1UZ6E

Anti-lewis x fab fragment uncomplexed
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
216
structure length
210
Chain Sequence
DIVMTQAAFSNPVTLGTSASISCRSSKSLLYSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSSSGSGTDFTLRISRVEAEDVGVYYCAQNLEVPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IGG FAB (IGG3, KAPPA) LIGHT CHAIN 291-2G3-A
publication title Structure of an Anti-Lewis X Fab Fragment in Complex with its Lewis X Antigen
pubmed doi rcsb
total genus 47
structure length 210
sequence length 216
chains with identical sequence L, M, V
ec nomenclature
pdb deposition date 2004-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uz6E02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uz6E01
3ESVF 1LP9B 2LTQC 5KSUA 2XNAB 4KDVA 2C3GA 4NBXB 2VB5A 3TVMB 4ZFGL 4YPGB 1MHEA 3S98A 3HNSL 2DI8A 2BSTB 2VZOA 3V7AG 5E00B 4JPWL 4W6XB 5BXFB 1S7VA 3NIDF 5DMGD 4HHAA 4XX1E 1G9ML 2DRUA 3VA2C 3BGFB 2WMPA 5KSBF 1XGQB 1YNLH 3IAPA 2BVYA 3RTQB 3SGEH 5DR5H 1RUQH 2NQCA 9CGTA 5D1ZC 5DJDB 2LTQB 2PCPB 2AS5M 1PKQA 3MUHL 4XAKD 2V5MA 4L4TA 3F7RA 3ARFC 4NJ9L 3LRGA 3EW3B 4PBXA 3EOTH 2P8LA 2G5BA 1NGXA 3SE9H 2ITDB 3BW9B 3VXRE 1EMTL 4H88H 1S9YA 3VWKD 5GGTL 3ZSTA 25C8H 1QBML 3OBAA 2MQCA 1B0RB 1JGUH 4U1HA 3ILQC 3ARFB 3CFCH 4BSVA 5HYIA 3QRGL 1NCWL 4ONFL 5E24E 5IVZB 4GKZA 5DK2A 1BD2B 4OV5A 1SJHB 1CFSA 1HZHH 3H9SD 4QOKA 3RU8H 5I73C 4X7EC 1T83A 1DLFL 4JQIL 4U1LA 3VG9C 1K8DB 5D7LB 4ETQB 4YXLL 5MP6L 4KI5C 4HXAL 4ZUWA 2B5IC 2NZ9D 4Z76A 5AYUL 5JW3L 5DD0H 1WZKA 1XEDA 1TITA 4I2XB 2DTSA 3TBVB 1VESA 5K9JH 4HJ0D 1S7TB 5KZCB 3BPCB 2JJSA 2PYFA 4E0RB 5CAYB 4K23L 4Q9BA 5CZXC 1H9VA 3DOSA 3JV4B 2DN7A 3PIQA 1IQWH 2VIRB 4X99A 3B2VL 2XPGB 4BFEA 5HDBF 1OQXA 3N1MC 3VG9B 4FQIL 3B2UD 2AXGB 4LVHC 2H6PB 3R8QA 3UTQB 35C8L 1X4ZA 1JPSH 1ZOXA 2DD8L 2B5IB 2JB5H 4X8JA 4XVSL 4JFED 3HR5A 1K4CA 4JN1L 4KHTL 1K6QL 2HFTA 3D69B 3CLEH 5EBGA 2YKLL 4IIQC 5K9OA 4DTGH 3BT2H 5J12C 2OR9L 2A77H 4E42A 3C8HA 4KAQL 3TWCL 1HE7A 1XR8B 2G2RB 4K3DH 3VFNB 1OSZB 3W9EA 4KRPD 1AO7E 4JLRB 5C0RH 3LHPL 3MJ7B 3B9EA 1Q9LB 2ADGB 1QD0A 3NN8A 1GZPA 4QCIA 1J0ZA 5DRNB 4JFDE 3QEQA 3TPKA 1LP9F 4LVHB 1J1XH 4UBDD 1ZA3A 2R15A 5J1AB 1YYMH 3EAKA 4XH2A 2AJYL 1FORH 4D0BA 1JGLH 5D72L 1R3JA 3BH9B 2JE8A 1J11A 1X5JA 3Q1SL 2Y72A 4IIQB 1A7RH 2YUZA 4K94H 3MO1A 5J12B 4DGIL 3ALPA 5FYLL 3QG6B 5ANME 1I1FA 4YO0A 3GIVA 2G5RA 1P9MC 4HPYL 4PRAA 1A6PA 2XRAL 3HI1A 4UT7H 2IPKB 2D9QB 2H2SC 2VRAA 3R1GH 3C5SA 1BJMA 4X5XA 2E8ZA 4UAOC 4DKEL 4G8IB 5KTEL 3C08L 4PRHA 2HN7B 4NDMA 5FA4B 2ZPKL 5EU3A 2BOCB 2PYEB 3RNKA 4FQLH 4D9LL 4FQXC 2GFBA 1MIMH 2OTWB 2NZIA 1IC5L 3MJ9H 4KUZL 4MLIA 1ORQB 4MQSB 1NCNA 3FQNB 4P2RE 4FFWD 4MXQD 1CFVH 1HSBB 3T2PA 1L9MA 4ODTH 2HFEB 3ARDC 4LLUB 4HKZB 4UAOB 3MRQB 5HPMB 1I7RA 1GSMA 5GSVB 1UJ3A 4WV1A 3LPFA 1O7VA 4TNWK 4YAQB 4NRYB 1ZEAL 5DS8B 1CGWA 4FQXB 4MQ7A 4NM4H 1LK3H 4WCYL 5DJ0A 5T3ZH 5B38G 2VDPH 4ODVH 5E5UB 1G0YR 2V6HA 2HKFL 3SDXA 4ZUUB 3IAQA 4TULL 4LSPH 1MCSA 1CICA 2PO6B 4GXVH 5JDJA 4V2BA 5CUSL 3ARDB 4KY1H 1WIUA 2CKBH 4MDIB 2DM7A 4KTYA 2VLRA 1JUFA 3IVKB 4JDVB 3WIHA 1AD0B 4XHJC 5ISZD 4NO0D 4DJMA 1QBLH 4ZO6A 1D9KD 1FLTX 1A9EA 3PGFL 4QRQB 2EDDA 2VKWA 4JPKL 1ZT4B 4F37K 4G6AD 1ADQA 2BJML 2XFXA 3RBGA 3NAAL 1ZLWH 1DTUA 1JZ2A 1U3JA 1U91A 4R3SB 4C4KO 4HGKC 1LNUA 3BZFA 1NCCL 5EU4A 5IBLD 3TCLB 1EDQA 2W38A 1V3JA 5EZOL 2MPAL 3TJEH 4NZRL 1DE4A 1P1ZA 2DWEB 5HSFA 3BEVA 1Y18A 4PRBB 4JFHE 4LSUL 2XICA 1G7IB 3VG0H 2X41A 5CIPH 1ZLWK 4XZUA 4S1RH 4LP5A 1J5OL 3MUJA 2D7NA 3RVWC 4NSKA 1EJ6A 5BRZD 3QO0A 1SHMA 1UCBH 3JWNC 2M26A 1CF8H 1NEZA 2OP4H 1T3FA 5C0ND 3T3MF 1OAYL 3FT4B 4ELME 2FECL 1T1WB 1CE1H 4YXHL 3AREC 4LCWD 4E41D 5DEFB 4X98B 1S7QB 4MA7L 1IM3B 2YBRB 4JHWH 1BZ9B 3SE4A 4GW4A 2AJ3A 2PN5A 4XP4H 5DMJB 1WCBB 1QRKA 1VSCA 4P2QB 1RIVL 4H26A 1R5VA 4GOSA 4XVJL 3QUML 5FGBC 1M71B 3THMH 1S3KL 2CJUL 3U30B 3QULB 4NO5B 5DWUL 3TH3T 3VXQA 3CCHA 1F8TH 1YPZB 5E2VH 3QEGH 3CVHL 3B5HA 5JHLL 2W0LA 4HIEB 4O02L 4LHUD 4D0DB 4U49A 5AYQA 4LU5L 4YHIA 5F70A 4C59B 4ZO9A 4S1DC 5ILTH 1CE6B 4XMKL 1RK1A 1J0YA 1C5BL 3GIZH 2CD0A 3IJHA 1J8HB 2H8PA 3HUJE 4X6DF 5E6ID 4M1CC 1KN4H 1NGWA 4Y5YC 3QUXA 5J9PA 3FFCD 3P4MA 1QFOA 1QFWL 2DOCA 1E6JL 3AC0A 4F7TB 3TN0C 4S2SA 2VLLB 3O6FD 4ODWA 5I8EB 4QRPA 4OZIA 5JPNA 5D2NC 2AV7A 5IBTL 2ERJC 3DO3A 1RUAL 3ZKQD 1I1YA 1CLCA 2V2XB 3RQ3A 1ITBB 5T3ZE 1EERB 4KZEL 4EUPB 3PHQB 5HHXH 1NLDH 2DDQH 3ARYA 4Y5YB 3QDJB 4KZDH 1OGAD 2MKWA 5E7FA 2NY6B 2WW8A 4H8WC 3O4LE 4Y4FD 2V9QA 4LPYA 4BELD 3FB7A 3O6MH 2X4NA 5D2NB 2ERJB 2AEPL 5IHBA 2X89D 3DRTA 3I6LD 2CSPA 1JTPA 2XA8L 5K59E 3C2AL 3EBAA 4XC3H 5AEAA 1NFDE 2EIBA 3GM8A 4HWBA 4X7FC 3T4YB 1CFNB 3D0LB 1FNEB 4M48L 4XCEB 3T0XA 5HVWA 3RX7A 2BVTA 3D48R 1D6EA 3ZDXE 1YY8B 3O81A 4IRJD 5I1CL 3FONA 4LSTH 4MA8H 1ZVYA 3OXRB 1M7XA 2P45B 4C83A 1JI1A 4KQ4L 2CDGB 1SY6H 4DCQA 2VDML 5GGRY 3VFVA 3IXAB 4CAGA 1F5WA 2BC4B 1UM4H 4GBXD 1I1AA 1JCKA 3TH4T 1BQSA 2ZCLL 1AKJA 5SWZD 1QNZL 3ROOA 1CDHA 4ZFZA 2B0SH 4KJWD 3MACL 4QXWA 5MERB 1MCDA 3VXSB 2VDRL 4YLQT 1XGYL 2FEDD 3U83A 3QXAB 5GRUL 1K8IA 5IVXE 5CBAB 2B2XL 1NFIA 3CFJA 3CSGA 1A1MB 1BLNA 1A6AA 1Z3GH 5EA0L 2ESVB 5E70A 3PNWB 1VFMA 3KPOA 1R5IA 2AJVH 5IR1B 1VGKA 1FDLH 3D2UB 2HLAB 2A2QT 3O3EB 3RDTA 4ZSOB 2QKIA 4YNYA 3GRWL 1S7XB 3I9GH 3VD4A 2VISB 2HVKB 1YPZF 2AV1B 5EG6C 3ROLA 5CP7A 1N5AA 1TMCB 5MI0C 4YDIH 4X6FA 5DVMA 2LVEA 2AI0H 1DDHA 5C09D 4TSAL 1HYSC 1RIHH 4YGAB 3GSQB 3LKNB 3BDYL 2R2BA 1YN6A 3VXMB 1AQDA 2L7JA 5AG8A 4LARL 5KN5A 3LS4H 5MHSE 1VEPA 4U1IB 1U8QB 2AGJL 2DLGA 3S37L 4C56D 1P84J 5IB5A 5MI0B 2E9WA 4BK4A 4YR6B 1L4IA 4LSVL 5D9SB 2WBKA 1FYTE 3FZUD 4J3UA 1FP5A 3MMEA 4GUPB 1NCBH 4LKXA 5I19L 3AY4C 4NWTH 3NZ8A 4Y88A 4GAGL 2NX5A 3ESUF 1QFPA 1JPTL 2MHAB 4L8DA 3TBWA 3V95A 3VFMA 1MCPL 2D7TL 3Q5OA 4F7MB 1KCRH 3VXUD 1KIQA 4OCNC 1AQKL 4YH6A 2E7BA 3OF6D 3T4AB 1DEEA 1FAIH 3WSQH 4PJ9A 3O45B 3VJ6A 4AM0A 4XXDA 5GRWA 1NUDA 4ELKA 5D5MB 4EVNB 1EX0A 3EYOA 1JGEA 4YFDB 2B8OT 1YEJL 5D7IE 4JRXD 2H26B 4P9HH 4P9ML 3FQUB 3BHBA 5ENWB 2Q7YB 3SKNB 4ZUTA 5IJKC 3O6LH 3U4BL 1T5WA 2Y6SC 4ORZC 5I9QC 4WO4C 3BIAX 4P23D 3D39A 5EBMB 4UMGA 3CJJA 1SBSL 5I76A 5C92A 3PGDB 4IOIB 4Z78B 3VXNB 3KWWA 5F44A 1KPUA 2LE9A 2WLZA 4RCAA 3J8F7 2ZUQC 3RGVA 5GSRB 4JY5L 43CAB 4X4XB 3MRIA 1QFHA 1C7SA 4I4WB 3SKJH 5DD6A 5FKPA 3IDMA 4KMTH 3GHEL 5CEZL 4LBEA 4G7YL 3PQYE 1CLOH 3GBNL 4LVOC 3QA3A 1S7SA 3E8UH 2A6DB 2YSSB 2DWDB 4R97C 3BGAA 3MV8A 4Z8FL 2CDEB 5I9QB 4WO4B 5EU5A 2GAZA 1XF3B 1E4KA 2EDOA 5KVEL 2FJGB 3RWGA 4NT6B 4X6CE 4WWKA 2YK1H 5EORL 2Q76A 3QQ4A 1JYNA 3ZSSA 3FQRB 5IVNA 1WICA 2NR6C 1J1PH 1A4KA 1DQLL 2ZUQB 3DIFA 2HT3C 3PJSA 4ESKA 1I4FA 3ALWA 3O9WD 4HBCH 1NGZA 3UTSA 4PJEA 5E9DD 1LO3L 1KJMA 1KJ2H 1CU4H 1G7JA 4Z7VF 2IH1A 1GC1L 3QXWA 4R97B 1D5ZB 1KEML 1OTUC 3S3PA 1W8NA 3FO1A 1KTLB 5TDNB 2FATL 4NRZA 2DYPD 4POUB 4JO1H 1YY9C 4M4PA 3GBMH 3JVGC 1U8PB 5JW4Q 4MAUH 6FABH 5L2KA 1DANU 4H20L 5H35B 1PZ5B 2Z91B 1X7QA 2F54B 4IHOA 3WS6A 5D4QA 1CT8A 1FIGL 1BQHA 1MCRA 1AGBA 2AK1H 2DQUH 2EE3A 5FUCC 5D71L 5KVFL 3HZYA 4PG2A 3FN9A 2MJWA 4CRPA 3A67H 2WP3O 4NUGL 1FLRL 2NY0D 5IW6A 3F7VA 1RUKH 2G9HB 3HPLA 1BM3H 4M6AA 5C0FA 2WUCH 1EO5A 1PLGL 3O3DB 3SDAA 1MWAA 1BFVL 3T0EC 1UWEH 3DURB 4X4YA 4D8PB 3GSUB 1IGCH 3GEWB 3DSFL 1CG9A 3FB6A 4RRPA 4X4MA 3WLBB 2FZ3B 1OARH 2VDLH 2UYLB 4KC3B 4G5ZL 5DUBA 1DP0A 5IWLC 1T21A 1FVEA 3L3KB 5D5MF 5KVGH 3WE6B 1FG2B 1NJ9A 1TCRA 3QUZD 2X5PA 4PLKD 4PV9A 1MFBL 5C07A 2BX5A 3PWJB 1T80A 2XWBB 3WXWL 5C0DB 3T0EB 2H45A 1N0XH 4LOUC 4U4BA 2RCSH 4KK8D 4UIKH 4GSDL 1YDPA 1KTDB 2G75A 2CQVA 5F88B 1QHPA 1UZ6E 3VFPB 2P5WA 4MD0A 4HSQA 2EYTA 5F6IC 3ZTNH 3M17B 4EZMA 5EU6D 5JO5B 3Q3GA 5ADOH 1QOKA 3I02A 3FFDA 1IEBB 1W72H 2AXHA 2KQMA 1K3IA 1RJCA 2P8PB 3K0WA 4AH2B 4CGTA 2COQA 2CMRH 2OJEB 5IB3A 4N8CH 5F7MC 4I9WE 4X7DC 3P0VL 1UXWB 1XF4B 3TNNA 4YHYC 1LWRA 3QEUA 4W70A 4FFZL 3U0TA 2QSQA 3D18A 5F6IB 2A83A 3A0OA 1J0JA 3B9DA 2ZSVB 4K3JH 3AMKA 3DBXB 4Y4HA 1NH6A 5IMLB 3U4AA 4ZO8A 3CPLB 3OPZH 1C5CH 1T0PB 2EDFA 3QDAA 3NFSL 5C6TH 3LRHA 3MLXH 1T89A 3SQOH 3M8OL 2VLJB 2YR3A 5FCUL 1S9WB 4XWGH 3EFDH 4M62H 4QHKJ 4HJJH 1FRGL 4HFWA 4HUWA 1GIGH 5F7UA 4KKNA 3MSPA 5E2TL 2XWJB 3CMGA 5GJSL 1RU9L 1BFOB 3C60A 3PDDA 1L7TL 1TZHB 2DQGL 5TQ0L 2JELL 3REVA 5EZLA 2F53D 5DYOB 3QJFA 5E1AA 3G5XB 4J1UA 5CJOL 1IQDA 3HAEH 4GAJH 1OTSC 3ULVH 1MREH 3KHOA 5B39B 2X2YA 4P2OD 1A6WL 1BJ1J 4PJ8D 5JZ7D 3UO1L 5C08D 4HKXB 4YHKL 5LGHL 3P77B 4NM8L 1A7QH 1REIA 2UWEB 4PJGE 4P5TA 2Y5TB 5DD1L 2I9TA 4L3EB 1GOFA 1P7QB 3MJ8B 5KSUB 4AZ8A 5IQ9A 5DUPH 4Z0XB 3C8DA 1A6VL 3A6CL 3HA0A 1NBZA 1G1YA 1F3DJ 4M7KH 4XGZB 2R9HC 1INDL 5T5FL 4X6EB 3MLWL 4OCWH 5F9DC 1NGYA 4OUUA 1S7VB 5C0AD 1MRDL 2F58H 1CL7I 5HXMA 1AO7D 3BKCL 4JO3H 2HRLA 4XI5D 1EO7A 1CDUA 4PJ5A 4Y19E 2AJXH 5FKAA 4ERSL 3NIFE 1PKQB 5DC4B 4ZUVA 4L4TB 5DA0B 1YEFH 1PYWA 1XZ0B 4PV8B 4NQVA 1QRNE 4Y1AA 4OZHE 4OLYH 1E6OL 1DVFC 1MJ8H 3RWFA 2P8LB 3QHFL 1T83C 1WTLA 2G5BB 3SDCA 1NGXB 2ICEA 3ZE0E 1ZLSH 2YMXL 4GJTB 1J0IA 4Y2DD 1S9YB 4ENED 3I50L 4O51A 5MENA 3PXHA 4DW2H 2XG4A 3NA9H 4U1HB 3SN6N 3MXVH 3L3OA 4NKQB 2UY6A 2QQKH 3RKDC 4MJ4A 1G7HB 1IC7H 4S10A 3SEPA 1S5HA 3RZCB 4MNQE 1MHPL 4BSVB 5D6DA 2JJSC 1N0LA 5C0CA 4GKZB 5DK2B 3KJ6L 5JUEL 4OV5B 1CFSB 3IFNL 3JV6A 3O2VL 1DVFB 5LAXB 4G9FD 1A21A 3BPNC 3K1DA 3ZZ1A 3CXHK 4X6BA 5BV7H 4U1LB 3RPKA 2BNRE 4TVPD 4XNQB 2OYPA 2W91A 5A2IH 3QDGB 2QTEA 4TUKL 2ATPA 4ZUWB 1NC4A 3L3IA 5FDYA 4Z76B 3H3KA 1FNSH 1QSED 3ARBD 1KB5L 2PYFB 2ZP0T 1ZMYA 2L4OA 1DQDH 3AMLA 4HT1L 4JY6B 2IPUG 4I3SH 4PTUA 3PIQB 4X99B 1KG0A 2FHCA 3FO2A 3BPNB 4LSDA 3UZEA 4KJYB 5GS0C 4JG0H 2DBLL 2UY7A 3P30H 3EDEA 3QXUA 5IVOA 2P42B 4NGHL 4X8JB 3HR5B 3BWUC 1JV5A 3ULUH 1Q0XL 1MCOL 2GTZA 3NPZB 2ADJA 3IRPX 1Q9KA 4KK5D 4WY7L 4XPAH 1V7MH 5DDHA 4ZPVA 5DQ9A 4E42B 3KXFA 2XXMB 5SX4H 4PRIE 2CLVA 3W9EB 5T33H 4Q6IA 2PR4L 2X1QA 4PJHA 3ULVE 3NN8B 1GZPB 1IBGL 2D7QA 1FO0A 4Q9QH 1IAOA 1XF5A 1NDGA 5IHUH 4C58B 4XH2B 2OBGA 2AK4A 4M8VA 1PW3A 2W0KA 1R3JB 4F58L 4RX4D 4YZFF 3VI3E 2XG5A 3U6RA 2R0KL 1TNNA 3MO1B 4WW2A 5T3XD 1BIIA 1YN7A 1I1FB 3MRNA 1QEWA 4YO0B 3GIVB 1IVLA 1RUMH 1QSVA 2EDLA 4NQDD 4PJFF 4EI6A 4PRAB 4JFHD 3HI1B 2LVCA 1MFAL 5HI3D 5CP3A 2VE6B 3TZVD 3U9PL 3C5SB 4X5XB 2FNBA 5HHME 1VDGA 2J8UF 4KRNA 1ZHNA 4DN3H 1UJ3C 1IGML 5JW4R 4AEHH 3OKDB 4IRSC 5EU3B 3RNKB 3OTTA 1M7DA 5I8OL 4HCRL 4ZS7H 2EZ0C 7CGTA 2QSCH 