1UZ6F

Anti-lewis x fab fragment uncomplexed
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
216
structure length
208
Chain Sequence
EVKLLESGGGLVQPGGSQKLSCAASGFDFSGYWMSWVRQAPGKGLEWIGEINPDSSTINYTPSLKDKFIISRDNAKNTLYLQMSKVRSEDTALYYCARETGTRFDYWGQGTTLTVSSATTTAPSVYPLVPSVTLGCLVKGYFPEPVTVKWNYGALSSGVRTVSSVLQSGFYSLSSLVTVPSSTWPSQTVICNVAHPASKTELIKRIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG FAB (IGG3, KAPPA) LIGHT CHAIN 291-2G3-A
publication title Structure of an Anti-Lewis X Fab Fragment in Complex with its Lewis X Antigen
pubmed doi rcsb
molecule tags Immune system
total genus 44
structure length 208
sequence length 216
chains with identical sequence H, P, W
ec nomenclature
pdb deposition date 2004-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uz6F02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uz6F01
2HYMA 1FVEA 1SY6A 2RGSA 5BS0D 5ICYA 4OD2A 2YK1L 4ZO7A 4P2QA 1R5VB 3O45B 2IH3B 4IRJD 1YNLL 4XWGH 3MFFA 4WFHE 2G5BB 4TUJA 4RFOH 3RKDC 1IAIL 3RZWA 4Z7NE 4PRBB 4MDIB 4MAYC 1R5IA 4Q9QH 3WSQL 4DUXA 4S1DD 4K8RL 3BT2H 4K71C 4X7CC 4WHYH 1J86A 3EHBD 4LVEA 3BPNC 4Y2OA 3CFJB 5DHVH 4G8GE 1QBML 3QDJA 3B8YA 4HHAB 2IFFH 5IB2A 5JZ7D 3N50A 2B5IC 5HDBF 1KLGA 3QUXA 1T04B 3FB7A 4OSUL 2SEBB 2UVFA 2BNQD 2IQAB 4Z0BL 2P43B 2WLYA 4Y5VA 4O9HL 4Q9CA 5CAYB 2H2SC 1A7NL 3OJ2C 4H20L 2R1YB 3C2SA 4OT1L 3VMPA 4Y89A 3EAKA 4HX1B 3B83A 1RHHA 2NY7H 4LSSL 5I19L 4PS4L 1IARB 5E0QA 2UZIL 4K7PL 4PJ8C 2HMID 1CICC 3QH3B 5HPMA 1JBJA 1R3JB 1YEIL 3OHXA 4NQTA 3VCLA 3EO0A 1A6PA 1C8PA 2A9NH 4LCWA 5JOPD 4M61A 4JHAH 5C2UB 5CD5C 1CGWA 4YDLC 4UDTB 1R3IH 4JJ5B 3U79A 5T3ZE 4XPBH 4QRUB 2V2XA 1FG2B 3UTSE 4P4KB 2WNGA 4YLQT 4U6YB 5EBWA 4YPJA 3R8BB 4N8CL 1P6FA 1JPSH 5H8DA 5E1AA 4UV4H 1J8HB 2UWEE 4ZS7H 4TOYH 1RV6X 2W0PA 5ALCH 3GMNB 1CR9H 4KKAC 2B4CL 1S9YB 4JM2A 4JO2H 3ZDYF 3ARFB 5K59F 2OQJA 1GGBL 1FCGA 3JV0A 2C3VA 4K7PX 1KCRL 4CVXA 1BQHB 1OB1B 4FRWA 4ZQKA 4FQJH 4NGHL 1P9MC 1AHWC 5CUSL 4HQQL 1QNZL 5E24E 4ODWB 2UWEA 3D0LA 2X10A 5DD6B 1KIQB 1FV1A 1K5NB 3QO0A 3LOWA 2NZ9C 2VDNH 3MJ9L 1JFQL 2M26A 1NBZA 5GS3A 4J3WA 3HUJA 5MEQA 1HOCB 2BC4A 3I3DA 3NFNB 1I1FA 5FUZL 2BVOB 3ARZA 3IJYA 3MRLA 5JPNB 3QPXH 1KG0A 4PY8I 4JRXE 5KANG 1A3LL 1W72L 5ESAB 3WDIA 2QBWA 5J1AA 2MHAB 4M8QB 1CT8A 2P5EA 4XPHH 4IS6A 2YRPA 3BQUC 3F7YB 4LDEB 5DJAA 3RL2A 3VFRB 3IDXL 2Y5TB 5T5NG 1ES0B 5ANMB 2JIXD 4WW1B 4G8EB 1EHLH 3BSZH 4JRXA 2X4RA 4R2GC 3VGFA 1VSCA 3U46B 2IGFL 3IJSB 4X5WB 5DUMH 4CMHB 3VI4E 5B39B 4LLVB 2FL5A 3MRGA 4MX7A 4X7EC 4ZUUB 1C5BH 1S9XA 4JFED 1JGEA 3ARGD 2B0SH 1B3JA 4UILH 3FO0H 4IIQB 4RSVA 3AU1A 5IBUB 1FC2D 1KB5B 1IGJA 3BKYH 3CDYA 3QHFH 5GGRY 3L3OB 2HT3D 1T5XB 1MNUH 3QQ9D 4IRSA 1DTUA 2OJEA 4NKDA 2GFBA 5GRJL 4NQUA 5FKAA 4MNQA 5H37H 2YMXL 4E0RA 4CN4A 3VFMB 4Z8FH 1U8LB 1T0MA 4QNPE 4R4FH 1YMMB 4KROC 1I7RB 4MCYA 1GGIL 3QCVH 5I1IH 1MCEA 3V9FA 3SDXF 2YZ8A 3HE6A 4QCIA 3OXRA 4PJAA 4NWUL 2DDQH 5DUBB 4KI5F 5HI3D 1RJYB 5GJSH 5F44A 4PGBB 1S7TA 4OZFG 1TQCC 4WHCA 5EZJB 1NDGA 4DEPC 1E4WH 1AC0A 4M1CC 1TTFA 4ALAL 5IG7A 5JORA 2CK0H 4LCCC 5E8DH 1NBYB 3TVMD 3E6FA 4OCWL 5EU3A 1RUAH 4UTAH 2IANB 1OTSD 4K3DH 3H9YA 2ZPKL 4I77L 4Y2DA 3UYOD 3QXDB 3CZFA 4EDWL 5JA9A 3RGVA 1OT2A 4G7YL 5E99L 4XXCA 1MCWW 1DQJB 5KOMC 5I2IA 2X89A 4G6MH 1IGFH 1LNUB 2VDPH 2AEQL 5BV7C 2ESVB 4PBVC 1Q72L 2AXJA 4Y4HD 2Z92B 5F9JB 1D9KD 2A77L 4L1DA 4R3SB 2XXMB 1P4LA 2OTUB 2H32B 1PG7H 3LS5H 3RVXD 4WVRA 4J1UB 4R7DB 2OK0H 1AXTH 4JKMA 4PJBB 3LIZH 4P57B 2G2RA 1MJJB 4JE4B 5FGCB 4M7JL 1MVUB 3ZKXB 4IRJB 2EIZA 4NRYA 3GZKA 4OZFA 1VFBA 4N8PA 3QDGE 1WISA 2BX5A 4PJ7A 4PJDE 2XZZA 4QHKJ 4AH2A 2P46B 4Z7QE 4JVWA 1A8JH 3VFGH 1INQA 5DQDL 4RGOH 5J9PB 4LIQL 3DX9B 3I9GH 3PABB 2GEEA 1WVZA 3GSNL 1MEXL 5I1LA 1CXLA 4M7KH 1XF5B 3QDGA 2BNQB 4OD1H 1HINH 3GSOB 1YEDB 3G04A 2WZPD 2J88H 3IFLL 3TIDB 1MRCH 4WWID 4Z7UB 1AH1A 3T3MF 2CH8A 4FQXA 4L3EE 3OKNB 3QIBB 1KT2B 5C0FA 4JVUA 2R29L 4N0CC 2NY5L 3SDAC 1T89A 4DKEH 2EDWA 5IB4A 3QWOB 1QLEH 4FQCH 4HXAH 1Y6KR 2VXVL 4Y0GA 5DO2D 3GKZA 1U8MB 1MHPH 4L3EA 4HKJB 3V7AG 1LK3H 5J3HD 5HHOE 1I8LC 3ILQC 1QYGH 4XPGL 2PYFA 2YWYA 1EFXA 4WY7H 3B9EA 1FDLL 4L8SC 4KTEL 3HZVA 4WWKC 1YYLL 2YA2A 3QULB 3F7VA 5AYUL 2UVEA 4POYA 3TZVD 2OS7A 5DHYB 1AI1H 4JREB 5HHOA 4ZTPL 1IQDA 1PFCA 3E8UL 5C0RL 2Y7QA 1W2KT 4M6NH 1A1MA 1JHTB 2CK2A 2DQGH 4KKBC 5FYLE 3VFVB 3V7MA 3GSUA 3P4MB 4U6VL 3IGAA 3DGCR 3DVFA 5CEZD 3P9MB 2VUYA 3NBNA 1AE6H 4Z5RB 2ENSA 4JY6A 5EOCL 5IVXA 4G5ZH 6FABL 2DM2A 5TDNA 2XV6B 3JV4B 3VW3L 3HTLX 4NRZB 3I02A 4YDKL 2OL3B 4O4YH 2ADIB 5K9QI 4NOFA 5CFHA 5I1JH 1OWWA 1JYVA 4EUPB 2BRQA 1VGKA 1N4XH 1A7BA 2FEDC 2BRRH 3FAXA 3IFNL 4MD5B 2WBJD 3T4AB 3TO4A 3NCCB 3O81A 2YPKA 3T8XA 5EC2A 4A6YA 3ULSB 2JELL 3HMWL 5E5UB 2FX8L 4TSBL 5HYQB 5MEPA 4Y19D 1FZOB 3WLBA 2JIXB 5EUOB 4JKWA 1TXKA 4FQIL 3L3GA 3LMJL 3SDDC 5I75C 4X99B 4NHCH 1FQ9C 1NC4D 2V9RA 2V2TB 4OCRH 3CLEH 4XXDB 3QNYB 1KB9J 1TTGA 2VAJA 2YKLL 4P99A 2MMXA 5I74C 3X3FH 3CFDB 4XH2B 3V0VA 3WMSA 5T3ZL 4KJWD 3V95A 4F57L 1NGPL 2VLJE 3REVB 2PETA 3VFSB 2H8PB 5ERWB 4LLYA 5I1EH 3QNZB 4GRLA 2NTSP 3EJZD 3ARGB 4GLRI 2DIJA 1S7XA 4X6DB 4XP9H 2QR0A 3IU4L 4L4TA 2QTEA 1UC6A 3RWHA 1FH5L 