1UZ6F

Anti-lewis x fab fragment uncomplexed
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
216
structure length
208
Chain Sequence
b'EVKLLESGGGLVQPGGSQKLSCAASGFDFSGYWMSWVRQAPGKGLEWIGEINPDSSTINYTPSLKDKFIISRDNAKNTLYLQMSKVRSEDTALYYCARETGTRFDYWGQGTTLTVSSATTTAPSVYPLVPSVTLGCLVKGYFPEPVTVKWNYGALSSGVRTVSSVLQSGFYSLSSLVTVPSSTWPSQTVICNVAHPASKTELIKRIEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG FAB (IGG3, KAPPA) LIGHT CHAIN 291-2G3-A
publication title Structure of an Anti-Lewis X Fab Fragment in Complex with its Lewis X Antigen
pubmed doi rcsb
molecule tags Immune system
total genus 44
structure length 208
sequence length 216
chains with identical sequence H, P, W
ec nomenclature
pdb deposition date 2004-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uz6F02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uz6F01
3MRJA 2Y7QB 3HMXL 3O9WB 4H88L 4NZRH 3PV7A 3A6BH 5B3NA 2GYSA 4JRYD 2VLRD 4JFOA 4KI5E 1OTSC 3INUL 4WHYH 3WS6A 1FZOB 4Y4KD 3E8UH 4C83A 3HNTL 4KZEH 3U46B 3O6KL 4TPRH 4ZXBA 4L1HA 4JKPH 3JV4A 5DMIH 1F4WH 2C3VA 3LKRA 5AUMB 2BY2A 4Z7VB 5TDOB 2QV2A 4PJGA 2L0DA 3BDBA 3E6FA 5IHUL 2NXZB 4TVPD 1RZJH 3DXAD 3K0WA 2PYFA 4Y19A 5IEHA 3MOQA 4NO3B 1LDPH 2R9HD 3PABB 4EI5D 3PWPB 4LSPH 1U8KA 1LO0L 5J3HC 5INDA 4P2YA 1GHFH 2VSCA 4O58H 4KKLD 4P9HL 3RGHA 5JMOC 3U0PA 3EYQD 1BREA 2BOBB 3L7FA 3SBWC 2VQ1B 4HHAA 3B5HA 2FHBA 4G43B 4TUJA 1FV1B 3ZZ1A 1J0YA 4YFEA 4JJ5B 2BHYA 3IKCB 3MA7B 5LXGH 3DRQB 5ERWA 3ZKMC 5BMFL 2HFEA 3Q6GH 3BN9C 4LPTA 4U31A 3B9DA 2NLJA 4KUZH 3SGDH 3X14A 2HLFC 2QSVA 2V5RA 3U7AA 2B5IB 2UV3A 1T7YA 1HHIB 1AQDA 5CD3A 4I77L 5IVXB 3MLTA 3D0VA 4KXZI 4NZTL 1X5JA 3U7WH 4QYOA 2X4UA 5DK0B 1CDYA 1J7VR 5F71A 4PJAE 4HIEA 3QQNA 2DQTL 2ERJC 4KROB 1B4JL 2VDNH 4G42B 4CGTA 3VGEA 5DRXA 3DROB 2QSCH 4JZNB 4XHJD 5HHOB 1GL4B 3IDMA 4K94L 3PWNA 3QHFH 3OB8A 5GISL 3U83A 1RZ8A 4IHOB 5FA4A 2X4QB 4F7CA 1OT1A 1D5IL 2HH0H 1HQRB 3GSNA 3BVNA 5IMLB 2AI0H 3N1PC 3BP4A 5T33H 2YXMA 5CILL 1UXWB 2BY3A 2XFXB 3CDFA 4M5YL 1CIUA 1U6AL 4OZGB 4OV5B 1KCSL 3Q48A 3UO1L 2Z4QA 4FQXC 3OJDB 4G7VL 4AMKL 1KPUA 4OKDA 2RCSL 3UDWC 1MFBL 3U30B 1L4IA 2F54E 5BW7C 1EO5A 4EN3A 1S9XB 5AYQA 5F7YC 1MCFA 4ZFOL 2OK0L 4NKDA 4PP1C 4M6NL 2LFGA 1CT8A 4D3CL 4LCCB 4HXBH 1KN2H 3SE8H 2YPLE 2GSIB 3JWDC 2VKXA 2AV7A 1INDH 4OCXH 4PJIA 5D1ZB 3WIHL 4QXGL 4XWGL 5E2UH 4K9EL 2DMBA 2VLMD 2OR8A 1AXSB 2YEZB 4JQVC 5EULV 4YXLL 2ESVD 5DUPH 3KPNA 4P57B 2AVGA 4LOUC 5GGSA 4S2SB 1E27B 2ZSVA 1LO2L 3QI9A 1F58H 3DSFL 2A38A 4YHMH 4FFZL 4F33A 4RIRB 3W0WB 1YNKL 4HJJL 5ANME 3LKNA 4U1LB 1KTDB 1QEWB 3WUWA 2IFFL 2A9NH 1MCSA 1JI1A 3BE1H 1ORSA 5GIRB 4WUKL 5I2IA 1HHKA 4FQJH 3MCKB 4NC2B 1UM5L 1WZMA 4JFEB 2VL5B 4FP8L 1RZ7L 2AV1A 1NMBL 5MEND 1U8PB 2VR4A 1JFQL 3PL6A 4G6AC 4QRRE 3VXUD 1LD9A 4QHNB 4X99A 5TPWH 4WWKC 4XP1H 1BFOA 1TTFA 2HMIC 4DQOL 4QXUL 5EUKB 2F53E 5FYJD 4U6XA 4GKSA 4JPWL 3UX9B 5EA0L 3RAJL 3GMLA 5EN2B 1IGMH 2XYCA 4K7FB 3EFFA 5C07E 2R23A 2W59A 2APTA 5D7LE 1S3KL 5F44A 1P9MC 1RZIB 4R4NC 5EOQH 1CD1B 1FNSL 5HGHA 3V4VH 2X4TB 3VW3L 5H2BB 1I85A 2JB6B 1X7QA 2H1PH 3Q3GB 4K3GA 4F7PB 4S1RH 3QXAA 1MJ8H 5EU5B 2ITDA 1ZEAL 3DNKA 1M71A 1CE1L 1TZHA 1AHWA 3QUZC 4XNZC 4PJEE 1JGVH 3MRMA 2BJML 3BH8B 3V6OC 1V3KA 5DVOA 1N59A 1GPOH 4UINL 5CJ5A 4AIXA 3T0ED 4LLYB 2E27H 2AJYL 3I02A 1D5XB 5J6GB 2PW1A 3FAXA 4DGIH 1ZANH 5I1IH 3OBAA 1PG7W 4JPIA 4P5KB 2VXTH 5HDQL 3WN5C 5FGBC 1BZQK 3W9DB 2BNQB 2P5EA 3TBSB 4PJ5D 2UWEB 3W5NA 1Q9WA 3EO9L 3MOAL 3OKKA 5SX4H 3TV3L 1CZ8H 1I3RB 2R2HA 1MLCB 1FLTX 4ZDHA 2ZCKL 3QEQE 4S0TD 3VDBA 3BT2L 2DQCL 5D7JD 5FV1L 5MP6L 2DD8H 5BVJB 1EIBA 4MA3B 5DJCB 3NN8B 5F7UA 1FAIH 4LFHG 1QSFB 1K85A 3ZKQD 3DVNA 2CPCA 1DBBH 2G5BA 4P4KD 1JGDA 4PV8B 4FTVE 1XGQB 4MXWH 4WW2B 5DJYA 5E2WL 4F8TA 3GSOA 2P8LB 5JDSB 2FIKB 4PB9H 4WTXA 4RFNB 4NZRL 4J3OC 1L6ZA 2XWTB 1XCTB 4I0PC 5HGDB 4JB9H 5D4QA 2XZAH 2XWJB 3RI5F 4ZO7A 4HUVB 3MXWH 4WY7L 3HI6H 2OBGA 3AY4C 4HCRA 1F4WL 5GRJL 5HD8D 2GTZB 2LAGB 3I9GL 1GC1H 1SVZA 4P2OB 2YC1B 4KU1A 3WNPA 5T3XE 5CINH 3BJ91 3EOTL 3QEGL 2O5YL 1LDPL 4PRBA 1D9KD 2DICA 2BVEA 1EAJA 1MFAH 5FO7A 3PIQA 4QHMB 4RX4D 1EPFA 4LKCA 2EDTA 3OKYA 4WO4A 2VN7A 5K9KB 4YLQT 4NRXA 3RL2B 3DV4A 4RAHA 3FO9B 5CKGA 5DQJA 3QDMD 5DR5H 5CEZE 2JK5B 2VN4A 4DOHB 1U58A 2IALA 1IZJA 4M7LT 4RZCA 1JPGA 5TDPB 4R96B 3N50A 1NGYA 4Y2DA 3OHXA 2WBJB 1T4KA 1F6AA 4ZOBA 1X5HA 5JQ6L 3LH2H 1B9ZA 2R0WL 2VQUA 4DZBA 1CXFA 1ZHKA 4U6VH 2HVKA 2HFFA 1QD0A 3HCVB 5EU6A 2YD6A 5D2NE 4U7SA 2BSRB 3NOIA 1MVUB 5FXCH 1I8MA 2VTFA 1ZV5A 3QDJE 4V1DA 1AI1H 1NDGA 3NCJH 1YJDC 4TVSa 3BSZL 1IARB 5KVEL 1JWMA 2FX9H 3ZHKA 1UENA 4HS3B 4XVJH 3BUYB 1T21B 5I74B 2NY7L 3UYRH 2XTJD 4PJDB 3AC0A 4TULL 5CWSB 4Z7QF 1EHNA 5F96H 3GK8L 1ZTXH 1SEQH 1FG9C 3PXHA 4BELD 3MQIA 1JYNA 4LEXL 2BP3A 3PGFL 1G9ML 1R3KA 4TRPL 5HI5D 2XWBA 3IFOB 4Y16C 2XZZA 5T33L 3BXNA 3WE6B 3K8MA 4N68A 1CXLA 1W0WB 3VWJA 4JQXA 5TDNA 3VD9A 2Q3AA 3FN3A 3SDAA 5HY9B 2H2SD 3AB0C 1IGFL 4MLSA 5JORB 1A7OL 4NZUL 4NRYB 1XT5A 1JZ4A 2ICEB 4AYFA 5F7DA 2YPKB 3NGBB 3C8HA 5E99L 4EUPG 1BIIB 4JKWA 4BSWA 2J12B 4P4RA 3WLWD 5C0JB 3IVKA 1EXUB 4IOFD 1DQTA 1JHKH 4PRIB 4XNMB 3HE6A 5IFHH 4I48B 2VDQL 5AZ2L 3QEHA 