;  3FWE A;  4GH4 A;  3VBU A;  1DP0 A;  1K42 A;  4I0B A;  2LUW A;  2ZGL A;  1FNY A;  2FBE A;  3J8F 1;  4A45 A;  4GAZ A;  5FBZ A;  1SG3 A;  2QCS B;  4QGM A;  1S1A A;  3KS7 A;  1NZI A;  2GDF A;  4P9L A;  5FKC A;  2XON A;  2WL1 A;  4IGQ A;  2V09 A;  3FN9 A;  2R0H A;  2BNN A;  4P00 B;  4CP0 A;  5IK4 A;  3I2D A;  4RS5 B;  3X29 B;  5HCA A;  1AR6 3;  3T2O A;  1BZW A;  5FZ4 A;  2V5Y A;  3M3I A;  4Q8L A;  3DEC A;  2XJR A;  5FLI A;  5FO9 B;  1AXY A;  1NLQ A;  4YGE A;  4KQ7 A;  1RUD 1;  1PO2 2;  1PVC 3;  1W6Q A;  3D4K A;  4C91 A;  5F6K A;  5DAV A;  1W6N B;  4AE2 A;  4HOO A;  3HD8 B;  4XFF A;  3LIG A;  5BNO A;  3P1I A;  4GJZ A;  4ZS3 A;  3A0K A;  2X5I B;  2WZR 2;  3QOP A;  1X7N A;  4L99 A;  1PGW 1;  2WJS A;  3V0B B;  1UWW A;  2Q1M A;  5A7S A;  4MXW B;  1R09 1;  3NWK A;  2RM2 2;  1ZZB A;  4FPG A;  3WR0 A;  5DZF A;  3UGF A;  4LK7 A;  4WM8 C;  1OF3 A;  2YRO A;  2D3S A;  2R1B A;  3A0N A;  3WG1 A;  5IVJ A;  2DVA A;  3H42 B;  3KD4 A;  5DMY A;  2NYY A;  2CGP A;  4CDW C;  2B7Y A;  1MPX A;  2XJP A;  3NO8 A;  4MXV A;  3FBY A;  1DQ1 A;  2NMO A;  4CXW A;  3C7E A;  1WBL A;  4IEO A;  1W0N A;  5FYM A;  5FUP A;  4B7E A;  4EV0 A;  1K12 A;  2BBV A;  2ZEX A;  2TBV A;  3H50 A;  1QJY 3;  4NRO A;  4LHK A;  4Z92 B;  1TVG A;  3KF3 A;  1YQC A;  4LJH A;  1ZZ6 A;  2JIG A;  4QPY A;  4RD7 A;  5JCT A;  3O7O A;  3S6P A;  3ZFE B;  4HVQ A;  1W3V A;  1ASJ 1;  3GZA A;  4CYD A;  5FZG A;  2HJI A;  2WRA A;  4AG4 A;  1S0B A;  2A6Z A;  2Y6J A;  1LAJ A;  4CDQ B;  1D4V B;  2NQY A;  5JDB A;  4Q4Y 3;  3EXU A;  1H8V A;  1MS5 A;  4A3X A;  3CZU A;  1WBF A;  2IXK A;  2B8M A;  4XFH A;  3RS6 A;  2W47 A;  5C3R A;  1V6J A;  4U2A A;  5ANQ A;  5FZL A;  2VTX J;  1LHO A;  5CFC C;  4XHB A;  1RUE 2;  2Y6F A;  2VU9 A;  5FY4 A;  4AVV A;  2WWS A;  3EQE A;  1ODN A;  2D5H A;  4KU7 A;  4FQ4 A;  4PLN A;  2QE3 A;  4Q0S A;  3S5Q A;  1YHF A;  3GAL A;  3POB A;  4I3P A;  4TXW A;  3THC A;  2RDR A;  1BBT 3;  3KV6 A;  4DXR A;  4Q8K A;  3ZXL A;  4ASK A;  1KD7 A;  1G7Y A;  1PO1 1;  2VVE A;  1EYB A;  3IB3 A;  5DZG A;  3AMM A;  1TNR A;  1FV2 A;  5SV8 A;  3SLI A;  3V64 A;  3MW3 A;  4FI9 A;  4QX7 A;  3VKF C;  1VBE 3;  3DPR A;  3BYW A;  4LIU A;  4XF1 A;  1LHU A;  4XTP A;  1I5P A;  3ETP A;  2WQ4 A;  1XYP A;  5T50 A;  4IES A;  2XXZ A;  4I02 A;  2VMF A;  3GHN A;  3DYO A;  4RQP A;  4Y5S A;  4CXX A;  1DQ6 A;  4YZ5 A;  3OB8 A;  4CP2 A;  1GSL A;  1XNA A;  3B94 A;  4XC9 A;  3VBS B;  1MS9 A;  4UW4 A;  1XU2 A;  1XJA