1UZ3A

Crystal structure of novel protein emsy
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
102
structure length
102
Chain Sequence
GSMPVVWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSISTERHRAEVRRAVNDERLTTIAHNMSGPNSSSEWSIEGRRLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Ent Domain of Human Emsy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chromatin regulator
molecule keywords EMSY PROTEIN
total genus 40
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03735 ENT ENT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1240.40 Mainly Alpha Orthogonal Bundle Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 1uz3A00
1UTUA 2FMME 1UZ3A
chains in the Genus database with same CATH superfamily
1UZ3A 4HEHA 1K7YA 2J6YA 5C8DA 3IVAA 1R8JA 1Q6BA 4M0MA 3H20A 4JGIA 2J6ZA 2PBIA 1V2ZA 3EZXA 3WHPA 5C5EA 1Q6AA 4HH3C 1R5QA 1UTUA 3IV9A 3L9TA 1SV1A 1SLYA 3BULA 2I2XB 2J70A 4G86A 2FMME 3BJDA 4X8QA 1K98A 1W53A 1BMTA 1QTEA 1SUYA 3M1MA 1QSAA
chains in the Genus database with same CATH topology
3H20A 2FMME 2PBIA 1UZ3A 3M1MA 4X8QA 1UTUA 3L9TA 4M0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UTU A;  2FMM E;  1UZ3 A; 
#chains in the Genus database with same CATH topology
 1UZ3 A;  4HEH A;  1K7Y A;  2J6Y A;  5C8D A;  3IVA A;  1R8J A;  1Q6B A;  4M0M A;  3H20 A;  4JGI A;  2J6Z A;  2PBI A;  1V2Z A;  3EZX A;  3WHP A;  5C5E A;  1Q6A A;  4HH3 C;  1R5Q A;  1UTU A;  3IV9 A;  3L9T A;  1SV1 A;  1SLY A;  3BUL A;  2I2X B;  2J70 A;  4G86 A;  2FMM E;  3BJD A;  4X8Q A;  1K98 A;  1W53 A;  1BMT A;  1QTE A;  1SUY A;  3M1M A;  1QSA A; 
#chains in the Genus database with same CATH homology
 3H20 A;  2FMM E;  2PBI A;  1UZ3 A;  3M1M A;  4X8Q A;  1UTU A;  3L9T A;  4M0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...