3IDUA 4JM2C 4NQVA 2CDEB 4I3RH 1B0RB 4MX7A 2R4SH 2YRLA 3IRZA 1T80A 3VXPA 2HN7B 2WAHA 3DURB 5FF6B 4YDKH 1A2YB 1JF1A 4GQ9L 1N6QL 2W9EL 1FNHA 2A6IB 2UVEA 1Z9LA 1F8TL 2C3XA 4JM2F 1XF5A 5EBMB 5J1AA 2F9BT 4Z5RA 2BNUA 5GS2H 1HI6B 4U4BA 1I1RA 5TQ2L 4BYHA 3TJHD 1MFCL 4HV8B 1KLUB 2DQEH 2ORBH 4P23D 2WNGA 5EO0A 5TPWL 4QRPB 3GRWH 3DUSA 3NACL 4P3DA 4G8EA 5LJYH 2ZUVA 3O8XA 4WUUB 5IJKA 5F89B 1G7LB 3UTZB 3GI9L 1UWEL 1NH6A 2IANE 4L8SB 4TSCL 1IGML 4L3CB 1MJJB 1J1PL 5E9DB 2PXYD 4Z7WB 5HVHB 3TIEA 5F1OB 4PJHF 5EOQL 5SWSA 3L3OB 4Y1AB 3QJHB 3C5ZB 5GZOD 5DGQA 1NEZG 4N8CL 5D6DA 5DO2C 2MJWA 1A1OA 3MRRA 3MRBA 5BRZE 2Y5TB 1YEIH 4WV1B 2X1OA 5ITBH 1DQQA 3U9UA 3WS3B 3KYKL 4MJ2A 5H8DA 1WFUA 1QO3B 4OFPA 3UTSB 3P30L 3ILQD 4EBQH 1FPTL 4NKIH 2NX5D 2ICWJ 1MH5A 1ZANL 3LDBC 3I2CH 2NY4C 4KI1A 4KTEH 5F3HA 1IGTB 1FE8H 5FK9A 2Q7YB 1WEJH 4NT6B 4DN4H 1J1XH 2FBOJ 3SKMB 3MOBH 3MYJA 3QUKA 4ZTPH 3G5XB 4QF1B 2B0SH 2F5BL 3QIBB 1KFAL 1F00I 2CMRH 1EEZB 2B5IC 2R15A 4HGKC 1RJYA 3WBDA 1JHLH 4H25A 35C8H 1T5XA 1NBQA 4U1KB 1NMCB 4Q74A 4KKAC 3RPIA 1K4DB 4P2QB 1H8SA 3RNQA 3FB6B 1C5BH 5JUEH 1INEH 3LHPL 1BFVH 4OD3H 1S9WA 1ZA3B 3BZFA 4MD4B 5F72S 3NFPB 3BIKA 3JTSB 1WK0A 1UB6A 5C0IB 4GKZB 5LBSH 5HYQB 5C08D 2E8YA 4MLIA 1UCBH 4HIIA 3FB7A 3RY4A 4OJFL 1H3GA 4JB9L 4X7SL 5K9OA 2XZAL 4Y4HA 3B43A 2D7NA 3HAEG 3LEXB 5D1XC 3MXWL 5C0ND 3KJ4B 3HI6L 2DJ4A 2IMMA 3QNZA 3K4DA 4Y89A 1WZKA 3QFJE 3M1BB 4NQDD 3K2MC 4XTRD 1M05A 3RWIB 1M7DA 1F5WA 1RUAL 2JIXA 4HIJA 4EXPX 1BVLA 5CJXA 3V7AE 5JHLH 3JWDL 4J12A 1PVHA 5FO9B 4AIZB 4F57H 3DSNA 15C8L 3MFFB 3A6OA 1S7WA 3R1GL 3UBXA 4UV7L 2AK4E 1K5NB 4J1UA 4YBLC 3HMXA 3TBWB 4PJAA 4LCCC 1NLBH 25C8L 3DMMD 4ZO9A 4LAJH 5FKPB 5CP7A 2DJUA 2XZCL 3PHSA 3SDCD 2HKHH 1XGYH 4HAGA 2HFGL 4YHKH 4PTUB 1A7RH 2E7HA 2F19L 3D3VE 2IQAA 4HF5H 2EH8H 3EYOA 4M3JA 4KVCL 3AS0A 3X11B 4WEUD 5KSVB 1HHJB 2N4IA 3TM6A 1P2CB 1DSFH 5JW5B 3C6SB 2J3SA 4UI2A 4M03A 1H5BC 2J88H 1IJ9A 2AJUH 2EE6A 5FCUH 5CIPB 2PUQT 5EO9B 5KSBF 4H20H 1DBJL 1B88A 4X6CB 5CZXD 1YEJL 1ZT1A 4PGCB 2WIIA 4O02L 2MKWA 2RB8A 1NFDE 1YMME 1RURL 2FX9L 4GBXB 5FUCE 5JXEC 1ADQH 2F54A 2FYYB 5MEQA 3KPQB 4XZUA 5E5MB 4HUKB 3MUGA 4R7NB 2IJ0C 3QPXL 1KIPA 1C7SA 3RWFA 2YPLA 5FM4A 1XH3A 1CI5A 3O3EA 4PGDB 4YZFE 1OPGH 1MIML 3CFKB 5DD0H 2NXYB 4N8PA 2GEEA 2OXGA 5HPOA 3L5HA 2VOTA 5E6IA 4TUKL 4YHNB 3DX6A 3GB7A 3RDTC 4XRCA 3FTGA 1IKFH 5AZEH 5HYFA 2EDNA 5ESQA 3H7LA 4KJPD 3PDDA 5E00A 3QUML 1CDIA 4JEGB 2FEDC 2Q76A 1HYSD 3MMEA 2Y07H 5ALBH 4HWBH 2OJEB 5KVFL 4UU9A 5ANMA 3SQOH 3QXDA 4UOJA 4IIQC 1I7TB 3VRLF 5DJ0A 1MCJA 3LMJH 3T65B 4CL7A 1OAYH 4KMTH 1U8NA 2NY0B 1PW3A 3ARYA 2D7MA 4NM4L 3C87A 3NCYS 1ULVA 4JFFB 3RVVD 2EDWA 4PJ7F 4QRRA 1LEKA 3V0AC 2W91A 4JDZA 1A9BB 3B2VH 1SHMA 4M48L 2HT4C 2F53A 1HINL 3RVXD 1XCQB 1ZLWH 4UQ2A 4L4VE 5C07A 1K4CA 3DX8B 4XWOD 1A6TA 2R4SL 3HRPA 5DC4B 4CVUA 1PDKA 1Q0XL 4XI5D 5D7LA 3RVTD 3TZVA 3QH3A 3I50L 5JOFA 1WIPA 2CDGB 3MXVH 3TJEH 2GJ6D 4OAWA 1CK0H 1QSEB 3P11H 2HWZL 2XI9A 4LFHD 4UDUB 1FVDB 4JREC 1IAKB 4HIXH 4Z95L 1UXSA 3E0GA 4NJAH 4PJEA 3REWA 4JO2H 4X6DF 4S1QL 4KTDH 4Z78A 4FQCL 2QADB 1F4XL 4QTIL 1F6FB 2DQEL 4P0DA 5GS1A 1QLEL 3FQRB 4I9WD 1BLNA 3A6CH 3KNBB 3HS0B 4JHZA 4LVOC 4N0YL 4ODBD 4ZPVB 4NC1E 1RAMA 5DMGD 1YDPA 3G08B 4R26L 3GBML 3ZTNH 1CGSL 1DQLH 2DQHH 5C0CE 5B39A 4HX1B 1NL0H 2R2EA 4JHBA 3CXDH 3SKNA 4PFEA 4OZFA 5FYKU 1I9JL 3P0VH 5DYOA 3DX7A 5GQBA 1T1YB 4RGNB 4ORGB 2NMSA 4PGEB 2GUOA 4P2OC 3QWRA 1PKQE 4AEFA 3QEQA 2IPTL 2E8ZA 3BQUD 4UDTA 5KW9H 2NYYC 4MJID 2B39A 2Y72A 5CJQH 2OI9B 5IMMB 2CJUH 4F7EA 5ADOH 2IH3A 1JPFA 2XV6B 3FT3A 4QRSA 1QQDA 5JW3L 2JB5L 2JCCB 1EVTC 1FFNB 3VFPA 4ELKB 2YA0A 4NKOA 4XP5H 4Y4FC 4ZUSB 3W2DL 4FTVA 3QUXD 4NKIL 4RAUA 1FC2D 3I2CL 5IOPB 2J8HA 2XZQH 5DHYB 4EDWL 5KS9F 1XIWD 5BCAA 1CCZA 2X89D 1HDMB 5IR1B 1KIRA 3PDGA 2ZUWA 4ZTPL 3F12B 1ZLUH 1YJDL 3KPRE 1CXEA 3D2UA 1X4XA 4PPTA 2CMRL 3TO4D 1JPTH 1QR1B 2O5XH 4XMPH 2OZ4L 4FQHB 1JHLL 3MRKA 4P2RB 4X9BA 5T1MB 4UOW0 1IC4L 4NDMB 1ZHBA 1INEL 1T6VN 2R1WA 5A40E 5HBBA 1E4XL 3QQ4A 5EU7C 4KFZC 4FQLH 5I1HH 4YHYB 4ELMF 1VDGA 3U36A 4PJXF 3QIWA 1KLGB 2K7PA 2QHRL 4P5TD 2PNDA 2VR9A 5E8EA 2DQDL 3VWKC 3DBXA 4PB0H 2VIRB 2GK0B 4YNYA 5GHWH 1R5VB 1OD7A 4OCWH 3U48A 2Z31D 3HPLB 4X6EB 1V3LA 1J8HD 1OP3H 1FGVH 5KTEH 2NY2B 1NC4B 4MJ5B 5D2NA 3QULA 2VRAA 2IBZY 3C09B 4CVXB 3QDJA 3T2OA 3FHQA 2KZWA 1AGCA 3CZJA 1XF1A 2BNRB 1T2QH 5IHZB 3UMTA 3EDDA 2Q87A 4PJ8C 1JK8B 3TVMB 4AJ0A 1LWRA 4XPGH 2W9DH 1HZHL 5HHNB 2UZXB 4HT1H 5AG8A 1YYML 3RVWC 2A9ML 3K80A 5I1GH 1XF3B 2LVCA 4J6RL 4LLQA 4N90D 4XNQA 2Q86B 5FO8B 2G9HA 3F7VB 3GMQA 1MI5D 3QBTB 3C6LA 3EOAB 4JFDD 1DVFC 5FB8B 5AWNH 3Q1SH 4YHZL 5GRXG 4KRMB 4R97B 1E6OH 3THMH 2J88L 5B4MC 2AJUL 1FL3B 4J3VA 1HILA 1GSMA 3O45B 3LKOB 5EOTA 1A7NH 1JCKA 1IL1A 5D7IB 1IAIH 1IEAA 3ARSA 1KC5H 4R2GC 1H0DB 4K7PH 3BX7C 1T3FA 1ADQL 4NN5C 1BF8A 5ID1A 4L8DB 3R8BB 3HE7D 5E7FA 5J12C 4YR6A 1O7SA 4FS0A 3CCHB 4XB8A 4AL8H 3QB7C 1N8ZA 4M43L 1MEXH 4CN4A 2J7LA 1NCCH 4LF3A 5TE4H 3ARGB 5DURD 2HJLB 2UYLA 1NJ9B 4HPOH 4HSQA 2H9GA 5HI3D 5IBLD 4X5WA 2QLVB 1J0JA 3KJ6H 1TQCB 4RAVB 3MCG1 5D7SH 2X70B 4HWBL 4KKBC 3DI2B 1NGPH 3MLRL 4HWNA 4LDLB 3ARBD 4Q2ZA 2P45B 4PJ9B 2P8PA 