A;  1NAE A;  4MGQ A;  4LK6 A;  2VZR A;  5LAT A;  3WCS A;  2LTN A;  1WCQ A;  3MW2 A;  4GWM A;  4RSU A;  3B9C A;  5GLU A;  3VHR A;  2RS3 3;  4Q4W 3;  2VNG A;  1C8M 3;  4FXG B;  1SLB A;  4W6Y A;  2A5Z A;  2SBA A;  2VOT A;  2YZ4 A;  5AFB A;  4LBO A;  2Y8K A;  1SHW B;  1ZZ9 A;  2ZTN A;  4ARX A;  2BWA A;  4E2G A;  2CNA A;  3BPZ A;  4PIZ A;  5JI9 A;  3D0S A;  1DZR A;  3N9Q A;  2EXJ A;  4MGT A;  1WCK A;  1MZE A;  1CZV A;  2TEP A;  2Y6H A;  1UY0 A;  1W9F A;  2FDJ A;  1RXG A;  4KMQ A;  5A3P A;  2K2S A;  3H3U A;  1UYY A;  3AK0 A;  4S2H A;  4XUO A;  3VDD A;  3PNA A;  4A6O A;  4XJU A;  3UKV A;  4UOJ A;  2PHD A;  1MQT B;  3HVD A;  4IDZ A;  1X33 A;  3VBH C;  2L9L A;  4L2N A;  3KHC A;  4OHV A;  3IDC B;  4YVS C;  4B3N A;  4KI5 M;  4GZ9 A;  2E51 A;  2VNO A;  4E4D X;  4YFZ A;  5C8C C;  1V6M A;  4CDW A;  3T4V A;  2ZX3 A;  2VCA A;  1W6P A;  5FZ3 A;  3ELN A;  4FTE A;  2JX9 A;  2WAO A;  3I4I A;  1KFX L;  4UW6 A;  5LCW L;  3H8O A;  3G6J B;  4LKF A;  2ZGT A;  2VZO A;  4BXF A;  4NRP A;  1CVN A;  4OUM A;  4R9C A;  3R4U A;  1XNB A;  1AJK A;  3VBS A;  5AC9 2;  5A7O A;  2CV6 A;  4NPL A;  3PUH A;  2RR1 2;  3OGR A;  4AI2 A;  2E31 A;  3GZE A;  5FYH A;  2HH9 A;  5GZC A;  1F8V A;  2HYX A;  2B39 A;  3DYM A;  3LSD A;  1WLT A;  1REF A;  1KDK A;  4ONU A;  4Y22 B;  1UZV A;  4EWD A;  4LT5 A;  3K4Z A;  4HMZ A;  3BGA A;  4P02 B;  2VZV A;  2WO1 A;  5A80 A;  3H1Y A;  1E5H A;  3T0A A;  1WLW A;  2OUH A;  3MPB A;  5FMD A;  4K21 A;  5GZG A;  4QD2 A;  2D98 A;  5DDJ 2;  3AP7 A;  5A7Q A;  1JZ6 A;  1LCL A;  1IS3 A;  3G7D A;  5D8A C;  3RWN A;  1ZBE 1;  4GH4 B;  3FC0 A;  1EPW A;  1Q43 A;  4L92 A;  3VBU B;  5I0R A;  3SCG A;  2CL2 A;  2PA7 A;  3E5U A;  4QHZ A;  1AYN 3;  1S2E A;  2VQU A;  2JE8 A;  1GP5 A;  2YMZ A;  1GQH A;  1QJU 3;  3OUI A;  4Q4Y 1;  4N90 A;  1COV 3;  5F39 A;  4HL0 A;  1QEX A;  1RUH 2;  4HVO A;  4WM7 A;  2JWP A;  1JZ5 A;  5FZK A;  1FX5 A;  1EV1 1;  2W9X A;  2A6W A;  4HLT A;  5FPV A;  1DYP A;  5F8P A;  2ZGQ A;  3T1M A;  2A3Y A;  4XDQ A;  4AWD A;  2QKD A;  3DPR C;  4TLF A;  5FYV A;  1POQ A;  4A7Y A;  1TQ5 A;  2ZHL A;  4QKB A;  4P5Y A;  1SCR A;  2X09 A;  4K3U A;  2YBP A;  1WA4 A;  2E63 A;  4DFS A;  1RJ7 A;  2JEN A;  3VKN A;  2Y0O A;  1RXF A;  3WF0 A;  5JVV A;  1RUD 2;  2Q5T A;  1BBT 2;  1JHJ A;  2ZHM A;  4Y1Z A;  5CKM A;  1JMU B;  2P3Y A;  3B00 A;  5FUI A;  1U5X A;  1VP6 A;  1H8T A;  5DUX A;  3FLT A;  4AQ6 A;  5F37 A;  3PU3 A;  1SLC A;  2R6Q A;  3NQH A;  1UX7 