3CDGB 3FQUB 2ARWA 4IJ3C 2X9XA 5IKCA 2R4RL 1NLBH 3AB0C 2EDRA 3S37L 2R1XB 4P5KB 4AM0A 3X11A 1NUGA 2X70B 4ZD3H 1SM3H 1C7SA 2EEBA 4X6EA 3SDCD 2L7JA 2R0LL 1U8KB 1PYWB 4TTGA 2BDNH 1MUJB 1KXTB 3MOQA 3P11L 2X05A 2W59A 4I5BA 4BQCA 1NFIB 5HHQB 4P9HL 5E2WH 3VXOB 1R5VA 1P6AB 1H0DB 1BZQK 3SKJH 3ZKND 2G5BA 4PB9L 3UPAA 5FUOL 2FB4H 2ZUUA 4QTIL 5GGVY 4PRBA 4MDIA 4M8VA 5F71A 3RWFB 3WIFB 4MA7H 1BQHG 1MAMH 2BCKB 1KYOJ 3CFJA 3TVMB 4EDXB 4OGXH 5EN2B 2CRYA 2A74B 5IFAL 1HQRB 1SJXA 4RDQG 3MFGB 5FUCE 1ZLVH 4FP8L 4NQSB 2CLVB 4RGND 3U9UB 4HMCA 2SEBA 2IQAA 1F58L 2DJUA 2R1YA 5IBLD 4HEPG 1DBBL 5IM7B 3RDTD 4ODUB 4JGJA 3L3HB 3MRFB 1R24A 5CJ5A 4I13B 5MI0C 1UM5H 5IEHA 1JHLL 2ITDB 3QIUC 1R3JA 5DK0B 3Q6GH 2AXFB 2X4SB 1U92B 4Y4HB 2YRLA 5EOTB 5JOFB 4HSQA 1D9KB 3D2UD 4UDTA 4ZOBA 3VG0L 1J8HE 4HWBL 3RNQB 4G6KL 4MXQD 4PP1C 1VDGA 4JJ5A 5EO9B 4WEBH 1KFAH 1B9ZA 4I4WB 5IMLB 3OKYA 4WGWB 5B39G 4QRUA 1NJ9B 1FG2A 2BHYA 4P4KA 4M7LT 4TULH 4HT1L 3WS3B 1RIVL 2FX7H 2BVEA 1F6LL 2B39A 3RWEB 1J8HA 2A73B 2YR3A 4I0PB 1H3WM 2OTPA 4MXVF 4O02L 1FO0B 3GMNA 3TGXA 5HHNA 1BQLL 1I8KB 2QSCH 3ULVH 3ARFA 3KLDA 1IGIL 3TA3C 1LEIB 3NGBB 3VI3E 4JPWH 1KLUB 4PYGA 4HUUB 1JZ3A 3SEPA 4DAGH 2D7MA 2Y23A 4PLOB 2DM7A 5DD6A 4ZSOE 5CD3B 3BE1H 1KIQA 4JDVA 1K5NA 4KAQL 1N7MH 5F88B 3D87B 4LHUD 4N68A 3UC0L 1F3JB 2YUVA 1U2HA 1BBDH 3NFNA 5ANME 2BVOA 1YEKL 4O51B 5JPNA 5BO1H 3G5ZB 1A5FH 1X5IA 4QY8B 3QRGH 1DANU 2MHAA 4M8QA 2VXTH 1D5MB 1E6JH 1JGDB 4MZ3A 1T83C 3P30H 3DV4A 2V7HB 2FATL 4H26A 4JFZH 4DGIH 3MPCA 1H8SA 1TCRB 3LB6C 4XVSH 4OLWL 1FL6A 1ES0A 1UACH 4OIIL 5ANMA 4WW1A 1QBAA 2EDBA 3W11C 4G8EA 3SO5A 3FO1B 4YHIB 3LN5B 4LEXH 3U46A 5FYKD 1GZPB 1CIUA 2XWJB 5GGRB 4E9LA 1LK2B 3IJSA 4NQCA 3H2WA 1IBGH 3T09A 1S9VB 4OGYL 4KKNA 5B39A 4B41A 4LLVA 3ULUH 3MRMB 4P3CH 1B0RA 4I0CC 1J0IA 2DI8A 4N5UA 4ZUUA 2VR5A 2VXQH 4F58H 5DTFA 4K3JH 1U8QA 3NFSH 3TZVB 5ESVA 3HCVA 1T22B 1TVBB 3RY6A 4IIQA 1PKOA 4O2CB 3PWPD 3WE6B 1YMME 3BDYL 4MA1B 5D7SL 1LO0L 4TTDC 3L3OA 4ZUWB 5ADPL 4Y16C 1T5XA 3NPSC 4UB0L 5ILTH 2IQ9L 4U6XB 1LHZA 4EQ2A 4FN0A 1AQDB 5C2BH 4R4BB 5DR5H 1RFDH 4ENED 4MJ5B 3PDGA 1UWGL 3U9PL 2IPUK 4HMEA 4IMKC 5GSRA 5MERB 1U8LA 1XIWD 1ZTXH 5FYKL 5KANI 5EO1B 3UYRH 1I7RA 3BGFC 1RZGA 5ID0B 1OLZA 3MACH 4FS0A 3VFNA 1A2YB 1NDMB 3HC3L 2IANE 5DUBA 4HC1A 3WL9A 4HAFA 2XT1B 1ZLWH 3TBTB 1Z9OA 4B5EA 4K7FB 4PGBA 1EERB 2WBJB 4OM1H 4XPAH 3CFEA 5EZJA 5F3HB 1YNTA 2N7AA 3NAAH 4XNQB 2J2ZA 5LAXB 3S34H 2G75B 1HHJB 5EC1A 4U1NB 4ZAKB 2HLAA 4KJPC 5GPRA 4Y19B 5CIPH 4PY7A 1CIDA 1ITBB 5CJQL 4ORGB 1B4JL 1JRHH 2IWGA 3QXDA 2M8XA 4JHBA 1JYXA 1A1OB 4JQVA 1ITCA 3ILPB 4U1GB 4OQ1A 3GFUA 5HGHB 1FZMB 2KBGA 2ESVA 5F8RC 5HD8C 1J1XH 3G5VB 1IM9D 1KF9B 5KAQF 1KACB 4YHYC 3ZO0A 3R0NA 4RQQB 3V6FA 4GG8A 4R3SA 2P5WA 2E9BA 5HHVH 5FGCE 4YK4C 4YJZL 3H8NA 2H32A 5FYLL 2V2WA 5JO5B 2DKUA 4J1UA 3HFML 2E9JA 4GAJL 4PJBA 3SDCB 4P57A 1MF2L 1YJDH 3NH7L 1BEYH 2ID5A 4JB9L 5DHXB 1MJJA 4Z95L 1MIEL 3WHE0 4QRQB 5TQ0L 3WXWL 3BPOB 4ELME 5BS0A 4XBGB 3BKJL 4R0LC 3BMVA 5IFJB 3RQ3A 1MVUA 4G6FD 4IOSD 5DD0H 3KJ4C 4YX2L 1B2WH 3ARBA 4RBPH 1XGUB 4IRJA 5D6DC 3GI8H 5B3JE 2ADFL 3KYNA 4GH7B 3C09B 1L0XA 2WWMC 4L9LB 1E6OH 2BNQE 4FQQB 4HUVB 1TZHB 2HLFD 4HIXL 5FHAL 1SEBB 4Z7UE 2FZ3A 1MCWM 3DX9A 3ECBB 5C6PB 3PABA 1QRND 4NKOA 4X80L 4RGNB 4MNGE 5DGRA 1XF5A 1S7VB 1S9WB 2BNQA 3P77A 4WFED 2ZUWA 3GSOA 1YEDA 5AUMB 3LEXA 3TIDA 3MLXH 4EUPG 3BZ4B 4Z7UA 5IK3A 5IQ9B 1MWAL 3RDTB 5JOPE 3OZ9L 1UCTA 2YPLD 3EOTL 4PJFA 5F9WB 3MODH 5IJVB 4POZC 4XNXH 3QWOA 3UJIL 3U30B 4YUEH 3MV9D 4GFTB 1NCWH 2UWEF 5I1HL 3IXTB 3C6LC 4DGVL 2IAMC 4CVWA 2BSRA 1U8MA 1KBGH 1GAFH 5D8JH 1ZVSB 3Q3GB 2JCCE 3MJ9A 3LD8C 1NSNH 5GIRA 5ETUB 5C07E 1S7QB 1MPAH 3HI1B 4NNPL 3MLUH 1PSKL 3STBA 1FL3B 4IDJH 1OAQH 3MZTA 5DEGB 1W72A 1JVKA 4LPVA 2FNBA 3X3GL 1G7PB 1GHFL 2X4NB 1T5WB 4K94C 2LU7A 1NGWB 3EOBB 5CJXA 4NJ9H 1RZFL 4PRDB 3GSRB 3RVTC 3VFVA 1FFNB 4BQ9A 3DRTB 4G6AD 2F53E 3TYFB 1IEBB 1PLGH 1I1YB 3P9MA 1VGEL 1N0XH 4Z5RA 5F3BB 3A67L 2J8OA 3FFCD 3QAZC 4C4KO 3JV4A 4OB5H 3LEYH 5JPMB 5DVKA 1ZHKA 2OL3A 5FF6A 3MRKB 5JLZA 2AK4D 2K9UA 4KDTA 2ADIA 3M07A 3OGOE 4LHUB 4ZUSA 4G9FD 2ZUQC 4W6YB 4EUPA 4TN9A 1CZ8L 3VI4F 3IETB 4BYHA 4MD5A 4KK9D 3AS0A 3KNBA 1U8PA 3T4AA 1Q1JH 2AGJH 2AJUH 3ULSA 2E27H 4ONFL 3V6OA 4OGAD 4LDLB 2DQFB 3O4LD 2E7CA 5TE7H 4YQXL 1V7MH 5EUOA 3QIWD 4XTRD 5L7XL 1YEHL 4X99A 2V2TA 5A2FA 4IRZH 4FMFA 2VSCA 3QNYA 3WNMA 5JW4R 1INDH 4PR5B 3KDMA 1YECH 3WN5B 2XRAH 3RWGA 3PGFH 3LKPA 3VD7A 5IHZB 1VPOL 2BNUB 2Z31C 1DLFH 4EQ3A 3CFDA 3H3PH 4XH2A 4OV5B 3D0VA 1A9BB 3REVA 4H8WC 5DLMH 4QNPF 2H8PA 3O11B 4JFEA 5ERWA 4KHXL 3P9WB 3MC0A 2I60L 3ARGA 3VG9C 3VDAA 1F4AA 3KS0J 3L9RB 2AVGA 2VH5L 5DHVB 4X6DA 3U36A 1CWVA 4FG6C 4PJ9C 3VGHA 3PWPB 3FB8A 2FBOJ 3BD3A 4NN6B 2IPKA 4X7DC 3CDGA 3FQUA 4F7PA 4X4ME 5M7QA 1EEQA 3LQZB 3OX8A 1J9CT 3TBSB 2R1XA 4P5KA 1XGPA 2KL6A 1G7MA 2X70A 4CMMB 1Q9LB 1MJUH 4JDTL 1U8KA 1XIWB 1EX0A 1PYWA 1CGTA 3QEGL 2NY3C 3OPZL 1NFIA 2NW3A 1QHPA 5HHQA 4RNRB 2GAZA 4RWYL 4XCFH 2GI7A 5HGGS 3VXOA 1DBAH 1DUYB 1H0DA 4P46C 2AJVL 2OZ4L 3BISA 1BAFH 5DUPL 4M7LL 3JWNC 3MOBH 4HAGA 4NUGH 4LDOB 4MVBD 3WIFA 3KPSD 2BCKA 2EXYD 3TVMA 5F7DA 3QT2A 4EDXA 1G0YR 1OP9A 