1BVKB 2AKRA 5HPMB 5JXAH 3VXSE 4RSVA 3VFMA 2ZUSA 4PJBF 3ES6A 2BOCA 1OSZB 4Z7UF 4YHIA 3EHBC 1BQHA 2ADFH 3LB6C 5HHXH 3FO2B 4NHUA 4M6OL 5T5FH 3V0WH 5HGAA 3UTQB 3DYOA 4LEOB 1U8HB 4YK4B 3V79C 3BEWA 4M8QB 4X0KB 1L9NA 1KEMH 2BFVH 3V5DA 5MI0B 2V6HA 2MHAA 4LRIC 5JIHA 2NY3D 4PLKD 3HI5H 2NY6D 4QNPE 5FUOL 3O3DA 3VI3E 5L88L 1QKZH 2OTWA 1JN6A 1X5ZA 12E8H 3RJDA 3VDCA 3MNWA 2R1XA 4HG4K 3LS5H 4KZDH 4PG2A 1F2QA 1S7UA 4ETQB 3QXUA 1J0KA 1GZQA 4Y5XA 4GG8A 1KULA 5L0QC 4HULB 5T1LB 4LSUH 3WNNA 2VLLA 2V7NA 3CDGA 2DQIH 4BUHA 5I8KL 1W0VB 3UJIL 4NJAL 4JHAL 4JO2L 1GGIH 4Z7OE 4Z7VE 4HJ0C 3VI4F 4BKLA 2DQJL 5IEKB 2GIYA 4W70A 5DRNB 4KDTA 3VCLB 3WJLC 3NAAH 4DGYH 3QEUA 1KJMA 4JDVA 3PHQB 3FMGL 4JRYB 1MCHA 2VLRB 5EO1A 3PWPE 3ZKXC 1FZJB 4Y4KB 5C70A 3E6HA 2EKSA 1HOCB 2MQ0A 4QOKD 3KPOB 3WNLA 5A16A 3LKPB 5DK3A 4GRLA 3CXDL 1R5WA 4CDGC 4XPTL 3P0VL 4RWHA 1IC5L 3U9PH 3S4SB 5CLTA 2BX5A 3QNXB 1FJ1A 2A6KB 3NZHL 2VUYA 1TIUA 2AGJL 5KW9L 1NCBH 3QAZB 1FP5A 2DMKA 3VH8G 4QO1A 4LSDA 5ADOL 3SGEH 5DS8A 1JPSL 3BZEA 5TGBA 4LSQL 5GJSH 3OAYK 2HAZA 4Q9BA 2VXVL 3OR6A 4H8WH 1IAMA 3C60D 2CR6A 3HR5B 4NKMA 3QQ3B 1TETL 5IVXE 1YZZA 1HNFA 2WUBL 5I18L 5I8OH 5KSUA 3RI5K 3MV7D 1RY7B 4LPWA 2HJKA 4YWGL 4KRPD 1FVCA 4P5MB 5J13C 1XR9B 4F3FB 5JZ7D 4LCWB 4RFOL 2C4XA 1J05B 1TZGL 5FYLH 2HT3C 4PLJD 2C3WA 2X05A 3BPLB 1OCWH 3VFTA 4EQ2A 5IK3A 2WW8A 2O5XL 3MBEC 4RGMB 3D18B 1NGXB 3ARFB 1P53A 3EO1B 2XN9D 4AEEA 4APQB 4E0RA 3SKJL 4L29A 5KVGH 2ATKB 1MRDH 1JHTA 4X6CF 4C4KO 3IDXH 3NIGF 3ULVL 5D5MF 3L5JA 3D3VA 4ZOAA 3IDIB 2FBJL 3QWOA 5EBLB 3BMVA 5LCVH 2GSGB 4OCWL 3MNVB 3CZFB 1WIUA 3DUUB 3HC0A 1OP5H 3ZO0A 1I8LC 2YUZA 1A4JA 1FGVL 6CGTA 3VXRD 5DUML 2C3GA 2ADIA 5CJOL 1EO7A 1UVQA 3EJYD 2G75B 4GRWB 1NC2D 3TA3A 2V5MA 1T66C 6FABH 4ODVH 1EEUA 4MDIB 2DMCA 4PJFE 1NFDA 1YMMA 5L2KD 4FG6D 1T2QL 1WWAX 5LGJA 1AKJA 2EYRB 3OKMB 2CKBB 1CG9A 3W0WE 3FQWB 1VERA 1AQKL 1I7UA 3OPZH 3D0LB 4CVZA 2VDKH 3VD4A 4LCYA 4KJQD 1NFDF 3MRDB 5E8OB 3RNKA 5I1GL 4JFEE 4G9FA 5BVPL 2FZ3A 4L3AA 4PRNB 4W4NA 3PGCA 4XBPB 4OLZH 1F45A 3LS4H 2ESVB 1OOAA 5F8QC 4HW6A 1REIA 1D7FA 1KXVC 5INCB 3IDNB 1ZGLB 4NZJA 2B1HL 4M93B 5IVNA 1WC7A 1DUZB 1K8DB 1HNGA 5JNYA 2X4NA 2QSQA 2YPVL 1E4WH 3D69A 4ONHA 4Y19D 4JQIH 1YPZB 5EUOF 4I2XB 1SYVB 4ZD3H 5DD6A 3SO3B 5HHMD 4JFYB 3V6ZB 5MENB 5FYKD 3T2NL 3B9KB 4R0LA 2QL1A 1AGDB 3FFDA 3HUJB 5D1QC 5HTSA 4HUUB 4OFVA 5L8JB 3VJ6B 1RZGB 2R1YB 5KG9A 1C5CH 1KG0B 5DUBB 4JFPA 2EDOA 1U9KA 5EORL 3X3FL 2AP2A 4FQ1L 4L4VA 1CN4A 5D7KE 4YE4L 3QNYB 1CICC 1PZUB 2DOCA 4YPGA 5IMOB 4OIAA 1UJTA 2QKIB 2X2YA 3ZKMD 1D5ZA 1LK3L 3PWLB 3D85D 3BN9D 3DX9A 1NKRA 5GGUB 1AY1L 2UWEE 4U6TA 3VFNA 3MACH 1WBXA 5DQDL 5KSAC 5F1SA 2VZVA 4HPYH 2OYPA 3OXRA 3GIVB 2FJFB 5DMJB 3KPTA 1P5VA 1KBGL 3SCMA 1BFTA 2NW3A 3T0EB 3OJMB 1OQXA 3BP5B 2XIDA 4DKFH 2C5DC 5BV7H 1QSFE 3H6JA 4C56E 1JZ6A 1AXTL 5KJRH 5E70A 5C0CA 3QUMA 4PJ5B 4G9DA 1F4YL 4M1CC 4MZ3A 4X4XA 4GKNA 3JWNC 1V7MH 4ZUUA 5H37G 1CFTB 5F21B 3VFVB 4FABH 2D7TL 1A0QH 3VG0H 2VXQH 4JPVH 5I16B 1PKQA 1TJGL 3HNVH 3GSRA 5MERB 4GOSA 3GJFK 5KN5A 4LBEA 3LD8B 3V52L 1PY9A 2CUHA 4NO0A 3REVA 5EWIL 1RHFA 2H8PA 2D7OA 5D96B 4M62L 4OTXH 1GGIL 5IUSA 1QFWI 1PEWA 1GH7A 4U2ZA 1X5LA 4P4KB 4FXGA 2H6PB 5IKCB 1M7IB 5I66B 3MLSL 3E2HC 4EN3D 2J4WL 3S35H 1DEEB 1I4FA 5SWZD 3HZVB 4DKDC 4PP1D 1AP2A 4RBPH 4MNHA 5E8PB 3S6CA 5I19L 5ESVB 3SE9L 4BH8B 4FMFA 1Y0LB 4TNVF 2FB4L 3FOMB 4KK5C 1HKLH 2MPAH 2PETA 3MREA 1IBGH 1MCKA 3RY5A 2R2BB 1VESA 3WIIH 5GS0H 1A6UH 3KPRA 3WHE1 2CH8A 1FH5H 4G7YL 4LOUD 3TBVA 1MPAL 3C09C 3DHMA 1F11A 3BP6A 4HUXA 1NCBL 2GTWB 3B5TA 3OR7B 1KGCD 5ILTH 1VACA 1J18A 4LCIH 4Z76B 5JR1H 5CSBA 4JKMA 1GGTA 3K4AA 3GKZA 4LASH 4L9LC 1G7IB 4G8FA 1CF8H 2Q8BH 2VDOL 4GW4A 3VGHA 1UQSA 4OQ1A 5C6TL 4I13B 3TBTA 4AH2A 3PL6D 3GMNB 3QDMB 3LRHA 5ICYB 4GS7C 2MCG1 4CVWA 4N0CC 4LARH 3MV9E 1HCFX 2GCYB 1AJ7H 5IG7B 1YQ2A 4YDJA 1V7NL 4I5BB 1TENA 4PJDE 1KN4L 2EE2A 1H15A 4HK3J 3OJVC 1XR8B 4OZIF 2IH1A 1H8NA 1E0OB 4R4ND 1G7PA 3JTTB 1I75A 3RGVC 1HHGB 2NQCA 3EDJA 2Q20A 3QIUA 1N64L 4MXQD 3RZWA 4JDTH 3OB0K 3Q5OA 3RJQB 5EBWB 1UZ8A 3ZYJA 4WRLA 3QUZD 1MRDL 4IS6A 1NBYA 3G6JB 2XTJB 3L3KB 1UZ6F 3MA9L 5DRWB 1N0XL 3ULSA 2ZNWA 3W39A 5FHBH 3NCMA 5JPMA 1RHHB 3GUTA 2J8OA 4PRPD 4NNYA 2IPUK 4OI8A 2P5ED 4BM7A 3W11C 3WLBB 5J89A 1TJHL 2OZ4A 1IAOA 1K6QH 4HUWB 4PRIE 2AJSL 4YJZL 3U79A 1FL6B 2VDRH 3U4AA 4K55A 4S10A 4D0CB 3SDXE 3N85L 2C26A 2JLLA 2J5LB 4H1LG 3PWUA 2R0ZH 5IB3A 2VLKD 2DQGH 2DWDB 3WV0A 2E7LC 3WKML 4JGUA 4KQ4H 5JQHC 2HG5A 2OJZH 3SKOB 1UJ3B 4U1JB 4KHTH 4LCUB 2EYSB 1JWSA 4DKAA 4QGYA 5FYLE 1G6RB 1T04A 4I0PD 3DUHA 2WQRA 4OLZL 5E8NA 4IRZH 2VAAA 4P46A 4LLMB 3VXOA 1BD2D 4QRPE 7FABL 5DTFB 5E03A 3ZSSA 5B39G 5DSCB 4FFYL 4JVUA 1YEHH 2R0LL 3D9AL 2KZ1B 3P0YL 4WUUE 4OZFG 4QXWA 4ZQKA 3OGCA 4WFGD 1XGUB 3LQAC 4FZ8L 3CMGA 1VFUA 3OKNA 3PP4H 3VXSA 4Z7WE 4TOYL 1T7WA 5DD5H 1A9EB 1SJXA 2D2OA 3IFPB 3VGGA 1JNHA 3HNSH 1SEBA 4OQTL 2D9CA 4O9HL 1AGBA 5ABDE 2I9TB 1T1XB 4Y1AE 1YN6A 3VFSA 1NGQL 1G7HB 4P23B 3U0WH 3G9VA 1GAFH 2Y4SA 1PYWB 4OLYH 3PWJB 4WEMB 2G5RA 3I3BA 1BX2A 4E42B 5GGQL 3U4BH 3AVEA 4YDIL 4O2EA 3VA2C 2A74A 4HAFA 3V5KB 3VXNB 3WXWH 5F7NC 3UTSE 1VGEH 1EO8H 4Y2DD 5B8CA 