A;  4OHX A;  4CCL A;  5IWF A;  3JD7 2;  2W39 A;  5CFC B;  4MAD A;  4XIL A;  3GM8 A;  5IVB A;  1V70 A;  2N7G A;  3OPT A;  5FY5 A;  5LRS A;  4AK3 A;  1S0I A;  4P08 A;  3NJX A;  1C8N A;  2YBS A;  3LDR A;  2P6H A;  2V5D A;  1GZC A;  1NCQ C;  4TTG A;  3RYK A;  1OMI A;  4RFT 0;  5LY1 A;  5F5Q A;  1LOC A;  4X6Q B;  2ZJC A;  1B09 A;  1VRH 2;  5LA2 A;  3NNL A;  4XFG A;  4K8F A;  3T4H B;  1KJL A;  5GKA C;  1MS3 A;  2ZGM A;  5IT6 A;  5KXB A;  2WA4 A;  3GGL A;  1GZW B;  4HPK B;  3QD6 A;  3HAG A;  4YW4 A;  3D82 A;  5CAZ A;  2W1S A;  1OHF A;  3U78 A;  2DCY A;  5FZD A;  1HQN A;  3FFZ A;  3OG2 A;  4D7Y A;  4RHV 2;  1GZW A;  3H1W A;  4AFM A;  1YCI A;  4IV3 C;  2GN7 A;  4LBM A;  5TSW A;  4CDX A;  3EO6 A;  3TYJ A;  1WMX A;  3J7M A;  2E26 A;  4WZF A;  1HXS 1;  1S2B A;  5E8A A;  4BB3 A;  1IZ3 A;  1PGS A;  1RUJ 2;  1W6O A;  1WLD A;  2HWD 3;  3OBZ A;  1DHK B;  4KG0 A;  4OHZ A;  3ZFF C;  2LM3 A;  4CPB D;  4ERO A;  1X9P A;  2VZS A;  4Q4V 1;  2RS5 2;  3N9M A;  3NNM A;  4EZ4 A;  1WKY A;  4LKS A;  2RMU 3;  2PHX A;  1OD5 A;  2DVB A;  2XJV A;  3AKP A;  2H6C A;  4LTA A;  2CSG A;  5K0U A;  3EYP A;  1RUF 1;  3J8F 2;  2YC4 A;  1Z7S 2;  2J22 A;  2CDO A;  5FMB A;  1J1T A;  4NMI A;  1GNH A;  1CAU B;  2QQL A;  3SCF A;  1YRZ A;  4LKD A;  4CCN A;  4Y1Y A;  5HV0 A;  3Q8E A;  3P6B A;  3WNK A;  1ASJ 3;  4XET A;  2VXR A;  3TEZ A;  4YRD A;  2KA3 A;  5E88 A;  2AEZ A;  3VBR B;  3RSJ A;  5IVV A;  2B9U A;  4Q5O A;  3AFG A;  4MET A;  1LUL A;  4IEY A;  4KH9 A;  3AP4 A;  4LMF A;  1ALY A;  4NWV A;  1CR7 A;  3SH5 A;  2R0F A;  4CP9 B;  2ERF A;  1UNB A;  2B42 B;  2Z69 A;  3M3C A;  4MH0 E;  4XFA A;  1PGL 2;  4LOR A;  4LNV A;  5JXG A;  4BZ4 A;  2ZBJ A;  1K5M A;  4MUV A;  3OPZ A;  5BNP B;  4AED B;  1F9K A;  1Q5O A;  4CP9 A;  3AX4 A;  1AHS A;  3W58 A;  1AR7 2;  1RMU 1;  4Y5T A;  1ND3 B;  5CG9 A;  3MIG A;  3MYX A;  1W2O A;  4URA A;  1U12 A;  3DN7 A;  2EIG A;  3J8F 3;  3FHI B;  2HWE 2;  2HWB 2;  1B35 C;  1OLQ A;  2WS9 2;  2XUM A;  3HQX A;  3WQ0 A;  1HLC A;  1H0B A;  1G9F A;  3IZO A;  4R9D A;  4S2D A;  4YW5 A;  5FV3 A;  3WVJ A;  5CFD B;  3CZJ A;  5KR7 A;  2AYH A;  3TWI A;  3J9S A;  1FT9 A;  1ONA A;  3VBO A;  1OLM A;  4GH4 C;  3VBU C;  2BJS A;  2IXI A;  3ZFE C;  2WN2 A;  5LBC A;  2V4A A;  4JAA A;  4E2S A;  3MLJ A;  2PHF A;  3O0X A;  5FZF A;  1QJE A;  3OOX A;  4WV8 A;  3WNO A;  2IXH A;  4NWW A;  4IUG A;  4AVB A;  1RVF 3;  3LOB A;  1NOV A;  4S2F A;  1OPO A;  3VLB B;  5FZI A;  1EPZ A;  4P9Y A;  4AQS A;  3E97 A;  2VUC A;  3ZXF A;  4ZKT B;  3WG4 A;  5CNA A;  1R1A 3;  5FY7 A;  1RUG 3;  1KRI A;  5CFD A;  2A71 A;  3PUQ A;  5FJK A;  2JG9 B;  2WNV A;  4AHZ A;  3ILR A;  2W94 A;  2XHK A;  4PJY A;  3VBF C;  4IV1 A;  1C1L A;  3H7J A;  3KF5 A;  4A2U A;  3BI3 A;  1LU2 A;  2WR9 A;  2Y60 A;  4IE7 A;  4LOS A;  1WWY A;  3RG0 A;  2UWC A;  1POV 0;  2VZU A;  1ZNP A;  2XUE A;  5FDB A;  3HN3 A;  5L73 A;  2YPD A;  4NJ4 A;  4WBB A;  1XYN A;  3R4D B;  4JTN A;  4N9I A;  1QQP 2;  2YC2 A;  5FYT A;  3THT A;  4E4H A;  2DUR A;  1KQR A;  1RMU 3;  5FBJ A;  4PIY A;  5K8S A;  2C9K A;  2WKK A;  2XR4 A;  4RGG A;  1VR3 A;  5LEJ A;  4XE9 A;  2W92 A;  3III A;  4LKE A;  2AC1 A;  2J1V A;  2ZX2 A;  3H9A A;  4NID A;  1JOP A;  1EUU A;  3SEE A;  2Y26 A;  3DV8 A;  3VDB A;  1ULG A;  1JN2 P;  1GZ9 A;  4UFI A;  2NMN A;  4EN7 B;  4UFK A;  5BUV A;  1VBE 2;  3U0Z A;  2BNM A;  5IVC A;  5B4N A;  4JGZ A;  1AXK A;  1PK6 B;  5JWP A;  3C7O A;  1O8P A;  1QXJ A;  4N53 B;  2VTF A;  4QKF A;  3UJQ A;  3POE A;  2XG3 A;  4OYU A;  1MQT A;  5BXX A;  5A1L A;  1O3S A;  1RUJ 3;  4QXB A;  1NX9 A;  4LXL A;  2JG8 B;  1O7F A;  2HWC 2;  1NQJ A;  1GR3 A;  1BVP 1;  3K48 A;  1HRV 3;  4GMP 0;  4B4Q A;  3U07 A;  3DKQ A;  2FZ2 A;  1AR8 1;  1GWM A;  4LBK A;  3O1P A;  3RZM A;  3OGJ A;  4CU7 A;  2ARA A;  1UYP A;  2W87 A;  4Z2A A;  1LGN A;  2ZEW A;  5HCB A;  3HEI A;  1PVC 1;  2NN8 A;  5EFU A;  3I2O A;  4QQL A;  1ULP A;  3JQX A;  4MHU A;  3GF6 A;  3HBK A;  3PVN A;  1QOT A;  2C4X A;  2EIC A;  5J09 A;  3SKV A;  4YGB A;  4K40 A;  1WCS A;  5D21 A;  1IOA A;  1LES A;  3S57 A;  2TUN A;  2R1D A;  2Q4S A;  2Y6K A;  4HN0 A;  4OFG A;  3SCH A;  3UL2 A;  1ZM1 A;  5DN2 A;  5BYN A;  1DGW X;  1DZQ A;  2A6Y A;  2QNK A;  4IEQ A;  3TOJ A;  4COZ A;  4OI2 A;  4NUB A;  2GNB A;  1WLC A;  2Z4F A;  5JIA A;  2VMD A;  1OSG A;  1SLA A;  2ZA9 A;  2AR6 A;  3BB6 A;  3KMH A;  4QB6 A;  2J1U A;  4KL1 A;  1FAY A;  3POG A;  1FMD 3;  2QBX A;  2ZEZ A;  4NRQ A;  5DG1 A;  5HPO A;  3AYE A;  5HBA A;  4SLI A;  1W28 A;  2OKX A;  3Q8A A;  1W3X A;  5IFT A;  2MEV 2;  1CZS A;  1DGR A;  4R9A A;  3U4X A;  1XND A;  2CDP A;  4KWU A;  2EAA A;  3LOI A;  3M2M A;  4UF0 B;  1XYO A;  4EWA A;  5C6C A;  1R08 1;  1AX1 A;  4IER A;  5FPL A;  3LA7 A;  3BIE A;  4CTE A;  2R06 2;  4AVC A;  1Z0H A;  2ZAA A;  1RUJ 1;  3INA A;  1FXZ A;  1ULD A;  3W5N A;  1CGP A;  2YYO A;  4ZPI A;  1PNG A;  1Q8O A;  2QFE A;  4QDR A;  4A7K A;  4EWE A;  2WUH A;  