1UZ6F

Anti-lewis x fab fragment uncomplexed
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
216
structure length
208
Chain Sequence
EVKLLESGGGLVQPGGSQKLSCAASGFDFSGYWMSWVRQAPGKGLEWIGEINPDSSTINYTPSLKDKFIISRDNAKNTLYLQMSKVRSEDTALYYCARETGTRFDYWGQGTTLTVSSATTTAPSVYPLVPSVTLGCLVKGYFPEPVTVKWNYGALSSGVRTVSSVLQSGFYSLSSLVTVPSSTWPSQTVICNVAHPASKTELIKRIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an Anti-Lewis X Fab Fragment in Complex with its Lewis X Antigen
pubmed doi rcsb
molecule tags Immune system
molecule keywords IGG FAB (IGG3, KAPPA) LIGHT CHAIN 291-2G3-A
total genus 44
structure length 208
sequence length 216
chains with identical sequence H, P, W
ec nomenclature
pdb deposition date 2004-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uz6F02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uz6F01
5JPMA 1BZ7B 4E41B 3T0EC 4PY7B 4M8QB 3UDWA 4N1EA 5D6CA 1S9VB 3TBTA 5D5MA 1FNLA 1QFOA 3QPQD 4OLUH 3DTXB 3OSKA 3N06B 4W6WB 3O6KL 4MNGA 3ARRA 2X70B 4J3SA 4JR9L 4PYGA 2QADB 4IRZL 4YBHA 1DTUA 2IFFL 2VLLB 1U8KA 3KPNA 2ZUXA 4DKFH 2IF7A 3IDNA 2X10A 2X4RB 3SJVB 3NCBB 5E94A 2NY6D 4J8RB 1KIRB 3EFFA 3T0WA 3LV3B 1K2DB 2R2HB 1CTNA 2VB5A 4S0TD 4JY6B 4TNWF 2IPKA 4OCLC 2X9XA 5HHXH 4P23C 2HH0L 2Z93B 2PUQT 4UT9H 4L4TA 5JW5A 4DKAA 5E4EB 4PYHA 1OF2A 3VH8G 3ZZ1A 5CKGA 5JW4N 1XGYH 1IC7H 4P4RA 4GAFB 2DQCL 4QTIH 3CFJB 3EYUL 4Z7NF 3VI3E 3CX5J 5H2BB 4MX7B 3T3MF 3C5JA 4NQCB 4YUEL 1MCSA 4ZAKA 3VMNA 3RZWA 3F7PC 1EEYB 3RIFF 4O9HL 1FSKC 5I73C 1DZBA 3QCUH 3MRKA 4F2MB 5JW4Q 3EYVB 12E8H 4U6VH 5F7WC 3TJEL 4D8PB 3AU1B 4BSVB 2AJVH 3GSNA 5I15H 4ZUWA 4PGDA 4WW2F 4OFYD 5DC9B 3VWKB 1FNSH 2YKLH 4QHUA 1M7XA 1IEBB 1KELH 4N8VG 5DUMH 3VG9B 3D87B 4NQEE 4XPAH 1FGNL 3THML 3QXVA 2QQLL 4LCUB 5BS0A 2J88L 2VH5L 3QAZC 1ZLUH 2OCFD 1REIA 3WJJC 1WIPA 1XGRA 1CDCA 3O9WB 1P4IL 2DLFH 1D6EA 3RGVB 4JM2B 3SY0A 3DX7A 5AWNL 1HINL 2PO6A 4JO4H 3VD9A 4PBWD 4XP5H 5J56B 4U1LB 1PSKL 4HGWB 4F9PC 2VL5A 4XP9H 3BAEH 4OTXL 4JY4B 2V17H 1IGML 1DEEA 3GMNA 3V6FB 3DXAE 4JZJA 4YDIH 4HUUB 1A3LH 1KLGA 3VRJB 1KFAH 3C8HA 4NCDA 3ILQD 1NL0H 1YNTB 4RMRA 3CH1B 3D0LB 1H8OA 1KBGH 2A83A 4F7TB 4PJBF 5KVMC 3VCLA 4JN2B 1J8HD 5CEXB 3MLUL 2YBRA 3PQYE 4GS7B 4KQ4L 5M95B 3BESR 3RA7L 1J05A 5IMOB 5CD5D 1JNNH 3OXRA 4Y5YB 2VO5A 5E8DL 3HE6B 1KNOB 4HS6A 1TJHL 5KSBA 5DS8A 1U3HA 2AK4B 1PG7W 2X42A 1WWAX 4ISVA 4XCFH 5D1ZC 4MAUL 1G6RL 1A7RL 4JQVA 4G3YH 5GGVY 1AKJB 1LDPH 3U46B 5EU6B 4KTEL 1XR8A 3AC0A 1J11A 1GZQB 4C56E 4MVBD 4FQIH 1G9NH 4JN2A 5DA0B 5GGTL 4KZDH 4I0CC 1NDGA 5BMFH 4WI6A 1F58L 1TVBB 1FIGH 2G75B 1J12A 1YEKH 2HJLB 3PHQA 5I18H 3F7VA 1FL3B 1M7IB 3ZDZE 1JGDA 3IETA 4OCSL 3TBSB 4M43H 4YX2H 3TO4A 4XHJD 4NKMA 1QACA 4Y2DB 2VE6B 2GJ6A 3GSRB 2CD0A 3V7MA 4L9DA 4P2CG 5T3ZL 3T4AB 3SGKC 3VXRA 4M61B 5IW6B 5JZ7C 4YR6A 3AB0C 3QBTB 4JFHD 4NHCL 2PTVA 2EXYC 3WFCL 3QYCA 2D7MA 2IAMA 3UX9B 1XIWD 2NY2D 3QUXC 1E4XI 2VLME 1WITA 2CMRH 3I9GL 3B9KB 4FABH 3FB5A 1CIDA 5C0AB 3DROA 3HE7A 5DSCA 1I8MB 2EDQA 1QVOB 2KPNA 2BNUB 3AMKA 5A43C 1EHAA 2OJEA 3V6OC 1AGDA 4YXLL 3BGAA 1TJGL 3SDCC 5I66B 4TULL 4ZNCD 1E6OH 1X5IA 1XF4B 4U1IA 1FJ1A 3KPRB 3MXWL 5H37H 3T4AA 3ARDC 3G5YB 5FK9B 1B90A 3O2VL 5KSAD 4F9PA 5D7JA 3CGTA 3O9WC 3QUMB 3O4LE 4OZIA 2CJUL 2GEEA 3CNKA 4GAYB 4PIRF 1Q9WA 3FN3A 4URTB 1VFMA 4AEIL 4TUKL 4ZS7H 4G8FA 2HFFB 5ANME 1RURL 4XH2A 1QSEA 3A6CH 4F7CB 3U9PH 3E6FB 3KYMA 4M6ML 2XA3A 4D9RD 5IHUH 3GSUB 3QEUB 3SE3C 4ZFOA 5IESH 1FDLL 4ALAH 2DQUL 1YYLL 3BIKA 5L6YH 3MXWH 5I66A 4PJ8D 3O45B 1OT2A 2MNUA 5GQBA 1DLHB 2VXTL 1GCFA 3MRLA 3JWDL 4PFEA 2DQEH 2B0SL 3TVMC 3HUJB 4RMQA 5DQJA 4TPRL 3KJ6L 3QFDA 1AGCB 3AREB 4UBDC 2PW1A 4F37F 2NXZD 1WV7T 3V4PH 4OZIE 1I8KA 4OZGB 1ZHLB 4Y8AA 2DL2A 2AJSL 4JANA 3VXUA 4FTVE 2C1OA 4NO5A 1XR9A 3LEVH 2W9LA 1KB5B 1NC2D 4FTVB 2CH8A 2EEBA 3KYNA 3A6OA 5JDJA 4PP1C 1WBXB 1DBMH 4UT6L 3QG6B 4IEFB 2YD2A 4OFDA 2VDKL 1RZKH 4Z6AT 5FM5O 2A77H 3OMZA 3QI9A 1TXKA 2B20A 1DFBL 3DIFA 1UCBL 1MRDL 1OB1B 3OL2A 3DSNA 1G7MA 1A5FL 1TCRB 3L7EA 1BFOB 1BGXL 5CP3A 5FA3A 2ZOLA 4XNXH 1KN2H 4CNIB 2H9GA 3MQIA 2YWZA 3KPSA 3O6ML 5DEGA 4ODSH 1C7TA 1YMMA 5HDQL 5ID0A 1BBDH 1FZMA 4O2CB 5IBLC 2MCPL 3JWDC 2AGJH 4M02A 1QA9B 2YPLA 3QHFH 3M07A 3P4OB 