3FN0H 4OIIL 4NFDA 3L6FB 2WBJD 2J3SA 3KPPA 4YHZL 1F42A 2HKHH 3PWNB 4XBPB 3QISA 1RULL 3OKYA 2RAMA 4OQTH 1CICC 5SV4A 1B6DA 1RZJH 4JKKA 5GIRA 1NAKH 2IANE 1I7RB 3RTQD 3KPRA 4IRSB 1XAUA 3PP4H 4CU8A 1RZFL 2ZUSA 3BAEH 4MQ7B 3IB4A 3VFSA 2NY5C 1NAMB 2EEAA 1PAMA 4LPXA 4PFEA 4N0YH 4XCCL 1LO0H 1NMBH 2APWA 4HUKB 2D2OA 4LRIA 3GSXA 3CSPA 5TDPA 4NIKB 1F58H 4LAQL 2N56A 1YEKH 2CGRL 2R39A 1FE8L 5D1ZD 3HZKA 4X9BA 2GY5A 2I26N 2KL6A 1A9EB 4OCYH 4NHCH 1HWGB 4U6XA 3S97C 4PJ7B 1IT9H 3GHBL 3V7AE 1BWWA 4M6NL 1BD2D 3V6BR 1N64L 4IS6A 5EIIA 2Y1VA 3UTPE 1U91B 2V9TA 3FRPA 3MOAH 3BWAB 5I1IL 1LNUB 3BZFB 4QHUB 1URLA 4HIIA 4BYHA 1AGCB 2CR6A 3C5JB 1CR9L 1DE4B 4HJGA 4JGMA 1P1ZB 2BP3A 4FABH 5T3ZD 3BEVB 4JFOA 3ILQD 1HXYA 3KPSE 1FFQA 5KZCD 3VRLE 3ULUE 4MD4A 2IH3A 4XZUB 4LCCB 3TYFB 2K9UA 3RVVC 3SPVA 3C87A 3SE4C 3T2NH 4KJQC 3QO0B 4XBEH 5DR5L 2J8HA 5IFHH 2J8OA 1C16A 4TVPL 4KI5D 4N1CA 1T3FB 1OVZA 32C2A 1RY7B 1PG7X 1RSFA 5DVKA 3PHSA 1RURH 4N1EA 3HRPA 4XHQA 4G6MH 2R4SH 5CZXD 3BYTA 4L3AA 5T1DH 2W65A 4MDJB 4HWUA 2VOTA 3Q5YA 2VABA 4GW4B 4WI4A 2AJ3B 2O26U 2R69L 3O2WL 4PJCA 2BDNH 4H26B 1R5VB 3JZ7A 1DQML 3NGBC 5B39G 2JKXA 1FL3B 3FOMA 5BVPL 3SCMA 3QUXC 3L5HA 3VXQB 1XCQA 1WSST 1YNKL 3FO0L 3CCHB 5DMIH 3CH1A 3OGOE 2B4CL 3UTTA 4OFDA 4PJBA 1YECL 3ABZA 1KJ3L 1QLEH 3FT2B 1ED3B 1NQBA 5HGBA 3V79C 1CCZA 3QQ9C 2NY2C 2R0WL 1RK1B 4WHCA 1OB1A 4I0CC 4OM0L 3IJHB 2H8PB 3NGBB 3IDYC 4QXTA 3MLZH 3QUXB 5J9PB 3P4MB 2FO4A 4KK6D 3GI8H 2PYED 5C9JA 1EGJA 4Z7NF 2PXYA 1J7VR 1XGPA 3TJHC 1FL6B 1P2CA 4FOMA 4V1DD 4OZIB 5JPNB 3MGOA 2X7LA 1HHHA 2AV7B 4XTRD 3WIHH 3IF1A 5T3XL 3ZKXB 3RY4A 5E8NA 5E94A 1H15A 4YHOL 2NY2B 1I1YB 5DO2C 4XP9L 1IE5A 4PD4J 4NQCD 1SQ2N 2H2SD 1A7BA 3MCLL 1JFQH 5EOCJ 2D03L 3IDYB 1CD9B 4HC1H 4LDOB 3SGKA 4PJ7F 1G0XA 4OLEA 3SBWC 3QFDA 1FH5L 1RZ8A 2IFGA 2Z92B 5C9KA 1OAZL 5C0RL 4FQXD 3FB7B 3JWOL 4Z0BH 2X4NB 2CLZA 3UTZA 2GJ6E 5IMKA 5JXAH 1CD8A 3DRTB 4I77L 1I1AC 1MUJA 2ED7A 3C09B 4L4VE 4FFVC 3LKQA 1FL5A 5BMFH 1JGLL 5T5NG 2GITA 3ARDD 3G6JB 1D6EB 3AVEA 4KMLB 3U2SA 1L6ZA 3FONB 5JHDB 3MFFA 2B1AH 1MLBA 4C83B 4QNPE 4DCQB 2ORBH 2I9LA 3VFVB 3JBG7 1ZSDB 4Q0XL 3OV6A 1I1AB 4J4PD 4OQ1A 1JYVA 1AKJB 2VDQH 1FZMA 5HHNB 3ROOB 3RDTC 4ZFZB 4UNVA 3OL2A 2ADIA 4Z5RA 2B1HH 4PUBL 4MJIE 4DVBA 3TV3H 4KTDH 5EUOE 2YD3A 5AG9A 2V2TA 1R0AH 1A1OA 2YPLA 3T3PF 3OZ9H 5EH1A 1K8IB 3GSOA 4AL8L 3ZDZF 3OAZH 4TUOA 1QSFB 3ZT6A 4OZ4A 1RIUH 1BLNB 4RMSA 3PWPA 5TE4H 5D70H 3MV7A 5IJVA 5D7SL 1R5IB 4K71C 3T2QA 3NIDE 1MH5A 3FL7A 4HS6A 4P4RA 3LQAC 3RDTB 5KSBE 2QKIB 4YNYB 3MLUH 2BXYA 1K9TA 3QXVA 4F8TA 2VXQL 3GNMH 3ROLB 4DOHE 5CP7B 1N5AB 3D1MC 3OMZA 4NM4L 3U46A 1UVQA 2F15A 4X6FB 4P4KA 5DRXA 2NXZC 2VDPL 1GGYA 4OCSH 5H2BA 4MB5A 4PJIA 4K71B 1ND0B 3ALXA 4O5LH 3RVWD 2BNQE 2R2BB 2X4SA 1YN6B 3GMOA 2CKBL 3WMSA 1AQDB 3K2MC 4YC2C 2AEQH 3CZFA 4HLZG 4P2QD 3WXVL 4OB5L 4X80H 3BX7C 3ILPA 4R2GC 1C1EL 4LCWA 2CO7B 2CLRA 1HNFA 5IB5B 2YRPA 2LU4A 4PJ9C 2DTML 4XNXH 1MRCL 2W60A 3ARED 3R0NA 2NXZB 5HI5C 5MEPA 3MMEB 5EPMB 3MLTB 3VGAC 4QRRE 4MD5A 4LKXB 4G42A 5KG9B 4QTHA 3NZ8B 5DA4A 3PDGA 1MCHA 4L8DB 1UM5L 4XC1L 3VFMB 4YC2B 3HTLX 2NW3A 1QR1A 3MXWH 1J0KA 5BZDB 3DV4A 5JXEA 4R2GB 3INUL 1DEEB 2F5AH 4PJ9B 1T1XB 3V5DA 4PR5B 5F6HJ 3RGVC 3VJ6B 4AM0B 4OKDA 3VGDA 4ELKB 1WAAA 3EYOB 5JOFA 1QFWM 1EHAA 4CADA 1SJXA 2W1NA 3VA6A 3VGAB 1WUNT 5IK3A 3FB5B 3K7UA 1PY9A 5HDBE 1UCBL 1A7NL 1IGIL 4JM2A 1T5WB 3G6JF 5E6IA 1E4KC 1KXTB 4S1DD 4XPGH 3D39B 3IDGA 2NY1B 5JNYA 4WWKC 4XB8A 5I76B 3V52L 4M1CD 2D7MA 5FUOH 4C57C 3KWWB 3O6FA 4LK4A 3QDJD 1KPUB 4KQ3L 2R1YB 2EH7L 5IB2A 4Y16D 3RGVB 4JFFA 3SQBA 5I2IA 3TN0D 4JHWL 2AXJA 5FKPB 3IDMB 3GSVA 3PV6A 2E7LC 1NMAL 4LBEB 5DQDL 1SJVA 4PRPE 5LGJA 1GYAA 1L9NA 3MLSL 3QA3B 4JG1L 3HG1A 1S7SB 3P11L 3KPMA 1H3PL 3GMPA 2OK0H 5JIHA 3MV8B 1LP9E 5F1NA 3UAJC 5EU5B 3RWGB 5DJAB 2BVPA 4WWKB 5F7EH 3QQ4B 4NKIL 1F8TL 1JGVH 3SOBH 1U8LA 2K7QA 3DIFB 4KWUA 4OGZA 4U6VL 2XT1B 3PJSB 3CLFL 4Z7WA 1WTGT 3WNOA 1TJHL 3NH7L 1I4FB 3EO1A 1OHQA 3UTSB 1HI6A 4DGVH 5DHVA 1AGEB 4C55A 1G7JB 2XWTB 4HIHA 3WS6C 2DQEL 3CFIC 4K9EC 4FZEL 3QIWB 5DJ8A 3FO1B 1U8OA 2X4RA 3PABA 5EOQL 5F3BA 1WWWX 2C26A 4PG2C 4JRYE 2O5XH 2NTFA 3SGDH 5TFSH 1MFCH 4RMVA 3U1SH 3RX5A 4BKLA 3FB8A 3MRBA 5JIKA 1WF5A 2DQDL 5D1QA 2H2PC 1HQRB 1WBYA 4NJAH 3DI3B 2PF6A 3SDAC 1O5DT 3MBXL 2A74A 3L1OH 3DECA 4ZD3L 5CEYA 1F90H 2ESVD 5E8OA 3H6JA 1CLYL 4MNHA 5JA9A 1D3CA 4X83A 3T08A 1CT8B 3D2UD 1BQHB 1AGBB 5HHXL 5FIEA 1ZVSA 4I3RL 3GJFH 1ZHLB 3HZYB 4XPTH 1DN2A 4NPYA 1CDYA 4DFHA 1V7NH 1UM6H 3LH2L 4ZTPL 3I2CH 3N1GC 1ZT7A 4JFXA 4OFYA 5IW6B 5CD5D 4ZS6D 3HPLB 5B3JF 3OG6B 4G6FD 1WZ1H 2VLME 1P4BH 3MRLA 3QDHA 3SDAB 5FA3A 4LF3A 4X4YB 2BVQA 1OM3H 1HXMA 2AW2A 4OLVH 2RQ8A 5FV2A 1T4KA 3OAUH 3GJFK 2R4RH 5C86A 1CG9B 4WEBH 2ID5A 3HHRB 1WEJL 3VXMD 5LWYL 5DUBB 2B39A 4WUUE 5JQHC 2Y23A 1T7VA 4EDWH 4BSJA 1B3JA 4G8EB 3KAAA 4UV4H 3TBTB 1NJ9B 1F00I 1TCRB 4X9IA 4F8QA 1OQOA 4B7LA 4OF3A 4PV9B 4NNYA 1SY6L 4NZTH 5C07B 3RWDA 2ILLA 4HBQA 3QIUA 2HT4D 1TCMA 4KUCD 5HGAA 3HE7A 5ACZB 3QG7L 1HYSD 3QFJE 1YDPB 2YOCA 2G75B 3HNVH 5E03A 4HGWA 4GAYA 3KHQA 2P5WB 3MRDA 1I3VA 1EO8L 1S7RA 4FQQA 1MOEA 3K2UL 3BEWA 1E4XH 1A6TB 2FSEA 4TNVF 