3KCX A;  3LPG A;  1XPW A;  1H2K A;  4XIK A;  1GV9 A;  1RUI 2;  3AYA A;  2W5F A;  3ZVX A;  5BY5 A;  3USU A;  1SCS A;  2AEN A;  1UCX A;  3AB0 A;  3NAP A;  5EHD A;  4GWI A;  4QM8 A;  2BGO A;  4BQ2 A;  3WUD A;  3RI8 A;  1JZ3 A;  3CBN A;  5IVY A;  4CXY A;  4XF0 A;  4LIV A;  1ENQ A;  1AYM 1;  1MS1 A;  1HB3 A;  1O8S A;  4XXP A;  2Q8O A;  4XZP A;  1PM7 A;  1LOD A;  2GN3 A;  1IPJ A;  4P5H A;  4XYX A;  3K4D A;  3S7I A;  2E32 A;  4DRV A;  3ACF A;  5KXD A;  1W8Z A;  2RJK A;  1UMI A;  1A8M A;  3R4S A;  1G8W A;  3FUQ A;  1UY1 A;  1LOE A;  1AX0 A;  4JKL A;  4AED C;  5JIU A;  5ISL A;  1AL2 2;  3JU9 A;  1SFN A;  1RUF 3;  1REE A;  4C0H A;  2O1Q A;  4N7U A;  1WW5 A;  4XMA A;  2F6B A;  2WIN B;  4LO6 B;  2MEV 3;  1UXX X;  1RUO A;  2X5I A;  3WNL A;  2PTM A;  2VOW A;  1LOF A;  1SLT A;  3KT4 A;  5FLJ A;  3HPN A;  4GMP 1;  3AXE A;  1CON A;  3ACI A;  2IC1 A;  5H9S A;  1W04 A;  4ATE A;  1LNS A;  3OYW B;  3QAC A;  4KG8 A;  5A7W A;  2B46 X;  1IPS A;  4A6S A;  2W95 A;  3ZYJ B;  1A34 A;  4TN7 A;  2VBD A;  3OBR A;  3PIG A;  3ST7 A;  4QPG C;  4RA0 A;  1RUH 1;  5C5U A;  3CHX A;  1I3H A;  4E8D A;  1F4A A;  3VHN A;  1FPN 2;  2C9A A;  2WSV A;  1VPH A;  3VKM A;  3GJA A;  3GCX A;  5EXO A;  4JGZ C;  4L9B A;  3NST A;  2GC2 A;  3PVE A;  4Q26 A;  3SH4 A;  5FY1 A;  3VBH A;  1D4M 3;  3POS A;  3VZO A;  4H7L A;  3ZFF B;  4PT6 A;  1PO2 1;  2JDY A;  5T5P A;  1YEW A;  3DUI A;  3MFA A;  1G9C A;  1AR8 2;  2ORX A;  4JDM A;  4JGY A;  1DYK A;  1GQG A;  3UGH A;  2P6C A;  4DY5 A;  3RMY A;  5DPN A;  3JXS A;  2WT0 A;  4FP3 A;  3KVB A;  1LOA A;  1YYN A;  3FBM A;  2D6K A;  4N7I A;  5SV5 A;  5DUW A;  4CCD A;  1DF0 A;  2JEC A;  2VBP A;  5JOW A;  1BLZ A;  1Y9M A;  5IK8 A;  2BYV E;  2W91 A;  1J83 A;  2AUY A;  3NMB A;  1VBA 3;  2OQ6 A;  3SQO A;  2GND A;  2K46 A;  5C70 A;  3MW4 A;  2WZR 3;  1CAU A;  2HWB 3;  3FHA A;  1H4H A;  4GUL A;  4XUQ A;  5E89 A;  1RL3 A;  5LY2 A;  1ZZ8 A;  4QU1 A;  1C8M 1;  5FLH A;  3WX5 A;  2LAL A;  3PJY A;  2ZGN A;  4OLL A;  3VBS C;  2DUQ A;  3RZZ A;  4L8Q A;  1C1F A;  3DCQ A;  1OFS A;  3IAQ A;  3WP3 A;  1LOG A;  4O65 A;  4OUL A;  2J1S A;  4CDU A;  1ODM A;  2XL9 A;  1J3R A;  4K20 A;  1V0A A;  1SFP A;  1NUK A;  2BWC A;  2AGS A;  1DCS A;  1QDO A;  1GIC A;  5T5L A;  3O1U A;  5A3N A;  3LSE A;  1STM A;  4R4Z A;  4YNI A;  1NY7 2;  4YW7 A;  1IQD C;  2GMP A;  2W52 A;  4LO4 B;  3ZYI B;  3UYJ A;  1MAC A;  5KHG A;  1LKN A;  5J3U A;  4AI9 A;  3F95 A;  4FPF A;  1V6I A;  