2DMCA 3EO1B 5EN2A 2H2SD 3CVHH 3SKOB 1HQRA 4LAQH 3LPGA 1GJIA 3PWUA 3ZLQC 3C2AH 1V7NH 2CLVA 1PG7X 4NQSA 3TJHC 3U9UA 5IV2B 3WIHH 3FONB 4PJ8D 4MSWB 1CICD 3WJJC 5IM7A 4G42B 4ODUA 3TBWB 4ONGH 3I6LD 3L3HA 3CPLB 4PREB 4QHLB 3S97C 3TNMB 1HCVA 3QQ3A 1CFSB 1ZT7B 3OXSA 1NCCL 3PIQB 4KJYA 5C0AD 1A6WL 1RZKC 2BNRD 5JR1L 2NPLX 5CD5D 3EFDL 1KIRA 2ITDA 2DB8A 5DK0A 1IM9B 2J5LC 4YGVA 2AXFA 2X4SA 1U92A 1U95B 2JLLA 3MZGB 5EOTA 43C9A 5JOFA 2HVJA 4G8IB 1M7IB 2ZKHL 4X83A 3VFTA 5E2TL 4X7TB 3RNQA 4YGAB 5TQ2H 3QUMH 5EO9A 4I4WA 5FHBL 4PJDF 1SJEA 3WUZA 5DQ9A 1NJ9A 4NQDD 4Z7QF 1D5BB 2D4DA 2BP3A 4KKAD 5DQJB 1JGVL 1D6EB 2YHGA 4YAQB 4ZXBD 1LP9B 1B0WA 3WS3A 5CJOH 3GNMH 3RWEA 5IHBA 2A73A 5C70A 3JTSB 4JO3H 5FYKU 1A14H 1FO0A 4G6FB 4PGDA 3ZSTA 1HKLL 5F9OH 1I8KA 2AS5M 1CK0H 4C57C 5DD1L 1X4XA 1CGUA 3IRPX 1LEIA 4WW2C 2GJJA 5HI4C 1JK8B 3SJVD 2PR4L 5HY9B 1YZZA 4HUUA 5CGTA 3P9LA 4X6FB 3O2DH 1NBVL 3F6LA 1PW3A 2IBBA 5CD3A 2DQIL 5IUSA 4QXTB 3DMMD 3MV11 1A6UL 3T0AA 5DJ8B 1YN6B 1QRNB 5GGSB 1JNNH 1F3JA 2EDKA 3NIDE 4R97B 3UZQA 4KV5E 1FVCB 5CZKA 4ZPVB 3VA2C 4G8FA 4BZ1H 4NWTH 3G5ZA 1DBJH 4I3SH 4QY8A 3TFKC 2C1OB 1CLOL 1D5MA 1FHGA 1JGDA 2JTDA 3BZFB 1P69B 2V7HA 2YS4A 1P7HL 5F6IB 1UKTA 1QVOB 1TCRA 1H3TA 1YUHA 3TPKA 3WFDL 5K9OA 5DZOA 3MV9B 3MYJB 3Q5YA 3FO1A 1KJ2L 4QRPD 4D0BA 2AKRA 5FECB 1EEZB 2EDQA 1OP3K 3LZFL 4YHIA 3K4AA 2XWJA 5GGRA 1LK2A 1S9VA 4JKPH 1MRFH 5EWIL 4M48H 3MRMA 1G7JA 4N0FB 5F7YC 4C4KT 2MCPH 1U8NB 3VJ6B 4NZTH 3PWVB 4BQ6A 5IR1A 4PRHA 3MRRB 3NTCL 4PD4J 3D25A 3FQRB 1T4KB 1OP5H 3TZVA 2BY1A 1BD2E 3FAWA 3IS0X 4GRWH 5H35B 1T22A 1CDUA 2Z0BA 5GGTA 4FZ8H 4O2FA 4ZUWA 4P2YA 2IC2A 5F89B 2EIEA 3FO9B 4HCRL 4U6XA 4LSQH 3HC0B 4KROD 2F15A 2ZSWB 1EGJL 2VOTA 5DYOB 4R4BA 4MJ5A 1CD0A 1QKZL 4R96A 1C1EH 3QCTL 3WHXB 3NCYS 3H7LA 4E5XB 4M6ML 4Y4KD 1HIMH 3TYGH 5ID0A 2AQ2A 1F13A 2VZVA 3WBDA 3F58H 1J5OH 1A2YA 2XXCB 4G9FB 3CC5B 2E7LA 1NDMA 1Q94B 2B1AH 4Y19E 1GGTA 3RY4A 1A7PH 4APQB 1CE1H 4K7FA 3D48R 2WBJA 4TRPL 4EN3C 3W82A 5CBAA 2OR9L 1EEYB 4XNQA 4QXWA 5LAXA 1JE6A 2G75A 3T77A 3O4LB 3C08L 4Y19A 1F4WL 1V8HA 5F96H 4FFWC 1P2CB 5HYIA 3FOLB 1NC4A 2WMPA 4XNUL 4ZTOL 5E7FA 1P4IH 4RA3A 1IAII 3MNVB 2MQ0A 4B53A 3HB3C 1QZ1A 2NQCA 3ILPA 4GXUM 4XBEL 3DX7B 3X12B 3ULVD 3MXVL 5HGHA 4JFYB 5BVJB 1AQKH 2F8XC 3G5VA 1RU9H 1HEZB 3HE7A 4OCNC 4GBXC 1FBIH 4RQQA 5ID1B 4EIZC 4L4VB 2VDQH 3KPPB 1KOAA 1WC7B 1A3RH 4FFZH 4N9OB 1IGYA 1SBSH 2DQJH 1TQBB 2PXYC 5JO5A 1MQKH 4Z78A 4XMLL 1UM6H 2V17L 3ZTJG 4C56E 3SDCA 3FL7A 5BV7L 5I30H 4QRQA 3FKUS 4I18B 3C8HA 4XBGA 1K9TA 3CSGA 3IDIB 5IFJA 4MD4A 2MFNA 1YPZB 1XGUA 4K71B 5BMFL 5C0NC 3VGAC 3RHWK 4RGNE 2XA8L 3HS0B 1G7LA 4XNYL 4L9LA 4FQQA 1PQZB 4TNWF 3WFCH 2VDRL 3ARDA 1SEBA 1I3GH 3KPRB 1T0NA 4HWBA 2EE2A 3TCLB 4OBRA 5E1HB 2GK0B 3ECBA 3BH9B 2HVKB 3IU3B 4JR9L 3D9AH 4M62H 5E2VL 3E3QC 1S7VA 1S9WA 4N0CD 3SDAD 5CGYC 5AUMA 4FNLH 1I4FB 5KW9H 2A9ML 2PTUA 4PJ8B 4HZAA 1KUMA 1CICB 3RDTA 1G6RH 5FOBB 4UUJB 1RUQH 3QXTA 1LQSR 5C0AB 2Y4SA 3DI3B 2R1WB 1YC8A 1WV7T 5IJVA 3A6BH 4YDLB 5DD5H 4N0UB 1IQWL 4XHQA 1RZ8A 1GC1C 5ADOH 3QZWB 1NMBH 5JW3L 3EOAB 4RDQF 1OPGL 4WWKD 3D18B 4HH9B 4M6AA 1ZKAA 3D2UA 1U93B 5MENE 1LO3H 5GS0C 3VD5A 1X5AA 2FD6L 3Q3GA 4Y5YA 4UI2A 3VI3F 5CILL 2Y07L 4DUWA 4KC3B 3QRFM 5ETUA 1IKNA 4GLRH 1RIUH 3RU8H 1KJMA 1UVQB 3G5XB 3LPWA 4NQDB 1RVFL 3HI1A 3ALWA 1RZJH 3W0WD 1FL3A 2KZWA 3U0WH 2VL5B 5DEGA 4NC0B 4ZXBB 1OL0A 5EZLB 1G7PA 1SY6H 1FC1A 2PO6B 4D9QD 5I15H 1IAOB 1T5WA 3EOBA 2HKHH 3CDFA 5T1MB 2B2XL 4PRDA 4ETYA 1MHEB 1FFNA 3DRTA 3TYFA 1IEBA 3T0ED 1I1YA 1XGTB 1N2RB 4YDJB 5F3BA 3SJVB 4CNIB 3E2HB 4HGKC 1FJ1B 5DJCA 4JM4L 5DFVD 2ZJSL 4H1LB 5JPMA 2FEDD 2QADC 3DMMB 1A3QA 5D1QD 12E8H 1FNSL 5IWLA 2NZIA 5E5RB 4X4XB 3F6IA 3CGTA 5IMOA 1WFUA 3OKMA 4KRNA 3NZHL 4R26H 4O58H 3KLAB 1IZJA 5GS1C 4DKFL 3SDDD 3KHOA 2UYLB 5EOCJ 1U8OB 4JCMA 5CJ8A 3WS6A 2DQFA 2FGWL 3Q48A 4DFHA 4W68A 3L3JA 3K74B 3GIVA 5CINH 1KELH 1ROWA 3BIBX 3O3UN 3MLRH 1T7YA 2EH8L 4QRPB 5E4IA 2HN7B 4JPIA 1H9VA 4R8WH 4N0YL 5JHLH 2EDNA 3QEUA 5FOJA 3A6CH 4MNHB 3ZYIA 4UTBH 1SVZA 2YD8A 5IHZA 3QEHB 2BNUA 3H42L 4O2EB 4IOIA 3IYLW 3U48A 3KR3H 2XTJB 3NABL 4M5YH 4OV5A 4PV8B 3EFFB 3VGGA 1CXKA 2JF1A 3GHEL 5IW1A 5IB1B 3VXNB 1WF5A 3EDJA 5KSAD 3PWPA 1AFVH 1NKOA 3D3VB 5J12B 2FHBA 2CKBL 2ZCHL 1OAKH 4X98B 3VGEA 3LQZA 3TBSA 3B9AA 1CFVH 1G0XA 1KTDB 3CK0H 4MCZA 5D70H 4CMMA 1RMFL 3V8OA 1Q9LA 1S7UA 3RUGB 1HSBB 4UOW1 1OM3H 1XIWA 5ACMA 1FGNH 3GM0A 4UINL 4ZUTB 2ADJA 4Y4KB 3S3JA 1UWEL 1YNKL 4WI9A 4RNRA 4M93C 3P0VH 5C92A 3O41B 4DEPB 1TQCB 1ACYL 1CXEA 3SDYL 3PXHA 1CLZL 4LCCB 2D7PA 2X4TB 4LRNH 1BPVA 4K55A 1DVFB 4GRMB 1HXMA 2XQBH 4PV9A 1NCAH 3VFOB 3V5HA 3T2NL 5T1KA 4JRYD 2VERN 4F15B 3SKOA 3U4BL 1FFOA 1HYRC 1EAJA 3FZUD 4BFIB 5L88L 5IV2A 5A16B 4F7MB 8FABA 4NHUB 4I48A 1JGLL 3TF7C 3M8OL 3FONA 1O0VA 3SCMD 5A2LH 4G42A 3QIUD 4MS8C 3ELAT 5J11C 4D3CH 4IM8A 4WENB 3WFEL 3CPLA 4PREA 4QHLA 5D72H 3TNMA 5EU7E 1CFSA 1ZT7A 1QA9B 2HP4A 1DEEA 2XQYG 5DFTA 2FJGB 1GGYA 3RKPA 4ELMF 4PP1D 1FSKB 1IM9A 3CX5K 1U95A 3WDHA 3GMQB 5H37G 4MAUH 4CRPA 1ORQB 2B1HL 4X9BA 3W5NA 3QDMD 1I9JL 4RAVB 5B3JF 4DN3H 1HH6B 1G9MC 1IEHA 2WV3A 3MREB 5DT1L 3UPCA 4J3VA 5I1KH 3O3EA 4Z7UF 1QFUH 