1KBGL 3I02B 1EVUA 1GOGA 3MGAA 3FFDB 5C0JA 3IFLL 5E56A 3JV5A 3LMJH 2FX8L 4ZXBC 2P44B 2AJVL 3LPGA 5DTFA 4IEFB 3KPQA 5IB3B 2W92A 2EC9T 3DJ9A 3V4UH 3RPIB 4JQVA 3TNNB 1HKLH 3QEUB 3U0TB 3D18B 3D0VA 3G6AA 2R29H 3V4VH 3ZYIA 5CILH 3T3ME 1RFDL 1O0VA 5F7LB 4FFYL 4C4KT 1GGBH 4MMXC 4ZXBB 1TETH 1F4WH 5SWSE 4EN3A 4HUWB 4BUHA 4NZDA 1Q94B 1N6VA 4P5TC 5KS9F 2GYSA 3JTTA 1I9JH 1U3ZA 2Y6SD 2X6MA 4WO4D 5M95B 3QWOA 1CBVL 2Z0BA 5EZLB 4HIXL 4M5YL 2FYYA 5E1AB 2BNRD 4J1UB 3BYYA 4JR9H 1IQDB 3MRMA 1NKRA 3EHBC 4UDUA 4GRMA 5IW1B 5EBLA 2ITCB 1VB9A 5EN2A 4F9PC 1UWGH 4YWGH 2IEPA 1MFEH 4WTWA 5CBEB 3WBDA 1OLZA 4ZO7A 5SWQA 2FIKB 4J8RA 1MQKH 3ZDYF 3IDJA 3MCKA 2I9TB 3X12A 2VLKB 1P84K 1MWAH 4X6DE 3OKEA 4XP5H 1FAIL 4FTVB 2EDKA 4F2MA 5IQ9B 1SMOA 3V6OA 3VFWA 5I18L 2NR6D 1NSNL 2NY7L 1IEAA 1NGYB 1ZLUH 4OUUB 3D87B 1W0WA 3SDCC 5DT1L 1MI5A 1NUNB 4H8WL 4PY7A 1J86A 2E7CA 3PWLA 1UYWH 1OTUD 2UVEA 1KACB 1PG7H 1QFUL 4PJ5B 5FKAB 4BZ1H 4J3OC 4JN2A 5ITBL 2ICWA 4O2FB 5D6DC 1PYWB 4NQVB 4Y1AB 1YY9D 4XBGA 5D96C 4LRNL 1AI1H 1MIEL 3RWFB 3LKRA 1AY1L 4YUEH 3UC0H 3SDCB 2ICEB 1JRHL 1PBYA 2I60H 3EOBA 4K3EH 4O51B 5HDQL 5MENB 3D3VB 3PE9A 1EPFA 4OJFH 1MJUL 2ZKHL 2DM2A 2OI9C 3E2HC 5CJ8A 3L3OB 5KSVA 3GK8L 3S35X 2HRPH 2OZ4A 3WKML 4BJLA 1S5HB 1NCAL 3HC4H 2A9NH 5C0CB 2R1XA 3H7BA 3HMXA 5D96B 3JV6B 4WGWB 2K1MA 5L0QC 1KJ2L 2IFFL 4GW1B 4XAWH 1JGDA 5TF1H 1F4YL 3WFEH 3T0ED 5HHOD 1ZHBB 3RAJH 4X6BB 43C9A 1N6QH 3G08A 3V0VB 2ATPB 1PG7W 1NC4B 3L3IB 1A6UH 3BO8B 4HPOH 2OI9B 3E2HB 4HK3N 2YS4A 4YE4H 4KH2A 4XP6H 3GBML 4CW1B 2A9ML 5AZEL 4WENB 4QF1B 4WFFE 3WNNA 3GI9H 5L0QB 4PTUB 3GZKA 3TYGH 4R96B 3FO2B 5D7KD 4O58H 1K2DA 1AXTL 1EFQA 4LOUD 4R26H 4NC0B 1CVSC 2QSVA 4UB0L 4D94A 5I1GL 4MQXC 2Z31D 4TOYL 2BOBA 4UV7L 4AY0A 3O41A 1YPZE 2ADJB 4WUKH 1Q9KB 4Q7DA 1BM3L 4ZPVB 4WW2C 2ZUYA 4F7CA 1T1YA 3C6LC 4QY8A 3VWJB 2CLVB 4OM1L 2VLJD 4UINH 3MODH 4PJHB 3GSNA 5A16B 1BOYA 1GGCH 3AFLA 5JW4N 1FO0B 2ZJSH 3RVTC 1FGVH 1NDGB 3VFOA 2DQHL 1L7IL 4KK9D 4MAYA 4WFED 3VXRA 2AK4B 5F1OB 1RK0A 4POYA 4PGEA 3B3IA 1ZGLM 3ES6B 3U6RB 5DEGA 1LHZA 4WW2B 3C6LB 3MRNB 1GPOH 1QEWB 3WCYA 4F15C 3MRPB 3MRJA 1OAQL 2X9XA 2RCSL 4X9FA 4MS8D 1F4AA 3RBSA 2OTUA 4XCYA 3ARRA 5C0GB 1X5LA 1ZKAA 2QEJA 3SDYH 4Z7UB 4PREB 3O2DL 1P7QD 5CINL 1RZKH 3KYNB 2WANA 4LIQL 4DKFL 1MNUH 4KVNL 2ZCKH 4YFLF 4Z95H 5F1IA 1XGUA 3GSWA 5E08H 1EBAA 4PLOB 4URTB 3KPPB 4F15B 1BQHG 4KV5F 1S7UB 4R8WL 1LQSR 1RJZA 1X5ZA 4N8CL 3D9AH 3N1FC 5GGSY 2AJZA 5A40E 4LRIC 5L9DH 1KC5H 3VFGL 3GDBA 4OZGF 4MXVF 4N9OB 1MAJA 5GIRB 3GB7A 5J0BA 2Z4QA 1S8DA 3CFKA 3TT1H 5I1LA 1KN2L 3KPRB 1I8MA 3H42L 2AQ1A 1EV2E 3O0RL 3GMRA 4M00A 5JOPE 1KYOJ 4HAGA 3M07A 1UB6B 1FNGB 5DHXB 4XNYH 5TDOA 3IDXL 1HOCA 1CD0A 2AABL 4M62L 4XWGL 4HKJA 1ZGLP 2OL3H 4IM8A 2R9HD 3VFSB 4YQXL 1EUTA 5CCKH 3QUKB 2VKXA 1YEEH 1G9NH 1AO7A 2MNUA 1F11A 3GSXB 5TDPB 3VXSE 1ZT1A 5FYJH 4FS0A 5FM8A 2NTSP 1S78C 3WFHA 1UACH 4OGXH 4JFDA 5F3HA 4ZTOH 3VDBA 2HFFB 2J6EL 1ZHKB 4N8VG 2C3WA 1I7UA 1DQQB 4WI8A 4CVXA 1FYHB 4RFEB 1MREL 2V5TA 3PGCA 1BJ1H 2EECA 3MRCA 1A3LH 4JHBA 4L8SA 4ZYKA 5ANMA 4ZSOE 2WIMA 4JCLA 3FOLB 4QOKD 5EIIB 4IS6B 3OR7A 3VWKB 4HD9A 4Z7VE 5FV1L 4L5FL 3VH8A 4RAHA 1CFBA 1SM3L 2XQYG 3U9UB 5TJWK 4LMQE 4HIIB 1H5BA 2VDNL 1X44A 4HJ0C 4KXZI 3OJDA 5FYKD 5ACLA 4PB0H 2P8MA 4A6YH 1YEDB 5KJRL 3BE1H 4JFOB 4QLRA 2AP2A 3RKDD 1F3DH 1HXYB 4LKCA 1N5YL 4MD4B 1BQLH 2IH3B 1TENA 3WS3A 5CHNA 1DUYA 4MMZC 3SPVB 4XNMB 3B2UC 5LXGL 4P2RA 2CIIA 5IG7A 2JB6B 3E6FA 1C16B 4NZUL 3S88H 4JFQA 3GBLA 3SCMC 1H3VA 1FPTL 4NWUH 1DL7H 3BD4A 3OB0H 4L4VD 3S5LG 1JK8A 2BRRH 5D2LB 1CS6A 4QT5A 4M43H 4OBRA 5HPOA 5KAQF 2YWYA 1XGRA 1K3ZA 1ZLSL 4OD3H 4XMLL 4PBWD 2VABB 3B8SA 5I17B 4Z7UF 5ERWA 5GS0D 5FM4A 1BWMA 4NBZB 4G7VH 1JHLH 1X5IA 4PJCB 4MJ6A 3QEQD 5DK3A 4HXBH 3OB0K 4MXWH 3CVHB 1U58B 3FOMB 1EEZA 3LV3A 3I6GA 5DLMH 5I30L 3HFML 1OPGH 5JW4M 3WUZA 1LDPL 1KGCE 1XCQB 3MZGB 5D5ME 3DGGA 2X9WA 3H3PH 4NQXA 3CH1B 4MJID 2BNUA 4XCFH 1V3LA 2VL5B 4PJBB 3WFBH 2PXYC 1ONQB 2BK8A 3WL9A 4JFPB 5DVLA 3C6SA 1YC7A 4JPVH 1ES0A 2WP3T 3DVFA 3NACL 5T1KD 2FL5B 4Y5XB 3UPRA 5F9JB 3LIZL 1OB1B 4LLDA 3OHXB 3GMQB 1F45A 1FNSL 4UDTA 4QXTB 3TNMB 3SGKC 2FO4B 2EDJA 3L95A 4PRHD 3BGMB 4YGVA 1LO2L 1YEIH 2PXYB 1MLCA 1XGPB 4G8GE 5DGQA 3MGOB 1B4JL 2EO9A 1HHHB 2MFNA 2X7LB 3G6DH 2WLYA 5E8NB 5E94B 1H15B 1YA5A 5EWIH 1RHHA 3UPAA 1ZWIA 3GMMA 4UTBH 1AGDA 4HS8H 4HUVB 1A1NA 2FJFA 1GAFH 2W9DL 4PLJC 3BI9X 5DJZA 5FYJE 3BIKA 4NCC2 1TTUA 4WIQA 3QFDB 4ELMA 3R06B 1MCKA 5T33L 1OP5H 5TE7H 1KLUA 5FHBH 3UTZB 3PHOB 3BMWA 2VXUH 2ZCHL 1SJEA 3T09A 4V2CB 1MUJB 2CK0H 4GS7B 2FR4B 1WC7A 3I85A 3LKQB 1CICD 1FL5B 4B53A 5IOPA 2GITB 1G1CA 4GRLA 1MJ7L 2BY3A 5BCAA 2CUIA 2VLRD 3MV9E 2OR7A 4ZFFA 5BOZG 5DFTA 1MY7A 1S9XA 3U2SB 2W9LA 4LCUA 1CL7L 4NOBA 1ZA6B 3MFFB 2VQTA 2VNCA 1B9ZA 2C1OA 2F54E 1UZ8A 2I9LB 2NXYD 1JHKL 3ZTJG 1QA9A 3WIIL 2O5ZL 1KELH 4WW1B 5FFLA 4S0TD 2ADIB 3CAFA 4Z5RB 5DFWH 4DVBB 5D2LF 3MJ9A 2JJVA 2V2TB 3QBTB 2F19L 2HJFA 1A1OB 3HUJA 3W82A 2KZ1B 2F74A 3GSOB 1PFCA 1RI8A 4M5ZL 4TUOB 3QNZA 4OZ4B 4P4KC 3UBXG 3PWPB 1ZLVH 3K3QA 1HYRC 5IJVB 3IFOB 3PL6A 4YDVA 4HS6B 1T2QL 1KUMA 3A6BL 4M1DL 2APBA 1Z0MA 3OKNA 4XMPL 4PIRF 