4P9I A;  2JD9 A;  3OPW A;  1PM4 A;  2RR1 3;  4A44 A;  1POV 3;  4FPY A;  2XLG A;  2DYC A;  3AKQ A;  2PAM A;  3ATG A;  3E1F 1;  3ZMO A;  4BJ0 A;  5F5C A;  1W6Q B;  2AAC A;  4W6W A;  2R04 2;  3RPQ A;  1UU6 A;  4EE2 A;  1AR9 2;  2D6P A;  1LEN A;  3O0W A;  3VGI A;  1H1A A;  1OKO A;  1J58 A;  3PHM A;  3AKR A;  3MBW A;  4HG6 B;  2RS1 3;  1N1V A;  1CN1 A;  5FKB A;  1PIV 1;  1PK6 A;  1ZRR A;  4FCA A;  3ZSJ A;  5FR3 A;  5D8A A;  3VD3 A;  4NE9 A;  3O1R A;  2PLV 1;  2Y34 A;  1IG3 A;  2QZ3 A;  2ZAH A;  5DXD A;  4RHV 3;  4YW3 A;  5CKN A;  2PHU A;  3KWV A;  1W0O A;  1QJY 1;  3DKW A;  3APB A;  1NCQ B;  4YFW A;  4IQP A;  4JQR A;  4GKX A;  2VGD A;  4LBQ D;  1EAH 1;  4MZU A;  2UWA A;  1NA1 A;  1W05 A;  1QJX 3;  3OBA A;  3PTR B;  3WXP A;  4DNY A;  1X9T A;  1KJR A;  1DGW A;  3NV3 A;  4KGQ A;  4AQ2 A;  1AUY A;  3IPV A;  1ENS A;  3O1S A;  3RZG A;  3R6S A;  4MX3 A;  3TB0 A;  2WNU C;  3KQ4 B;  5FYB A;  4QX5 A;  3N35 A;  1DQ2 A;  3E6B A;  5HXV A;  4GIQ A;  3O1O A;  3LFM A;  3U37 A;  1O5U A;  4KBB A;  1H2N A;  2Q8C A;  3NV4 A;  1P8J A;  1OBN A;  3JZV A;  3VZL A;  5I0D A;  3KCC A;  4YVS A;  4IEP A;  4LBJ A;  2VMH A;  2WQ8 A;  3DEM A;  3HQU A;  1KXG A;  4CCM A;  4PQ9 A;  5EQU A;  4GWN A;  1V6L A;  4XF3 A;  2CU5 A;  4GAL A;  3O1T A;  3ZN4 A;  3V65 A;  1OQD A;  2GMM A;  3DPR B;  4DUW A;  3QH6 A;  1ZRI A;  2MPF A;  4ZZ5 A;  1LB2 A;  1JUH A;  5KHK A;  4JGY B;  3ZKU A;  4AEJ A;  4DXT A;  2JEM A;  3ZIW A;  4ITC A;  1NQD A;  3A22 A;  5FZ7 A;  5IVE A;  3OD4 A;  5C4W B;  1WW7 A;  3WNP A;  4BQW A;  4AI8 A;  1QXP A;  2DVF A;  4TLG A;  1NG0 A;  5F5I A;  1N3O A;  5FZM A;  5I8Y A;  1WZX A;  3ALQ A;  2HLE A;  5D8A B;  5GAL A;  1RIR A;  2WII B;  2XJT A;  1SLL A;  5A33 B;  2NP0 A;  4F83 A;  1JYT A;  2FCV A;  1QDC A;  3KB5 A;  1Q3E A;  2UYA A;  3P3N A;  1VRB A;  1QGL A;  3TNP B;  4RS5 A;  1X8E A;  2ZPX A;  4GXL A;  1FOD 1;  2WYS A;  3KT1 A;  1LGB A;  3NJY A;  1RUE 3;  5FZC A;  5AFE A;  5C5T A;  4BHP A;  2BGC A;  3HMY A;  3POF A;  5ACA 1;  1HB2 A;  4LPL A;  4HPK A;  3B7M A;  1UIK A;  1F35 A; 
#chains in the Genus database with same CATH homology