1KIPA 1N3NA 4NQXA 3P4NB 5IBUG 3CCHB 3MNVB 3KNBB 2QHLA 3WXWH 2CLZB 1N6VA 2HKFH 1U95A 3L3HA 3AU1A 4F7CA 3OB8A 2FD6L 2VDOL 5DFTA 3WEXB 1FGVH 5TDOB 4EBQL 3HNTH 3NGBC 3IDUA 2AV7B 1YMME 3MREA 5T3XE 3NIDF 1CD9B 5GZOC 3JWOC 2ORBH 4EBQH 1F4YL 1CGYA 3DX6A 2NXYC 4XVSH 1ORSB 2FJGA 2FB4H 4U7MA 4QXTA 4XCEB 4EQ3A 4X4YA 4W6YB 4PB9L 4P5TC 4JR9H 3U4EA 3GUTA 2CK0H 4GAGL 2BSSB 5CZXD 1K2DA 1JF5A 2R2HA 3C5ZC 3MYZA 3VGEA 3TF7C 3I6GA 3WL9B 3DMMD 5GJSL 3X12B 1DQML 3C2AH 5C0BA 4G6MH 3WFBL 5F97E 3C5ZA 5EC2A 1XF4A 4NN5C 4R96A 1B4RA 1IEAA 3V0VB 4JFEA 2CIIB 4M6OL 3BP7A 4IHOB 4LQFH 4HAFA 3IFPB 1UACL 5I9QC 1GOGA 3S37L 1MQKH 4I2XB 3MX0A 5ADOH 1N26A 2FX9H 4S2SA 1XGUA 1INDL 2AXFB 1MRCH 4LEOA 3REWB 1JTOA 2WUCL 3EGSB 4FZ8L 4IMKC 2A6KA 1SEQH 3D3VB 4QHKI 1T0NA 2AI0H 3B5GA 1JGEB 4LRNH 1F4YH 1J0KA 5CSBA 4YHNA 3RRQA 3QG7H 1BVKA 2W59A 3KPLA 4K3HA 4HZAA 4PGDB 4X5XB 2YPVH 2P7TB 2RCSL 4O9HH 3P2TA 1G7IB 4JHWH 5FKAB 4XVJH 3LKSA 1MCWW 3KLHD 4OI8A 4ODBD 1JK8B 3HC4H 2NNAB 4QRTA 1N5AB 3NCYP 2R1XA 4KK8C 2J3SA 3ARFA 3SKJH 5F1KC 4KPHH 3DX9A 5HYSB 2C1PB 2IALA 2N56A 3F7VB 3P4OA 4LCIH 5DFVC 2I60H 4F7EA 1CQYA 1Y0LA 5DI8B 5JORA 3TT1H 2ED7A 1HKLL 1KPRA 3STZA 3N9GH 2UVEA 3LPFA 1IEHA 4M6AA 2L4OA 3WL9A 5CBAA 3LH2L 1A7BA 3M45A 3CVIH 2DJSA 4N5EC 1MCHA 4KK6D 3DETD 4P2QB 1WZLA 3D18A 3FO1A 5C9KA 3ULVF 1NANH 1UWGL 1S5HA 3RL1B 3FO2B 3RAJL 1IAII 1IC5H 4GH7B 3RWJA 1MJJB 2KBGA 4KTDH 2FECI 3U7AA 3D69A 3GJFH 4GKOA 1S9KC 2F19L 4WW1B 5AD0B 3QI9B 3D2UA 1L0QA 3V95A 2YUVA 5E8PB 1K5NB 3IU4L 1A6PA 3ARTA 5F96H 4ZQKA 5GHWL 1FLRH 1RK1A 2WBKA 5D7KD 1FO0H 3FQNB 5AG9A 4YHOL 3WXVL 1OSPH 1CCZA 3D48R 1INEH 3MRDB 3K4AA 4NRZB 2W0PA 1KGCE 3OB0K 1JWMA 3BHBA 4HUXA 5KANG 2X4TA 4L5FL 2CR6A 3BGMB 4YHMH 2XZZA 3BD4A 3CLEL 5DZLA 3TCLB 3RGVD 1SHMA 2UY7A 4I2XE 2CPCA 5C0RH 4C56A 2R39A 4LPVA 3O6FB 1VERA 3H3PH 1RIVL 3WO4C 3MO1B 1PG7X 3C6LD 3HN3A 4CBPA 2DB8A 3RWEA 1I7ZB 2A74A 4PRAA 5IBUB 3T4YB 1Z9OA 3VXOB 1ZSDA 5CWSB 4MSWA 1FLRL 2GJ6E 4MD4B 5CP7A 4MNGB 2PYEA 1FO0L 2R1XB 3VFUB 1UVQA 5C0IB 2Z4QB 4JM2C 4P4KA 1LO4H 2DKUA 3NA9H 2J88H 1TZIA 4D9QE 5JHDA 4LIQE 4CMMA 3U4BH 2ITDB 4ETYA 5IMLB 4D9LL 4EIGB 1Y18B 1FRGH 4YFLF 4TYUA 4GO6B 2P42B 4ACPA 1IJ9A 2EC9U 4H25A 1TMCB 5FEBA 5C0AA 2F5BH 3U4BL 1VEPA 4QKXB 4HW6A 5ISZA 1MH5A 4Y4FD 1LEIA 3P0VH 2GTWB 4RMSA 3BGMA 4JDVB 5IBTL 2PW2B 4ODUB 2FWOB 2WIMA 2D7TH 2J8UB 3TIDA 3WE6B 3MBED 4WTZA 2VDRH 4MA1B 4F80A 5ITBH 3MJGX 1AKJD 4AYFA 2X4SA 4LNRB 1P1ZB 4ZQKB 2BSED 5H94A 1ZT4B 3LV3A 2E7CA 1ZLVH 3NCEB 5E8PA 5DJ2B 1XF5B 4ZFGL 3ARFD 2ADGA 2BSRA 2VDNL 3HC3H 4GRWE 3T1FB 3VFGH 1HHIA 4AIXA 2NCMA 1JRHI 1XGPA 4APQD 4MD4A 2VKXA 4JHAH 1OM3H 5EZIH 1R3JA 2C3VB 4TSAL 4JRXE 1S7RB 4JHZA 4IRSA 3QQ3B 4PD4J 3RIFK 1YUHB 1AFVH 1YYLH 3MRRB 1OVZA 1CZ8H 1JUFA 2WWKT 1DQTA 4IJ3C 4R0LA 3JV4A 4YXHH 2XA8H 3DV6B 3WCYA 2Y6SD 3QIWB 4OB5L 1F8TL 1N2RA 4N8VB 3MA9L 1SYVB 3L7FA 5T1KB 3VI3F 3VXSD 1WICA 5C0AD 3WO3B 1TVDA 3T08A 4GRMA 4RNRB 5EU3B 4DGVH 2VH5H 4QCIB 2OYPA 2NY4C 5EOCL 1HYSD 5EBWB 3O3BA 3F12A 4LGRB 1EO5A 4KVNL 4N0UE 1EH9A 1B4JL 4X6DF 5EUOB 4K94H 4K7FA 1YUHA 5IMKB 3OGOE 5HYJB 4GRLB 1YECL 1I3RA 3RX8A 4WEBL 4GW5B 3OWEA 1RUML 5DRNB 4YC2B 2AQ2A 3I9GH 1ZLWK 3SGJA 1MLBA 3DVFA 4OD2A 4Y2OA 3ME0A 5CJQH 4JFEB 4GAYA 1YJDH 1Z9MA 2FL5A 1RZGA 4IDJL 1NMAL 5TQ2H 5IVZB 3FQTA 2N4IA 1MCDA 1I9JL 3MRHA 4BA8A 4Z8FL 2YPLE 5MHSE 4G6FD 3BGFB 4E5XB 4ORGA 4KQ3H 3T3PF 3CU1A 4TOYH 4D0BB 5C9JA 1Z9SA 1WBYB 4EOWH 3QEHA 4Y5XA 4PJBA 5J11B 4PJCF 4XGZB 2F74B 2V7NA 2KQNA 4ORZC 1QD0A 1TJIL 1FL5A 4JRYE 2BNUA 3MV9A 4PTUA 5KSBB 3BKMH 4RZCB 1AI1L 1ZV5A 4K9EL 4Z7WF 1KYOJ 2PW1B 5T3XD 4OLZH 3ARBB 2MPAL 2IAND 5AYUL 2XPGA 1F02I 1VFAB 2AV7A 1UQSB 4YLQT 3QSKB 4PREB 2FEDC 2P24A 3MUJA 2P43B 4XCEA 1RAMA 2PR4L 1EBPA 5D7SL 1I9JH 2NY7H 2HFFA 3BKYL 4AEHL 1R3IL 2HN7A 3CFJA 1I4FB 3QEGL 4FNLH 3VI4F 2VJXA 4AH2A 5DMGC 4NN6B 1F00I 3IETB 5JDSA 4BZ1L 2ENSA 3QEQA 2VXSH 3UTTA 2SEBB 5F70A 5IVXA 2UYLB 5EU5A 4Q9BA 1YZZA 1KIQB 5INDA 1X7QA 3G5YA 4YHKL 4PG2A 1I3GH 4HIEA 5IVZA 1JHKH 2QQNL 5C0CD 4HK3N 3FOMA 4XMKL 3GSQA 3EO1B 5KVEH 1ZTXL 4GSDL 5I9QB 1LE5A 3RTQB 3KJ6H 5FM4A 3GSOA 5FUZL 5I19H 4MJIE 5K9JH 3BN9C 3PWLB 4GBXB 5L6YL 3FB5B 3S37H 1KCVH 1FZMB 1FPTL 2ICWI 3WIIH 3GB7A 