4PRPD 3MOBL 4XXCC 3KYAA 4OLXH 2XYCA 1AFVL 4RGOH 2ZUXA 4S1SH 4JFZH 2GIYA 2BVOB 3MRKA 5ADPL 5I1JH 1H3GA 5FYKL 5EC1B 1UVQB 3BSZL 4P4KB 5DRXB 5I1EL 3HMWL 4KKLD 2VC2H 3G5VA 5H2BB 1KIRA 5BRZB 1LO0L 3O4LA 4PJIB 1AP2A 2DLEA 3DRQA 4HWNA 4F57L 4LCYA 1GJIA 1KCUL 3WHE1 2GSIA 1MJJA 2VQUA 2AEIT 2VDKH 3ZHDA 1EGJH 2UZIH 1UGNA 3QZWA 4KJQD 4NN6C 3O11B 3CZFB 4DKDC 2C4XA 1NFDA 5JXEC 4DZBA 3ILPB 1CIDA 3MJGX 1NANH 4LCWB 2CLRB 3U48A 2GJZA 4I5BB 5DVOA 5KAQG 3MLVL 3UTOA 4XT1C 1EFXA 3EYUL 4FQ1L 3CX2A 1XMWA 4P3DA 3VFRA 4MD5B 3DROA 4G42B 4W81A 4QTHB 4JM2C 3MA9H 5E6IC 4LLQA 1INEH 4NN6B 2NW3B 3ZKNC 1QR1B 5CIPA 3BZDA 2XZAL 5GS0L 2DQFA 3PWUA 1E4WH 2WUBL 3QCUH 1X4YA 5ESVB 3O6FC 1P4IH 3QUXD 2AVGA 5CZVH 1PEZA 5JORA 2AJUH 1F02I 3WIFA 5JOFB 3DLQR 5IVXA 4CADB 4QRPD 4KTEH 2BHUA 3EGSA 4XWOC 3U7WH 4JM2B 3NBNA 2NY2D 3WHXA 5E6IB 1ACYH 3NCJL 3LEXA 5DD5L 5H94B 3QPQD 1N4XH 3MV01 4KGJA 3O6FB 1RURL 3BD5A 3GJEA 5EU7E 5IB2B 1AR1C 4PJDF 4JFFB 5E1HB 1GC1C 1MHCA 5DHYA 5I2IB 3ZE2F 3PV6B 3HI5H 3TJHD 5LGJB 5I8CB 1HHJA 1JWUA 5IGXL 4L3EE 3HG1B 3S36X 3KPMB 1KIPA 3GMPB 3FAXA 4HLZH 4HV8A 4PY8J 5F1NB 3S35H 2EC8A 1RUPH 2BVPB 5AWNH 1A3RH 3QQ3A 1DBJH 4UTAH 1FJ1A 1NPUA 3AROA 2GTWB 4YK4C 4YZFE 1DBBH 1EUUA 5DMIL 5F8QC 5IW3A 4Y4FB 1U8LB 5D1QC 4Z7WB 4BQ6A 1T0NA 3FRPG 3X3GH 5HY9A 2EH8H 5KVDL 1HI6B 4PJFE 1FYTA 3LKPA 4N8PA 5IEKA 4NCC1 3WJLA 5F8RC 1ZANL 3U7YL 2YD7A 1I1AD 4WNQA 5DJ8B 1TPXC 2GT9A 3TT3L 3HKFA 4KRMB 3CMOL 1U8OB 2X4RB 3PABB 5ALBH 1T22A 3W9DA 2FEDC 2J8UE 3WEXB 3BESR 2NTFB 4X7TA 5DJCA 1L0YA 5FUZH 4YK4B 2I24N 2CH8A 2VXTL 4P46A 5EO1A 3MRBB 4AEIH 4ZNEE 5D1QB 1GHFL 2MTPA 1NC2A 1WVZA 2AKRA 3SKMA 4YDKH 3WIHL 2A74B 4MHHG 2HFGH 5SWZB 3WFDH 5E8OB 1R5WB 5D7IA 5IESL 3WFZA 4IRZL 1KB9J 5DEZA 5EOCH 5SWSD 1K4DA 1JWSA 1UENA 5ICYB 1ADQL 2NY5L 3TO4A 1ZVSB 4K7PH 4E5XB 4GFTB 3W39A 4NPYB 3V6FA 2IGFH 3L3HA 4JFXB 1IKFL 1U8JA 5IB4B 3DX7A 3MRLB 3QIUC 5FA3B 4LF3B 3L7FA 4F7EB 3QDGE 1U93B 2BVQB 1U36A 1I85A 3HE7C 1WITA 2VZSA 3PQYA 4N0RA 5BQ7A 5GS3A 3N1QC 2Q3ZA 5BMFL 2Q7NA 3IDIB 4K2UH 3BUYA 3LEYH 4QXUH 3U0PA 2Q8AL 2PTUA 4G6KH 5FO9A 4UQ3A 4JM4L 2IBZX 4OF5A 2R8SH 2YPVH 4KHXL 4X6CA 5GZOC 3HZVA 3NTCH 1T03H 1ZV5A 1UQSB 1Z6JT 4NNYB 1YUHA 2FB4H 5HVGB 4WFGE 2Q6WA 5C09B 3RWDB 2ZSWB 4OCXL 3QIUB 4M3JA 3HCVA 3IS1X 2NXZD 2FJHA 5A1AA 5L7XH 4YDLC 4I13B 1I7ZA 5T1MA 1NGQL 2E8YA 2AJSH 4GAYB 4HGWB 4N90E 3ZL4H 2NX5D 5BZWA 4FQQB 4GLRH 4CVUA 2W0FA 3BUTA 3QXTA 1A9BA 4OGYL 1CQYA 4ZQKA 2FSEB 5C0JB 4HF5L 4YHNA 4PJ9D 1IGYA 3KLDA 1A6ZA 5BJTB 2A0LC 3CX5K 5DTFB 2CKNA 3KPQB 3STZA 4YDLB 4RISH 4XPFH 2A73A 4HG4K 1YEHH 1SEBA 4OCLC 1MF2L 1FVCA 3QNYA 3VXUB 3G6AB 4GKSA 4G6JL 3D39D 3DXAE 4K07A 5CMAB 4OIAA 2BXZA 5KANG 1U95A 2FX9H 1WFUA 1F6FB 1A14H 2VXSH 4HDIA 5C2BL 3RGVD 4JRXB 4O4YL 3B6SA 4QEGA 3P0YL 1CDCA 1WT5A 4P23B 5IT2H 2WSKA 3JTTB 4FMKA 3MV8D 4XPHH 4JO4H 4WVRA 3QWOB 3DHJA 1VGEL 5GGRA 4Y16A 4M7JL 4WWKD 1BAFH 3V6OC 2LABA 4LSQL 5IFAL 4GG6F 3QIBA 4JHAL 5EN2B 3VXOB 2X4UA 5JQ6L 4MCZB 4S1QL 3UTSD 4LNRA 5SWQB 1RZ7L 4J8RB 3KPLA 3IDJB 4QGYA 3MCKB 1P7HL 1H3XA 3UAJD 1BEYH 1MQ8A 4GRWB 3UYOD 2IALA 5FO8A 1NUGA 1QVOA 1Y6KR 3DX9A 4HWBL 4GMSL 2VITA 1KCVL 1SEQL 5GISH 4JO2H 1U92B 3K1KC 3LS5L 1DLHB 4Z7NE 1IEAB 4RSVA 3H9HA 3NCMA 4G9DA 2EYSA 3WO4B 5L2KD 3ZYOA 1W0WB 5SV3A 2Q8BL 1PD6A 4PY7B 4DN4H 3PWLB 2FBJH 4NO2A 3ZT7A 3FQWA 3I75A 2HWZL 2P43B 3FAWA 4JN2B 2GEEA 3AAZA 4PJ7E 2ICWB 1ULVA 1BGXL 2XKNA 3DO7A 1LMKA 1U3HD 4OD1L 3RIAF 4XBGB 1P7KA 5C2UB 3VFTA 5ACMA 4IBLT 3LKRB 3SDAD 5HGDA 4UIMA 5BOPA 3VD9A 1MHHB 1DEDA 3F7QA 3WN5A 1MPAL 4E9LA 2GK0A 4G3YH 3KR3H 5ITFB 5TE6H 4ZOBA 2ZG3A 4NQTA 4POZD 2NY0B 5KSVB 1I3GL 3UJTH 3NCCB 1KLFA 1V3KA 3P2TA 4YXKL 2R1XB 1ZS8A 2DQCL 3H7BB 1CFTB 1OAKH 4KVCH 5C07D 5EZJB 1JGDB 1UXSB 1AC0A 43C9B 4LLWA 4H5SA 4XRCA 3UJJL 3G08B 2HLFC 3CK0L 2FD6L 4PJGA 5E4IA 1MFCL 2P5WD 1R3HA 2NY3D 3S4SG 1KFAL 3LQAL 3T3PE 2VN7A 2H32H 1N7ML 4WEUD 1FSKB 2Y06L 4JJ5A 1UCTA 3ZDZE 3ARZA 4ODHL 1JTOA 3HI6L 3FT3A 4X5WA 4NNXA 3HB3D 1GRWA 3EO0A 1NGPH 5JOPD 1F90L 1YMME 4RWYH 3MUGA 1K2DB 1P53A 2JJTA 4CN4A 3S34H 4U7SA 4P59H 4OLUH 4CN6A 3JTSA 3RFZC 4MAYC 3A6OA 2BOBB 2YD6A 3O41B 1EJOL 2P47B 3I2CL 4Y4HD 4Y19A 4OZFG 1N26A 2HH0L 5DJ2A 1I8IA 5JLZA 3F5WA 4U2ZA 4QY8B 3IKCA 3J7HA 2GSGB 2N1KA 1QRNA 4OZHA 4NFBA 5C7XL 3OAUL 3GSNB 2R4RL 1VHPA 1U6AH 5HI4C 1IFHH 3IDUA 4OTXL 1LE9A 3VFOB 5JTWA 4YDJA 3VW3L 3C60D 3CXDH 2J5LB 2QR0B 1JPFA 4PGEB 3B3IB 4FXGA 4F7PA 5DEGB 3QSKB 4PJAF 3PP3H 3D25A 3T8XB 4OF6A 4PP1C 3MLYH 5L2JA 2GCYA 4MNQA 1A0QH 3CGTA 2EXWD 2OTUB 4DWHA 4LPUA 1S7WA 4M8QB 1QLRB 4XCYB 5GJTH 1L0XA 4OLZH 1W72A 2WWMC 1OAXL 2Z35A 1YJDC 4P5TD 3FRUA 4FP8H 4UOJA 2BNRA 3DUUA 1R24A 5J57B 1XIWA 2M8XA 4Q58C 4PJ8B 4K8RH 5F1IB 2C1PA 1XGUB 3GSWB 1MCJA 4DUVA 5C08B 4OF7A 1LEGB 4MCYB 4APQA 1J05A 3NPSC 2IJ0C 4HUXA 2OZ4H 4XVTH 2AJZB 4WI6A 1HKLL 3WYRA 2ICWJ 5FHAL 3SGJA 3G6JE 3GB7B 2Z4QB 2DF3A 4DUXA 1J8KA 2R29L 4K3GA 4RBPH 5I1LB 1I8MB 4PJ5D 1AJ7H 5JHDE 2NCMA 1JMZA 3GMRB 5LQBH 4QKXB 5CJQH 2NLJA 4UILL 1PEWA 3BOVA 1KCSL 5TDOB 1HOCB 2JF1A 4KI1A 2NYYC 4HKJB 1CN4A 4JREC 4AYFA 1YYLH 4Y1AD 1TVBA 5I71C 1KGCD 4PRIA 3NPSB 2RR3A 4IMLB 3C9NA 1AO7B 1GOHA 3SDCD 