2PXYB 1NDMB 2Y7QA 4IRJB 4LLUB 4Q0XL 3O9WA 4YUEL 4OKVB 4WI5A 4ZNCD 1IKNC 1YEEH 2AXGB 2BXZA 4IOIA 2DB8A 5GSRB 4EI6B 1FZOA 3I3DA 2R9HC 4MNQD 1CDBA 3AREA 3UTTD 3NA9L 3UROR 3U46A 3WXVH 4EI5C 4QNPF 3VI3F 1WWCA 1ADQA 2XA8H 3QDHA 1TPXC 3MNZB 4J3TA 5AUMA 1RJCA 1J5OH 4Z7VA 2YA2A 4HK0B 4HBCH 3SJVD 3EYQC 3ZE0E 2X09A 5TDOA 3UTOA 3DJ9A 2R0KH 4PIRF 2OM5A 4KGLA 2WP3T 2DLIA 1MHPL 4P2QE 5CJBA 4XXDB 3PABA 5JW4R 3PWPA 2CRIA 2C1OB 1H8OA 4HWBA 4R4FH 5DMKB 2YD1A 5L7XH 5IQ7L 3QJFB 4E41D 2FX7H 1LNUB 2R8SH 1NAMB 2A0LC 2GHWB 2VQ1A 2VZUA 4YIQA 4G43A 4GFTB 3FRUB 1FV1A 3VWJD 4PLNC 1L0YA 5KAQG 2CLZB 3KR3H 3MA7A 3DRQA 1HQ4B 5MHSE 2CXGA 3MRPB 4OM1L 3ORJA 1LDSA 4U1IA 3WO4B 3HC4L 5D2LB 3RA7L 3TT3H 4KGJA 4PJCB 1NGZB 5C08B 3QDGB 4XHJC 1HHIA 4J4PA 3S37L 1IFHL 5IVXA 4LHUB 4CNIB 1ZMYA 3HZYA 2NNAB 3EYSH 5F9WB 5DK0A 3VXMB 3HE6D 3MBXH 1KJ3L 3PWVB 2E5EA 3T8XB 1VEPA 4NQUA 4OF6A 4L8CA 4OLUH 2YD8A 4G42A 4DAGH 1QFPA 1TNMA 1YA5A 3DROA 4MB5A 2CD0A 4JZNA 3FAWA 5HHOA 3NFSL 1T7VA 5HGGS 4WTWA 3D48R 4NRZB 4IHOA 2X4QA 4Q7DA 2DYPB 4LIQH 1HQRA 5CLWA 3C8KB 5IMLA 4LVNC 5H35B 2VNCA 2AJVH 2ZCLL 1UXWA 1CF8L 2XFXA 5IMKB 3T1WA 1EZVY 1OY3B 2Q8BL 4OZGA 1DBAL 4OV5A 4XCCH 3DMMB 3RTQB 4HUNB 1I1AB 1JYWA 3OJDA 1UA6L 4HWEL 2MKLC 3ZTJH 1S9XA 4JY4B 4TTDD 3S37X 4JVPA 1MCPL 3CU1A 1GIGH 1RFDL 1RZKC 3LPGA 3BAEL 4ERSL 2DLGA 4BZ1L 3E3QC 2GSIA 3QG7L 4I8DA 3O4OB 5BZDB 2VDLH 5D1ZA 5IGXH 1AXSA 1CLYH 2P24B 2YEZA 2HP4A 4G6FD 3HC3L 1S5HB 4P57A 1TFHA 4S2SA 2DWEB 5K9QG 1E27A 1CBVH 4XAWL 5DO2D 4M8VA 1YN7B 4RIRA 3W0WA 3UZEA 2V7HB 3I75B 4H0GA 1FYHB 1P69B 4YDLB 4U1LA 1KTDA 1F4HA 1A64A 3WL9B 2CUIA 5GIRA 2RR3A 4TVPH 4PJFF 3AM8A 3G6AB 1JZ8A 4JFEA 2VL5A 3MODH 4KI5D 4JFFE 3UPCA 1U8PA 4PTTB 3CC5B 1K2DA 3IETB 1X3DA 4QHNA 4AY0A 3CMOL 5CAYB 1T83C 4XH2A 1LO3L 1P4LB 5EUKA 4YDVB 2VMFA 1Z3GL 5EN2A 3OTTA 4JO1L 3GSQB 4K7FA 3AAZB 4MSWB 2BZDA 1MWAB 1RZIA 4KKAD 1CD1A 4F9LC 2X4TA 5T1KB 2DI7A 2FGWL 1RIVH 5H2BA 5J7CC 2JB6A 5J57B 4P99A 3Q3GA 4JFZL 3VFWB 1S7TB 1HYRC 3QZWG 1IT9L 4F7PA 4OZHB 4CMHC 2XQBH 4KPHL 4QCIB 3R06B 1FZKB 1XGTB 4HLJA 4QHKJ 2FDBP 1ODAA 1CIDA 3MRHB 1MFDL 1VGKB 4LLYA 2Z8VC 4JKLA 3ET9F 5J4MA 3EOBB 4HKZB 1D5XA 5J6GA 1QSVA 2PR4H 4OF0A 5D93B 4RMVA 1WV7T 4RMUA 5LGKA 1PSKL 5HYJE 4P5KA 4PGBB 5D7JC 2GJ6B 3W9DA 5EOCL 3TBSA 4N0UE 5GGTH 3TESA 4N8VG 2W0FB 2UWEA 2JIXD 4CRPA 3PP4L 1U42A 4RGNE 1I3RA 4RMWA 3P77B 1MLCA 2NCMA 2BSTB 3N9GL 2BCKB 4CMMB 1YYLH 3HRZB 5IF0B 3KYAA 2IAMA 3QHZH 4OB5H 2HKFL 3LN4B 5BVJA 1INQB 3O0RH 3NN8A 4MA3A 5DJCA 5E6YA 4GRWH 4ZOCA 2W0PA 1OAKL 1QSFA 3HR6A 2JCCE 5F7EL 1JYXA 1I1YB 4C56A 3C08H 2JELH 4N5UA 4PV8A 1A6WL 2IBZX 1XGQA 2YUWA 5HD8C 2CK0L 3KYNB 4LSVH 2CKBH 4WW2A 5D72H 2P8LA 2FIKA 1KTRL 2VXSH 2XWTA 1YEEL 1XCTA 5HGDA 1P5UA 3KXFB 4NFDA 5AD0B 2XWJA 4IM8A 1D9KC 4HUVA 2DI8A 1BOGB 5IESL 2GTZA 1J5OL 5K59E 1MLBB 2PCPB 4NN6B 4XVSH 4G3YH 1I9IH 2YC1A 3UZQA 2F54D 4P2RE 5J1TC 1Q94B 5A3IC 5JXED 5F6HI 4XP9L 4BFGA 3NH7H 2FATH 1G9EA 1FORL 4UILL 1Q1JH 4QHMA 5C9JB 1XIWB 1SY6H 3GMOB 4NGHH 3TCLA 5A2IH 1RUQL 4UT6L 4LK4A 5K9KA 5E6ID 2I60H 3FB8B 1CLCA 1EFQA 3FO9A 5L7XL 3O6LH 2JK5A 2DDQH 1UM6L 1Y18B 3TO4B 4RNRB 1N3NB 1UFUA 1MRFH 3CJJA 5TDPA 4KY1L 4R96A 1YEKL 1RZFL 5LGHL 4PUBL 2WBJA 3MV01 2PO6C 2PYEB 3MRIA 4UNVA 1MELA 4MQTB 4NP4H 3Q0HA 1UG9A 2FHCA 5I0ZA 3QUYA 3HCVA 1OGAE 1YQVL 1QBAA 2BSRA 1EAPB 3BD4A 1MVUA 4W4OA 3U2SB 2KL6A 3QSKB 4CN1A 4DN3H 4U6YB 2BNRE 3K7UA 4P5TB 2B2XL 3TNNB 3MV9A 4HS3A 5FDWB 3BUYA 1T21A 2F5AL 4DTGH 4YC2B 1NFIB 4PJDA 5CWSA 4ZFOB 2Z31B 3L3HB 5C07D 1BEYH 4DAGL 3EO0B 4LU5H 1J8HB 4LNVA 5D7LD 2H2SC 4GAGH 2R29L 4I1NB 2ZUYA 4GRMA 1WT5C 1JGLL 4KMQA 3NCEB 4NHCH 1ZGLP 1F42A 1JRHI 3IFOA 3DTXA 4JE4B 1PZ5B 2OP4L 2ZPKH 3WE6A 2HTKC 4XPFH 1W0WA 4EUPB 2VZSA 3KYMB 4IEFB 3CDYA 3TCXA 3O2WH 3O3AB 4PBWD 4XCCL 4IOFC 1LP9B 4IRSC 5F6IB 5HY9A 1BF2A 2MSPA 1C8PA 4ZTOH 4FRWA 1RIHL 5D7IE 1NCUA 5DMYA 5JORA 1XF4B 5I76B 3MJ9H 4ZFGH 2NY1D 4L1DA 4NRYA 2ICEA 5FUZL 2DM7A 5F8RC 4KQ3H 3LQAL 1BIIA 4JJHA 2VE6B 5C0JA 1GIGL 1EEYB 4OSUL 1F3RB 5FAAA 1UCTA 1EXUA 4Y5YA 5JHDD 3LN5B 4LHQB 1FLRH 4PRIA 4ENEC 4XNMA 4I48A 2XXMB 3QWRD 1P7QD 2CO7B 3SDXA 2CDEA 4GXVL 1B0RA 5DJAB 4FQ2L 1VADB 4H8WC 4CBPA 2HN7A 3DURA 5FF6A 1YC8A 2ZG2A 3STZB 4GH7B 1EHLL 1A2YA 2UZYB 2ICWI 3HE7B 3SGKA 2A6IA 1KCKA 4YGVB 1G6VK 5EBMA 3LIZL 4FTVD 4RRPG 5DFWH 1HKFA 4BK4A 1HSBA 2ZZUT 3G04B 5DURB 1HI6A 3MODL 4U0RC 4HV8A 2GK2A 1NCDH 3ZHDA 3L6FB 4QRPA 1GGYA 3VFUB 1MCCA 1ZHNB 2P42B 3TN0C 5GZOC 5L2JB 1IC7L 1JNLL 1MSPA 3KDMA 4LIQE 4WUUA 5F89A 3UTZA 4M7LL 2IG2H 2MCPL 4F80A 2EH7H 1DLFL 4Z77B 4L8SA 3ARBB 5DQ9B 4NQED 3ARDB 4G8IB 3BH9B 4IDJL 4L3CA 1MJJA 5T3XD 5JDJA 5E9DA 4D9RE 3V5HB 4Z7WA 5F1NB 2B4CH 1S7XB 2VL4A 3ULUH 2VITB 3ILQC 1CDHA 2OSLA 3L3OA 4LAQL 4GUPB 3OL2A 4HXAH 4Y1AA 3QJHA 1BGXH 1RI8A 4O4YL 3C5ZA 1D5BB 3BKYL 1NAKL 4F58H 1MJUL 4WU7B 4QXTA 2Y5TA 1KPVB 4WV1A 5E0QA 3WS3A 5CEZD 3L1OL 3GSVB 4W6XB 4XVTL 3QIWD 1MCWM 3VGBA 1QO3A 2NY6B 3UTSA 5IJVB 3ZL4H 1UADC 2E7CA 3MFGB 4PREB 3B3IB 2J8UB 5TE6L 3VG9C 1IGTA 4NO5B 4JRYE 2VLRE 2Q7YA 2NTFB 1U8LB 4NT6A 4JZJB 1PX3A 5FGCE 5GGTL 5GXBB 1EGJL 3MYZA 5T3ZL 3G5XA 1AD9B 4QF1A 4E9LA 4Z0BH 1NCWL 3UYPA 1JNNL 3OKEB 3QIBA 