3QUKA 4NQVA 4ZS6D 4ZUSB 3MRFA 2IAMC 3QO0A 3CZFB 3V0AC 1KULA 3IDIA 4EN3A 4LGPB 4AEIH 5F8QC 3VXNA 4K23L 2PXYD 5E6YA 5TFSH 1G9MH 2X4NA 4ZOAA 5CIPH 4X6CA 1CE1L 4ODSL 1X6LA 4ZAKB 5HDQH 2WQ8A 3QDMA 1DDHB 3B9VA 1NFKA 3Q5TA 4R7DB 2E9BA 2R23B 2V5MA 3DIFB 3LQAL 4PP2A 4UV7L 2HLAA 3MRBA 1AY1H 1QSEE 3DURA 3LMJL 1C8PA 5GGQL 1HK6A 3PL6D 1BF2A 3MOAH 4Y5XB 1DCLA 3RVTC 4NNPH 2ZG1A 2IQAA 4O2EA 4JM2D 5ALCL 5EU6A 1X7QB 5EU3A 5EOQL 5IMOA 3OKEB 4WU7B 5DJCB 4JDZB 4JM4L 5ILTH 4NJ9L 2NXYB 4NUGL 3DO3A 2DM4A 2XQYG 1A9EB 1YEEL 3EOBB 2BNQE 2WINA 3V6BR 1G1CA 5DMIL 4YGVA 4F3FB 5DD0H 4JDTH 4PG9B 3VG9C 1W72A 2BY1A 3UXFA 1UM4L 4NDMA 4M3JA 4N1CA 3UTTD 5J06A 5MENE 4X0KB 5LGJA 1BVLB 3RGVC 4AG4L 4NHUA 4EI5B 2YD7A 5EU6E 3KYNB 4LPWA 3MODH 1V7MH 4KDTC 5ETUA 4P3CH 5SWQB 1QLFB 1EGJA 4V2CB 5DRWB 4I5BA 3E6HA 3QCVH 5DJDA 1T1ZA 3NFPA 2P7TA 5F3BA 4HJJL 3EDEA 3KNBA 2RR3A 4AY0A 3VFPB 1C5DA 4LQFL 3LOWA 4HX1A 3HR5A 5CJOL 3ZKQD 1A5FH 5C08D 1S7WB 1WFUA 1JPST 4J6RL 3L6FB 4NSKA 4LASL 5GGRY 5LCVL 4PGJA 2Q6WA 4G8GE 1OAKL 3OKLA 4PBXA 5DQJB 3IDJB 1S9XB 3T8XB 5D71H 1CK0H 3CDCA 5BQ7B 3EDKA 5TDPA 4N0YL 4MB4A 5DK0A 5D2NC 4OFKA 3W2DH 3AM8C 5FOBB 4IRSB 4JFFB 1QFWL 1UVQB 5CGYC 1QLEH 4KK6C 1UEMA 3HC4L 1DDHA 2DTMH 3TT3L 4G8FB 3BI9X 4Q6IB 3SOBH 1BQHG 5KSVB 4PGEA 1CYGA 1H3PL 1HSBB 5I1EH 5E9DB 5ALCH 5BZDB 2J8UF 3GHEH 5DEFA 1R0AL 2B4CL 4YK4B 1KTRL 3ZTNH 3CLEH 4TRPH 5DVNA 1TZHB 3MROB 2OP4H 1TQCB 4RAVB 3GBNL 4QCIA 3W2DL 1U58A 5EO9B 3VFNA 4QRQB 3UTQA 1CU4H 1PKQB 3AREC 4E0RB 2NTFB 2VABA 3F12B 4RDQG 3A0OA 2J6EL 3S88H 4K3GA 1CGVA 2OZ4A 3KYOB 2IEPA 3EOBA 3I02B 4H8WH 4PJHE 3CC5A 3OXRB 1CDJA 1OTSC 2DBLH 3MFFB 2NLJA 1KEMH 4WW2A 1S7UB 3R4DA 4Q2ZB 1CI5A 4O5LH 3DYPA 3BVNA 3QPXH 2FLRT 2D7QA 2IG2H 4MNGE 2DBLL 2ZCHL 5I6XB 5BRZD 4Z95L 1XGPB 1CBVH 1MELA 4OGYH 4ZODA 3P9MA 9CGTA 5GS1A 1RVFH 3RBGA 4LLYB 3H9HB 5D6DC 32C2B 1FYTB 4HC1L 1C08A 4PGEB 3X11A 4OZGF 4KRPB 5D1QB 4X80H 1TDQA 1IQWH 5FB8B 3SN6N 3SDCB 1EHNA 2OR9H 1RUKL 4L8BB 1RIUH 4HWBA 4BQ8A 2NY5H 2PKDA 2D4FA 5IB4A 4WW2B 4XVTL 3CPLB 2P5WA 3HE7D 4UT9L 4LSSH 3LQZB 2W91A 3RL2A 2X1PA 3WLBA 1S9WA 5EO0A 3BGFC 4D2NA 4J3VA 3OG4B 4G6JH 4OM1L 3RJQB 3TCXA 4R8WL 4YHZH 5B21A 5EU4B 2EIDA 2VWEE 2ZCHH 2X9WA 4BELD 1XZ0B 3NZHH 4HIIB 1MJUL 4HJ0C 3SPVA 2HMID 1I1AA 1FG9C 1UZ6F 3X11B 4X6EA 5EOTA 3EO9L 3LS5H 3GFUA 3S98A 3QUZB 4PJAB 3SKUD 5ICZB 3UYPA 3FAWA 3D0LA 1KIQA 1I85C 2Y72A 1QYGL 1DBJL 2I24N 3PWJA 4BM7A 4QHLB 4X8JA 5KSAA 3MJ7B 5EDXA 5IBLD 2IANA 3LN4A 1T80A 1MI5A 3QHZH 2QQLH 2G60H 4NN7B 1G7LB 2LVEA 4N8CH 3MNWA 4LBEA 3T1FA 1IGIH 5J89A 4XNMA 1MNUL 3BP5A 3I02A 4ZO8A 3V4VH 4AENA 1EO8L 1IKFH 1A7OL 4WV1B 3IFOB 4FS0A 1Q9WB 1EMTL 3PDOB 4M4PA 4R8WH 2BCKB 3DXAA 4R90L 4O02H 4WU5B 3UMTA 1FL5B 2VL4A 4XBPB 4Y4HD 5D6DA 4J4PA 5I1JL 2EIZA 4FQPA 4UINH 5B3NA 3LD8C 3BPNB 4FXLA 3T8XA 1RJZB 4OV5B 1UEYA 4K94C 2EKJA 5CEZD 2EICA 4XPHH 4D94A 2JCCB 4YO0B 1YEFL 4MNHB 3F7QA 5DUBB 3SDDB 5I1JH 3HC3L 3VFGL 4U1NA 1KPUA 2K7QA 3ZE2E 5CLTA 1BZ9A 4LARH 4YNYB 3MR9A 1C7SA 3I85A 1UWEL 3PWVA 4PRPE 5GISL 4ZUWB 2AXGB 3GSNH 1DUYB 4NYLB 1ZANL 3K2UL 2D7TL 2HVJB 5I1CL 3TZVB 4L3EE 1VGKB 4KV5F 4YPGB 4EUPA 3K0WA 5I17B 3FN0L 3BKJL 2VZSA 2OK0H 1MFCH 3N0PB 4P5MB 4Z0XB 1P84J 4P2RA 3D2UD 4HBCH 3RWCB 1MLCA 1JVKA 5D9SB 5C0DA 5IMKA 5GJTH 2X4OA 3LAFA 3RFZC 5HDLA 5C0JA 1QR4A 2JIXD 3GMQB 5ICYB 2W9EL 2YA1A 5FHBL 4RWYH 4Z7WE 3DX8A 3HZMB 4WWKC 5EU7C 4HF5H 5B3JF 3UTSB 4GRWF 5C0CB 2NY6B 4HWZA 3DMMB 1JGVL 4XXDA 3TJEH 2FR4B 4EOWL 1OSZB 4ZSOB 5K59F 3AS2A 5D93C 1T5WA 4JHBA 1A6TB 3U4AA 4LSTL 2X05A 1U92B 5GRUH 3T65B 5J12B 3DO7A 1I7RB 1M7DB 1LHZA 3MOQA 1FAIH 1A7PH 1FNEA 2QBWA 5ACMA 5L8KB 1R24A 4JB9H 2C3GA 1N4XL 3O4OB 4UOW0 1D6VL 2G2RB 2F8VA 1RHHB 2QV2A 3DHJA 2CR3A 3QUZD 3QDMB 4U1HA 4H88L 5EBLA 2X4NB 3FB6A 3BP5B 1WEJL 1S5IH 4ZFFA 1XGTB 4XZUA 1DQQB 3SE9L 5DUPH 1GC1L 5HHOA 3C60B 1HXMB 4QHMA 1AD9A 1NFDB 1J1PL 4FQ1H 5F7UA 1V7NH 1IILE 5I0DA 3BZEB 4QRPA 2IMMA 5LAXA 4XMLL 1K8DB 3DGGB 1JYXA 3D9AL 1CFBA 1OTTC 1A8JH 3TESA 3NAAH 2PO6D 3O2WH 2Q3ZA 3GK8L 1KC5H 2DIJA 1S78C 3FQTB 1XR9B 2HFGL 2WBWB 1KB5H 1VACA 4HMCA 2NY5C 4O51B 4XBGA 1A4JA 3T2NL 5ESAA 3S5LB 5T1LA 2MQ0A 3THMH 4YDLB 1QVOA 1ERNA 3QXUA 1ZT1A 1RFDH 1MF2L 2D3VA 5GGTA 3F58L 