 4MAD A;  3GM8 A;  2DCK A;  4M4R A;  2YFU A;  4P08 A;  3NJX A;  5J1X A;  2V5D A;  1PX3 A;  2VM9 A;  4BK5 A;  2QQM A;  4TTG A;  3HNB M;  3PUI A;  2J1R A;  5LA2 A;  3I2K A;  1CZT A;  3I2I A;  4RYD A;  3A23 A;  3GGL A;  2BER A;  2W1S A;  4XUT A;  3OG2 A;  2VCB A;  2ZEY A;  5G04 L;  2W46 A;  2E26 A;  3I3E A;  1CX1 A;  4DXS A;  1US2 A;  2VJX A;  4PF1 A;  4W4Z A;  2VZS A;  3I2J A;  2WAB A;  1JYN A;  1WKY A;  4LKS A;  4BDV B;  3T09 A;  2KD7 A;  2VL4 A;  4UI9 L;  3EYP A;  2YC4 A;  1W8O A;  2B4K A;  2J22 A;  2CDO A;  3C7G A;  4QDS A;  2QQL A;  1UZ0 A;  2X10 A;  1PMH X;  5A1A A;  2V4V A;  3A7Q A;  3P6B A;  3WNK A;  2XOM A;  3SEP A;  4MO3 M;  3WNN A;  2WAA A;  1RYY A;  3A21 A;  1SDD B;  5IHR A;  3AC0 A;  4UAP A;  2QQI A;  3GXU A;  4ZXE A;  3HNY M;  4QB2 A;  4CVU A;  1GOF A;  1EUT A;  5JXG A;  4OMD A;  4QPW A;  1ULO A;  3VDA A;  3ABZ A;  2BZD A;  5IFP A;  4BK4 A;  4JKK A;  3DYP A;  1R64 A;  3WNM A;  3CZJ A;  2XQX A;  4JHZ A;  1GQP A;  1D7P M;  2WN2 A;  4XVH A;  1W99 A;  2JKX A;  4QX0 A;  1W8N A;  4CU8 A;  3WNO A;  3CKH A;  1KGY A;  4IUG A;  4QX3 A;  3ZM8 A;  1OD3 A;  3CIH A;  3WEZ A;  3T0B A;  3K46 A;  2VZ3 A;  4A3Z A;  1H6X A;  1JYW A;  2YB7 A;  2J1A A;  1CIY A;  3I3D A;  2W94 A;  2VR4 A;  3LEI A;  2VCC A;  4W8J A;  2VQT A;  3CDZ B;  3C7H A;  1O59 A;  3VD9 A;  2VZU A;  4JKM A;  2Y6L A;  4CUC A;  3HN3 A;  2J1E A;  4XUP A;  1TG7 A;  4D0Q A;  2YC2 A;  3F2Z A;  3VDC A;  2C9K A;  3C7F A;  5C7G A;  5JXH A;  5B4X A;  3I3B A;  2W92 A;  3WF4 A;  3WQB A;  3III A;  3T0D A;  5EJZ B;  2J1V A;  2LS6 A;  2J7M A;  2QQO A;  4XUR A;  1EUU A;  2Y6G A;  3SEE A;  3VDB A;  3WF3 A;  3VD7 A;  2B9V A;  5DQ0 A;  2YG0 A;  2RJ2 A;  5B4N A;  1GOH A;  1PMJ X;  4XZU G;  3C7O A;  1O8P A;  1UY4 A;  2JDA A;  2VTF A;  4A42 A;  2DCJ A;  4OYU A;  3HJR A;  3MV1 1;  2X05 A;  3MO4 A;  1NX9 A;  2BBA A;  2EIB A;  2WZE A;  5F7U A;  4CU7 A;  2W87 A;  4Z2A A;  2ZEW A;  3HNM A;  3HEI A;  1JZ8 A;  1J84 A;  2W1Q A;  1XNT A;  1ULP A;  3T08 A;  3CMG A;  4AAX A;  2EIC A;  2C4X A;  3SKV A;  1W9S A;  4GWJ A;  1KEX A;  3LQC A;  2VZP A;  2Y6K A;  2ZXQ A;  5DN2 A;  3I97 A;  3C8X A;  4BXS V;  1GOG A;  4CU6 A;  1PX4 A;  2QQN A;  2Z4F A;  3NJV A;  2VMD A;  5C71 A;  4QB6 A;  2J1U A;  4ZY9 A;  2QBX A;  2ZEZ A;  5HPO A;  2OKX A;  5LA1 A;  5IFT A;  1NKG A;  2WBK A;  5IYY A;  1OH4 A;  1JYV A;  1CZS A;  1W9T A;  2V72 A;  5EIY B;  2VZT A;  2VME A;  3GDB A;  2CDP A;  4KWU A;  4YPJ A;  3OGS A;  5HXM A;  1JYX A;  1GMM A;  2EIE A;  3WF2 A;  4RN5 A;  2WZ8 A;  3MV0 1;  1JZ4 A;  4ZZ8 A;  3W5N A;  3WSO A;  4CU9 A;  2XHN A;  2RV9 A;  4QDR A;  5G05 L;  2WUH A;  3K75 B;  3HOB A;  3LPG A;  3K4A A;  1K42 A;  1DP0 A;  1XPW A;  1JU3 A;  4A45 A;  3OEB A;  1SG3 A;  1UXZ A;  2W5F A;  2J1T A;  2XON A;  4GWI A;  2BGO A;  3FN9 