2P44B 4H26B 1QOKA 2V17L 2H32B 1EEZA 3GO1H 1U3HC 5D8JL 1NQBA 4FQQB 3M17B 4AM0B 4TVPE 3CPLB 4QHUB 4U1KA 2AK1H 4F7TB 4LGPB 3B9AA 3NABH 1K4DA 4P2QA 1RD6A 3B9VA 5F9WC 3BPNB 3FB6A 4ODHL 1JP5A 1KACB 3CUPB 4MXVE 3RVWD 5C0NC 1ZA3A 2VZ3A 1HWGB 1SBSL 4MD4A 4QOKB 3NFPA 3JTSA 3ZDZF 2CXKA 4NJ9L 1CL7I 5IV2B 5C0IA 4GKZA 5HYQA 3C6LD 1T5WA 2CKBL 4HKXB 4HUMB 4XTRC 5C0BB 2F15A 1MF2H 3P9MB 5GJTH 2AABH 4Z9KB 5IM7B 3S5LG 4OGXL 4OLXH 3S36H 3BGFB 4JFHE 5IT2L 4OD1H 4XP4L 1F90H 2EYTB 3PV6B 5IWLC 4V2BA 2W0KA 1RIUL 3LEXA 4LCWE 3T3ME 1OWWA 1S7QB 1G6RH 1LE5B 3M1BA 3DMMC 1X5FA 3MJ6A 5ADPL 2FJHB 4W6YB 1UM4L 4HS8H 3RWIA 4R2GD 3SDCC 4G8GB 3FT2B 3RUGB 1RZKL 2JJTC 1TCRB 3BYYA 3L7EB 4TNVK 4RA3A 5FO9A 1SM3H 3FO0L 3MFFA 3CFJB 4FQIH 1LO4H 3U1SH 3WFEL 2QQLL 1K5NA 4KRPB 1CLZH 3TBWA 5C0AD 3IXAB 5B38B 1E4JA 2I60L 3QO0B 4R90H 5FKPA 5IQ9B 2DBJA 3UJJH 5LQBH 4HEME 3OZ9L 2DDQL 4PTUA 2AEWA 4Y0GA 43C9B 1CU4H 1RK0B 1FC1A 1EX0A 1S8DB 5CZXC 3X11A 4V2CB 4WJ5B 5FYJL 2XN9B 4XNYL 1HHJA 1P2CA 4F7MB 5JOEA 5JW5A 3C6SA 3IAQA 3P40A 1CFQB 4TSBH 5GRUH 4UQ3B 2CK2A 3TO2B 4TNWF 5CIPA 4QKXB 3LB6D 5BV7C 5EO9A 4GRWE 2ICWB 2IF7A 1LHZA 5K9JH 5DJXB 4PGCA 4N9GB 2IGFL 4GBXA 4HIHB 1GOGA 2FYYA 1S9VB 3KPQA 5E5MA 4R7NA 2IAND 2I26N 3H7BB 1HYSC 4FFVC 2R56H 3BHBB 2BDNL 3WSQH 4LU5L 4DGVH 2ADGB 4XGZB 4QRUB 3MJGX 2VLME 1F3JB 1L7IL 4YHNA 1PY4A 1QACA 5HI4C 3WIFB 3HMWL 2L7UA 2P7TA 3FN0H 4KK9C 3S34L 1ZK9A 3QCUL 5E4EC 3RVVC 5CBAB 5BRZD 4GG6F 2OJEA 2PKDA 4Q9QL 4FZEL 2DM3A 5DEFB 1G1CA 3MGTA 3Q5YA 1WICA 1ZGLM 1C7TA 1T1WB 3RVXC 4HFUL 4ZFGL 1YPZE 3F65A 3MRJB 3OXSB 1AIFB 4I2XE 4ODXB 3RX5A 3T2QA 1JUFB 4KQ3L 4XWOC 4NIKB 1FDLH 2GFBB 4BJLA 4CU6A 3RVTC 4JFFA 5BS0D 2O5ZL 2J6EL 3EYUL 4AEIH 2DTML 3PXJA 2VO5A 3FFCB 3HUJE 5CKAA 4QHLB 1A9BA 1FN4B 1RJLB 2EXYD 3CVHL 1XCQA 4O5LH 5HDBF 1AE6H 1NUFA 3DX8A 5TJWK 5IEHB 5ELIA 3WJJC 3SGJA 4KKCD 5A2KH 1KTKE 5EZOH 2C7UA 2LV4A 2CDGA 5HHMB 1CFNB 4CDHA 1QSEA 3KG5A 4UDUA 1FVDA 1MY5A 1WFTA 4MYWB 3SEPA 1IAKA 1R0AH 2X5PA 4K3JL 5CD5C 4JPKH 1KENL 3L7FB 1HXMB 4HHAB 2VISB 4MCZB 3T0EE 3IAGC 1TJIL 2VQTA 4JG1H 4BZ2H 1NCDL 3FQRA 2BMKB 4L9DA 1P4IL 2KDGA 3KNBA 5EC1B 1T03H 3W82A 2HFTA 3RX8A 4YEFA 4TSAH 1MHCB 3BQUC 4NQTA 5ERWB 1BHGA 4QWWD 3CFCH 2HT3D 5HYJA 1X5XA 3G08A 3D85B 3QFJD 1OWRM 1ZT7A 3VFGL 3KS0J 4HX1A 4PJ5E 3WD5H 3U4EB 4UIKH 1IM3B 1T1YA 4ORGA 3PGDB 4WIQA 4PGEA 1KCVL 4F15C 3X12B 3QUXC 4RMQA 1ACZA 2AK4D 3SDDA 4L4JA 3UC0L 1OF2B 3ZSTA 5IMMA 1GGCL 3D39B 2CGRL 2ERJB 4IMKA 4PJIE 5E5RB 2DJSA 4X8JB 4ZFFB 1YEFH 2JCCA 1QRND 4Y5VC 4HBQA 5I30H 4ELKA 4MAYA 4DKEH 1YNLL 4ZUSA 4LGSB 3HZKB 3MLXL 3PNWB 5DA4A 4ZS7H 1DBML 3VFOB 3GSNB 3SPVB 5IOPA 1KCRL 2EDDA 1V3JA 5DHYA 5AYUH 3DO7B 2N56A 4YFLI 2G60H 1HDMA 1UH2A 2P5WD 5IR1A 4JN1H 3F12A 5I1KH 3BMWA 2LABA 4Z0BL 3G5YB 1J1OL 1IEBB 4R8WL 1TTGA 5ITFB 4FQXB 1AR2A 3QP3A 1O0VA 1A3QA 3MRQB 1T66D 3JV0A 2DM2A 1VHPA 3FHAA 1OARL 1QR1A 3BGAA 1YMMD 3IFNL 5D6CB 1AKJD 1E6JH 4XP6H 4FQHA 4M5ZH 1MREH 4P2RA 4UOW1 5T1MA 5SWZB 3F62A 3FT4B 4NDMA 1Y6KR 5I1AB 1A5FL 3P73B 4F2MB 3H0TB 4KHXH 2Z31C 3JWOC 4C55A 5FOJA 3QDME 3WFCH 4ODSL 5C0GB 5LWYH 3MUHL 2OL3B 3ZDXF 1KLGA 4KV5E 2AEPL 2OMBA 1F90L 3GSWB 5JOPE 5C7XL 3ULUE 2VIRA 2GK0A 4XC3L 4MQXD 5FA3B 1R5VA 4PRHB 2OCFD 4HQQL 4OF3A 3HPLA 4X6EA 4WU5B 1S9YB 3NVQA 2BVOA 1F97A 3EW3B 1NC4A 1OGAA 4MJ5A 3OGOE 4HS8L 2ARJB 1I9RH 4XHQA 4PV9A 1J0ZA 4CVXA 5IB5B 3WEXB 1T89C 3LPFA 1WZLA 4H88H 2BNRA 1DCLA 4FQIL 3MV11 3INUH 3H3BC 4HKBB 4I18C 4WWKB 5IHZA 3PJSB 4P9ML 5E5UB 1PEZA 1JK8A 3TVMA 4U6XB 4JN2B 2DQFB 1QZ1A 2AS5M 3GMLB 3KPSD 3O6KH 4XMKL 1X9QA 2XTJE 5HHNA 4DVBB 4AT6A 3B6SB 4L4VD 1QFWL 4CU7A 1CICD 4ZUWB 3EDEA 1K9TA 3KGRA 1XF3A 2Q86A 1ACYL 1VEMA 5FO8A 2ED9A 4LLAA 3F7VA 5IHUH 4L3EE 3EOAA 5FB8A 1SBBA 1JTTA 3KHOA 3O11B 2V5TA 2IFGA 4LDEB 4DJMA 1U8JA 2CDFA 3IXTB 3QUZB 4XNZB 5KSAD 1LO0H 1FL3A 3KPPB 1FYTB 1U8QB 4M7KL 1EH9A 3O45A 3CSYA 3LKOA 3SCMD 4P9HH 4PY8I 5D7IA 5SX5K 1DLHB 4BH7B 1MFNA 5HI3C 1H0DA 3MJ7B 3BYTA 2BY1A 1EERB 5DT1L 2QQKL 4L8DA 3TNMA 4PRPB 3WN5B 3O6FC 3SOBL 2X4RA 2EEAA 3T3PE 5C0CD 5TF1L 3CCHA 5BMFH 3OKKB 4M1CD 5FM5O 4ZODA 4MNGB 1GCFA 1C5DB 3V8OA 4WVRA 3NTCL 3ARGA 2HJLA 3BO8B 1NJ9A 2YD4A 1QR4A 5ENWB 1X4ZA 4BQ9A 1KUMA 3KPLB 2VLKB 2O26U 1ORQA 3BPCB 4NZTH 2LVEA 4NO0D 1D6EB 2X70A 1AO7B 2DQTH 1NAML 1B4JH 4PJ9A 4DCQB 5EPMB 1BVKA 5HPMA 3JV6B 5I73C 1CR9L 1X5YA 5FOBB 1OSZA 2YK1L 1DTUA 2NY3C 4K94H 2Q6WB 2BRRL 3DYPA 1AGEB 3FO2A 5GISH 4I0PB 4POUB 1TTUA 1DQML 3EYFB 4AEIL 1D5IH 4JCMA 5BOZG 3GJEB 1BD2B 1I1FB 1U8HA 3NPZB 1RMFH 5EU6E 3KPRD 4M5YH 3L3JA 1KCSH 4XXCA 4M1DL 2C4FU 5KBNC 3CSGA 3UO1H 4G7VH 4AMKH 5E94A 1DL7L 3T0AA 3GNML 2YBRB 3RY6C 2RCSH 5GS2D 1QBLH 1MFBH 4ETQA 4B0MM 1ZVYA 5FDYA 4NQCD 3HHRB 5ALCL 2OK0H 2DRUA 4M6NH 5T1LA 1I8IB 3STBA 2RHEA 3BPNC 3H42H 4NRXB 2FRGP 4UUJB 1W0VA 5DQJB 3WIHH 4QXGH 4XWGH 4NM8L 5I9QC 1IGCL 3GI8L 4K9EH 1A1MB 4X7TB 5IEKA 3NZ8B 1CWVA 2ZJSH 4N0CD 4MD5B 5DRNA 3H9HB 4YXLH 4JG1L 2N7AA 3VCLA 1F6AB 2WIMA 4EUPH 1D3CA 1LO2H 1UKQA 3PHQA 2V5YA 4JRYA 1OSPL 4FFZH 2VLRA 4UT9L 3VH8B 4K71C 1YNKH 3BPOC 1EZVX 1HOCA 4MNQB 3KPOA 3P4OB 3UTTB 3O41B 3B2UC 5IROC 5IROA 3RGVD 2IFFH 3QIUD 3ZE2E 2ITCB 3S4SA 2VZTA 3QNXA 4WEBL 