2PW2A 2V9QA 2HVKA 4NPYB 5JA8B 4XMLH 4E41D 4Z76B 1QBLH 3O9WA 2VQTA 3QXDB 2A6JB 4QRSB 5CEZL 2ARJA 4OF6A 3PWJB 3UAJD 3DLQR 4D8PA 4CJ0A 1EZVX 3C9NA 5AUMA 4N9GB 3TBVB 5IB1B 3O3BB 4QHUB 2XFXA 2EE9A 1QFWM 4ZG1A 5ABDE 3SBWA 4K7PH 2Y07H 4JFOA 5SX5H 3LRHA 3LKRB 5D8JL 2OL3B 2YSSB 4HS3B 5EN2A 1XGQA 4MD5B 4M00A 1CDIA 2B1HL 1NLBL 4K7PL 1U8MB 5I76B 4OLYL 3BKCH 4QY8B 1T0PB 2QQQA 5ITFB 4LCWD 3MLZH 4HBQA 2VDLH 4LLVA 3T1WA 3SE8L 2QEJA 4M48L 1ED3A 4LLMA 1LO2H 1K4CA 5D7LA 1CVSC 2PTUA 2NYYC 2GW5A 1QBAA 4OCRL 1FG2A 4ZTOH 5BZWB 1DEDA 1G7PA 1KN2L 3GSRA 2X4QB 2VQ1B 2IQAB 5DF0A 3TO4C 1U3HB 4L3AA 1N64L 2ILLA 2ZOKB 1OD9A 5GRYA 4MA7L 1D5XB 1U42A 3IDMA 3LQAH 4MNQD 4ZUVB 3WFZA 2YSSA 4HS3A 3VWJD 4NKIH 4LSQL 5HGHA 1R3JB 2C3VA 4I77L 1U8KB 1DQMH 4M61A 4Y19A 2C9AA 1HN1A 5IW6A 5MEND 2CXGA 1OP5H 2A9NL 3ECBB 3W9DA 4MWFB 5SWZB 4JJHA 3IAPA 1M6OA 1G7JB 3P77A 3S3JA 4DJMA 2R2BB 4UNTA 1D9KD 4AQ1B 4BQ9A 4LEXH 4KHXH 2VITA 2Y7QA 2HT2C 4HIJA 1FNHA 5ALBH 3N1GC 4H1LH 5D6CB 1UKQA 2MJWA 1AO7B 5C08B 4BSWA 2ZUVA 25C8H 4WIQA 4GBXA 5DURD 5L8JB 3WS3B 1U8QB 1RK0A 4PJHA 3SQOL 2BVQA 1IT9H 1A6TA 4HV8B 2DQDH 1LK2B 4P5KA 2BDNL 1A2YB 2H3NB 3EO0A 3VFRB 3MCLL 1M1SA 4GQ9H 4HGMA 5F3BB 4K3EL 2PN5A 2QL1A 3BEVA 3EYQC 4YHKH 2CMRL 4Y88A 3MV7A 5E08H 2YPKA 3T0AA 1MFBH 1C16B 2GCYA 4KHXL 5D2NA 1CICA 3WXWL 4M6OH 2FIRT 1QEWA 4PBVC 4TN9A 3UPAA 1RZIA 3CVHL 3RJDA 5D93B 4OIAA 2E3VA 4JQXA 1N5AA 4MNQA 4JREC 2Z91B 2R0LH 2AJ3A 1RD6A 1B0WA 2E6JA 2BSRB 2WWMC 4UQ3A 5D7JC 3RPIA 4N5UA 3U79A 3FT2A 4FQJH 5FCUH 3LS4H 3IFNL 1K4DB 1LP9F 5IEKA 2VTFA 4NQCA 1DVFB 3VFTA 3BEVB 1IC5L 1YNKL 3FAXA 1NCAH 3L5XH 3LQZA 1P9MA 1NFDF 3RL2B 3ZSSA 5FCUL 1TITA 3B5HA 3MCG1 4KDTA 1FN4B 5FGBC 1V7ML 5A40E 4MJID 1ADQA 1EO7A 5C0CE 1QRND 5HVGB 4PGCA 4OF7A 4N8PA 3RY6C 1NGWA 2R0KL 3EYOA 4LVNC 2A1WH 3RVWD 3V52L 1CDBA 1U41A 4W4OC 2Z0BA 1JNHA 1YC8A 1J5OL 3FQRB 4H25B 1LEKB 3RUGA 5E03A 5C07B 3D0VB 5HPMA 2BNQA 3QI9D 5L88L 5DJ8B 2WLZA 4PLKD 3QQ9C 5DVMA 5IKCA 4Y2DD 4PRID 2Y7QB 1WBZB 2IWGA 2R2CA 2RCSH 1S7UA 1I1AC 4XB8A 2R2BA 4G6KL 5D5MF 2PXYB 5C0GA 1OAUL 1YA5A 3TN0A 4RMTA 2LU3A 5ADOL 3OJDB 4KV5E 5DRXB 4MX7A 1PD6A 2BK8A 1KEML 4V1DB 1NDGB 4OT1L 2NYYD 1R24B 1ZXQA 3OKOB 3VGGA 2E6PA 5HD8D 3DX9B 2CRYA 2CDFB 1T04A 3T04D 3TA3B 2XZAL 4U1NB 1SY6A 1YEJH 4F7EB 1HYSC 4R4FL 5F6HJ 3QEQB 1L6ZA 4WWKD 2VNCA 1EAJA 1LP9E 1CLZH 1ZOXA 1MWAH 5H35A 5LJYH 2Z31D 2OTWA 4JFQB 3E8UH 2HTLD 1CXHA 3PABA 3DPBA 1X5ZA 4JPWL 4L4VE 5C0DB 3L7EB 1F6FB 5IKCB 3OKDA 4P2RD 2FD6H 2E8YA 4ZYKA 5LWYH 3H0TA 1CD0A 2Q7NA 2O93L 4BFEA 5HYIA 3RKDD 5GGUA 2AABL 4P46B 2Z93A 4GG6A 4OLWL 3PE9A 2FHCA 1ZHNA 5HI3C 3QDJA 4DZ8A 4X5LA 2GTWA 3T0EE 2EXWC 2BXZA 5F9WC 4NPYA 3WSQH 1EFXD 3OG6B 3WJJA 1F2XK 2J8UA 3N1QC 3IT8D 4X8XA 1BP3B 1YYML 4AIZB 3FRUA 4MXQD 1H3XA 4WY7H 3MUHL 5TPWH 1UZ8A 4NQSA 1MCOL 5JHDE 4IRZH 2BY0A 4K2UH 2H32H 3BN3B 4FP8H 5EO1B 1FNSL 3O3AA 5DFVD 1YQVH 5FGBA 2NNAA 4L3EB 1KCUH 5GGRB 5GJTL 1QO3B 3B5TA 1MAJA 1GHFH 3HLAA 3U0PB 3QUZA 3IGAA 4PJAA 3QQ3A 4MCZB 2ZPKL 1U8HA 1AD9B 1OLLA 5KVDH 3MLRL 1AGFA 3QULA 5BJTB 3EOAB 4G8EB 3VRIA 2VRAA 4LMQE 3V8CA 4X8JB 5F7MC 5L8LB 1MFEL 3TLRA 4JRXB 4R4BA 1BOGB 1XGYL 1AE6H 3FRPG 3OR6B 3LEXB 5EPMB 3MA7A 1LILA 1KCSH 1ULVA 1F11A 4O2FA 5E8NA 4M7ZB 3Q6FA 3CFDA 5K33A 1NEZA 2F53A 3L7FB 1AGDB 4LKCA 2Y23A 4LU5H 2RQ8A 4C58B 2V5RA 3ARVA 2B5IC 4NQED 3P0YH 1NBZB 3WD5L 1E4KC 1CFVL 1GGBL 4KKNA 2GTZB 1D6EB 3RGVA 4MD0A 2B7DT 2HWZH 3F5WB 5DD3H 5B39G 2DI7A 5EG6C 2YD3A 4MS8C 3V79C 1T5XB 5E9DE 4XP9L 2FHFA 5FGSA 1N0LA 2R56L 3HTLX 3ALPA 4YQXL 4P5TD 5J0BA 4P48A 3GBML 3CH1A 4NRYA 3J7HA 1D5IH 1MPAL 1BD2D 3CFCL 1H0DB 3E0GA 4KTDL 4L1HA 4YXHL 3RL1A 4L8CA 1J1XL 4OZ4B 4AQOA 1QNZL 4OCWL 1KPVA 2VSCA 1YEHL 4P2RB 2EDXA 4L8DA 1N59B 1WZMA 1EEYA 4XPAL 5DHYB 4OLZL 4K2UL 4Z7WA 1WTLA 4OCXH 3DUUA 2DQHL 5ADPL 5CGTA 2D0FA 3QDGD 4N90E 4LCWB 4PRDB 4PRAB 4PJGA 3B9EA 1TVBA 2F54D 1ED3B 4LLMB 5J6GB 5E1HB 2VDLL 3MGAA 1ZLSL 2DLIA 4FFWD 1MHEB 1FVDA 4P23B 3QJFB 3QEUA 3ZT7A 5D1XB 4AIOA 5IWLA 5C7XH 4RMWA 5L2KD 3O81A 1AR1D 3TFKD 5D9SA 4E0RA 4HWUA 3ZTJH 3OX8A 3SJVE 3VWJB 5BJTA 5DJ0B 5I8CB 2IMNA 4PJ5D 2XTJE 2LE9A 4M1CD 4Z7WB 2FLBT 5J6HA 1A7PL 1EEUA 4LLQA 1BOGA 3ULUL 2OL3H 3W11D 1X5KA 1F4AA 5FYLD 1ZVSB 