4K3EH 5C08D 4U49A 1MIML 4BFGA 5C09D 1D6EA 1LP9A 5C1MB 4YBLC 5BQ7B 1RUMH 4GS7B 3WNNA 3KGRA 1GZQB 1I7UB 3JTSA 2FYYB 3FN0L 2COQA 3FMGH 3P4OB 4TSCH 1KNOB 1H8NA 2E3VA 3DVNA 3BKML 1QRNE 1VFMA 5ALBL 3QXAB 1FFPB 1EH9A 1JK8A 5FB8A 2FBJL 4WFEE 5HY9A 3CX2A 1LO2L 4UAOC 4X6FA 3IDUA 3ARRA 1G7IB 4K3HA 4B7IA 4QXTA 3QR2A 5FO9A 1VA9A 2OP4L 2FSEB 3PGCB 5DJ8A 1YN6A 1QRNA 1BF8A 1M7XA 5F7KC 3EDFA 4K07A 5CLWA 5F7LB 1IT9H 3GIZH 5F1SA 3MV9E 4V1DB 5I1CH 4PLKD 3SDAB 5J13B 1FVCA 4UQ3A 4ZPVA 5KN5A 4NFCA 4NCC1 2JCCF 4MA8L 5F70A 5IVZB 4N5ED 4H88L 2VDLL 3W11D 2C1OA 3BW9A 15C8L 4DGYL 3KLSA 3SKNA 4QRRD 4KY1H 2YPLA 4MDJA 3O3DB 4TVPH 2Q7NA 3BN9C 3MV9A 4KI5C 5C0BE 1T7VA 1DQMH 5ENWA 3CSPA 5FECA 1EEZA 3QHZH 3TJEH 3MLVH 3MBXH 4WWKB 1RK0B 1U8HA 3MUZ1 1FAIH 4P5TC 4CVZB 4NC1C 3TC9A 1MJ8L 3ESUF 2WIIA 1MVFA 4J3TA 4EBQL 1YQVH 4N0FA 3LPFA 3LS4L 1UA6H 1U8NA 1XCTA 2HTLC 1QSED 1MREL 3PWVA 1NAML 4ZOCA 3W0WB 4GW4B 1BM3H 1CD8A 3MRRA 4LP5A 5JIKA 2BVTA 1K6QL 4JG0L 2YEZB 2H26B 2EDTA 4GT7A 1T66D 2ARJQ 4OCYL 1W0VB 1OW0A 1R5WB 5CIPB 1TZGL 3RA7H 3UBXB 3FO9A 3WFHB 3HC0A 3RWCA 3BN3B 5GRZA 1BJ1J 4MQXC 3HRZB 5DYOA 3ZTNH 4TNVF 3T0EB 4OZFH 1IRAY 3WHXA 3B2VH 4UDUB 4PTUB 1UH4A 4LVHC 5EBLB 3FFCA 4KMLB 2QQLL 2IALA 2JJUA 4E5XA 3EO9L 3QJHB 4JO4L 3HMXL 5D1QB 2AK4A 2Y6SC 5MP6H 5LVEA 4NN5B 4G9FA 3CC5A 2VLMD 4OQTL 2BVYA 1Q94A 5F72S 1GGUA 3TM6A 1QQDB 4LSUL 3DVIA 1HH9B 4PJGB 3VWKC 5JXEA 3B5TA 1QBLH 1OSPL 1QG3A 4Q9BA 4JY4B 3SDDB 4IDLA 1EEYA 1BVKB 2YD3A 3H3BC 3O4LA 5I0DA 3R0MA 2RFXB 3ARQA 4MB3A 3QIWA 3MXWH 1P2CA 5MEOA 4YXHL 4XP1L 3V4UH 3FOLA 5HYEA 3S88H 1TITA 2JJSA 2R9HC 5JNYA 4RZCB 4P2OC 1P7KB 2ICWJ 5HD8D 4GUPB 2HTKC 4JY5L 4LMQE 4FQ2H 1FYTD 3MNVA 4LASH 3UCRA 4L4VE 4ONOA 3X12A 1S7WB 3CUPB 2OZ4A 1CE6B 2CUHA 5DC4B 4OD3H 5BVJA 1AGFA 2YZ1A 3RGHA 3S36X 3U0TB 2BVUA 2VDKL 2EKSB 1HEZA 4Z7VE 2HKFL 4NN7B 3EZJB 3QZWG 5KSAB 2VB5A 1SEQH 5ID1A 2VLRD 4YDIH 1CF8H 1AXSB 4EJ1C 3KPPA 2Q8BL 3FHAA 1T2QL 1HHHB 2QLVB 4TPRH 3PP3K 4PGEB 5T1DL 5LG1A 4R90L 1YPZE 1J05B 3MRIA 1F11B 3RL1B 5LQBH 2H1PH 3OV6A 1L7IH 3IDJB 4Q6IC 3ZT6A 2W65B 5DMYA 2EKJA 3PJSB 5IJKC 3L6FB 3C6SA 3N06B 4I18A 1MFDL 4JJHA 1GSMA 3KPRE 4WO4C 1H15A 3CMGA 4XRCB 3W81A 1IC4H 2E6PA 1J0HA 4F7TB 2W9EH 1Z5LB 2QQNL 2R56H 3HS0A 4WUUD 4QGTA 2AJSL 1UZ6E 2NLJB 1LILA 2DJSA 3T0DA 1PQZA 1IMHC 4WI2A 5JDSB 3UO1L 1KEMH 2NNAA 3KPSA 3TCLA 4HPYL 2GK0A 1I85C 4HJGB 2Y5EA 1S3KL 4JRYB 4A6YH 5JA8B 3BH9A 4K8RC 1M1SA 4OF8A 2CDGB 4OI9A 4H1LG 1QD0A 2APTA 2HJFB 1WBXB 1GPOH 1KJ3L 3MR9B 4N0UE 5E5MB 4NP4H 1UENA 1B6UA 4PJ8A 1KV3A 3SCMB 4Q9QL 2N1KA 1CICA 3QIUB 1ZGLP 4UUJA 2VISB 5C0AA 1HCFX 2R1WA 3OMZA 2IAMD 3HLAA 2BNRA 2YN5A 1RUKL 2AQ1A 2IFFL 3BYYA 1F4XH 4NQDE 3QZWA 4ERSL 3EOAA 2JB6B 5I8OL 5DJXB 3D18A 1JGUH 4MXWH 3HPJA 5IVNA 1U93A 4PJCB 1ADQL 3NA9H 3QDMB 3CIQA 4NO2B 5E56A 1QEWB 1EMTL 2AJXH 2NXZC 1UVQA 2VC2H 4NQDA 5IFHH 4N9GB 5C08B 4QXGH 4WTWA 3WIIH 5C09B 3H9SD 2VL5A 1MLCA 3QDAA 2CRZA 4LAJH 4P3DA 4NSKB 1L7TH 2XG4A 4F9PC 4ZXBA 5EZLA 3NIGE 3SJVE 3SOBL 2A9NL 4YWGL 1KULA 3HC4L 3CFCL 4JHAL 3NIDF 3LQMA 5HGDB 4FFYL 4KV5F 3IAGC 3PP4H 4XX1G 1MHEA 4XPBL 2I24N 4QKXB 3SGKA 1XGTA 4WUKL 3SGEI 4YDJA 3SJVA 4CNIA 3VFWB 5IBTH 1JPSL 2E8YA 5CBEB 2NW2B 1UG9A 4UV4L 4H1LA 4TOYL 5K9KB 5HHXL 3ZE1E 2R0KL 4KRPD 1I9EA 2R69H 3EYOB 3GMOA 4UIKH 4K94L 3ZHDA 3PHSA 4M43H 5B8CB 2GJ6E 3KLAA 1C12B 3DURB 1A6VL 1A7RL 3SPVB 2UYLA 4RAHA 4QRRB 1DFBL 5EB9A 2F19H 4NM4H 1Q0YH 2VDNL 2L7UA 1EGJA 3QUYD 5D1ZC 2XTJE 1YY8B 2DOCA 4QRPA 3G6JA 2Z31D 4OZGA 3QPXL 4XP4H 2HN7A 3IXAB 4B0MM 1KPVB 5CZVL 3T4YB 3K2MC 5CZXC 4U05A 3RY5A 1CLYL 3I50H 4MNHA 5L0QB 3QEHA 4FQ1L 4XPHL 4O2EA 3D3VE 4WI8A 2XZQH 2AJYL 4FG6D 4PJ9D 4HWUA 1QSEB 4PV8A 3EFFA 3BD4A 5IB1A 4KZDL 3VXNA 3GDBA 4UMGA 2FGZA 5C0EA 2WK2A 1DJSA 4YHOL 2NY2C 1CXFA 1BZ9A 1CD1B 1TLKA 4KH2A 2ATPB 4GMSH 3V4PH 1ZT4B 1ZS8B 3VXRA 4XNZC 1KEGL 3I2CH 3NFPB 1C5BL 3NCFB 6CGTA 2F74B 2NR6C 1KTDA 3U0PA 2YA0A 3WLWD 4WHTB 3RUGA 3FO0L 1ORSB 4ZUTA 4H8WL 2VE6B 4YZFE 25C8H 3BKYL 1EA9C 3O41A 1JWUB 4KKCC 5TGBB 2C4FT 2I9LB 5F1IB 3W9EA 3GBNL 4LCCA 2X4TA 2CJUH 3GUTB 5F6HJ 3QUZC 1A7QH 1H3PH 4GRMA 4Z8FL 1X5LA 2H6PA 4BJLA 3TJHD 4MQTB 4GKZA 3QUMB 3RWJB 5DK3A 1D7FA 5L2KE 3WNPA 3ZZ1A 4LHQB 2FECL 3QCVL 3I84A 2AW2A 5I1IL 2DI7A 3ULVE 1TJGH 2R4SH 4U1SB 5TH2B 2QKIB 4BFIA 3VDBA 1MCOH 1UADC 1WCQA 1X5JA 4M3KB 1TJIL 4NHUA 4Y7MA 4KI1A 3DXAE 4S1QH 5GJSL 2AV7A 2R0WH 3RP1A 1E4WL 2KQMA 3MCKB 4U1HA 1FYTB 1PBYA 1T2XA 1TJHH 4HJJH 4HUXA 4YHYB 5K93A 4JG1L 2FJGA 5CP3A 4WU7B 3O8XC 1NMAL 3EZ8A 3MV7D 4K3DL 5IB3B 3UAJC 5FYJD 3WD5H 1ORQA 3RIAK 3MLSH 4LGRB 2C7UA 2DQTH 4U1MA 3QDJD 2VDML 1IL1B 2VLRB 3MRCB 4QXUH 3IDYC 1HH6A 3OBAA 1C7TA 1U3HC 2A1WH 2NXYB 2QV2A 3OJVC 1INEH 5TE4H 3MREA 2VDPL 2JB5L 3AS1A 3N9GH 4WCYH 1WK0A 3BVNB 1Q9WB 4RAUB 1AGEB 3TH4T 5C3TA 1I8IB 1RZKL 3OF6D 4XZUB 2H41A 1QRKA 3PE9A 5BQ7A 3HZYB 4KGLA 3FB5B 5JQ6H 5L8JB 1I7UA 5HYJD 1E27B 3ULUE 2FYYA 3P4OA 1CFNA 3B8SA 3HR5A 1KNOA 2WW8A 2AJ3B 1DL7H 1EHXA 3LS5L 3QXAA 1FFPA 3UBXG 1RJLA 2OK0L 4K23L 1AXTL 4JQIL 4LCWD 2X1XR 2XG5A 4V1DE 5FYJL 1WZ1H 1CBVL 3EKCA 3LIZL 2Z35B 1JPTH 4OM0H 5EZOH 1F8TL 4YDVB 1G7IA 3DX6A 3IFOA 1PKQA 1ZXQA 4NUJB 5BVPH 4M1DL 