2A6KA 1UM5H 3C60C 3LSOB 4FMKA 4FP8H 3SJVB 1RZ7H 1NMBH 5GRYA 1JFQH 4NUJB 1GGBH 2YD3A 5C0FB 4KRPC 4DQOH 4QXUH 1I1CA 1A6VL 1YEFL 5JZ7C 4JPWH 2XQYG 3RAJH 3T4AB 5ETUB 5I30L 5BQ7B 5D2LE 3FRPG 4PJCE 5C08E 3HR5A 3QDGE 3QQ3A 2ZOLA 5ECJE 1EHAA 1S3KH 4E41B 2APFA 3W11D 1FNSH 5E6ZA 4Y16B 3VW3H 3VXME 3RWDB 1W72B 1XR9A 2F8VA 4F3FA 4LCWA 4ZAKC 3TH4T 2I9LB 1ZEAH 1J05A 4M4PA 3MLWH 3AB0B 3ISWA 2BJMH 4UINH 4ZG1A 5C3LD 1EA9C 3D18A 3LZFL 2AJYH 2OX5A 3ARFA 5ISZD 3EO1A 5E08L 3RZCA 1A4KB 1KJ2B 4EJ1C 4APQA 5J56B 3GMMB 2VZ1A 1LEGB 5HDQH 3O2VL 4YXHL 2ATKA 3ELAT 4JO3L 1MWAL 4PBVC 1NBVL 3HZMB 4J8RA 5C6WH 3EO9H 3TV3H 1T0MB 5EH1A 3C5SB 4P46D 1Z9MA 5DWUL 3VE0B 5GGTA 3HI1B 3EJYC 4JR9L 4HC1L 2GITB 3OAZK 3IDIA 3IT8D 3MGOB 3BT2H 2GSGA 3KLAB 3NIFF 5MP6H 3MNVA 3CZFA 3UXFA 5DVKA 4XNUL 1XF5B 3VXSD 5J1AB 1IILE 5IP4A 3PHOB 4OCYL 4PY7B 3JXAA 3TWCH 1E4KC 2G75A 3CDCA 4KJQC 4JM4H 4NQXB 5E2WH 5MEPB 3KPMB 2EECA 2VDPL 1DE4B 2W65B 5FM8A 4MDIA 4PJHB 4X83A 3WS6C 2RBLA 2AQ1A 2EYRA 2CKBA 4DVRL 1BAFL 1IQDB 3FQWA 4NWTL 4U1SA 4ZXBC 4WY7H 2A2QT 3D0LA 3KYOB 4BK5A 2H32H 5F7KC 4NWUL 3GJFB 5GRJH 4ESKA 3L3GB 3D25B 3N06B 1WUNT 5KVDH 3I9GH 3MRDA 3O9WD 3QYCA 5E8OA 4YX2L 3VMNA 3DGCR 1Z0NA 3Q6FB 2BSED 3EOTH 4XBEL 3QEGH 4XBPA 1C08B 1OAXL 2ZP0T 2O5YH 2ESVA 3ARED 3TP4A 3K4ZA 5INCA 1TDQA 1HH6A 4K8RC 5I6XC 3IDNA 3MRBB 2XPGB 1ZGLA 3U9UB 4MB3A 2YZ8A 3M45A 4PJGF 3N1FC 3M8OL 5L9DL 4MGXA 4C58B 5CCKL 1DUZA 1U8OB 2IQ9H 1K8DA 1SY6A 2NXZD 1HN1A 4WFEE 1YPZA 4I2XA 1HIML 1SYVA 3ECBB 4LPVA 3LDBB 2NY4B 3JUZA 3PWPD 4JFYA 3V6ZA 4ACPA 5MENA 4YAQB 3B9KA 5JQ6H 4X9GA 2R0WH 1OB1B 1AGDA 3HUJA 1W8OA 4M61B 4P59H 4HUUA 4LSSL 4WTZG 3VJ6A 1RZGA 2R1YA 4KK6D 5DUBA 1KG0A 2DQUL 1F6LL 2A0LD 4LGRB 5IIEB 2BC4B 3ZKNC 1YECH 1RJYB 2Z35B 2ZCHL 3QNYA 1T5XB 2FL5B 3OQ3B 5IMOA 1EVUA 3BSZH 4DW2L 5KVEH 3GSUB 2QKIA 3RNQB 1DQJB 1T1ZB 4MMXC 1SMAA 3PWLA 2H41A 2NY7H 1S9WB 2FLRT 5GGUA 2EICA 4TULH 5DJ6B 4N1HB 4W68A 3GK8H 4J4PD 5T3ZD 1FCCA 1FCGA 4M7JL 2FJFA 4LEXH 4NCC1 1LILA 3PGFH 4OCSL 3T0EA 5HYSG 1G9MH 4TRPH 1P7HL 4WHCA 2APXA 1KB5L 3BP5A 4R4BB 5D1XB 4KROD 1RMFL 3WHXA 4RGOL 3T0BA 2WBWB 1SQ2N 1YNTB 1A7PL 1G9NL 4PJ5A 1JGEA 3LKSB 4CAGA 1IGFH 1CFTA 1BVLB 4HJGB 1A7OH 3MROB 4NYLB 4NZUH 1QBLL 3VFVA 4EN3C 5F9OL 5I16A 4KC3B 2O61A 3KXFE 5MERA 5E99H 3KWWB 4J1UB 4MAUL 3MJ9A 3RL1B 3JWOL 4YBLB 3OF6A 1FBIL 3VFRB 2YWZA 3H42L 1NCNA 3UPRB 2VDQH 1UWXH 5AZ2H 2ZJSL 4P4KA 2H6PA 4TQEH 1ERNA 5IKCA 1M7IA 5I66A 4RWYL 5KSBB 1DEEA 1VFBB 3QI9C 3HZVA 5LAXB 5E8PA 4PJIF 5ESVA 2Q7NA 4S0SD 4BH8A 4K23H 1Y0LA 3FOMA 4GQ9H 5D1ZD 2W9EH 1S7VB 1N6QH 1H5BB 2AEQL 1F8TH 2YA1A 2YRPA 4NSKB 1O5DT 1TVBB 2R2BA 2N1KA 5EIQA 5GGRB 1XAUA 3BESR 1SJVA 2JJSA 5KZCD 3CIQA 2YN3A 1CE6B 4PLOB 5TQ2H 3PL6C 3QG6B 1MFCH 2GTWA 3OR7A 3W0WD 5MEQB 1N5AB 2PYEE 1GGBL 4Z76A 3BP7B 1BQLL 4MD0B 2P8MA 3NACH 1G7MB 3R4DA 1G7IA 4RX4A 5I1JL 3GI9H 1UWEH 4TSCH 2Y6SC 3TFKC 5CBEB 4JFED 4YFDB 1J1PH 3V4PH 1QFUL 1T22B 1MCLA 1QFHA 3GMNA 3RDTB 1T20B 3QDMA 5ICYA 4D9LL 2GT9B 5ESQB 2EIZB 3LEYH 1I85C 2VLJD 4Y88A 5J11C 4MXQC 3ULUC 2GCYA 3H9YA 5IG7A 1RV6X 4N8CH 4UU9B 1H3UA 2CRYA 4I5BA 4PJ7B 3V0VB 1AHWC 4IIQB 1IQWL 3MLWL 1J8HE 5GGRY 1PLGH 3G6DL 1XR8A 4P3CL 1U8NB 3KYKH 5GS3A 3MUZ1 1HHGA 3P30H 3ULUF 1KPRA 1FPTH 5CJ8A 3DVGA 1LEKB 3S3SA 4G5ZL 5E2VH 5EBWA 3ZYIA 1I7ZB 1U8IA 32C2B 3QCVL 2F8XC 1QYGL 3P4LA 3G6JA 2F5BH 4WNQB 3L3KA 3JVGA 5D7KD 5DRWA 4XPBL 1KFAH 1KCUL 2BHZA 1I7RB 5B3JF 5F88B 1KT2A 4LHJB 4X6DB 4H1LB 2AJ3B 1Z2KA 1Q0YL 1N4XL 1NUDA 1RHHA 4L3EA 4N5ED 3WLBA 4HD9A 1RU9L 4TNWK 4HUWA 2VWEE 4L5FL 3LHPH 2IBBA 1FGNL 4JREB 1FL6A 1YEDB 3BZDA 4OGYL 4D0CA 3TWCL 1DANU 3F7RA 4JM4L 2IAMD 4WI4A 3GHBL 1S78C 4OJFH 2DWDA 2BSSB 4X7SH 4LVOB 4LSTL 1QSFD 1M6OB 5IBUB 1NSNL 5CFHA 2FR4B 4C56D 1GGUA 3LPWA 3SKOA 1A3RL 1IGIL 3P9WB 1UJ3A 5GGVL 3SGDI 3UAJD 5JHDB 4U1JA 5KVDL 4A6YL 4LCUA 2EYSA 1P7QB 1G6RA 1RUAH 5K9QI 4PYHA 5DRZB 5BZWA 4UDTB 4LLMA 3JWDH 1MHEA 2CRZA 1FO0L 3OSKA 4F7EB 5DTFA 15C8H 5DSCA 3H9SB 3R1GH 4UV7H 1CDUA 1U95B 4R3SB 5C0EB 4MCYB 4WO4C 2DI9A 4IBLT 4YFLF 5KS9B 25C8H 2DLFH 3VFPB 4OFDA 3BFOA 3T08A 3F7PC 1XGUA 2OL3H 5DLML 2IQ9L 2XZCH 4Y4FB 1BP3B 3GIZL 2HFGH 5A3ID 1S7SB 1A9EA 3IFPA 4M6ML 2F19H 2B20A 2PW2B 4Y2DC 4KVCH 1T1XA 4KJWD 4L4TE 1JRHL 5EFIA 1G7HA 2ATPB 4P23A 3X3GL 4OM0L 1A3LL 5DI8A 2WV3A 2Y9RT 4MA7H 1PYWA 1X44A 3PWJA 4P59L 4YPJA 4E42A 3MV8D 3AS1A 4X8XA 3MRFB 4PD4J 8FABB 3V5KA 4NQEB 2MMXA 3VXNA 1YECL 1DBJH 2JTDA 4A2MA 2PXYA 3L3IB 1YEJH 2PO6D 1NDMA 4O02H 2Z91B 4IRJA 4FXKA 5DZOA 4LLUA 1B90A 4ELMB 4OKVA 1RURH 2EDKA 2AXGA 4PJXB 3GGWB 5GSRA 4EI6A 1ZLSL 3QUYD 3NCFB 3FO1B 3K2UL 1DEDA 3QPXH 1TVDA 3WDHA 3RPKA 3KAAA 1FG2A 5F6HJ 3MNZA 1MIMH 4BA8A 2FNBA 1RULL 1KCLA 4TUKH 3EIFA 4GW1B 2D4FA 3RIAF 3MV9D 1RVFL 1XGRB 3VWKB 2X9XA 5IW6B 2KH2B 3QUMH 4HS6B 3P0GB 4XXDA 3VWJC 4DUXA 4JQXC 5KVFH 3SDAC 4QOKE 1A6AB 1BOYA 3ARTA 4G80B 1ZT4B 2A73B 1B0GB 3VGAC 5C0BE 4U3HA 3QJFA 4YO0B 4QT5B 1JV5A 1NAMA 4OLVL 5EIIB 2XXCB 3NA4A 1ZVSB 4NM4H 2YD7A 2VABB 3FRUA 4D0BB 2HTKD 1MIEL 4PJ8B 4ZS6C 2DIJA 5IFJB 4FN0A 4EOWL 2IC2A 1HQ4A 2M2DA 4IRSD 5IFAH 3HE6C 4M48H 3MRPA 3GHEL 2ZKHH 2CIIB 1HINH 3OAYH 4KAQL 2AAVA 1N26A 4TQEL 5D2LA 4G8GE 