2YD4A 1M71B 4YXKL 1UKTA 1X5HA 2LV4A 2MCG1 3L3HB 1CS6A 5ADPH 4PPTA 3KLHC 2QKIB 5A3ID 4Q9CA 1BX2A 5CGYD 4WHCA 4ZXBC 3V4VL 4KVNH 4RGMB 1N6UA 4QOKB 4PD4K 1A6AB 1K9TA 3SGEH 5I1HH 5LBSL 5HI3D 1U8IB 3S3PA 1DBAL 2DQTL 4K23H 4PJCA 4YWGL 2DRUA 5T1DH 3PGDB 3NPSC 5SX4H 1H3VA 1RQ5A 4JEGB 3V5KA 1RULL 4U49A 4E5XA 3BIBX 2Z8WC 5ETUB 3VGAB 3KGRA 3HI6H 3DVNB 3MLWH 1HCFX 4UNUA 3JUZA 1A21A 4K8RD 1BQHB 1MRFH 3WFHB 5CLWA 1M05B 1NMAH 2GI7A 3F65A 4OJFL 1QZ1A 1IBGL 2IPTL 4IOSD 2ZUYA 3ILPA 3TPUB 3FRPA 4QHLA 5KSAB 5C0IA 4UIKL 3AXLB 2OQJA 3DGGA 4ZO9A 1WEJH 2VERN 1QQDA 1FNFA 1JZ2A 3FQXA 3G5XA 3DRTB 4PJEA 4UQ3B 4R4ND 2VUOA 1B0RA 2WK2A 5M7QA 4YPGA 3BDYH 2W9DH 3HMWL 4ZAKC 4X6EB 3FONA 1YJDC 4XP1H 2AEQL 3BT2H 1Q0YL 5SWZD 3BPLC 3V6OE 4WHDA 4LEXL 3BPLB 4K94L 1WCQA 1MRFL 4XVUC 5EZLB 2WBJB 5HHOE 2VXSL 3T09A 1J7VR 1UXSA 4AEHH 1JNLH 2JJSC 4MJ4A 5EULV 4O2EB 4G80A 2ATPA 1EFQA 4EXPX 4P23A 1OWRM 5MI0B 4PY8J 2CDGA 5DHVB 3ZKSD 5GGSB 4BQCA 5HTSA 5MP6H 3ARGD 4Z77A 3SKNA 4NKIL 3UPCA 3DMMA 4U1MA 1GGYA 1YY9D 4HG4J 2F15A 2NW3A 2H2SD 5EWIL 3FHQA 1CFTA 4NZRH 1HHIB 3MRIB 4E42B 4PLKC 1WWCA 3UTTB 2KL6A 5FFLA 5IVXB 1RPQA 5EZJB 1JGLL 4UV4L 4P9MH 2QSVA 3QG6A 2OXHA 5DZNA 1WCBB 3GJEA 3MMEB 2OSLA 3ZL4H 3L5HA 1SYSB 1UM4H 2OQJB 3DUSA 2GCYB 3RVWC 2AJXH 3FOLA 3UJTH 4H1LA 3VMPA 5DD0L 5D7LB 3B2VL 2ZKHH 3DYMA 1KCRH 3TC9A 3V7AG 3HUJF 5LXGL 1HWGB 3BN9D 3MJ6A 2M8XA 3EYSH 5F7LB 2ZCLL 1I9IL 1BVKB 1A7NH 3PP4L 3DVNA 3MLTA 3SGEI 1CR9L 5C08E 4OF0A 4NJ9H 3L5JA 1U8PB 2E5EA 3BMVA 4RCAA 4NOFA 3FT3B 3O11B 4HZLA 2ICEA 3RX5A 2XQBH 3AS0A 5T3XL 2P8LB 4IRJC 4U3HA 3CSYB 1DLHA 4LHUD 1MCPH 1P6FA 4M7LL 3RI5K 2EIZB 3DWTA 4HK0B 4UB0L 5EA0L 3FO0L 3CLFH 1T20A 1QBLL 2J4WL 3HUJA 3DX6B 1CLZL 2P24B 3P3YA 1T03L 3BPOC 4KKAC 4HHAA 2VE6A 4I18B 5HPOA 2HTLC 3RWDB 3R06B 1I8LC 4Y4KA 1IGTB 1MUJB 4YBLC 1F6AA 4Y89A 2JELL 1GSMA 3ARZA 1RURH 3N1FC 4AM0B 2D9QB 5GJSH 3IU4H 4JFHE 2R0ZL 2A9NH 3QUYA 2BXYA 3QUXA 3UBXB 1EBAA 1U93A 3EYQD 1I7TB 5LGHH 2R9HD 1ZSDB 4FQLL 4JKWA 1BVLA 2Z92B 1I1YA 1MREH 1GGIL 4UU9A 5ESVB 1BFSA 2WLYA 3SDXF 3QCVL 1N7MH 3V0VA 1MCIA 1BOYA 1D5BA 2XWJB 4P3CL 3ILQC 5K9OA 4M7LH 2OP4L 4X5WA 2X1QA 5EUOE 4AIZA 4QNPE 4KC3B 3O9WD 4CVZB 1IAOA 3HAEH 5I73B 3V5KB 3MV8E 2FYYB 3MV9B 4G5ZH 2BVYA 3CDGB 5FGCB 1BJMA 3BQUB 1A0QL 2F9BT 4NT6A 4HIJB 4NWTH 3TT3H 3SOBL 2V2TA 3OJMB 4DUVA 4KKCC 1GAFH 2R69H 4P4KC 3GKWH 5HHQA 3KPOA 4C57C 1MY7A 2I5YL 2W0LA 3DUSB 3LQMA 2JJUA 1YMMB 4F7TA 1WCBA 3QQ9D 4OQTH 3MRRA 3V52H 3WNKA 4I0PA 3HS0B 4CADA 4P9HL 1ZMYA 3GSUA 1FYTA 3AVEA 4FXGB 5F96L 4HKBB 4DCQA 2VZ1A 4ODTL 4GKNA 4JPVL 3RVVC 2AEPL 4QTHA 1DEEB 2XQYK 1CLYH 1J8HE 3GJFK 3IU3A 3O6MH 3REVB 1WIUA 3NFSL 1A4KA 3TV3L 3T4YA 4HKXB 1MRCL 3UJJH 3UEZA 4GRWB 1GZPB 3K74B 5FOBA 4H8WL 3NFSH 2YPLD 5MHSD 2WAHA 5HDOA 4OLUL 5JO5A 3WKML 4AG4H 1BJ8A 1ZS8B 2F5AL 2VLMD 4LSSL 1IZKA 1F2QA 2EDFA 4UDUA 3HCVA 4NFBA 4IMLA 2V2WB 1J8HA 2QKIA 1INQA 2WBJC 3DV6A 5I76A 3X3GL 1SMOA 1H3GA 1R5WA 1IC7L 3RUGF 5DMGD 3OKMA 5BCAA 5LWYL 3QDGE 4N90D 2NY6C 1OAQL 4I9WE 4XVSL 2EDEA 4YBQD 4QNPF 3OHXB 4XP4L 3U6RB 4JHWL 3IFLH 3R8QA 3HMXL 1ZA6A 1M6OB 4G5ZL 2ZWLT 5ACLA 4MJ5B 3NN8A 5DC0A 4HPOH 4DQOH 5TH2B 3LKPB 4PRPA 2G9HB 4IDLA 4LMQI 4JN1L 1PBYA 1XT5A 1ZLUK 1QFWH 4XH2B 5ENWB 1UYWL 4PJGE 4DEPB 5JOFB 2G60L 4NCC2 4IS6B 4X6CF 4QXUL 1MCEA 3SY0B 3T0ED 4HZLB 1T1YA 1XIWB 4QRUB 5T3ZE 1NCWH 3U82B 1MCWM 1FORL 5EBMA 3X14A 4QXWA 4WFGD 4MGXA 2VZOA 5FM5M 1HE7A 5EO0B 1OGAB 1GYAA 5D2LF 3PDGA 4RIRB 3Q6FB 1SM3H 5C3TA 3LKNB 4DK6A 3HNSH 4WUUB 1P2CA 5B22A 4ORGB 3U1SL 1FCCA 3FKUS 1JFQH 3KR3L 4RGND 5CCKH 1EDQA 4FQHB 1Y18A 1BVZA 4MSWB 4XPGL 3TNNB 2BP3A 4E9LA 3BH8B 4Q7DA 2E27L 4S1QL 5KSBF 5SWQA 4GUPA 3EYVA 4P4KB 1RUPH 2NW2A 2AJZA 5D2NB 4YIQB 2KH2B 3B3IA 4KROB 4QTIL 1KF9B 4CRPA 5L2KA 1PYWA 1RJYA 1WJ3A 1RUPL 4NQSB 4HIHB 3T2QA 5I0ZA 3QEHB 4HKJA 4Q2ZA 3IS1X 3FB7B 4ZTPH 4JY4A 4V1DD 1GPOH 4GMTH 2I9TB 4LSUL 4Q9RH 2H9GB 3ZDYE 3FFDA 4HC1H 3CFDB 3RWHB 2IBBA 2BCKA 3DXAB 1HHJB 2DWEA 1M7DA 2E27H 2AW2A 4S1QH 3VXSB 3FCTB 4QRUA 3DV4B 1JV5B 3W39B 3OKOA 3ZDXE 5L0QC 3UPRB 2IADA 3KXFB 1NC2B 4LSRL 4TSBL 3TNMB 4HIXL 4RWYL 4DKFL 1FRGL 2FH6A 3UTQB 5FIEA 3K81A 2XIDA 3ULVD 4WUUD 2H8PA 4XWOD 3NFNB 1J1XH 1B0RB 4EQ2A 3L3KA 2EDTA 3FQXB 