2EDWA 3D85A 4MZ3A 1ZT1B 5MEOB 15C8L 4JFDB 5F3HB 5MEND 4QWWC 1H5BC 2KPNA 4HK0B 3MFGB 1CDIA 4K9EL 1QSFE 4OBSA 4K7FA 4RFOH 1FNLA 4HK3J 1JHTB 3PGCB 4U6HB 1KCKA 3U0WL 2GQHA 5I1KH 1MFEL 4M03A 3G5ZB 4JREB 2MWCA 4DQOH 5I71B 2D0FA 4F9LA 3M1BA 4ZYKB 5ANMB 1C08A 5BO1L 4FQ2L 2MCPL 3OR7B 4HEME 3VH8B 4LQFH 4ALAL 2A1WH 1MWAL 3WFCL 1TJIL 1H5BB 3FO9A 1NC4D 2IAMA 3OJDB 3IU3A 4IDJH 1Y6MR 1RJLA 4DZ8B 1PSKH 4PYHA 3S36L 3SGEI 4G9FB 3MV11 4P3CL 4UQ2B 3CSYA 3SE8L 1LK2B 1DUYB 1HH6A 5GQBA 2OX5A 1UYWL 4PB9L 1D6VH 5I1DA 2DLFL 3UYRL 4HWZB 3ARSA 1G6RH 2CIIB 5IUSA 4TQEH 4BZ1L 2F9BT 4JFQB 2FH6A 1U42A 3BP7A 4KK5C 3ARBB 2C5DC 2IANA 3KDMB 5FM5M 4LPTA 5I1HH 4ODXB 1TVDA 7FABL 1DBMH 4QT5B 5B3JE 3ORJA 4W6YB 4RFNC 3NZHH 3KXFD 4FXLA 1DQJA 5CZKA 1XGRB 1YEGH 1F6LL 5K9QG 2FWOA 2IBZY 5FB8B 5ERWB 4NC1C 3NOIA 4MJ6B 2VQ1B 3O3UN 3LKOA 4OJFL 4QXGH 5F96L 2J2ZA 3LV3B 2AK4D 4U1GC 4LCIL 3DGGB 5L6YL 4NQXB 2YD2A 3EDFA 3ULSB 2KKQA 4ISVB 3RZWA 1B90A 4JDZA 3WL9B 1EAPB 5HI3C 3VD5A 4UT9H 3C6SB 1VFAB 2D0HA 5EOTA 2CO6B 1UH2A 4KMQA 3SJVE 3UPRB 4X7SL 3X14A 4G8FA 2VAAA 1U8MA 3RVTD 4UDTB 4Y8DC 4LSRL 3TIEA 1HEZA 1DSFH 1IAIL 2DJUA 4U1GB 4WU5A 2YRLA 4AG4L 4NKMA 4IMKA 4BQBA 4NQDB 1G7PA 1MLCB 4MVBC 5L8KB 4WHYG 4U6TA 3KPSA 1PJ9A 4O58L 3RA7L 1D5IL 1V5JA 4ODSL 4TPRH 5TH2A 1ZWIB 3GMMB 3T65B 1T04A 1AGDB 1JZ6A 4K94C 3K8MA 1T20A 3SDDD 4BZ2L 3LN9A 4UOW0 3EOYG 1J1OL 3WD5L 2IG2L 3BIKB 3KPRD 5IKCA 2W0PA 2WBJB 4ELMB 2OSLB 5HYQA 4Y89A 1ZTXH 3OQ3B 1KLUB 2VN4A 1JZ8A 3S37X 5I15H 1XR9A 4HWEH 2XN9E 5DRZA 4LSSH 2DQJL 5F7DA 3WJJA 3GKWL 1WC7B 1NCDH 3MRGA 5IQ7H 5KS9E 1U41A 4OCRL 5IOPB 1NLBH 3MLRH 2FX7H 4R9HA 1BBJA 3MZTA 4ZFFB 2QQLL 1S9XB 1PQZA 1I9EA 5DJ6A 4ZFGH 5I75C 3HNSH 2C1OB 1UZ8B 1UKQA 1OT2A 4JPWH 1FCCA 2ENSA 3PL6C 4BFIA 1G9MH 3ZDYE 4GW5A 5AD0A 1EXUA 5E8DL 5D1ZB 2R0LH 1S78D 5JMOC 1GGIL 2HJFB 2A6JA 4KPHL 4OQTA 2F74B 2MOVA 3RGHA 4ZDHA 2JCCB 1WWBX 5I75B 1E28B 2HTLD 4X4ZA 5E99L 4NJ9H 2EIEA 2V17L 1EHLL 5EB9A 1KC5L 4OD2A 4YHML 4M6MH 2IMMA 4L9LA 4YDVB 5IIEA 4PTTA 1EMTH 2KDGA 3RWCA 4PJXF 2BERA 2Q86A 2EE2A 3CUPA 4PG9B 4X0KA 4GMTL 2Z93A 3MREB 2ARJB 3C8KA 4XNYL 3NCYP 4LASL 2FDBP 2Y4SA 1KLGA 3QRGH 1NCWH 1FC1A 3ZO0A 3P9MA 4ONFH 2PTTA 2CKBB 5I73B 3G5VB 1KIRB 3DUHA 3O4LB 4HUNB 4P57A 1AP2B 5HHQA 3DRQB 1XF2A 1FG9C 4LCYB 2GJ6A 1DLFH 2E5EA 3IU4L 4JQIH 3IJYA 4LP4A 4BH7A 3QZWB 5IM7A 2BHZA 4YXLH 5MP6H 4D9RE 1T7YA 4F33A 4L4VA 1NFDB 4FNLL 5JW3H 4RAVA 5AYUH 4NQSA 3SCMD 1QQDA 4NQUA 2GJZB 4XNZC 4ORGA 4JVWA 3O6KL 4BUGA 1EFXB 1IILE 3P9LA 4K23H 3UTTD 4Z77A 4P3DB 3VFRB 5D6CB 1I8KB 4GH7B 4MB3A 3B2VH 4PRNA 1BBDL 2QHRL 1AGFB 4FQIH 4LLQB 2V7NA 2RFXA 5CIPB 35C8H 4M1GL 2DD8H 1F3JA 2DQFB 3PWUB 4XVSH 5HDLA 1FO0L 4KK6C 4MJIA 4JN1H 4KHTH 1K6QH 5EUOA 3O4OC 4XNZB 2YKLH 1YMHB 5JORB 5KVMC 1R6VA 4ZFOA 2VSCA 12E8L 2OR9H 4XTRC 4KAQH 3WIFB 1BHGA 1A8JH 2G60L 2PXYD 3IFPB 3JXAA 5T1KA 2VSDA 3EGSB 1W0VB 3LHPH 3DGCR 4AMKL 3GO1L 3KNBA 1CK0L 3WHXB 2N7BA 5B38A 2X4PB 4MJ5A 5M7QA 3IDNA 5EUKA 5KSBA 1A4JA 2AJYH 4N0UB 4I18A 4FXKA 4WFHE 5D72H 1UWXH 3GJEB 4ZUSA 3O4OB 4M43L 1Q72L 4V1DB 4PS4L 1BZQK 5DQJA 3X3FL 4DGIH 5FYLH 1FN4A 3TBYA 3VGFA 1HHJB 5ID0A 2XI9A 2DS4A 4HPYH 4NQCB 2VLKE 3WJLC 1KIPB 2XRAH 1T7WA 1TNMA 1F4HA 3T2OA 3BQUD 4FTVE 3K8LA 2BNQA 2JCCF 2V2WA 4DKEH 3QQ3B 4PLJD 3C08H 4QRSA 4EIZC 2OJZL 2AEWA 3MGTA 5ECJE 2P1YA 4P46C 4XCFL 4YHLL 2ZPKH 1XCTA 4D9LH 5FYKU 4U1NB 1T0NB 4KDWA 5IEHA 5ID1A 5HY9B 4ONOA 4J4PC 1IC5H 4KUZH 5IEKB 1RMFL 3DETD 2OM5A 1BZ7B 3BMVA 4M6OL 4WNQB 4QRRA 3HZMA 2GT9B 3OKMA 1EA9C 4F37F 1LD9A 2H9GB 3LAFA 1T22B 3W9DB 5IBUB 1NBVL 1ERNA 5TPWL 5TQ2H 2EDNA 1OWWA 4LEXL 5DJCB 4CVZA 4P46B 5GPRA 1RV6X 2YPLD 5EO1B 1ZEAH 3L3DA 3BP6A 1NC2B 2AKRB 3SKMB 1WFOA 3DXAD 4J12A 3P4NB 5HTSA 1U3YA 1JL8A 4HC1A 4KV5E 1HH9A 4WCYH 3PWPD 4KI5F 4R7NA 1I85C 3D3VE 3MV7D 1QFWI 5D7IB 5EFIA 1GAFL 5GS2D 2HKFH 4U1MA 4TULH 1A7OL 4RDQF 1JWSB 4OZGE 4MXVE 3E0GA 5CUSH 5DD3L 5DRWA 4JAMA 2UZYB 3V6FB 4ETYA 1KENL 3L3HB 1QLFA 5GHWL 2BZDA 4TTGA 4P48A 4J3VA 1U8JB 1MCNA 1HHGB 3PGFH 3QT2A 4FMFA 4JPKH 2AXFA 4P4KD 4JDTL 3L7FB 2M1KA 2BJMH 1Q1JL 3MNWA 4GG8A 4PRPA 4RGND 3MQIA 5BQ7B 1KT2B 1NCCH 4LNVA 1IGFL 4FA8A 2IMNA 3BUYB 3ARQA 3U0PB 1H0DA 2QQQA 1LP9A 3CDGA 5BS0E 5FO9B 3DVGB 2MPAH 2M2DA 4UQ3B 5EZOH 2CRMA 3QEHA 4NZRH 1F13A 1WWAX 4X6CB 1JNHA 3HZVB 2LAAA 2BSTA 1YUHB 4LSUH 2Q6WB 4JHZA 3TBSA 3HCVB 3DI2B 3W5NA 1EEUA 1J5OH 1KELL 3QCVL 4Q2ZA 4B5EA 1I7ZB 5T1MB 3B5GA 2DIAA 2J4WL 1ROWA 1GZQA 5GGUA 5BZWB 3ZT5A 1A9BB 4ONGL 3REWA 4ZQKB 5JXED 1OAYH 4JRYA 3AREB 3PWVA 2IQ9L 4YHNB 4YXHH 1OOAA 1IGYB 1DUZA 1A6ZB 3O8XA 4MA7H 1AH1A 2I5YL 4M7LL 4ZMAT 3CU1A 3STZB 5LJYH 3BW9A 5FYLE 4JVPA 1KSRA 1WT5C 3MC0A 1UA6L 2A73B 5KOVC 1SEBB 3DNKA 4JM2D 1FVCB 1RIVH 3E6HB 1JZ4A 2MMXA 4OT1L 4BH8B 1P69B 4GKSB 1EHNA 3ZKND 3QUMH 3F58L 4OSUL 1S3KH 4O9HL 4Y16C 2BSED 5FEBA 5I1JL 5DWUH 1U95B 2D7PA 3EYVA 3T1FA 5LCVL 3OXSB 3QHZL 5H37H 4JFFD 1CZ8H 4WJ5A 4BSWA 5JHLH 4PGCA 5D8JH 1ETZB 1VKXA 2F5BL 3B6SB 4O02H 1MFDL 2X9YA 5HJ3A 1KTKE 5AAMA 3ZKMC 2DLTA 5AUMA 2AERT 1EGJL 4Z7UE 1K8DA 1SYSA 3RWEA 3HG1D 4XWOD 4LU5H 4XMKH 2HAZA 1C5BH 2UZXB 3PG2A 4R4FL 1IAKB 2Y9RT 3T0VA 1AE6L 4EDXA 4P9HC 4HX1A 4Y16B 