2FSEA 1LEGA 3PGCA 4MMZC 2DWDA 3TFKD 1JF1A 3EYVB 3BP4A 1NMCC 4GRWB 4NNXB 3SDAA 4IBLT 3S6CA 5D2LB 2J8UB 5IVZA 4MB4A 3GKWL 5IT2L 4D8PB 1VEOA 2YK1H 5I9QB 3FRUA 3I9GL 4Z77B 2Q7YB 2DI9A 4PJIB 1EO8L 5D7LE 1ZHNB 1I8LA 5J89A 1IC5L 2NY5C 2DIAA 3AREC 3OAYK 1OQXA 1IAIH 4YXKL 3W0WE 1HINL 1NCBH 2IEPA 4WWKA 1C16A 1RK0A 1S8DA 2J88L 3WSQH 3V2AR 5IOPA 4CVZA 4HIEB 1QBMH 3M17A 3O6KL 4FXKA 2FLRT 3BUTA 5HHME 2H32H 4Z0BH 3W0WA 3H9SB 4O9HH 3T0EE 4BA8A 5I66B 3MJ8B 3BGMB 1X6NA 1URLA 4OT1H 3NMEA 1JI1A 2H26A 1MHPL 2DYPB 3BZEB 3TBVA 1QYGL 3D6GA 4LSSH 1UCBH 4MQ7B 5I19H 1W0VA 4JZOB 3VFUB 1N5YL 3CFBB 4JDZB 3UBXA 2UZIH 4K7PH 1OCWH 1WCBB 2GSIA 5LKNA 1YEIH 2OR7A 3C5JB 3T0EA 2VITA 4PRAB 1NFDB 5GZNC 5GRVL 5EBLA 3A0OA 3STLB 5IESL 1AI1L 2IPTL 1HQ4A 4O5LL 3T2OA 5D1QA 4KRPB 4M6NL 4EN3D 4WV1B 4XI5C 2DQGL 4NFDA 4TUKH 5MHSD 2CIKB 3FO2B 2I27N 1CXHA 3PV6B 1RZIB 4N8CH 1HH9A 4PJGA 3O2VL 1RSFA 1CGXA 3NCYP 5A3IC 4FFWD 1Y18B 4JY4A 3SDDA 1S5IL 2CKBA 1BVKA 3MBEC 2B4CH 4O4YL 5H94B 2RFXA 1T0PB 4ODVL 5I1JL 1GGBH 3QUYB 5EORL 2CDEB 4Z6AT 1KCRH 2FJFB 3P0GB 4ZFOL 4Z7WB 3IDGB 3KYMA 5FV1L 5IHUL 3B6SA 4RZCA 4GUPA 4QF1A 2CQVA 2FHCA 2OBGA 1MHCA 3JUZA 2BSED 3VG9B 3C60D 3R4DA 1S7WA 3MJ9H 1MFBL 3CUPA 1CE6A 3MUJA 4PJ9B 2MPAL 3BGAA 2EDDA 1ZA6B 5FUZH 3U0TA 1S7RB 4NPYB 5D96B 2EKSA 4BQ8A 4FZEL 3BPLC 4NHCL 5DJ0B 3NN8B 1CYGA 1A3LH 1W72H 2V5MA 5KSAA 2NX5D 4LGPB 3QEQE 3FB6B 4XMKL 4CAGA 1HHHA 2DM3A 3X3FL 5BOPA 3IDXH 1YC7A 2APXA 4BQBA 1LDSA 2XFXB 4RMUA 2CRIA 1J05A 1ND0B 1F11A 5CEYA 3RL1A 3KXFD 3WFZA 3OSKA 2W65A 3B43A 3PJSA 1XGRB 5KVDH 1G6RB 2IGFH 3L6FA 1JYWA 4U3CA 2OL3H 4M9OA 4F7TA 1Z5LA 1VACB 4AJ0A 2AJZB 4P9HC 3FTGB 4WNQA 35C8L 5JDSA 3HN3A 2BDNL 4AY0A 4G80B 3BRFA 5CGYD 2HAZA 4HJGA 1JN6B 4JRYA 5E2WL 5E9DE 1JUFB 2P7TB 3WV0A 2A6JB 4PYHA 2HJFA 3AAZB 5TF1H 2YD6A 4ZUVB 2LU4A 5E5MA 2YMXH 2FB4L 4NIKB 3J8F7 4X8XA 4MA7L 3QIUA 5FGSA 5HBBA 4KXZI 2J5LB 1VCAA 2H2PD 2VISA 4PJCE 3QDME 1GGIH 4P4RB 3ZDZE 4X6CE 4QHNA 1OAUL 2AABL 3MFFB 4OZHB 1WT5C 2P45B 4GKNB 4P48A 4TUJB 4NWUH 5AG9A 3MV7B 2VNCA 1KGCD 5C86A 3SGDI 2JB6A 5DJXA 5C09E 3T2QA 1KN2L 3X13A 2WUCH 4G6JH 3CFKB 4UZGA 4PJCA 1WIOA 3QDJB 3QDMA 3SQBA 2DF3A 4NNYB 1AY1H 1QEWA 4S2SB 4P23D 1KLGB 1UH3A 3CXHK 4RMQA 5GZOC 1NH6A 4N9GA 3A6OA 2ZPKH 5DZNA 5C08A 4I77H 4NSKA 4MZ2A 4LVNB 4EDWH 5KVEH 4WW2B 3ZDXE 2KQNA 5E99H 5F97E 5HGDA 1H3GA 2AEQH 5I8KH 4OIBA 3TPUA 5HPMB 3OHXB 4M4RA 5GS0L 1QHOA 2QADD 3PWJB 1IAMA 5A2KH 4LCWB 3UMTA 3VFWA 4MD0A 5D93C 3T0WA 2FEEL 4YFEA 3RJDA 3BZDA 4JEGB 5IMKB 3RPKA 5K9KA 4EVNB 3RX8A 4LLUB 4JZNB 4QRRE 2DQDL 4L5FL 3EYOA 3DGGA 4LLWB 1Z0MA 1F2QA 1NAMA 4AL8H 3MA7A 5B8CA 3MCG1 4HKBB 4Q9RL 3SPVA 2VLKE 2W9DH 4M7JH 4QRRA 1GIGL 2PYED 3V5KA 5C6WH 1YY8A 4EOWL 4XP6L 1QSEE 3UYPA 4RX4D 1OAZH 5BO1L 3IXAA 1KPVA 1G7HB 5I71C 1A5FL 1FV1B 3NA4A 3QO0B 2JJTA 3QRGL 4FTVE 5DQDH 3HMXA 4LIQH 1X5FA 1QFWM 2CPCA 1NBZB 1E28A 3HUJB 3VRIA 1CDYA 2BC4B 5D71L 1N59A 1MEXH 1QSEA 1OARH 3MRLB 1RULL 4KPHH 1IGMH 3IFLH 4LEXL 5GRUL 2P5EB 1IBGL 3DYOA 1J1OL 1CD1A 4P59H 4IS6B 4DW2H 4IMKA 1OP3H 3FN9A 1H5BC 1FO0H 3ULUL 3BP5A 1ZT4A 4CW1B 2D0GA 1IVLA 4P3CL 1TPXB 2Y9RT 2VXQL 3O4OB 1ZEAL 1BGXL 4K3JL 1T1WB 3NFSL 3P3YA 5KBNC 1WITA 2VXVH 3PWNA 4WHTA 1I8MA 3F12B 1ORSA 3HG1D 5FYJU 2VE6A 1T1XA 5J8OA 4XPGH 3O9WD 2AERT 3MRGB 1TZIA 4PGCB 4KTEH 4YBQC 1B4RA 1JWUA 1YYLH 4GW1B 4EN3B 2XN9D 2I9LA 2FJHB 4FQXC 2AXGB 5DR5L 1WEJH 5TDPB 4J3UA 5DURB 3RNKB 2NY1C 1ZTXL 2I25N 5IW3A 1IGJB 3QUMA 4L4TD 3UYRL 2G60H 4FQLL 4NKDB 4KVNH 4XMPH 4Z7VF 3LKNB 3AS2A 3MACL 4OZ4B 2K3TA 4U6VH 4U1SA 5TH2A 4Y5XB 4NQED 5DRXA 5DZLA 4E0RB 4UNUA 2O93L 2ED8A 3I75A 2WWKO 3Q5OA 4LKXB 4OM1L 1YPZF 3MCKA 3VW3H 1FYTA 1S78C 5GRWA 3NAAL 2BXYA 2VLRE 5T33H 4HFUL 3C60B 3S34L 3HE6B 2FCBA 4PJAB 4OLEA 3OAUL 5TPWL 4XCCH 3O2DA 3IFNH 3M1BB 5INDB 5FM5M 1QFWH 4P5MB 3CSYA 3UTTA 3RVVD 5GGTH 1IL1A 1I9RL 2VLRA 2NX5B 3MRCA 1KN4L 5JXAH 5EG6C 2JELH 3HMWH 1UZ6F 3G08A 2CSPA 3BVNA 1U8JA 3QI9C 4FQIH 3LMJH 4R0LA 1Q9WA 4PLNC 3KXFB 4RAUA 1AGEA 2AEPL 5CEZH 3VXMD 4Z9KB 1I8IA 4QRTA 4UQ2B 3CZFB 2DQEH 4DQOH 5D6DA 3VGAB 1ZGLA 1P5UA 1WWCA 4PJXE 3FB5A 4H0IA 3PV7A 4KZEH 4WRLA 1NGPH 3WNLA 2N56A 3O3BA 4WUUA 1WAAA 1G9ML 3JWOC 4GRWE 5LGKA 1J8KA 5D2LE 2Z35A 1YJDL 4HBCL 2YD7A 3O6LL 4I3RL 4YDVA 5IGXH 3PF2A 4NKIH 3IU4H 3ISWA 4NUJA 1FH5H 3LQAC 1Q9OB 5DD0L 4DKAA 3U1SH 3S37H 3DVGB 3GBML 3H3KA 3ME0A 3EYVA 4HJ0C 2V7NB 4XCYB 3GI8L 1EUTA 2GITA 2XKUA 1Z3GL 4NNXA 2QHRH 5D2LA 1E6OL 2J8UA 2R0LH 4D8PA 4KI5D 5GISL 1K3ZA 5ABDE 1O7VA 4JO1H 4Z77A 2IAMA 4MLIA 4IOFC 4JAMB 4PJIA 4P5TD 4NRYB 1ZHNA 4AMKL 2RIKA 4PB9H 4GG6B 5IVOA 4QTIH 4AH2B 2IBZY 3IJHA 4BFBD 2BMKB 3AROA 3TBYA 3H9SE 5LCVL 1INQB 2HFTA 2HTLD 3RFZC 3LAFA 5DJ2B 1U36A 2GY7B 5D7KE 5IFAH 3MODL 4P23B 3ZL4H 1FNGB 4XNXL 2B8OT 4NZRL 4FP8H 4PG2C 2D9QB 1MFCH 4K7PY 4YUEL 3AVEA 1NCWL 3F62A 5E6ID 1F58H 4L29A 3MJ8A 4HWZA 3BGMA 3H9HB 1NFDE 2CUMA 2ICES 1DBBH 4MWFA 3FQWB 3WXVL 4QRSB 1KBGL 3BZEA 2DQCL 4BUGA 2ERJB 1GAFL 5K9QG 4MQ7A 4JZOA 4JCLA 5IB4B 3VFUA 4BK4A 1OGAA 3WJLC 1NSNL 1Q9KB 1V3MA 3TEUA 3BHBA 3EYSH 3MLUL 4C55A 5FO8B 3U83A 5BRZE 2RBLA 2Y6SD 4KRLB 4IDJL 1NFDA 1MJ7H 3V4VL 3STLA 1XGQB 2PYFB 3C5ZD 1EFXB 1D6VL 4HWBH 