3G5XB 4JM2F 1OAZH 1U3JA 2EDBA 1XF5A 3PHSA 1MFCL 3GSNB 4APQC 1FLTX 4CVWA 3GMPA 2YA2A 3EOTH 4KQ3L 5EIVA 4JQIL 4AL8L 5HPMB 3DV4A 1UJ3C 2GITB 5CIPA 5EU4A 1ND0A 2DQGH 4EN3C 1X5XA 1BQUA 4HEME 2BFVL 4EN3B 5FO8A 4JFYA 3NABH 2A6IA 4Z78B 1OTTD 2DKSA 4LLDA 2XN9E 1N3NB 3H3PL 3MLVL 3I84A 3VXPB 1DQLH 5DUPL 2D0HA 1OGAA 3W0WD 1QLRA 3PWPA 1HHGB 4OZFA 4TNVK 3BRFA 5AZ2L 1EFXA 1RUMH 2LTQB 3MLVH 4WTZG 4Z9KB 1T5WB 4H0IA 1PZ5B 3NACH 5FAAA 1ONQA 4BH8A 1MNUH 2G5BA 4J8RA 2EE6A 2EDKA 4TVSa 1NEZB 2DQEL 1A7OH 4TUJB 3SJVA 4UU9B 4WCYH 3TNNA 3G9VA 4U6HA 5ITBL 2IANB 5E00A 3DX8B 3HZMA 4LLYA 5HVFB 3O4LB 5HYQB 4Y16A 1IAMA 1MHCA 4LQ1A 1L7IL 4HDIB 2IGFH 1MFAH 1EV2E 4JVUA 4F57H 3S4SB 2B2XH 5DRNA 4HJ0D 1GXEA 1X5AA 1ZT4A 4XRCB 5EORL 1I3RB 4JRYB 3WIHA 5EOTB 4J4PC 3BOVA 4PRIE 3QEQE 4P2OC 2AQ1A 2XY2A 2EDHA 4RRPG 5D1XA 2CO7B 3FT3A 3MUZ1 1Q72H 5C6WH 4HXAH 3RY4A 4U1KA 3C8KA 1U8PA 4RZCA 3HE7C 2UZIL 4Y19E 3IKCB 1VB9A 4KTYA 4QXGL 2M1KA 3CSBA 1PVHA 3MR9B 4R4NC 4YDKH 3ES6A 3HFML 4QXTB 4NQEB 1Q94A 3IKKA 1PQZB 4PRNA 1I85A 3DBXA 1Q0XL 2UV3A 5I1DB 1PX3A 4IDJH 4BZ1H 4JRYA 4XBPA 4GBXD 4KMTL 1FBIL 1PFCA 1GIGH 4FNLL 3TBSA 5HGHB 1WSST 3RWGA 1J0JA 4P49A 3UBXA 1KXVC 1S7QA 1KG0B 3TBWB 2GJ6B 4Y7MA 2W0FA 3O41A 3SHSA 2C26A 4JFEE 3V9FA 1FZKA 1YECH 1BEYH 1TTGA 3FZUC 3ZSTA 1XF3A 4XBEH 4PJFB 5DT1H 1DN2A 2L7JA 1DUYA 2A6DB 3L3GA 4OZHB 1H0DA 4C54A 5EUOA 1XEDA 1ZS8A 2DQHH 5GGRA 3VD5A 3GO1H 2EDOA 1IGJB 2GQHA 2OI9C 4I9WD 5C0BD 3WHE1 1I7RA 3RNKB 2ED9A 4RFNB 5IVXE 3UTTE 2OJEB 4KKBD 1PY9A 5AG8A 3SKMB 3ULSB 3OZ9H 4BKLB 1XFPA 1K6QL 3I50H 2CJUH 3WFEL 3A6BH 3NIDE 3QCTL 3TP4A 2BOBB 1FCGA 2ADJA 5DZOA 3HHRB 2CK0L 4NRXB 2NTFA 4KJYA 2RB8A 2E9IA 1AR1C 3TFKC 2AQ3A 4JFOB 1OD7A 4LKCB 2XICA 4OKDA 3L3GB 4CADB 4XAKD 1TJGH 1K5NA 2W65A 5FUZH 1E6OL 4R26H 1BFOA 3PV6A 4EDXB 5HGAB 3TBYB 1T7ZA 4ONFL 5JXAH 1QSFE 5F6IC 5BXFA 2C3HA 4CAGA 2DBJA 4CU8A 4OCNC 2VOTA 4Y1AD 4Y1AE 4R26L 1XCQA 3STLB 5IB5A 1FV1A 4NC0B 5E6IC 5GS0L 5DRZA 4YDJB 3UC0L 1CXEA 4GFTB 4MCZA 1DUZB 5DMIH 2OTWB 2FX7L 5TQ0H 1VKXB 4L8SA 1AD0A 1QHOA 3S37X 3T0VA 1NMCC 3MJ8B 2AJXL 1C1EH 2RJMA 5L9DH 1UM5H 3W81A 5IJVB 3KLAB 3MV9D 1UH3A 4P2QE 1UB6B 1JWUA 2EH8L 4PJEF 2C1OB 4NO5B 4IHOA 1QBBA 1RIHH 5I1DA 4UBDD 2HN7B 4NO2A 1H15B 1KXQE 2NQCA 1MAMH 3V4UH 1NAMA 3WN5A 4XNXL 3V5DB 2DL9A 2DF3A 2FJHA 2RAMA 2FEEI 2UZXB 2FX9L 5I1GL 5MEQA 3K1DA 5D72L 4LPCA 3PHOA 2GJZB 3U2SB 3STBA 3PJSA 4OZFH 1I9EA 4AENB 1AHWB 2CGRL 3KVQA 5TDOA 5AZEL 1A6WL 1Q9LB 3KPMB 1R3LB 5IQ9B 1MWAB 5TF1L 2DJUA 5D2LB 1TIUA 1OTSD 1CDHA 2ZUTA 5CUSH 3D5OF 3TM6A 2OR7A 2VLJD 5CWSA 3QXDA 3ZHLA 3BVNB 1DE4B 2JJWA 5T5FL 1RIUL 1KCRL 5I30L 3QUMA 3MTRA 1EHLH 4MAYA 1TCMA 3I2CH 4TNVF 4WVRA 5JW3H 3OPZL 3ARED 3DNKA 2CDFA 1AXSB 2NY1B 4FQCH 7FABL 3S5LA 3MV8A 3PP3K 3U30C 4O4YH 4JO2H 3SGDH 5E2WH 3VXUD 4YFEA 1PLGL 1W72L 3C08H 3MYJA 1H3PH 4PJGB 3MLSL 5KG9A 2OL3A 1S9XA 5T1KA 2LU4A 4G8GA 1J86A 5E99L 3GZKA 2VLLA 3MZTA 2ZSVB 5J13B 4DWHA 3QPXL 4GBXC 2E9WA 4FQQB 3Q3GA 4FZ8H 1N7ML 3S8WA 3ZDYF 3HG1B 3FQWB 4WENB 5C0FA 3O6KH 1JK8A 4L8SC 2A0LD 3PNWB 2PCPA 3HUJE 2JCCF 5JMRA 4ODXB 2R0ZH 3G04B 1YEJL 3EDDA 4XHJC 5IJKA 4HKZA 5FO7B 3MRDA 3IXAB 1KCLA 2EXWD 4Q6IA 5J6HB 4APQB 2ZOKA 1P7HL 1NSNH 1P7KB 4OFIA 2H2PD 2Y25A 2VLJB 2PXYA 3NMEA 3HAEB 2JIXB 3VA6A 4HJJH 3MSPA 4FFVD 5F7EL 1CFNB 2V2XA 5FYLE 2NLJB 3U36A 4RMUA 3BP4B 4QWWC 4TRPL 5K9KA 5GZNC 1YN7A 4NJAL 5I8EA 3Q3GB 1FC2D 2NY3B 5T3XH 3N9GL 2QHRH 4IMKA 2F8OA 3GSOB 1P69B 4U31A 4XB7A 5D2NE 4LFHG 5DI8A 1KT2B 2NXZC 3QRGL 3TNMA 2VABB 3O3DA 2EKSA 1KJ2L 3NFPB 1Z0MA 1BBJB 2ZG3A 2OR9L 2VZ3A 1HXMA 4LCUA 1EHLL 1UFUA 3QDGA 4DUWA 2FBJH 4GRLD 4WV1C 2EYSA 4OLVL 1FZOA 1DE4A 1NKOA 4NQCE 5FKAA 4R7DA 4P5TA 3RWDA 3MRPA 1VFAA 4GRWH 1DVFA 1Q9KA 4PJ5A 4ODWA 4FQ2H 2AI0L 1C16A 4POUB 2FZ3A 2DAVA 5ESQB 3GMRA 4EN3D 3ES6B 2JJTC 3CDYA 2PETA 4I4WA 5E9DA 4WNQA 3QQ4A 4HIIA 4JFED 3SPVB 3ZO0A 4M7JH 4XGZA 1LK2A 3CUPA 3RVTD 2PTTB 1ZA3A 4MAUH 2R4RH 3RZCB 12E8L 1A7RH 3IRPX 4U6VL 2P5WE 3MV7B 1JZ4A 3WSQL 1KXTB 2Q76A 4C56B 3B43A 4OFPA 3SDDD 4M03A 5FO9A 3OKDB 5TE6H 1MHHB 5BOPA 3VXRD 1MVFA 3GUTB 4F33A 3O8XB 2VDPH 1P7KA 3ALXA 3H3KA 1NGQH 3KPPA 4CN6A 5C6TH 1T7YA 1KPVB 5DGQA 3DTXA 2DS4A 2FX8H 3F7YA 4LKXA 3SE9H 2A9ML 1QKZL 