5DFTA 3H3KA 4PJCA 3RUGE 1CFVL 1NGZA 5C08A 1NUNB 3QDGA 1Q0XH 1DVFB 4LHUA 1SJEB 3I50H 5ACMA 2NNAA 1JGUL 4ZSOB 4K23L 5T1DL 4PRID 1G7QB 3VXMA 4ENED 1HILB 4BQBA 2A6JB 2WZPD 1J87A 3T8XA 2HWZH 5JTWA 4DFHA 2HVJB 1BIHA 4Z95H 4GT7A 1JPST 1MHHB 2F58H 4J23A 2QQQA 4S1QH 1OD9A 2FSEB 4FQCH 2VH5H 1F4XH 3L5XH 1BQUA 3AUVA 4QTIH 3UZVB 4R2GB 4HFWA 4NN5B 1QLEH 2Y36L 4CU8A 2DYPA 5J12B 2WP3O 3C8KA 5H35A 3L3DB 4N0YH 3NPSC 3O8XC 3M07A 5IJKC 4TTDC 4M4RA 5SX4I 4R26H 5IMKA 3GBMH 1CGSH 4R7DB 5E2JA 5FIEA 5C0AB 2YHGA 1QPXA 3CX2A 5FYLD 3RTQA 1WSST 3V4PL 1I9JH 3QCTH 1I1AA 1R3JB 1A21A 2XKNA 4K8RL 3ROOB 4PJBB 3RWJA 4RMTA 4QRPD 5FYKL 4Z7UB 1KOAA 3LEYL 2FJGB 2W60B 4GAFB 2IPTH 5KOVC 3TN0D 3S8WA 4JY4A 5D6DC 2D9QB 3MSPA 4UNTA 2D0HA 1Q9OB 5JW3H 4NFBA 2FGZA 2JB5H 1PLGL 4WW1B 5BZDA 4C57C 1OTUC 3CK0L 4WGVB 5E56A 3W2DH 1CL7L 4NCC2 2P24A 4XPHL 5ICXB 2OQJB 1S5HA 3C5ZD 3RFZC 2Y1VA 3NCCB 1AFVL 4KKNA 2KUTA 4QHKI 2DWEA 3MLYH 5E2VL 4KI5C 5IHLB 2FLBT 4XNXL 1EEQA 4Y8AA 4TUOB 1AD0A 4EDWH 2V7HA 1CYGA 3I75A 5CHNB 2IANB 3AS3A 1G7JB 1YJDH 3GMRB 2X9WA 3UTSD 1ZSDB 2OTWB 5C9KA 2WLZA 4W81A 3WL9A 3ARPA 4X4ZA 5CS7A 2EZ0D 4KI5F 3G6AA 3CFDB 1MAML 4JVWA 4OGAD 2OZ4H 1WZ1L 4PTTA 3CC5A 3CH1B 5L0QB 3FJTA 4KWUA 5I71C 3FFCE 4LQFH 1IC4H 3MR9B 5ESAA 5BRZB 1P4LA 3QZWB 1J0HA 2WQ8A 3LQZA 3T2PA 3WNMA 5IBTL 1U3HD 3GSQA 2D0FA 3GSNL 4AZ8A 1E4XH 1FNAA 5DZLA 3AAZA 4OT1H 4MSWA 3F5WB 5I15L 1CGTA 2H2PD 2APWA 2QHRH 4GLRH 2H3NA 4PRAA 3I3EA 4P2QD 2DQDH 5T1KA 4Y4HC 1UKTA 4HH9A 5D71L 5BS0B 3ZKXB 3LV3B 3VFWA 1S7TA 4BFBD 2C4FT 5A16B 4C4KT 3ME0A 4QCIA 5CEXA 1ZE3C 3R06A 3QT2A 3EUUA 1FZKA 1MQ8A 1XGTA 2R2CA 4N8VB 4G6JL 2RJMA 5EC2B 4OUOA 2K7QA 2ID5A 5CJXC 2ARJQ 3MRHA 4TTGA 1VGKA 4PD4K 3EOBA 4HKZA 3P4NB 4YHPB 1LK2B 3CFBB 5MHSD 1KNOB 4OV6F 2EC8A 4PGBA 3J7HA 2XY2A 3AGVA 2GJ6A 2DLFL 5GRVL 1HZHH 1MQKL 2W0FA 1WBZB 2OL3L 4NKQB 1JE6A 1YYMH 1QNZL 2A9MH 1FNLA 4I0CC 4OF5A 5EZIL 2D3VA 3MO1B 1FSKC 2BSTA 3K81A 2L4OA 4J6RH 2XG5A 2BCKA 4Q97A 2E3VA 4CMMA 4PJAF 3HRZA 5IF0A 1YY8B 4Y7MA 4UT7L 5J13B 1IGYB 3D39E 4YHZH 4MA7L 3LN4A 3SDYL 1R3IL 1INQA 3IDYC 1DFBL 5DEGB 3QFJB 3TLRA 1I1YA 1V5JA 4P49A 5IK3B 1MAJA 4YQXL 3MBEB 1URLA 3KYNA 4K2UL 4L8BB 3WFBL 1G0YR 5D5MB 3FQNA 1H3XA 2OTPA 4AK1A 5TQ0L 1KYOJ 4ALAL 1F4AA 3KXFA 1OGTB 3GJFH 1CTNA 1YEGL 2AK4B 1NPUA 2DKSA 3K46A 1P7KA 5TE7L 4XX1G 1WFNA 1AC0A 1BOGA 2R4RL 4M43H 2FIRT 3WDJA 1QRNB 4G9FE 5E6IC 1MLBA 2PCPA 5C2BL 1EJOL 2MNUA 4GBXD 4BFIB 4C54A 1Q94A 2X4PB 3A0OA 5SWZE 1UB5B 5ACZB 1XFPA 1Z5LB 1FAKT 4FFVD 3U7YH 9CGTA 3T09A 2VC2L 5C9JA 2M26A 2Y06L 4NBZB 1XIWA 3MLRH 2X89A 3GMOA 4URTB 4ONOA 2P5WB 3LVEA 3SO5A 5TFSL 3FB8A 5HHVL 5C09B 5HI4D 4AEHL 2X1WL 1Y18A 4KK9D 3TO4A 1QVOB 4RNRA 1N3NA 1NFDB 4K3HA 1AKJB 5I75C 4M6OH 4NFCA 2PYEA 4PRHE 4MJ4A 5IFAL 2ZKHL 4LMQI 2FWOB 4AG4L 4JRXB 1HXYB 1ES0B 3OJ2C 1I8KA 1EAPA 4A2LA 2I07B 5FUOH 5L88H 3U2SA 4JFFD 4CUCA 2ZSWB 4EXKA 1U91B 4JFQB 3TZVC 4NNPL 3ARXA 3AXLB 4ODWB 4OIIL 1N7ML 4KVNH 4P5TA 5EUOB 3TNNA 5DD1L 5EZJA 2UVFA 5FDWA 3K3QA 4QRQB 2ED7A 1NFIA 1DP0A 1L7TH 3UJIH 4ZFOA 4BQCA 5I8KH 3L3HA 5JNYB 3EO0A 2F58L 1J8HA 5H37H 4JHAH 4KH2A 2DQJH 2VH5L 3PQYD 3L5XL 2QR0B 3VU2A 2LU4A 5GS1C 1S5IL 3WIHA 2RFXB 4X6FB 2NY1C 3DPBA 1UT9A 3OB0H 1FZMB 1WTLA 4R0LB 2C1PB 3FMGH 4PJEF 1PZ5A 3U0TB 5D1QB 4EUPA 4OLWL 3KYMA 2VSDA 1FYTE 5CD5D 4I4WB 1X6LA 3AROA 1CTOA 1JZ5A 3KPSB 3MLUL 1RSFA 1LP9A 4RFEB 4XPTH 3QCTL 1IC5H 3WFDL 4L4VB 4MB4A 4FHBD 3X13B 4LL9A 4BQ6A 1QHPA 3NZHH 1XF4A 4D8PB 1BBJB 1CICB 2XTLA 2ZUTA 4GSDL 1VA9A 2AGJH 2OS7A 3RWCB 2X9YA 2R69L 1VPOL 5HYJD 3BKCL 4Q9RL 4PRPE 2UUDK 1JPSH 2VE6A 4XCEB 1EEYA 1IM9B 1MCIA 4LSQH 2Z0BA 4JZOB 4MNGE 1U2CA 2D03L 3LN5A 1IGJB 4I3GA 5KSAB 1C16A 1K3ZA 1QTYT 2VXVH 1EUUA 4MA1C 2NY5C 4GW5A 4X9IA 3CVIL 1TETH 3SDDD 5DJAA 1C1EH 2VLKE 1VADA 2WUBH 2MQCA 1JJUA 3MLYL 5I18H 2NW2A 3F58L 3HG1E 3GMPA 4YWGH 3SE3A 3STZA 2LU7A 2YMXL 1AO7E 5DHXB 3HE7A 3CFEB 4MAYD 4RFOH 4UV4L 1J0IA 4G9DB 1TZGH 3OWEA 4YGVA 3BRFA 2YKLL 1WGOA 5IVZA 3G04A 5CMAB 2Z9TA 3BKJL 1Y6MR 2QQNL 1EMTL 2CLRB 4B53A 1A7BA 1M1SA 3ZKSD 2LTQB 2VUOA 4LQFL 3L6FA 4GQPH 4MA8H 2VR5A 3SKJH 3VFUA 3IYLW 3PP3K 1ZHNA 4P48A 2H8PB 5L2JA 1ITCA 2FHFA 4WFGE 3ARBA 1ETZB 1WFOA 3HFML 3ARDA 4G8IA 3BH9A 1PG7L 4OT1L 1AH1A 3ULVH 4P2RD 3E2HB 4XCYB 3V5HA 4WWID 5F1NA 1W72L 3QIWC 1S7XA 4HGMA 3L95B 2VITA 2FBJH 3CLFH 4GUPA 4L4TA 1D5BA 3MREB 3WO3B 4XAKE 3BGMB 4WU7A 1KPVA 3KPRB 4RCAA 3MGAA 1KXTB 4XC1L 5D2NC 5DUMH 2VDML 1TNNA 3GSVA 1DDHB 3BWAA 2CIKB 1MOEA 5CJOH 1KJ2L 2XRAL 5IJVA 5F7HA 4EKXA 2J2ZA 4PREA 1ITBB 3B3IA 2J8UA 4JO4L 3OG4B 4EIGB 5KAQF 4NO5A 1GJIA 1SJHB 5EU3B 5FHAL 2NTFA 5C0DB 4NQCB 4L9LB 3WUWG 3LEVH 4U1GC 2OTUB 2NY2D 4MNQE 1NC4D 1OGAD 1AQKH 1KYOK 3UTTE 4B41A 1UQSB 1AD9A 5JPNA 1UH3A 4H1LH 4Z7QE 3OKEA 2GI7A 4H26A 2DAVA 2H32A 4OZIB 5I17B 4GS7B 5E7BA 3SJVE 3FZUD 2EKJA 4W6WB 4FQQA 5DJ8B 3C6LC 3M17A 5BVPH 1PG7X 1KEGL 1WCQA 4AM0A 4YHLL 3DVFA 3S9DB 4XMLL 3S5LB 3CPLA 3EZJB 4KXZH 4QHUA 3FOLB 4F7TA 5FEBA 2QEJA 3SY0B 1RZJC 2DTSA 1CVSC 3R0NA 1J88A 3RQ3A 1LE9B 3CUPA 2OR7A 4OZ4A 5LVEA 2B1HH 4QOKA 1G7PB 4RMSA 2Q3ZA 5CUSL 2X1XR 1OW0A 2YPVH 3RGVB 5C0BA 3WFHB 4HKXA 2V2WB 3DHJA 3P9MA 5IM7A 3C9NB 3MCLL 1B2WL 