4G6KH 4D9LL 2YRZA 4WJ5A 3VWKD 5GS1B 3RPIA 3QHTC 4W6WB 1T7ZA 3MNZB 2CIKA 1PX3A 3FO2A 4U0RC 4HT1H 1RZIA 4Z7WE 1N0XL 2HRPL 3PXJA 3B5GA 1IQDB 1RIVH 4GXVL 5FUCC 1Y18A 3SGJC 2Y7QB 3GSQB 3LEYL 3Q1SH 1UJTA 3GSUB 2PYEB 1BQLH 1J18A 5F1OB 4W81A 3H9ZA 2HTKD 1IGIH 3QUYA 2CDEA 5JHDD 4KVCL 2FJFA 4Z7WA 3IDGA 2Z31A 3KPQA 5IVXB 1ZLUK 4XAWL 1UH2A 4F37F 3L3DB 4KAQH 3SHSA 1Q1JL 3INUL 2AJUL 2E27L 4YHZH 4PJ9A 2C1PB 1RAMA 4HXBL 1E4KA 5E8OB 1NCTA 1V7ML 1MCRA 1YEKH 4YZFF 5IP4A 3BIKA 1J87A 5T3XL 5DJ0A 3NN8A 2YPKB 3OJDB 5EC2B 1LMKA 4XVJH 5F7NC 1LEKA 1INDL 4A6YB 1FLRL 1YECL 5HI5C 2XRAL 3PGFL 4PUBL 3R1GH 1DLFL 2EC9T 3H3PL 2XFXA 3K8KA 4WO4D 3DUSB 1CFTA 2J6EL 4OF5A 4F7CA 1K85A 1HILA 4HPOL 5A1AA 4P46A 1RZ7H 1XGRA 2GTWB 4MGXA 4P0DA 2MNUA 1HHKB 3ULVF 3HG1B 3KAAA 3O9WB 1BECA 3BUYA 4JANB 2WWKT 3V0VB 5E2UL 5GHWH 5AZ2L 3SGEH 1NFKA 2XN9B 1H3XA 2AJZA 1KCSH 2BHUA 4GRLB 2CRMA 4I2XB 1RURL 3I85A 4K8RD 3OKDB 4U6TA 4XT1C 4L4TB 5HDLA 3D39D 5CSZA 2R39A 4G80A 3BDYH 5D7SH 1LO0H 4W4NA 5IKCB 4P2QE 4XCFL 2IJ0C 4WTXA 4JKKA 3EGSA 1A64A 2IQ9H 3WJJA 1JUFA 1QPPA 2P7TA 5J11B 2A6JA 3X11B 4OZHE 4NQEB 1CU4L 3DUHA 3U9PH 4X6EB 3JWDH 3MOBL 4I5BB 1ZHLB 5FYKH 4LOUC 4OTXL 2Z8VC 4BH7B 2W1NA 3NACL 4M7ZB 3QDJE 3ARBD 4P4RA 1ACZA 4PJHB 4D94A 5JMOC 3CVHL 4ZNEA 2Y06L 1A6ZB 2D7TH 4LAQL 4R7NB 4OZHA 4GKNA 4IIQC 3C2AL 3MV7A 3HC3H 5ICZA 1AGDA 4LSDA 4FXGB 4F9LC 5EO0B 3ULUF 1N6UA 3S35L 2EDEA 3WIHL 3CFKA 1NANI 4XHJD 1FNHA 4NNYA 3ZE2F 4S2SA 4YBLB 3EBAA 5KZCD 4OJFL 2OXHA 4PGZA 3KPMB 5GGVH 4GMTH 5CJQH 8CGTA 1B4JH 3SKMB 3VXMB 1FIGL 3OF6A 3QQNA 3BDXA 4LCWE 3L7FB 5DFWH 3AS3A 4QHUA 1R24B 4WW2A 2HH0L 4LCIL 1OAXH 5HYJA 2DLTA 1KJVB 5IEHB 3GMMB 4WEUD 4ODSL 5TQ2L 4UAOB 4QHMB 3TWCL 3MQIA 5DS8A 3CAFA 1P4BL 3PWJA 1MFAH 1RJCA 5KJRH 3V52L 1ZAGA 1KSRA 4B50A 3Q5TA 3S35X 2X1PA 5CJOL 3GNML 3RAJL 1A7OH 1F3RB 3VH8B 5IMKA 3VD4A 1MAKA 4EVNA 4JO3L 4LLUA 2ICCA 4JZNA 1A14L 4PIRF 3N85L 3LN9A 3TV3H 4LLWA 1G6VK 5BW7A 1EUUA 4LU5H 5F7UA 2IBZX 5CMAA 4GAJH 4HKBA 1MF2H 3NH7H 4JB9H 5TQ0H 3BKJH 1JI2A 5HHNB 2GT9A 4P2CG 1Z0NA 4LLAA 3CVIL 4P5TB 5CZXD 3HUJE 4JFHE 3PWLB 4KK8C 1LO5B 3MA9L 2ADFH 2GJZB 3HI6L 3OQ3B 3FQXB 4BZ1L 1G7HA 1NQBA 4NWTL 4XC1L 1UM4L 1DBJL 4I3SL 4JDVB 4I3GA 4RCAA 4HK0B 4BSJA 2P5EE 1MCPL 4C83A 5EPMA 5JW4M 2D9CA 4X80H 2NY2D 2OI9B 2W0FA 4X4ZA 4Z18A 5E6IB 3H6JA 1RJZB 4KK6D 3V6ZA 1MWAH 3CCHB 1XR8B 3ZKXC 3DV4B 1QSVA 4H26B 3OZ9H 1HWGB 4OUOA 1MRFL 2XZAH 2FH6A 2MTPA 4M48L 1FL6B 4CW1A 4LVHB 2VZTA 3UJIH 1YEFL 4NZTL 3DX8B 4ZFOA 3EHBC 1ZSDB 1T1WA 4DGVH 4NQCB 3F12A 1EK3A 2FDBP 1FGVL 3ESVF 5E03A 1CLCA 3C5ZB 4ODTH 4N1HB 4LEOB 1B0RB 2ZG2A 3JVGC 1QO3A 3QUZD 4FZ8L 4PGCA 3VWKB 2Z93B 3N1QC 1UB6B 4GW1A 4EN3A 4DJMA 5GRVK 4BZYA 5DTFB 1U8QB 2FJHA 4MNQE 1PSKH 2AXGA 4I8DA 5ESVB 3HCVB 1PEWA 3QIBC 4JFDD 5TDPA 4U1IB 1C1EL 3RNKA 4N0RA 2HT2C 3UZEA 1MOEA 5SWZD 1MI5D 2XI9A 2Q86B 5EULV 1CDIA 1RZFH 1W0WB 2JE8A 2Q20A 3LKNA 4OZ4A 3F58L 1J5OL 3ARYA 1TTUA 4PJAE 4Y5XA 4CGTA 5JHDB 1J0ZA 5GSRB 4H25A 2X4OA 1A7PL 3W39B 1VGEH 4HLZG 1CE1L 5EU6D 4LKXA 5C7XH 1RZGB 2ZNXA 2ZUYA 3VFNB 3C60A 3E6HB 1CTOA 4GBXA 2C26A 1AIFB 3WL9B 4JREC 1N6VA 4MA3A 5F96L 3CD4A 1K8DA 2ORBH 1U3HD 3PDDA 5CJXC 1FFQA 3KXFE 3M1BA 3CFEB 4M02A 5INDA 1YNTB 4P5MA 3O6FC 3MNWA 2VLLB 1P4IL 1KB9K 4Q6IB 2NX5A 4QT5B 5EC1B 3SE3C 2HLAB 4ONFH 4N90D 5I1DB 4PY7B 4TVPE 4YQXH 3UTPE 2GK2A 1JHKL 1BMGA 4WO4B 3ROLA 1E0OB 3KXFA 1YEHH 1HNGA 2XKNB 1NLDL 1MCCA 3SE9L 2A38A 4UQ2A 4U1LB 4KDTC 3OKLB 2O26U 4JFFD 2O5XH 5J06A 3T0BA 4NFBA 1LDPL 4DVRL 1G9EA 4PRNA 1IFHL 1UGNA 4LSVL 5DEZA 4NZDA 2NY0D 5BZWB 4PJCF 1A4JA 4OGZA 1UM6L 2I60H 2DMKA 3ZDZF 3PP3H 4X6CF 3V6FB 2VH5H 4GG8B 2P5WB 3AY4A 4JN1L 2VQ1A 3D39B 1N6QL 2BJML 1J88A 1Q9OA 2V2WB 2YOCA 3DVGA 4S10A 2V7NA 4XCYA 5IIEB 1BLNA 4XPFH 2VIRB 3O0RL 1J1PH 4PJ7E 3WFBH 5GGQL 5TFSH 4JDTH 5BS0B 4Y1AA 5T5FL 3QEGH 3WFCL 5HVHB 1RD6A 3OPZH 3T65B 3ARED 1KYOK 2EYTB 4RWYH 3ARBB 4ODXA 4YHML 2Q6WB 4JAMA 2OZ4H 3ARGC 4CN1A 3KYNB 2UUDH 4M62L 1Z9SA 4GG6A 5DUPH 4M7LH 3ZDXF 2A6IA 1F4YL 4LPUA 2BMKA 4FNLL 1XF1A 2FZ3B 5DJ2A 1EEUA 1RUQL 4NKMA 5KTEL 2KUTA 3DO3A 4NKOB 3MV8D 1BFSA 4P23A 4WI7A 1FNGA 5KZCB 1FNEA 3P77B 2YUWA 3IDMB 1PY9A 4QEGA 3LEXB 5ADOL 1NMBL 2FR4B 5IK3B 3H9HA 3FQWA 1S5HB 4R4NC 4QRSA 2XICA 4HS8H 1LO3L 1U6AH 3GO1L 4F37K 4PJFB 3F7PC 2Q3AA 5FV2A 1A6WH 5HI3C 3CMOL 5JR1H 2OJZL 1Q9KA 4TQEL 3THMH 1IKFL 4WFHD 3RU8L 5FO8A 1UB5B 1KTLB 3TVMC 2BSRB 1QP1A 1UWXH 2OMNA 4KU1A 3F5WB 4JN2A 2ZKHH 1XGQA 4QO1A 4WI5A 4G8GD 5E2TH 1SY6L 3VXPB 5I15L 1CGYA 3K0WA 5LBSH 2X1QA 1OTSC 1BF2A 5GIRB 2HKHL 3HZMB 3VD9A 2W60B 4KQ3H 5A3ID 5GS1A 2XNAB 4FXLA 2XWBB 3SE8H 4PRHD 3MNZA 5E08L 3MBED 1A4KA 1W72B 2AP2A 2BFVL 2DL9A 1JGVH 3ORJA 2A0LD 5IVXE 5I18L 5C9JB 2P8LB 3GSQA 1X4YA 3QBTB 2ZOLB 4LVOB 4Y4HC 4JKLA 2PYEA 12E8L 1D9KC 4HIHB 4XC3H 2VKXA 4RX4A 4KXZH 3L5XL 3W2DL 4IMLB 2AAVA 4R26L 1UYWL 5I1GL 1NBVH 1I3RB 1B6DA 2DQIH 1ZHKB 3L3DA 3ARSA 4MJ2A 5FF6B 5JLZB 4X4YA 4HH8A 5A40E 4ZOEA 5T3ZD 4ZUSB 3SGDH 3HZKB 2C1PA 3UTSD 5IMMB 5E8OA 5AWNH 1NCUA 2FECI 1J0JA 1KELL 3V7AE 4I0PC 3KNBB 1Z6JT 1U8PB 3OJDA 2E7MA 4CKVX 4R8WL 5E70A 1UJ3B 1BIIB 4DZBB 3NGBC 2KKQA 5KVFL 4M5YL 4FFVD 5CSBA 2XN9E 4DTGL 3DUSA 3QDHA 