2Q8BL 4WO4A 3HS0A 4Z7OF 3JXAA 2LU7A 1CICD 1OPGL 1IARB 4ELKB 2EEDA 3MLXH 5HI4C 5C09B 4PJ8B 2YHGA 3CU7A 3I6LE 4LHJB 1AE6L 2ADJB 2DQIL 5EIQA 1HNFA 4UILH 1FAIL 4LIQL 3UZQA 2HJKB 4NKOB 3TCLA 4OCWH 4E41E 2DWDB 3FT4B 2D0GA 3ARQA 1NC4B 3KYAA 1RZJH 4TSCH 4NM4L 3BQUA 4NT6B 4NZTL 5HI5D 3HR6A 5KSBE 1FORH 1ZT1B 4L4TB 4HWEL 1MHPH 4JO3L 4OB5H 4YX2L 3MA9H 2EO9A 4MJ6B 4OT1H 4G9FD 2QSQA 2DM7A 1FZJB 2XWJA 3LS5L 2FGWL 1T1XA 2VR4A 5E5MA 1QOKA 1UJ3B 5DD3L 1NGXB 1J0IA 2YN3A 2CXKA 3D25B 5I15L 3HB3C 3C9NB 5AUMB 2JTDA 1ZHBA 2CO6B 5JHLH 5F9JB 4Z5RB 5IQ7L 1KENH 4ONGH 2CK2A 4NNXB 3T3PE 3CFKA 3UTPE 3OF6D 3ZDXF 1ORQA 4FZEL 5IW3A 3CMGA 5DVKA 4WFGE 4P5MA 1E6JH 2K3TA 2NW3B 2EYTA 4HWNA 5H35B 5D7JB 4XVTH 4KJPD 1EUTA 4QYOB 2D31A 2NMSA 1NAMB 3RA7H 3D3VE 3HPLB 2DI8A 2K1MA 1Q0XH 3P4MA 35C8L 1QFPA 3F6IA 3PGCB 4HFWB 3HFMH 4XMPL 3WE6A 4F58H 2DQFB 1HH6A 3HI1A 4LHUA 4NZJA 4YAQA 3KHQA 4UINL 3V6ZA 5IR1B 4LBEB 1DQJB 1V3JA 3L3DB 4WHYG 4PR5A 2RHEA 1U8HB 2F5BL 4KMQA 3FB7A 1HQRB 2XI9A 1Y6NR 3MACL 5F7YC 1JHLL 3MUY1 1JYNA 32C2A 1MLBB 1NKRA 4FQIL 4WTWA 1X4ZA 5E9DD 1F97A 1I3UA 1T7XA 2Q7YB 5HYJD 1IC4H 5F9WB 4K71C 4IM8A 3O4LA 4YHLL 1MHPL 2UZYB 4JO3H 4X4ZA 1VDGA 1T83A 1I4FA 2ENYA 3BEWB 3TH4T 4TUOA 5C0EB 1BREA 3GRWH 3SDXB 3ALWA 1CICB 4PJIB 3MRCB 5IWLC 3LN5B 3CZJA 1MCNA 4OFVA 4WRLA 1DQQA 5IR1A 1QO3A 4BH7A 5CMAA 4R2GB 1NMCB 1J9CT 4XP1L 1JNNL 4AM0A 4PTUB 1Q0YH 4UNVA 2KKQA 1BFTA 4U1MB 5EZIL 1QPPA 5KW9H 1L0YA 3RVVD 5CSZA 1A9BA 1NC4D 3MBXH 3RIAK 3VFNB 3WNMA 3EJZC 4JKPL 4R7NB 2AK1L 3L3OB 4YGAB 3SDDC 1X6NA 2V7NB 1ETZA 3VFPA 2VLRB 1S7XA 4EUPG 4PJ9D 4F8TA 5ISZB 4XWGH 3VXUE 1VSCA 5T1MA 5I16B 1PG7H 5EZOL 1U8JA 2OJZH 3VMOA 1T22B 2NY7L 1RSFA 5IOPA 3IDXH 3CFKB 2VDRL 4Z7VB 3H8NA 5EOQH 2VKWA 3B9DA 3QPQC 1GGTA 1QTYT 3QZWB 4YDKL 4M43L 1ZGLA 4UTAH 4XC3L 1XMWA 3QIBC 3AXLA 2YC1A 4H1LB 1BQLH 2BNRB 3G08A 4WUUA 5F7DB 5B38A 2AERT 1YN6A 2BVTA 3DUHA 2W60B 4YHPA 3AB0B 4ELMB 3DGCR 1N64H 4ONHA 2AAVA 4G9FA 3TO4B 4UV7H 2ICWJ 1AXTL 1R5IA 4YDVA 4EUPH 2EYRA 3EDJA 4KVCH 4GRLC 3HB3D 5C71A 1S7TA 3ULVL 4HUWB 2VLKD 3MYJB 2FEEL 1JI1A 5ITFA 1P7QA 3B8YA 1GZQA 3G9AB 1U58B 1I8KB 4X4YB 3U48A 1HYRC 1YMHB 1JF6A 4R7NA 4MQXC 3V0WH 2X40A 5EH1A 2XZQL 4JDTL 4HD9A 1NCDL 2VXUH 2WP3O 5GZND 1FQ9C 4JAMB 1R5VB 3EUUA 2VLKE 4UQ2A 1I7TA 1QSFA 5FO7A 2BNQD 4K9EC 3WNNA 2DJ4A 3QDHA 5B8CC 3K8MA 2YN5A 1T2QL 2DLHA 4UV4H 1IT9L 1C5CL 5HI4D 4RAUA 1X5LA 4ZD3L 3C6LC 2A6JA 2JB5H 1K8IB 3MRNA 1F3DH 5E5UB 2VXTH 3G6AB 1B0GB 4Z0BH 2ADFH 5FUOL 3L5XL 1NCAL 4HSQA 3IXTB 5FO9B 2HKHL 2RBLA 5EWIH 5F7EH 5E5RB 3MRGA 3TBWA 3P4NA 3L3OA 2HT4C 2J5LB 2X89D 3C5ZD 3LIZL 3IS0X 4R2GD 4S1RH 5CZXC 4RFOL 5CJBA 3CIQA 2IPKB 3EO1A 2NY0D 2JB6A 2MQ3A 3MBEB 1I1AB 4LASH 1T1WB 2FIKB 4P46A 3O11A 1I9RH 3WUZA 4TQEH 4W4NA 4MD5A 4PB9H 5CFHA 2HKHH 3BDBA 4DGIH 4X6CE 3T77A 3ZKNC 1VFBA 4G43B 4LSPL 4XCNA 1J0ZA 1FIEA 2H45A 1UXWA 4AT6A 2JB5L 4I48A 3WDJA 2BOCA 1QSED 3O3EA 3OXSA 4X4XA 4JZOB 4OD3L 2V9TA 5K93A 2NX5E 3VWKA 1U6AL 1KTKE 1OCWL 7FABH 3GDBA 3QUYC 5SWSE 5C0NC 3SKJL 1EA9C 2R15A 3LEYL 2B1HH 2FATL 3V0WL 4XVUD 4FQHA 4XPTH 4AZ8A 5JTWA 3V5DA 5SX5K 2ERJC 4Y4HB 3REWA 2QADD 5HHPA 4NWTL 5T1LB 1Q1JH 4LFHD 5DD5H 1IGJA 2XKSA 3ZL4L 4WU7A 3G5VB 1OTUC 2C4XA 4M5ZH 3NPZB 3QXAB 5KS9E 5FYKL 4M7KH 5I1AB 3TH2T 2MCPH 4NQTA 1CDUA 3ULUC 4O00A 4NNPL 4G7YL 3VH8A 4O2FB 2O5YH 5E2UL 1X5JA 1WFNA 2EYTB 3D85A 2Y5TA 3DVGA 1NBQA 1CTOA 3JWOL 1GGCH 1QBMH 5HGBB 4CDHA 5F7KC 1N59A 3GJFB 1K8IA 3MRNB 3V4UL 3H9HA 4Y0GA 5A16B 3WNLA 4QWWD 4G6ML 3MPCA 4L4VA 5I1LA 1ORSA 2EZ0C 3RPKA 5DJAB 4PRPB 3PV6B 3RHWK 3N1PC 2H2PC 2FHBA 4HKBA 1JPTH 2IJ0C 5DJ2A 2ZUQB 1T5XA 4GAGH 2FX7H 1QSFD 5TQ0L 5I1AA 4CVXA 1UWXH 4JPKL 4IBLT 4Y5VB 3HKFA 3T0XA 5A2KH 1Z5LA 1F4WH 3HRZB 5HY9A 1C5BL 2P8LA 4K3EH 2IBGA 3ZKMD 3VFSB 1HSAB 3T0DA 4OF3A 3C5ZB 4DVBB 4GQ9L 4DQOL 1G7PB 1UH4A 1KTLB 1TZGH 4X7CC 43CAA 3IVKA 1I1FB 5E8EA 2ZG2A 5DVOA 5JW3L 3L3IB 4WNQB 1OAQH 3KYKH 4NJAH 1CR9H 2NXYD 5JIKA 3BSZH 1RUQL 1OGAD 3W0WA 2R4SH 3DSFH 4G9DA 3X3GH 4OI7A 2OTPA 3O3EB 2J12B 1S7SA 1WAAE 1UB5B 1GZPA 1CFNA 1LP9A 4NKMB 4UUJA 5AWNH 4OFYA 4PJAE 3GM0A 1P6AB 3WKMH 3VFVB 5TF1H 5IM7A 3H9SA 2DLEA 1U8OB 2PYEE 1BM3L 4JRXD 4LL9A 1ONQB 4JFFE 1S7QB 3INUH 2A83B 3LPWA 5SWZE 