3JUYA 2EYTA 3PV6A 2I27N 3T2NH 1AR1D 4F9PA 1IVLA 5I1CL 2I5YL 1S7QA 5H94A 4ZUTA 2Q1EA 1LE5A 5HHQB 4ONGH 3GKWL 5EORH 1WCBB 3X3FH 5A2FA 2Z8RA 4FQ1H 1JYVA 4YE4H 4G8GA 1EFXB 2AXFB 3FT2A 3OAUL 3RUGA 1TCRA 4NNYB 1TVHA 3L7EA 4MDJB 3O6FD 1BZ7B 2IADB 4TYUA 3O4LD 3U7YL 5F7FA 3CFJA 1LK3H 2X1PA 3MC0A 5GRVK 3TIDA 3IXAA 5B38A 1AY1H 4YH6A 3MJ8B 5DA0B 1DN0B 4BSJA 5IB2B 3QO0A 3V6BR 5IQ9A 4PRDB 5DQDH 1PGRB 4DZ8B 1R5IB 4GJTB 1N2RB 4BSVB 4ZUVA 1V3MA 2ADJB 43C9A 1KBGH 2C9AA 1S8DA 1TITA 4WJ5A 1RUKL 5ISZB 2HG5B 4PJ9D 4F7MA 1CXKA 3MZGB 1CFQA 4PY8J 4U1HA 3TO2A 1AXTH 4WDIB 4D0DB 3T1FB 1F4YH 1T7ZA 5L6YL 4RQQB 3H3PL 4K3DH 5F3BA 4GMSL 3EOYG 5DJXA 4PG2C 2D7TH 4PJHE 4Y5XC 4KVNL 1TJGH 1BWWA 2VZOA 2FEEI 4HIHA 3AU1B 3SE4A 2Z93B 3V52H 1AXIB 1A6PA 3H7BA 4U0QB 1P1ZB 1DANT 1L7TL 3BHBA 5EWIH 4OD2B 1NCAL 1TQBC 3VXSB 4M62H 2ADGA 5J6HA 1PKOA 1CLOL 4HKJA 2V2XB 2C3HA 4OFYA 4QRUA 4KDTC 2VXUL 1AGBB 2D31B 3MLSH 4J3WA 3DECA 2J4WH 3WIFA 4Z0XB 4FNLL 5I19H 3SE9H 3OKLB 2KKQA 2FB4H 5CBAA 4GRLC 5DXWA 2JKXA 4PP2B 4MHHI 2XA3A 5DEFA 1RK1A 2EXYC 1T1WA 3S88L 3OXSA 4G7YH 4ODXA 1AIFA 1MPAH 2A83B 4IOIB 1JUFA 2GFBA 3CNKA 1OM3L 4U6HB 3VD5A 3DXAB 4JY6B 3AREB 3FFCA 4YHOL 5I8EA 3V7MA 3B2UD 4KKCC 4QHLA 4EI5B 1FN4A 1CGVA 1ED3B 1RJLA 3D6GA 5HVFB 2VDOH 5E2TL 1TPXB 4EEEA 4GAJL 5C6TH 5BJTA 1C1EL 3NCYP 1QBMH 4LPCA 3EZ8A 2HLAB 4FA8A 4UAOC 5CZVL 1CFNA 3P9LB 4WFHE 1V7NH 5F1IA 5T5NF 2FD6H 4Q58C 1KN4H 4U05A 4QWWC 3W9EB 1N0LA 5HHOE 1HXMA 4Q6YA 4YIQB 3RKPA 3SBWA 5TH2B 3V4UL 4JFHD 2VISA 4MCZA 3H8NA 5CSZB 3OKOB 1N64H 2BMKA 3DWTA 4LCWD 4MA8L 5EC1A 5BO1L 4ZAKD 1MHCA 2ZUQC 4I3SH 4OZGE 3D85A 4U1IB 5JA9A 3B83A 3FQUB 3U4EA 3MA9H 1IM3A 1BECA 1N0XH 1RQ5A 3ARFD 3PGDA 3RZCD 4APQD 3HZYB 2Q8AL 3CLFL 3X12A 4NN7C 5FECB 1OF2A 1TJHH 1OHQA 1H3WM 3D39A 3I6GA 4L8CB 2AJSH 2Y23A 3TYGL 5DVMA 1A6ZB 4X8JA 4ZFFA 3N1QC 1IAII 3N85H 2KPNA 4LHUG 3TA3C 4G6ML 5KSBE 4LVHC 1LO5B 3DIFB 3HZKA 1MY7A 2JJWA 3PNWA 1XGPB 3VFOA 3SPVA 2FECI 4U1MB 5FUCC 3WKMH 4LVNB 3I6KB 4Q9CA 1GRWA 3IDJB 3LEVL 2B1AL 3DO7A 4EDXB 2RIKA 1OAUL 3MRLB 4MJ6B 2E7MA 5AAMA 1PAMA 3G5YA 1IEBA 5ITFA 4FQXA 4O51B 3MRQA 3LN9A 3RIAK 3DRTB 4N0FB 4MWFB 5HJ3B 3UDWA 5D6CA 4N9OB 5BW7A 1GC1C 3G5VB 5C8JB 3CFIC 3QDAA 3VXTB 7FABH 4ZXBD 5SWZA 3FT4A 4NZDA 4XVUD 1MFEL 2IEPA 3F7YB 4FFYH 2R0LH 3D9AH 5C6PB 3P0YH 4M1GL 4YZFF 5I1AA 4MQXC 3P73A 4F2MA 3H0TA 4O2FB 5F9JB 4FZ8H 4H5SB 3GBNL 4TOYH 3VRLE 4JQVA 5C0GA 5KZCB 4GAYB 4OQTH 2OL3A 4O9HH 3ULVE 4PJFB 3GSWA 4HLZH 4K8RD 5E8DL 1NGQH 2FX8L 4R0LC 3VXUB 1JF5A 5FA3A 4PJ7E 4PRHA 1CGXA 4IMLB 1LEIA 5CGYC 2VAJA 4WU5A 1S9YA 5GGQH 4YDIH 1HHHB 4ONGL 2A1WL 2KBGA 1J10A 4GMTL 4IDLA 2ARJA 4ZYKB 5HYIA 4F37F 43CAB 5IB5A 1BJ1H 1K2DB 3WEXA 3B9KD 5C0RH 2X4SB 1XF2A 4Q0XH 2LU3A 4YUEH 2GAZA 1FNFA 1R24B 4WWKA 4HKBA 2VLJB 4XH2B 3PJSA 1HWHB 2BNQE 3TYFB 1BQSA 2NY5L 2DQFA 4JN2A 3QFDB 3NA9H 4PS4L 4DVBA 3B6SA 4ODUA 3ZKND 3K1DA 5HGBB 4ZUWA 3SCMC 1P9MA 4X6DE 3TT1L 1QRKA 5A1AA 4RISL 5F93C 5CIPH 1MHPH 1J11A 3V6FB 3O11A 4CMHB 2WUCL 4NC1C 1FFPB 1EK3A 5T3XL 3IXTA 3UP1A 3QUZA 3KPPA 1FYTA 1U8QA 3V6OA 4M7ZC 1MCOL 3QXTA 1VFOA 1WVZA 4K3DL 5IQ7H 3U6RB 1UACH 3QHTC 5IW1B 2QBWA 1BBDH 1DLHA 3SGEI 4BH7A 3MJ7A 3HB3D 2LTQC 1X6NA 4PRPA 2DLTA 3PDOB 3S3JA 3WN5A 5FGBA 5D7JB 4UTBL 3A67L 5CEZL 1IAIM 1NKOA 1AGFB 1G0DA 2X4OB 4OM1H 5JHDE 4MNGA 1C5DA 1T0NB 3HC4H 3RA7H 3BO8A 3NFNB 3I85A 1JWUA 3CVHB 4WCYL 3UBXG 4DUWA 3N0PB 3S37H 2IAMB 4ZO8A 5ENWA 1IFHH 1A7QL 2XKSA 4E5XB 3KPLA 2BVQB 2VLKA 3OF6D 3BPCA 4K07A 3H9SE 3MLZH 1A14L 1PD6A 1D6EA 3HG1A 4LLDB 4D9QE 1QPPA 1UEYA 2XNAB 3GM8A 4K3EL 1KJ3H 1EV2E 2YD5A 2HJFB 5KS9E 1AO7A 4C56B 3P4MA 4NQSB 2AXJA 4XCFH 4DCQA 5EPMA 2AJZB 3JV6A 5FOBA 4DOHE 4YBQD 3NFSH 5E1HB 3QI9D 2Q6WA 3A6BL 2Z8SA 1AGEA 2EDJA 4I0PA 1JZ7A 3VMOA 4U3CA 5A2LH 3E8UL 2PF6A 2K9UA 2DLHA 3EYFA 1OP9A 3GJEA 1BD2A 1D9KB 3ETBF 4KZEL 4TPRL 2XOTA 1I1FA 2ZCLH 4JKPL 5DMIL 5GZNC 1F02I 3AY4A 4LSRH 5F7MC 4KRLB 2ZOKA 1DBAH 2D7QA 4NQEE 3UJTH 2OR9H 1UA6H 3MRCB 2SEBA 1RZJL 2YBRA 3RWEB 1Q9LA 4HWEH 3TC9A 4ELME 1QBML 4PJXE 4WI7A 5I1LB 2GW5A 2R39A 4HMCA 4MQ7B 4J2XA 1HH9B 4LSPL 1I8IA 1MCPH 2EDLA 3TCLB 2FD6L 1RFDH 5AG9A 2Y6SD 3BAEH 3EGSB 4ERSH 3TFKD 1GHFL 4BZ1H 3QG7H 4O58L 4UUJA 5EU7E 1FVEA 3MV8B 4NC0B 2DM4A 3CX5J 2P47B 4N1CA 2EDXA 3O3UN 1A1MA 4X7TA 3E1F1 3NZ8A 3QIUC 4MD5A 4X98B 1BWMA 5JOPD 3H9HA 3HC3H 3MZTA 3ULUD 2P46B 2PO6B 3MRIB 3AMKA 4K7PY 5LXGL 4XAWH 4I3SL 4POZC 5FKAB 3VH8A 3Q6GL 3QUYB 1FL5B 2VJXA 1LGVA 4MNQA 3P4OA 3UTTA 3FQTB 3O41A 4KUZL 1G84A 3MX0A 2ITCA 1VFAB 4LNRA 1VB9A 3LSOA 3U7WL 3SJVA 4DEPC 3MV9B 3QA3B 4NUJA 1KTLB 5C0FA 3CMOH 2VDNL 4PG9B 3DV6B 4OFIA 1LO3H 5DFVC 2QSCL 1Z3GH 3T4AA 5ETUA 1Z6JT 4JO1H 5BQ7A 3QHFL 1HCVA 1JBJA 2WM0A 3EJZC 4GRMB 2EEDA 4L3ED 4E41A 3NCBB 2HH0L 1OVZA 3GDBA 4XBGB 3BZ4B 3WDIA 3DTXB 2AI0L 4Y16A 4ZSOE 2FGWH 5HHPA 3RWDA 1W72A 4JFZH 4ZPTB 3ARRA 1IT9H 1CDGA 1VENA 3BW9B 4KPHH 2I9LA 5DF0A 2X42A 4IRSB 2P43B 1S78D 1CD9B 2E6QA 4XB7A 5JO5B 1DBKH 1ZS8B 5I1DB 1MFDH 4P46C 1V8HA 3NBNA 3ROLB 3VGFA 1A4KA 1KJ2A 2AQ2A 3GMMA 1PSKH 4HXBL 1KN2L 1XMWA 4Y5YB 3SE8L 1JZ3A 1R3HB 1LEGA 1ZWIB 1INDL 4OCXL 3IGAB 5EOCH 5C0AE 2JJUA 5E2UL 3HZMA 2H26B 5E9DE 1FQ9C 3LQMA 1T0MA