A;  4P00 B;  5CYY A;  1JZ3 A;  1W9W A;  3T2O A;  1UMH A;  3NNG A;  1O8S A;  1OF4 A;  3DEC A;  4W50 A;  3K4D A;  1YQ2 A;  2E32 A;  3ACF A;  4L0P A;  4OZO A;  1UMI A;  1UY1 A;  4JKL A;  4QAW A;  5EJ1 B;  3P1I A;  3VD5 A;  1UWW A;  3K77 A;  1UXX X;  1OF3 A;  3WNL A;  4E8C A;  2E33 A;  5DMY A;  2VO5 A;  1DLC A;  2EID A;  1MPX A;  3HPN A;  3IAP A;  3C7E A;  3I2G A;  3ACI A;  4D8M A;  4DUV A;  1W0N A;  1LNS A;  1OT5 A;  2W1U A;  1K12 A;  4DEQ A;  2ZEX A;  2W95 A;  1TVG A;  2WDB A;  4ET7 A;  4E8D A;  1F4A A;  4AG4 A;  3ECQ A;  3LEK A;  2Y6J A;  2YFZ A;  2VC9 A;  4LHS A;  2C26 A;  4MGS A;  4PT6 A;  2WO2 A;  3LE0 A;  3CZU A;  1T2X A;  1JI6 A;  4MOA A;  2W47 A;  3FL7 A;  2ORX A;  4XUN A;  2LW8 A;  5DPN A;  3JXS A;  1DYO A;  3THC A;  4TXW A;  1BHG A;  4DXR A;  2W91 A;  1J83 A;  1UYX A;  3UET A;  3IB3 A;  5C70 A;  4XUQ A;  3FHA A;  3EB7 A;  4FI9 A;  1I5P A;  3ETP A;  3SKJ E;  1L7Q A;  2VMF A;  3DYO A;  3OB8 A;  3I2F A;  2W1W A;  3IAQ A;  1XNA A;  3OGV A;  2J1S A;  3CQO A;  1NAE A;  4MGQ A;  2VZR A;  3THD A;  3MUZ 1;  1WCQ A;  4CUA A;  2ID4 A;  1K3I A;  4DUX A;  1NUK A;  4PQQ A;  2VOT A;  4A41 A;  2QQJ A;  2Y8K A;  3OEA A;  1SHW B;  3I2H A;  4A4A A;  4ARX A;  1F4H A;  1IQD C;  5JMO A;  5JXJ A;  3IDA A;  1UY3 A;  4CUB A;  2ORZ A;  4JX0 A;  3VD4 A;  2VZQ A;  2W3J A;  2JD9 A;  4A44 A;  1CZV A;  2Y6H A;  3T2Q A;  3E1F 1;  1UY0 A;  4BJ0 A;  4KMQ A;  4ARY A;  1JZ7 A;  1UYY A;  3D3A A;  4XUO A;  4A6O A;  5JXI A;  2RVA A;  4UOJ A;  2L9L A;  3W5M A;  1HN1 A;  3MBW A;  4HG6 B;  4KI5 M;  4GZ9 A;  4QB1 A;  3FHQ A;  3VD3 A;  2VCA A;  1H6Y A;  4DEV A;  1K45 A;  3NRU A;  2WAO A;  5LCW L;  2WO3 A;  5JR2 A;  3OBA A;  2VZO A;  3LEG A;  4QX2 A;  1UYZ A;  3WF1 A;  3PUH A;  3OGR A;  2E31 A;  3J7H A;  2HYX A;  3U37 A;  3DYM A;  1P8J A;  3K4Z A;  1GUI A;  3BGA A;  2VZV A;  2WO1 A;  3MUY 1;  2QQK A;  4P02 B;  5CZK A;  2R7E B;  5I0D A;  1GU3 A;  3T0A A;  4OUE A;  3UNP A;  2WQ8 A;  3T2P A;  1US3 A;  2BGP A;  1JZ6 A;  4LQR A;  1JZ2 A;  2Y64 A;  2VQU A;  2VMC A;  2JE8 A;  3ACG A;  4DUW A;  4ZZ5 A;  3UES A;  1JZ5 A;  1GNY A;  5IJR A;  4DXT A;  2W9X A;  1L7R A;  2PQS A;  1XC6 A;  3ACH A;  3A22 A;  3WNP A;  1JU4 A;  4QX1 A;  4P5Y A;  2X09 A;  2HLE A;  3WF0 A;  1JHJ A;  5JUV A;  1UY2 A;  5FUI A;  3LPF A;  4OMC A;  2DDU A;  2WYS A;  4M4P A;  5LA0 A;  2WN3 A;  3BN6 A;  3NQH A;  4LPL A;  1UX7 A;  2VZ1 A;  4QDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...