3S7GA 4BFBD 3TBVA 5E2WL 4U33A 1S7TA 1JJUA 1QFWH 1T2JA 2VDOL 1E6JH 3BPCA 4WUUA 2P5EE 3TN0B 1AR1D 4H1LH 2X4UB 2XPGA 1SVCP 1C7TA 3BKYL 1RUAH 4LNRB 5GRYA 3PV7A 3KPLB 1SVZA 3F12B 1I9RL 2J88L 3MBED 3LEVL 3QFJA 1C12B 3V0WL 1KPVB 4KZEH 3QCUL 1P4IL 3DX9B 2IWGA 3GSRA 2ICCA 1F4XL 2G2RA 5D1QD 1OSZA 3C2SA 2Y36L 3RY6A 4JLRA 3H9HB 3EZJB 1X5XA 1KEGL 2EYSB 2ADGA 2AEPH 4I48B 3MNVA 4XAKE 2XA8H 1QO3A 2DQIL 3WN5C 3C2AH 5C70A 5GGQL 1CGXA 4NO2B 4M48H 2RIKA 3I75B 5CD5C 4WHTB 4ZS6C 3NABL 4LAJH 3QG6A 4HH8A 5I1CH 3BKML 2XKNB 2WAHA 4OFYD 3DO7B 4QRUB 1DQTA 3HS0B 1S9KC 4PRDB 4KQ4H 3VFTB 3Q6GL 4KJPD 4HIJA 5HGDB 5SWSA 5F7FA 4RDQG 2ZCLH 3WN5B 3OWEA 2GK0B 1D5XA 3KYKL 5EZIL 3IYLW 3MACH 4G8IA 4NQEE 1JPST 2BCKA 2P49B 3H9SE 1KJ2B 3WUWB 2VDRH 1XGYH 4G6FB 3K4DA 3JUYA 3STLA 5GRUH 2HT4C 1EH9A 2B2XH 4TUJB 3TPUA 5C0EA 3QIUD 2JJTC 3RWIA 4LLWB 1HSBA 3HE7D 4H5SB 5GGVL 2HFEA 5JR1L 1FGNH 1FNAA 3MRQA 3OGCA 5HPMA 3GRWH 4PJGB 4Q9RH 4LHJB 5D2LE 4X9GA 1QKZL 4CN1A 1X5FA 4X6DA 1INQA 5GZOD 4JJ5B 3FT3B 4X5WB 4NNXB 4JGUA 3GJFA 4PGZA 3BFOA 1O7SA 3MRFA 1DBAL 1NL0H 3MUGB 1KOAA 1OSPL 4JFEE 2PO6A 5HYJE 4K7PL 3JTSB 4MDIA 1CXEA 4LARH 3HC3L 3RUGB 3VFUA 1AD0A 3CDFA 2AGJH 3S37H 3LVEA 1HINL 5DJ2B 1I8IB 5JLZB 3F5WB 5FDWB 4H25A 4LSVH 3IKCB 3EYFA 4FQPA 3L9RB 1QRNB 4OZHB 1RJYA 2A0LD 1EEQA 1WZLA 4EN3D 5I19H 4LPWA 4R3SA 1OWRM 1CTNA 1ITCA 1JNLL 5L88L 3LOWA 3WDHA 4G6KL 1MCPH 2D7TH 1JPFB 1XIWC 4F7PB 3IT8D 1AQKH 5F93C 3ZMRA 3D25B 2V7HA 5L2JB 2GCYB 3DYMA 4MNQB 5F9OL 3TEUA 2OR8A 5J89A 4APQC 1CIUA 2A6KA 1HWHB 2CK2A 1F97A 2XTJE 1UH3A 5ESAB 5GRXG 3SGJC 3I3EA 3U4BH 2Z35B 4HQQL 3FRUB 2DQTL 5J06A 2BNRB 1LEIB 3G5YB 1R24B 1XIWB 2XZQL 1SBSH 1DJSA 2JLLA 1BFTA 1T1WA 4LLVA 3AU1B 1T5XA 2HT2D 5DEFA 2C1PB 4JY5H 5EDXA 4FQCL 2YBRA 1JMXA 5CEZH 3GHEH 4APQB 4LVOB 4G7YH 3GBNH 2XKUA 1FFNA 3QI9A 4LVNC 4D9QE 1MI5D 3ULVC 4HFUL 2QQNL 4Z8FH 4Y8AA 4NO3A 3QULA 5KVEH 4FQJL 4OZFH 2Z8WC 1MEXL 2K3TA 3MRRA 5EORH 3CFDA 4OAWA 2NLJB 1YPZA 3UX9B 1DQLH 2CIKA 4PJDE 5C3TA 1VACA 4PPTA 4PP2A 1QUNA 3ZE2E 4F9LC 2Q87A 5J8OA 4PRIB 1P6AB 5C6WH 3C9NB 1LO3H 2EDRA 3HAEB 2VUOA 5ISZE 4HS3A 4LVNB 1CE6A 6CGTA 1KEMH 4XPHL 5F72S 3MA7A 4RMUA 4C54A 4LFHD 2IAMC 5HVHC 4K7FB 4KUCF 4F7TA 1U3HA 1IC4L 1CXLA 1Q0YL 3M1BB 3CD4A 3L5IA 4H20H 2CRZA 1IGTA 3QP3A 1FZKA 2NMSA 3KLHD 3RUGF 2XTLA 3R8BB 3FO9B 4Y5YA 4U1JB 5D71H 5F89B 5KVFH 2IAMB 2JTDA 4AT6A 5HVHB 3IU3B 1Q38A 1MCLA 4NUGH 1FLRH 1P4LA 1RJLB 1EVTC 2AQ3A 5BRZE 2FHFA 4EQ2A 2QADC 4HMCA 1PLGH 3CSYB 4D3CL 5HHOB 1HH6B 3BPOC 5FK9A 5FF6A 1BFVH 4OFKA 3UJIL 2XZCL 2Z31C 5I1DB 3DSFH 3F65A 3JUZA 2XN9D 3D0LA 1FNEA 3IJSA 3S96A 4E41E 2HLFD 3BP7B 4G5ZH 2IANB 4NKDB 2HJKA 2OXGA 4BM7A 5BV7C 3OXRA 5J6GA 5F9WC 1VPOL 2QADB 1OL0A 3FHAA 2CDGA 4Z6AT 1MFBH 1DQJB 3BPOB 1UC6A 3IXAA 5CWSB 3WXWH 4EUPG 1IMHC 2BC4A 2IBGA 1N59A 4OKVB 2FWOB 4Z7OF 4KK9C 2Z31B 5LGKA 4NP4L 4GSDH 3HE6A 2YPKA 1RZGB 2IADB 4MAYD 3VXRD 3VXSA 4GAFB 5BV7B 4I0PD 5CEXA 2ZUVA 2H41A 5F9WB 4IMKC 4MSWA 4Y0GA 2IPTL 1FC2D 4JDZB 4MS8C 3PNWA 1FZJA 3ULUC 1A64A 3BJLA 4UT6H 5EOTB 3FFCE 4JZJA 4QGTA 3LZFL 4ZSOA 4YHYB 5CEZE 3P0VH 5HI4D 1EEYB 2VAAB 1U8MB 3B9KA 4Z7VA 5DUML 3RIAK 1BVKB 3TIEB 1HEZB 1X5AA 3MTRA 4P49A 5INDB 3F8UB 3RIFK 4KFZC 1P5VA 4NKMB 4FN0A 3BKJL 3M8OH 4PP1D 3QH3A 5FCUH 3KPSB 1DFBL 1FRGH 3LKNA 2V5YA 2ZOLA 1OGAE 1T04B 4DVRL 3WJJC 5E2TH 5LBSL 5SX4I 5GJSH 1RU9H 1T20B 3OJ2C 5A43C 1MCEA 1L7TH 2DQGH 2WWMD 1WIPA 5TQ0H 4XPBL 2JELH 5KW9L 4TSBL 2ENYA 1NCTA 5CSGA 1MHEB 4ACPA 4YR6A 3RL1A 1HIML 5L8JB 5D9SA 3QAZC 5HYQB 3HLAA 3BH8A 3VU2A 1A6WH 4J3SA 1T6WA 2EXYC 5FM5O 3UO1H 3ELAT 2YUWA 5DRZB 1S5IL 2D9CA 5F7DB 4HHAB 5GRJH 1RD6A 2MHAA 1G7QA 3ARXA 4YHKH 5LGHH 3WUWG 3RX8A 4YX2L 4WI3A 5DD1H 1I3RA 3MRHA 5GZNC 4F7MA 4A2LA 4Y5VA 4JFDD 3TFKC 4KKBC 3FMGH 3O45A 2P4AB 5DJ6B 3RP1A 3QAZB 1A6VH 3A6CH 1RZJC 5SWZE 5D5MA 4GG6E 1INDH 3HNTL 3MLWH 2H26A 2NYYD 5GJTL 3SKNA 1MRDH 3JWDC 4BFIB 4L9LC 4GW5B 5AD0B 3F62A 1EXUB 5EBMA 3BKCH 2H1PL 2DI9A 2D7OA 4ERSH 3PGDA 4QWWD 2A6JB 3VXNA 3U4EA 1HCFX 1LEKA 4X4XA 3AM8A 4WFHD 5F7NC 4QOKB 2OZ4L 4HUMB 1IRAY 5ELIA 3QHFH 4G8GA 1MFNA 3K74B 4L9LB 2YMXH 3HMXL 2R0ZH 3EJZC 3RWCB 3E3QE 5EC2A 2Q86B 3I50H 3CUPB 3CXHJ 2FJGA 4P2RD 4NT6A 4X0KB 2OL3A 2VMFA 2DIJA 3LQZA 2Z93B 3L5XL 5C09E 1B0WA 4BK5A 1MHPH 1W0YT 3VDCA 2VH5L 2PTTB 1Q9WA 4U3XA 1NBQA 3KJ6H 3IFNH 1LGVA 3O2VH 4P57B 5HHQB 1XF2B 5IMOA 1D5ZA 4C56E 3IJYB 3MUZ1 2DMCA 4BH7B 1QYGH 4TUKH 5IM7B 4F33B 4L4VB 1BREA 1K4CB 2YHGA 1XT5A 4RAVB 5K9OB 2FEEI 4R90L 4ORGB 3MV9A 1KB5H 1LO4L 3P9LB 2R2EA 2UWEF 3PUCA 4Z77B 2Z91A 2F54A 4GT7A 4QCIB 4PRNB 3VXUE 4A6YA 3QEQB 4UOW1 2DBLH 3DUSA 3W2DL 4AIXA 1ZA3B 4P5MA 1E0OB 2V7NB 2RFXB 1CD1A 1I9IL 2LV4A 4D0BB 4N68A 4AJ0A 3MCG1 3GSNL 4OI7A 4NGHH 3EJJX 1F3JB 4I18C 2YD8A 1YQVL 1MCOH 4MJIB 4CNIA 4JRXE 4ODUA 4J6RL 5EUOB 3VRIA 5GGSA 4ONHA 1B2WH 3JVGA 3SO5A 1R3IH 4CMMA 4ZFOB 4JKPL 1IAIM 4IOFD 3O3DA 1VFBA 4EOWH 5T1KB 3DURA 2PR4H 4GKNA 1VADA 4D8PA 3N85L 3KNBB 3WLBA 1R3KA 4XNUL 3TP4A 4MJ5B 2UYLA 1AC6A 3IDNB 5EUKB 4WV1C 4MX7A 5KSBB 4PRHB 4NDMB 4I18B 1OAUL 2ARJQ 1FG2A 3F6LA 2DMBA 2W9EL 1GVIA 2GFBB 2R0KH 3HAEG 5BS0D 3PWJA 1TJGL 1FN4B 5DJXA 3TBYB 4MVBD 2WQ8A 