3NVQA 5GRXG 2FO1A 3VGDA 2VKWA 4I2XE 2YN3A 3BRDA 2DLFL 4KHTL 1QLRB 2GTWA 3KDMB 2P8MB 1HHKA 3HG1A 4HWEL 2P42B 3RWGB 1F3DH 5HGBB 3LKPB 1AFVL 4NO5B 1MFNA 3O9WA 2D03H 4H1LH 4L4TE 4JANA 5EWIH 3D0VB 1OAKL 3VDCA 4JFXA 2A83B 2XN9A 4RWHA 2X4PA 4JFEB 3MLPA 1DUZB 3V0WH 3LH2L 1QTYT 1CVRA 1HE7A 2D0HA 3QG6A 3S5LG 4EXPX 1T2JA 2X09A 4I2XA 1CFVL 3NTCH 3HE7D 4JFDB 3BO8A 5D70L 4BUHA 3U36B 3U7YL 3OKDA 1OM3L 3FB8B 1IC1A 5SWZB 5EFIB 2X42A 1MI5B 2IPKB 4F7PB 3UTQB 1T7WA 3OX8B 4PJHE 3VH8G 1T80A 5DO2C 1XGPB 1EGJH 4NQEA 1G7MB 4UU9A 4BSWB 5J3HC 1QKZH 4CU6A 3ZKMD 5C3LD 5EU6B 1ZHLA 5FO7B 2NW3B 4M6MH 2GAZB 1YMHB 4BH7A 1F02I 4GAYA 4PJHA 3R06B 1DLHA 1A6ZA 3TZVC 4R7NA 1B0GB 2HFEB 2WUBL 2F58L 4PJXF 1U3HB 1CN4A 4FXGA 4KUZH 4QHKI 5EO0A 4PJEB 1XR9B 4MA1C 4UT9L 4CJ1A 3ARDD 3VXME 4TRPH 5KSUA 4L3CB 2OR9H 5F7DB 2ARJB 1OOAA 5D72L 5E2JA 3PWUB 1ZE3C 4GRWF 3C08H 1F4WH 2O61B 5D2LF 3S37X 1T1ZA 3KPMA 2CO6B 5ACLA 3SKMA 4MJ4A 2X9WA 3VXMA 3MGOB 3KPLA 4MAUL 3UJTL 3L7FA 1ZHBA 4ZTOH 1U9KA 1D5XB 3QQ3B 4JFFB 3OXSB 4KJYB 4XGZA 4U4BA 1KJVA 4DN3L 3BEVB 3GMMA 2R23B 3S5LA 2IPUG 3MXVH 4QHMA 1KIRB 4M4PA 4YGVB 2WBJC 4JHWL 1WFNA 2NY0B 5SWQA 43C9B 4K3EL 2IG2H 2HVJB 2DQUH 1RIHH 3VFTB 2P1YA 4HIJB 4ZAKC 1RUML 3JUYA 3QCUL 4XVTL 3VH8A 1CDHA 3GSNB 3FMGL 2VN7A 3T1FB 4TSCL 1SJEB 3UZVB 5DQ9B 4KUCD 5A2JH 3U6RB 1JTTA 3GRWA 2DLEA 2XTLA 4XMLH 5D7JC 3PQYD 5DA0B 1M6OB 3SDXA 3S7GA 1CQKA 1TETH 4JPKL 3VWJD 3G9AB 4PGDB 4OCLC 2ADGA 3TH3T 4IEFB 4LCUB 3EJZC 3QB7C 4P5TA 1A22B 2FRGP 3RIFF 4RISL 5GS2D 3DHJA 3PWLA 5CP3H 5JIIA 1LO5A 2R2BB 4I9WD 5DJYB 2GJZA 1IT9L 1HNFA 3GIZL 4OLZL 5H2BA 3P9LB 5E00B 2DQHL 5ECJE 3FQXA 4KJQC 1GVIA 4AIXA 4HK0A 1AGCA 5HPOA 4GKSB 4N8VB 1V3KA 1XF2B 5BXFA 3MV8B 4F80A 4TUOB 4JR9H 3AXLB 3SDCC 4C58B 4ONHA 5E2VH 4TVPL 3BPOC 4G8FB 5F8QC 3HNVL 1U42A 2Q76B 5E6IA 3MBXL 1G84A 2A9MH 1RJZA 1L6ZA 3VMOA 4NQCE 3CCHA 3S3SA 1XR8A 4GSDL 2BSSB 5EBGA 5DD3H 1WFTA 1YUHB 3C09C 4L9LC 5K9OB 1YQVL 3RI5F 4Z7WF 5FIEA 3BXNB 3UEZA 3MRQB 3MOAL 4D0BB 1IQWH 2AKRB 3DX8A 1ZSDA 4YFLI 4YBQD 4YR6B 5HDQH 4OLXL 5EU4B 2XA3A 4LP4A 3WEXA 1XZ0B 3C5ZA 5DVNA 4RGNC 1G7JB 3D85D 4LEOA 5CILH 3VWKA 2NY4D 2Z93A 4Q0XH 1UB6A 3RA7L 3OAZK 1KIUA 1Y6MR 5IR1B 4PRHB 5IBLC 3D25B 5C0GA 5JHDE 4FMKA 5ISZD 4U1IA 1L0YA 4J4PC 2DL2A 2A2QT 4K9EC 4O2FB 3U30C 2GIYA 2Q86A 4ZFGH 1W0WA 2CO7B 2B2XH 1RY7B 4P2OA 1GH7A 5KSVB 5F7WC 5ITBL 1T6VN 2Z4QB 3B5HA 2J6EA 4R96B 2CLZB 5JHDA 3W39A 4MXQC 4UBDC 1YEEL 1IKNC 3I6GB 4KKLC 1X5HA 2EE6A 3BPLB 1EZVY 1RPQA 1PX4A 1JNLH 3E6HA 3OR6B 3WUWB 1FNSH 1R3HB 1AIFA 5CKGA 3GMPB 2Q8AL 5BJTA 5K33A 1G9NC 4F2MB 4CADB 5CBAB 1XEDA 3F65A 5T1KD 1G1YA 3QI9D 2VLLA 1I7ZB 4Q6IA 2VTFA 3T77B 4LASL 4QT5A 3OG4B 3VXTB 5FYLD 4JPVH 5I1DA 5IJKA 4YHKH 2FGWH 3VGBA 2ESVE 4OD3L 1DQLH 2ZCKL 4WO4A 1NC4B 4EI5C 1HXYB 2XIDA 2XKNA 2P48B 3FFDB 4U1LA 1J0KA 1NC2D 1DDHA 4N0YH 3OKLA 2P5WE 3PHQB 4HBQA 5IWLC 4OZHF 1SEQL 1FVDB 4YDIL 3LKSA 1HI6B 1MCLA 4UIMB 3NABH 4TPRL 5D1XC 5AYQA 2GQHA 3BAEH 2BVPB 5BZWA 3QUKB 1OSZA 5LQBL 4ACPA 3GHEH 3HE7B 1CTNA 4PJBE 5TE6H 3WS6C 5BS0E 3RZCC 1FPTL 3D39A 4YE4H 3G5YB 3CDCA 2ZCHH 2CKBH 4Z7NF 3JWDC 3OJMB 1B88A 1IGYB 3QP3A 3U4AA 1T03H 2APBA 4Y8AA 4Z78B 5IIEA 1LO4L 2VWEE 5EH1A 2VIRA 3WN5C 1RMFH 2FH8A 3BKCL 1AJ7L 2BVQB 5EIQA 1T20B 5C6TH 1CVSC 3T65A 1YNKH 4U31A 3WNKA 4MD4B 1YEJH 2EYTA 3JWOL 3AMLA 2Q6WA 2VLJD 3SDYH 1CLZH 4DN4H 1G7LB 4ZO8A 1GPOL 5DRNA 4NP4L 3LQAL 4HG4J 1TENA 3ARDB 4NN6C 1EFQA 1T0NB 4Z76B 2PNDA 4KDWA 5BOZG 3IF1A 1F90H 5E6ZA 4PJFE 3PL6C 1L9MA 4ENEC 3U4BH 3DSFH 5JW4N 2X44D 3MSPA 1XIWC 5L88H 4RGMC 4ZOAA 3IDMA 2FR4A 1JGLH 4DFIA 4AEIL 4JM2F 1S5HA 2Y36H 5EA0H 2QEJA 3WFEH 3NA9L 2YSSB 4D0CB 3DYPA 4W4OC 2E5EA 5D93B 1EO7A 1RZ8B 4ORZC 1AR2A 4LLMA 3EJYC 2VC2L 3KLHD 5JMRA 1UB5A 1KTLA 3ZE0E 4QXGL 3D2UB 1GYAA 1DBML 3F5WA 3VXPA 3HUJF 3DSNA 5AZEH 1I9JH 2P4AB 4Y5YB 3PHOB 3IB4A 5I0ZA 4RRPG 4LL9A 5LXGL 2J7LA 3ZKSD 3K8MA 3HZMA 3PP4L 2W60A 1KJMB 4NRXB 5DT1H 1QOKA 2XNAA 1WUNT 2XWBA 3VE0B 4RFNB 3QQ4B 1MIMH 1X6LA 1I1AD 3PQYB 4H5SB 3V5DB 5D1ZA 3BIAX 1FE8H 5C9JA 2P8LA 3VWJB 3FN0H 3DV6A 2IH1B 2ZOLA 3LSOB 2CDFA 2R69L 1S7SB 4S0SD 3GK8L 5T1LA 4HIHA 5ALBH 3UTZA 3LKOB 4UIKL 5EU7C 4EZMA 5DI8B 4IMLA 5DJCB 3MCLL 1LO2H 1TCMA 1BOGB 4GQ9L 2B20A 1I3RA 1EXUA 4AENB 5EU5A 2O5ZL 4NYLA 3V6OE 5DMGC 4XPTL 1BVZA 2KDGA 1NCNA 3HZKA 3BJ91 5IMOB 5IMMA 5EUOE 5HI5D 5M94B 3OKMB 1NANH 5JXED 3B9VA 1DANT 4XP4L 1Y6NR 3PNWB 4KTDL 15C8H 4DGYH 1UJ3A 1BIIA 4DZBA 3CFIC 3L3JB 3GIVB 2YD9A 2HLFC 4JFEE 1F45A 1BQSA 4JPIB 4PJDB 4PD4K 1QLRA 1K2DB 2WAHA 3QEUB 4RRPA 4X6DE 2P8MA 1AR1C 3VXSD 5HGBA 1MJ8H 4PJAF 3ROOA 4NO5A 4IOIB 3D85B 1MI5E 3QUZA 4R97C 4GMSL 5FM5O 2NY4B 1OP5K 1JWMB 5D2NB 4U0QB 2A83A 4NQVB 1DUZA 1MREH 1NAMH 5IW1B 2DAVA 5T5NF 4JFDA 5ISZB 1M7DA 3MLWL 4JG0H 4FABL 3TLRA 2LVCA 5EU6E 5SWZA 5EFIA 1MI5A 2MWCA 1EZVX 25C8L 3UTQA 1F4HA 1TZGH 5HYSA 1PZ5A 3I3BA 1HSAA 4B7LA 5CGMA 4MCZB 4BSWA 3PG2A 5E4EB 4AEFA 1S7UB 2CJUL 3ARVA 4PJEE 1H3PL 2ADJB 5EU6A 5FO7A 3RKDD 1KIPA 1YMHA 4JO4H 5I1AA 4MAYD 3HMXH 4HFWA 3R06A 4OI8A 4W70A 4ZMAT 3S36H 4N90E 1B0GA 2HFEA 5DRWB 5I76B 3GJFB 3C5SB 1MCOL 1U3HA 5ICXB 2A6KB 1XR9A 4PJEA 1HXMB 5CCKH 4PV9B 1C5DB 5E94B 1QPXA 2ZP0T 3V5HB 1OSPH 4S1QL 4L3CA 3K2UL 5T1KB 2CGRL 3QI9B 3P4NB 3DRQA 4EXKA 2ARJA 1EVTC 1OY3B 4OCXL 1FFOB 3GSXA 1TJHL 4D0DB 1F6AB 1PJ9A 4JGMA 2O61A 3RIFK 2Q1EA 4N8VG 3LKRB 3V6BR 8FABB 4I48B 4XP1H 4Q58C 4PY8J 2W0KA 3MGOA 3WD5L 1NC2B 4JQXA 2QHLA 4JY5H 4LIQE 1D5XA 4JFFA 2OM5A 5JUEH 1DEEB 4QXUL 3BEVA 1KB5L 3W9DB 2R23A 4PJ7F 3UDWA 1B90A 1NGZB 5FK9B 2A1WL 4APQC 1INEL 5TE4L 1EJ6A 1DQDH 1OTTC 3L1OL 3N9GL 4J12A 1UEMA 2GCYA 1CGSL 4D2NA 5L6YH 2VL4A 4GAGH 1JZ8A 4OGAC 5EOQL 4HIJA 5E8NB 3GSNA 3T1FA 1L0QA 3MX0A 4PP2B 2JJSC 3O3EB 1AC6A 3O6MH 1QFHA 3U6RA 1U3JA 4F33B 3DIFB 1MY7A 2WQ8A 4YPGB 1M6OA 4HC1L 1MWAB 5ACZA 4MJ6B 4KGJA 3TT3L 1MFDH 4OM0L 3QXUA 4KMTL 3AREA 1GGCH 3DARA 4BZ2L 3DVNB 2XY1A 4LCUA 3MV8E 2VLJB 2QQNH 1A1NA 2NZ9D 3MLZL 2R2BA 5FB8B 1X3DA 5DJYA 3DROB 5E00A 1E4XL 1HHIB 2VABA 3UXFA 1A21A 2DRUA 3UO1H 5IB5B 4Q2ZB 2CKNA 2VR9A 1OGTA 1D5IH 5FO9B 4HPYH 4RIRA 1SMAA 1TQBC 5ESQB 2HFGH 1S3KH 2XPGB 4GKSA 4N8VA 1XF2A 3MV8A 4TUOA 1DP0A 3AXLA 1NBQA 5D7IB 3Q0HA 3WKNA 2UZYB 4D9RD 3BQUD 2RCSH 4UQ3B 1JIBA 1KJ3H 4I18C 5KN5B 5FCUL 3WUWG 2EZ0C 2Q76A 5I6XC 4OF7A 1NCBL 3BW9B 3RVWC 1SVCP 4R2GD 3SKNB 3DTXA 5HGAA 2YPLB 2BSSA 3OKEA 5EIIA 1HWHB 4MDJB 1V5JA 2ITCA 1RUKH 1NUFA 4OIAA 3S3PA 3BXNA 2QL1A 3MRQA 5IVXF 4MVBC 1AXIB 5ENWB 1A0QL 4I1NB 4PRHE 2BSTB 2EXYC 4ERSH 4YR6A 5JIHA 1U8HB 3UROR 5I8OH 3K1DA 5EU4A 3C8KA 2VZSA 1ADQH 1XZ0A 5J56B 4G8GA 2WIIB 2VQUA 4U0RB 3QIBD 1WICA 3MGTB 1UCBL 2R8SH 1EMTH 3B9KC 1XCTB 1YY9C 2HT2D 4OKVB 4DOHB 1OCWL 3QO1A 2W92A 5CEZE 1X44A 3MBEA 1I1AB 4AG4L 2OX5A 5L9DL 3SOBH 4YWGH 3P73B 3HC4H 3CFCH 3OG6B 4CU8A 4UV7L 4FFYH 3VXRD 2DJ4A 3RWCB 4AIOA 3TNNA 5KSVA 2Z4QA 5E95B 1HYSC 3KJ6H 4TUKL 2CLZA 3FHQA 4WUKH 1U0QA 1OD9A 2H9GB 3FFCB 2BXZA 2IALB 4NZUL 1S9KC 3I6GA 3TIEA 3K7UA 2AK4B 5HHXH 4NO3B 1MH5B 1R0AL 4HEME 2R0KH 4M1CD 5C07D 1IGCL 3OR6A 1KCUH 3WUWA 3O6FD 4ZXBC 1R3HA 3UTSA 4Z7OE 1X5XA 4K94H 1U8IA 3GMPA 2PO6C 2K7QA 4JZJB 1FL5B 2P24B 4F2MA 4CADA 1YEGL 7FABH 4YC2B 3BEWB 3PGDB 1A6VH 3SE4C 1A7RH 1TVDA 3J7HA 2FO4B 1I7ZA 5IW6A 1DFBH 3QYCA 5CLTA 4G7VL 2QJDA 1ZLUH 3VXTA 3SGKC 4QGYA 1BHGA 1P84J 5EBMB 3LN4B 2F53D 3E2HC 3QIWB 3IDNB 5MEOB 4P9MH 1O7SA 5JNYB 1HXYA 2XZCL 4M5ZL 3FFDA 3DMMC 5CZVH 3K81A 4PJHF 2ZUSA 3MRBB 5AEAA 3VRLE 4ZSOB 1CLYH 3PHQA 3VXSB 1FVDA 1GXEA 4FQ1H 1HI6A 3S4SB 2HG5B 4UIMA 2AJYH 1AGFB 3O3AB 3EYUL 3ARWA 3HNTL 5DK2B 2BVPA 2BOCB 3CU7A 3QUKA 2GSGB 2AK1L 1A6AB 4KZDH 4M6OL 4YHOH 5KVDL 2DD8H 2DTSA 2PW2A 3DBXA 4J8RA 4AEHL 1G7QA 3G5YA 2J4WL 3CXDH 2AV1A 4S1RL 2R2HB 2DLIA 4UT7H 2OL3L 1BFVL 2MKLC 3MRIB 1KEGH 3SQOH 3B3IB 2Y1VA 3ALPA 4KFZC 1FYHB 2BVQA 3C6SB 1MCSA 3TT1L 1WT5A 3G6DL 1QR4A 4HF5L 1P5VA 1H15B 1T20A 2XTJC 4H8WH 1X5KA 3MGAA 3KWWB 3WKML 4MAYB 2C3XA 2LTQC 3BPNB 5DWUH 4WIQA 3VMNA 3GBNH 4K2UH 4ETQB 5TF1L 4C54A 3KYKL 4LRIC 2B5IB 3KPNB 5J12C 3WO4C 2NNAB 5JDJA 3KPSB 4Z76A 3KHQA 5DEFA 2K7PA 4R4ND 3LKQB 3MUHL 4GW5B 1CL7L 4Y4KC 3REWB 3ZT7A 1TJIH 3UP1A 1N3NB 1UT9A 3GI9L 3AFLA 2WUCL 1MRDL 4G6JL 4NCC2 1IJ9A 2YSSA 1AY1L 2ATKA 2BNRB 3HLAB 4D0CA 4QOKD 4FHBD 3MRJB 4JG1H 3ILQD 1DVFC 1NMAH 4LQFL 1NPUA 4LQ1A 4XVUC 3HPJB 3PQYE 2ED9A 2GHWB 4F15C 4NBYB 2EDFA 1DBKL 2VDMH 5KVEL 3PHOA 2X6MA 4NRXA 2JB5H 4LGSB 3MYZA 4S1SL 5I8KL 3VE0A 4S11A 3QQ4A 1RQ5A 1MLCB 4KKBD 3E1F1 4P3DB 2BHZA 3O2WL 3PQYA 4I9WE 4OLUL 1RZKH 4HKZB 3ULVC 4H5SA 3V5DA 5KG9B 4RMSA 3VWJA 2WBWB 1CFQB 1FSKC 1AHWB 2IH1A 5LGHH 3LSOA 4XP5H 1KJ2B 3FT2B 1S7SA 5FA3B 3U2SB 2RJMA 3SBWA 3LKOA 4RMVA 4AL8L 4MYWB 4K23H 4JQIH 5DI8A 1WZMA 5FYJH 1LE9B 1CBVH 1BOGA 4LHJB 3TCXA 1F8TH 4AENA 4HZLB 1NCDH 4I0PD 3LRGA 2W9DL 1MCJA 2LQRA 4M1DH 3GMOB 1SMOA 3HI5L 2J12B 3BMWA 5AAMA 3U7WH 3DHMA 4GS7C 3BQUB 1C5CL 4TSAL 3CZJA 1H5BA 1EHNA 1OAZL 3MJ6A 4Q97A 1SJHB 5FYKE 4YIQB 1CFBA 1N5AA 3SO3C 4ELMB 3GKWH 1BFTA 5IT2H 4R2GB 2OR8A 3PNWA 4G3YL 2YBRB 1PAMA 4NJAL 1EO8H 5GXBB 5C0IB 5D2NE 3G6JB 3QFDB 1IC5H 1OARL 4OZGB 3ZHKA 3ULUC 4KPHL 4YXKH 1VB9A 4PJDA 1IGML 5ISZE 1K2DA 4LSRL 2DBJA 1D5ZA 3PWPE 1NAKL 4CBPA 4ELKB 3HNSL 3O6KH 4P59L 3D85A 2LV4A 4UOW0 4DW2L 2D7QA 2HA1A 1FO0L 5AG8A 5J13C 1JWMA 5D2NA 2ICWA 4MNGB 4JRWA 4NQVA 3ZYJA 5GGUB 2HFFA 1JNHB 5C0EB 5ISZA 3HAEH 2X4UB 1JPST 5D9SB 5HJ3A 1R6VA 3S8WA 1BZ9B 32C2A 3T2PA 3UJJL 1N5YH 3KVQA 3VXRB 2V9QA 2V5TA 1XGYL 4KROB 1F42A 1OWRM 2PCPB 2EO1A 1N64L 2CXKA 1XF3B 4OFKA 2HT4C 3U0PB 1X5GA 1WEJL 2MJWA 3RTQC 3ZKQD 5IESH 2IPTH 2X2YA 4O5LH 3P0YH 1P7QA 1FORL 2JCCB 5C07B 2G60L 4LFHD 1AO7D 4KVNL 4XMPL 3W9EB 3QWRD 3O6FB 5DRWA 1NUDA 5I76A 3GJFA 2A6DA 3C5SA 5ICXA 1BD2D 2A6KA 1C5DA 2H6PB 3O2VH 5E94A 4GKZB 1ULVA 2R15A 2HWZL 3QI9A 4OFYD 1S5IH 3P4NA 5EZIL 3T0EC 5T33L 5F7EL 1WIPA 1F6AA 2QQKL 4D0DA 4PJBF 1IILE 4ODVH 2F53B 5EORH 2AI0L 2AEWA 3LKRA 2KZ1B 5DFVC 5BV7B 4XCCL 5IHUH 2AV7B 1NC2A 5D1QC 1KENL 2W07A 2RAMA 1QFWL 4NN5C 4U1HB 3AM8A 4XWOC 3CLFL 4HUXB 5GGTL 2JK5A 3W9DA 5JXAL 1NL0L 1MFBH 4UT6H 1OD7A 4X6BA 1NGZA 5FK9A 5E8EB 2DICA 2HRLA 4IHOB 4ZAKD 1D3CA 5CEXB 2MPAH 3RRQA 1ZANH 4KK5C 3KPOB 2EEDA 4YXLL 4YHLL 4FZEH 5CEZL 3L3IB 2C7UB 1LP9E 4U1MB 2DQEL 4DQOL 4PB0L 3KG5A 5E8NA 3QG7L 5D7JD 1EVUA 3BI9X 3GJFK 5DJ6A 1ZWIB 4XMKH 2VXUH 4U1JB 4KZEL 1YJDC 5DXWA 4PP2A 2DBLL 3L5HA 4P2RD 4AT6B