1MVUA 3EYQC 5ID0B 4NNPH 1MFAH 1AIFA 1I7TA 3SDDA 1B6UA 3OB8A 3VRJA 3VFPA 4QXGL 1PGRB 3U9PH 2BFVL 1UJ3B 3M17A 2JJUA 2R56L 4WV1B 5T5NF 2R1WA 2V2WB 5IWLA 3H0TA 1IGMH 3JWDH 5CKAA 4GRLD 5E9DE 1XCTB 1YJDL 4PJAE 5E95B 5I8OH 2P8PA 3VGGA 4AH2A 2NXYC 4OIIH 5DJ0B 2C9AA 2E3VA 5ID1B 1JNNL 5IEHB 1OTTC 1RULH 3SDXB 1OY3B 4TSCL 5C0BE 5I6XC 1CICB 1HQ4A 1UXWA 4JFYA 2FGWH 1TTGA 1XF4A 1H8SA 3HZMB 4WEMB 4AIOA 2CR3A 2YEZA 1CLZL 3RNQA 3N9GL 2WIIA 2VLRB 1JUFB 3H9ZA 2VXVL 2CDFA 1RVFL 3CPLA 1BP3B 4WDIA 2YWZA 3BP6B 1RZFH 2NXYB 4U6YA 2XFXB 1CGSL 5EFIB 5I6XB 1BFOA 5A2FA 4XP1L 4U1MB 5CKGA 2AQ2A 1TZHA 3PL6D 1MRFL 5EU4B 3AB0C 5DRWB 3EJYC 4JAMB 2XQBH 1XF1A 2CGRH 2D0GA 1FE8H 3DV6A 2PNDA 1QLFB 1Y18B 3AXLA 4NZJA 4KKLC 4H0HB 5I15L 2X44D 2A38A 3ARWA 2B7DT 1WGOA 1HKFA 3GHBH 4M6NH 3MNWB 2P5ED 4NSKB 4NUJA 5CJXA 3O4LD 1YNLL 1N64H 4GG8B 4PRPB 4JANA 1RUQL 4L3EA 5I1IH 3AB0B 1NEZB 1H0DB 3CDGB 3FCTA 3QEHB 1CR9H 4RAUA 1AHWA 2Y5EA 3TH2T 1JNHB 4Z0XA 2EE6A 4KROD 3U82B 4XGZA 3EOTL 4X6EA 3O8XC 3TBSB 1EFXD 2BY0A 3SE9L 4M93C 1G7LA 1IJ9A 1Q9OA 4WHDA 1JF1A 4H88L 4LEOA 4Q2ZB 4YEFA 5EU6E 1JVKA 25C8L 4PJFA 1JGUL 2R0LL 1GZQB 5GGUB 4J3WA 2D3VA 4TVPH 3CFCL 3RRQA 3REWB 2J8UA 3P73A 4JRYB 3PWVB 1XZ0A 4PV8A 4B41A 1ACZA 4MNGE 3HN3A 1HZHL 3RU8L 1DUZB 3O8XB 4ZNEA 4L29A 4M93B 4M6ML 2W07A 1Z9LA 4YHIB 2BMKA 3W81A 4EI5A 1TIUA 2DJSA 2R69H 3QPQC 3BVNA 3O2WH 5DD0L 1DQMH 1NGWB 5K9JL 2APXA 5BVPH 1UJTA 3W0WE 1G7HA 3EZ8A 3RZCA 1JPGA 3EYVB 3T1FB 3CU7A 4S2SB 1BX2A 1YNKH 3FO0H 4NQED 4ODWB 4QRPB 2B4CH 3SDXF 1IQWL 4WJ5B 4BSWB 5LAXA 1J0HA 1DVFA 4PGCB 1YECH 1KJ3H 1VKXB 2I27N 1ODAA 4CBPA 5HJ3B 5AUMB 2F53E 1SYSB 1JPSL 4XNQA 3RWEB 1T66D 2R0WH 2JB5L 3QDGA 2V5SA 4LLMA 3QDME 3QWRA 1UH4A 4OM0H 2EICA 4MQTB 3CLEL 4EDXB 1U8IA 4DTGL 3BT2L 4HX1B 4M9PA 5FGCB 2A77L 3MOQA 5C08E 4WUUB 4TTDC 4K3DL 5MHSD 5CSZA 4JY6A 1HCVA 3RY6C 2DLHA 4KJYA 5T3XH 3BQUA 2HMIC 1J1XL 2JJWA 1FYTD 4YHOH 4HZLA 1YYML 4W4OA 4XP9H 3CH8A 1FORL 3TLRA 5I16A 3MCLH 3QFJB 2D03H 1A7RL 1V8HA 2YD5A 4K94L 5HYJD 2X4OA 3HR6A 3GSRB 2VO5A 5C0AE 5F21B 4P46D 1ZE3C 1FH5H 2X4TA 1II4E 2SEBA 1OAZH 1NC2D 4UT7L 3V9FA 3JWOH 2E7MA 3MNVB 3R1GL 1PX3A 1GCFA 1N2RA 4I77H 1QO3B 5FAAA 2ED9A 3TO4D 4FQLL 4ZG1A 1MIML 1D5BA 3DXAA 1YZZA 1NFIB 3CFJB 3MJ9L 4JCMA 5ESQA 1A6AB 1D5MA 2NNAA 1HN1A 4N0FA 4U31A 2QSTA 4LGSB 3KPOB 1CFVL 4HIJB 1VGKB 3B83A 4Q0XH 5SWSB 4ODTL 2VE6A 2DL9A 3PQYD 1D5XB 1M6OA 3MROA 4PUBH 3OKDA 2XTJD 3OAZK 2BCKB 5KSAD 3S3SA 2DKMA 4G9FE 5B4MC 4OGAC 5HYFA 3TIDA 3STLB 1LK3L 4OF8A 4WTXA 4AL8H 5T3ZL 3L6FA 3UCRA 4B7IA 4TVPE 4ODVL 3PWNA 5IV2A 3Q48A 1DBKH 3TCXA 1DDHB 4XBPA 3SGDI 3TPUB 5C0EB 4LSPL 1H8OA 4GXVL 5D7SH 3RWIB 1QSEE 4KY1L 2PO6C 2RHEA 3FJTA 4L1DA 3DPBA 5TQ2L 5KN5B 3OGCB 1JYXA 3NIGF 1IM9A 2YN3A 3F7PC 1PX4A 4IRSA 2VXQH 1QBLL 4D9QD 4OZIF 5C8JA 4X6DB 1INQB 2X70A 3T0DA 2HVJA 2FO1A 3GJFB 3BRFA 3MRFB 1NAMA 1BVZA 4EIGB 2NX5B 3TBWB 3VGHA 3IGAA 3PDOA 4U3HA 3V0AC 3LRSA 3TJEL 2P48B 4PJXE 2ZWLT 5CJ5A 3WXVH 1KIQB 4OB5H 3VFUB 1C1EH 4TN9A 1TVHA 4L3CA 3VG0L 2EO1A 3VXPA 4XXDB 4S1RL 2DTMH 4H25B 3U7AA 4PJ7A 3EYFB 1MRCH 1JGEB 3T1WA 4NC1E 1IZJA 1N3NA 1MY5A 1RJYB 2FHBA 3BHBB 5D7JD 4ZUTB 3VMOA 2BY1A 5F7KC 3BWAA 4QHUA 1CF8L 1OLLA 1UM5H 2OP4L 4XC1H 2DI7A 2RGSA 1AGCA 3LB6C 5T3XE 3C5JA 4KRLB 1I75A 1Y6NR 1T2XA 1CE1L 4NQDE 3L7EA 2X40A 3INUH 5DZOA 2V7HB 3MRIB 5JOEA 1AXIB 5DD6B 4LCCA 3TYFA 1JE6A 1E4XI 3QIBD 4KKCC 4XP4L 2A6KB 3CFBA 3NCEB 3ZKMD 3QI9C 1A7NH 1IGIH 3WV0A 2GAZB 3THML 4CU7A 3U30C 2EKJA 2Q76B 3V52H 5E2VL 1A4KB 3H9YA 3QEGL 4LLVB 4KQ3H 2EH7H 1T5XB 1U9KA 4Y2OA 1NGZB 4PJEB 1VENA 1NMAH 5DQDH 1KJMB 4MDJA 3MLSH 2IH1B 4JG1H 2IBBA 5ILTL 5EBWA 3GIZL 3P11H 3MBEA 1FFNB 1OGTA 1H3PH 1YMMA 3QI9B 1B4RA 1KN4L 4NO3B 1FL3A 4NRZB 4YIQA 4I9WD 1JP5A 3TC9A 5J11C 3MRRB 3CFDB 4NKIH 4OAWB 1U3HC 2CIKB 1CZ8L 1VACB 5D8JL 4U6VH 5DF0A 3RI5F 3CLFH 5L2KB 4PP2B 1TJHH 3DYOA 1N8ZA 4J23A 3NH7H 1B0GA 1NEZG 1X7QB 2VR4A 1ED3A 3FQTA 3FT2A 4IHOB 1A7PH 4HS3B 2DQEH 4FZEH 2E9IA 3MA7B 1NLDL 2DDQL 4POZC 1MCWW 4KZDL 5EOQH 5J11B 2JCCE 4UZGA 2AAVA 4RZCA 5SX5H 1S9VA 5CEZD 1BD2E 4AIZA 5FOJA 1U3HB 3F7VB 2NY6C 2YN5A 2OS7A 4JY4A 4RMQA 2DQDH 5C0FB 3O6ML 1FL6A 1HK6A 1MWAB 5CGYC 5D7LE 3MBXH 1IGTB 4ZD3H 4KGLA 4XC3L 1CLYH 3CFEA 3FB6B 1FZKB 5CLWA 4Y4KA 3UMTA 5SX5K 4I2XE 1EZVY 2NY3C 5J7CC 2IF7A 4I3RH 4MGXA 1T21B 1FVEB 1X5KA 4AT6B 3QO1A 4LSTL 4MA8L 3LH2H 4ZTPH 4JKMA 1P4LB 2Z8RA 2Z92A 3OJVC 3HB3C 4DAGH 3RWJA 3DMMA 1UM4L 1X3DA 5FF6B 5FK9B 3WDJA 4KI5E 2B0SL 4MJ2A 3ARGA 1A22B 4MD0B 2EYTB 4YPJA 2NY3B 3HE6C 3DX6A 3IJSB 3S96B 1WEJH 4Y4HC 5GRVK 3G6JA 5LWYH 3LPWA 3Q3GB 1SYVA 2HJKB 1U2HA 3SBWA 5JHDA 4Y19D 1T89C 1NUFA 5J6GB 3JV0A 3ME0A 3K46A 1Z3GL 5A2JH 1ZSDA 1FDLL 2EDQA 1N59B 1QRND 3SKUD 1U8HA 3C60C 3QG7H 4XVUC 4JZJC 5HHNA 2EEBA 3I9GL 4FZ8H 3HE6B 1MCBA 3B9KC 1WFTA 2A83B 4LGRB 1EO8H 2YPKB 4Y4HB 3K2UH 3KLAA 1JRHI 4YDIL 4PJEF 1KBGH 1QSFA 5CEXB 2AI0L 3QXDA 4MSWB 3IFLH 2R23A 2V5RA 5C0IA 1NKOA 1RIHL 2FX8H 2EXWC 1JZ3A 4QHNA 1FZJB 4MNQD 5HVFB 4HFWB 1BF8A 1J12A 5T1LD 3C60B 2H32A 5HDOA 4JZJB 1RZIA 1FGNL 3WNLA 4N0UE 3LS4L 4WGVB 4Q9RL 3B9KB 4Z7VB 2PYEE 3W11C 4LMQI 4QHLA 1M7IA 3REVB 4V1DE 3QJFB 1KXQE 1NDMA </