2A6KB 3D3VA 5F9OL 3RAJH 3VD4A 4X4ME 3ZE2F 4KROC 2YMXL 3PNWA 4KMLB 1YPZE 3BP6B 1FH5H 2R8SL 1I7ZA 4LRIC 3HI5H 1UZ8B 4NDMB 5DJYA 3CVIL 4DK3A 4WI4A 1L6XA 4MA3B 4P2OA 3U9UB 2JCCA 3NA4A 4YO0A 3LH2H 4ETQB 1KGCD 4G6JL 2NY0C 1MJ7H 4KAQL 3ROOB 1E4XL 4LSUH 2DMBA 4Q9RL 1CGSL 1CU4L 1CL7L 2CUIA 5DRWA 2HT4D 2AABH 4HEPG 2Z35B 1DQDL 4M9PA 1GGUA 2EIEA 4X4MA 5HJ3B 3VGFA 4IS6A 4XPHL 2XXMB 1RZFL 4J1UA 1YEFH 2OTUB 2VISA 1UWXK 2AEIT 4ZUVA 1T1XB 4KJQD 2D03L 1NAMH 3D18B 3FO1B 3MOBH 2AP2A 5E24E 1NBVH 3QT2A 3QIUB 3QO1B 2YUWA 5HGAA 4Z95H 3TBYA 1KFAL 3HE6C 4CN1A 2LVCA 1Z3GH 4HKZB 3CFBB 3HNSL 2XWTA 5HYJA 4Z7VE 4JDZA 2FWOA 4D3CL 3G6JF 4Y8DC 2FR4A 1R3KA 1V3LA 2Q87A 4AL8H 3HC0B 1PKQE 1CLYL 2X09A 1FHGA 2VN4A 3GI9H 3NA9L 3OKMB 1LO4L 3SDAB 3OGCA 3QA3A 4MXVF 1JYWA 3GBMH 4NOBA 5DS8B 4DGYH 3VH8B 1WFOA 2UYLA 3GI9L 1VESA 4U2ZA 1JPSH 3HPLA 2ARJQ 1FGNH 1CZ8L 3GSNL 3L95B 1A1NA 4XWGL 4R0LC 3BUYA 3ESVF 3WUWB 4KKBC 1ZHKA 5BVPL 1QPXA 3V5HA 1ITBB 4LLUA 4Z7VA 4HCRA 1OB1A 2D9CA 3QIBD 5ICYA 1BMGA 1O5DT 2DTSA 3ESUF 4F15C 3FONB 1S8DA 3MNZB 2BNRA 3G08B 3G6DL 1NMBH 4C55A 2ZNWA 1T89C 4PLJC 4Z0XA 4ZOCA 4OGXH 1VPOH 3SDCD 5C8JB 3WFCH 1A3LL 1U3HC 1DQDH 1MWAA 4KMTH 5EZJA 1FZJA 4YE4H 3MLWL 5FYJE 1H5BA 4WFFE 1IL1A 1T66C 5DVLA 3VDBA 1VFBB 4G43A 5DMYA 4WI2A 3NCYS 4XWOC 3IVKB 4WGVB 3BX7C 3OR6A 4H8WC 1J88A 5IW1B 5ENWA 4M3KB 1Y0LB 5JR1H 4DAGL 5KS9B 1DUZA 4PJBE 4FP8L 1F58H 4NKOA 4X99A 5FHBH 4K55A 1YQVL 3O2VH 4OCXL 4Z7OE 4F9LA 5L7XL 2VLKA 4HCRL 2VDQL 1MQ8A 2YZ1A 4ZSOE 1HZHL 8CGTA 4NQUA 2X89A 2CDEB 2WWKO 1OP3K 5EORH 1AQDB 5GSVA 3TIEA 4PJ5B 1D5BB 3SE8H 4ZUTA 2KDGA 3CD4A 2FL5B 3EFDL 4PJEE 1ACZA 3IXTA 3HZYA 1MFAL 3NAAL 5HYEA 2LAAA 4WHTA 3H9YA 4IOIA 1E4JA 2G75A 3T3ME 4XTRD 5IW1A 1ZANH 4YAQB 5JNYA 5D8JH 2DD8L 5DQDL 2V7HA 3FQUA 4Q0XL 4HC1A 4M7ZC 4U1IB 2DWEB 2W38A 1E6JL 1FFOA 1MOEA 1GGBH 4ZSOA 1IEAB 5DEZA 1CDGA 3UZEA 1I1AD 5FF6A 1EPFA 2AV1A 2J2ZA 3TIDB 4MCYB 4NRXA 4Y2DC 3RKPA 2FEDD 5EBWA 5ID0B 2P8PB 2J8HA 2BJMH 2GSIB 4TPRH 5C1MB 3K80A 4YHYC 1H3UA 3OR7A 4KJPC 1MEXL 2HG5A 5BS0B 2DD8H 4LK4A 2CIKA 4DGIL 5EOCH 1N2RB 1CGUA 4IRSD 2NR6C 1A4KB 4KTEH 5IESL 1NUDA 4HUVA 2APFA 2E6QA 4L8BA 2J6EA 2OMBA 3HG1E 2FO4B 1R3HA 4KGLA 4ELKA 1AQDA 3SKOA 3TH3T 4NGHL 1SY6L 3D39D 3O2WL 1TQBC 1QR1B 4S1RL 4BFIA 4HLJA 4I1NB 4PJXB 4OAWB 4LPYA 1JJUA 5AYUH 1OGAE 2MKWA 2CQVA 5D72H 1A6ZB 3QDME 1ZT7B 1MEXH 4KQ4H 4FTVA 4OCRH 1AO7D 1EJ6A 3ROLA 3RWHA 4P4RB 1RZ8B 4XNZB 1OARL 3P0GB 1RHFA 4NZUH 3MLZL 1A4JB 3EJZD 1S9YB 2DQDL 2HLFD 1KB9J 3VFMA 1VGEH 1VENA 1X5YA 1HEZA 4EDWL 5L9DL 5E7BA 4P57B 5DEGB 3GSXB 3GMQA 2Y4SA 4ODUA 1AP2B 3BISA 2I5YH 4ZMAT 4Q0XH 5LXGH 3Q1SL 5E94B 5CSZB 4HLZG 2HLAB 3JVGA 1JZ5A 1IGFH 3MGTB 4PRBB 2ZKHL 3OAUH 5D7SH 3NGBB 5BRZE 2VIRA 1A6ZA 4CJ1A 1KEGH 3WNPA 3BFOA 3SDAC 3VXTB 3TO2A 4G7VL 5IB1A 4D0DB 3O8XA 3RPIB 3BH9A 4L4VD 4OCSH 3V4PL 2GAZA 5FKPB 5FECA 1KLFA 4AEFA 1BF8A 1HCVA 5T1MB 2P49B 1JGLH 1ZGLM 4HLZH 2WUCH 4JG1H 1LMKA 5GPRA 3UTZA 3CSPA 1QQDB 2NZ9C 1YNKH 1FFQA 3LS4L 4F3FA 1JCKA 4H26B 4S1SL 3UBXG 3BKML 2XKUA 2GIYA 5TFSL 4RGNC 3EYOB 5T1LD 5BOZG 5JLZB 4UAOC 3B9AA 3QWRA 2QTEA 3CFEA 3RY6A 1Q9OA 1RJLB 3OAUL 2VLJE 3QNZB 4WI7A 5DD6B 4OF5A 5J1AB 4KDVA 3QDJE 3DSFL 4K3DL 2Z92A 5ESVA 4RDQF 1ZA6B 4ZNEE 1OAYL 5GS0H 4KUZL 1EERB 2B4CH 3VGDA 2WUBL 3BDYL 4PG9A 5JIPA 2GT9B 4MWFA 5SWZA 3X13A 3C87A 2NX5D 4Y4FC 2UUDH 2BMKB 2WUBH 4HS8L 3IJSB 1HQRA 3QNYB 3KHOA 4NQDE 1INQB 2KUTA 4X5XA 4EZMA 5A16A 2DOCA 3EYSL 4Q58C 5T5FH 2YRLA 4XI5C 2JE8A 3SKMA 4X6FA 1JTPA 1QSFB 2HYMA 3EZ8A 2JKXA 4PJ9A 5F88B 5IF0B 3RU8L 3FFCB 4ALAL 4FMKA 3VRLE 1BWMA 4HPYH 3E2HC 1NCUA 1VHPA 5MI0C 4MCYA 4ZNEA 5AZEH 4I8DA 3P9LA 1FN4A 4MJIB 2DQJH 4N0UB 4X7DC 5K9OB 4KK5D 3MRBB 3UYOD 2E7BA 3EJYC 2GK0A 2XXCB 3MLTB 5B8CA 1ADQL 4HS6B 1HSAA 1T21A 4GXUN 5D70L 3R1GH 3NIFE 2ADGB 1ADQH 3FO0H 5GGSY 4DFIA 3VW3H 1FZKB 5C0FB 5KS9F 5E2WL 4ZYKB 3B3IB 3R8BB 4OQTL 4GG8A 4WO4D 3AM8A 1XGUB 4L4VB 1FYTE 1JPGA 4KKLD 1WZ1L 5I1LB 5E5MB 2HVJA 4MJ2A 1RMFH 5KG9B 5DEFB 1T22A 3LRSA 1C12B 4DN4H 3CFEB 4J3XA 4PJFF 1F4XH 4O58L 5TE7L 3RY5A 4CGTA 5CBEA 1EAPB 4BQ6A 5SWSA 1IKNA 4OZHF 1NJ9B 5EOCJ 4JM4H 1RUQH 1J5OH 1L7TH 2HVKB 1HHJA 1J0YA 5GSRB 1Q9OB 1RJLA 1UZ6E 3C6SA 1DLFL 1EK3A 1D5ZA 3QR2A 1QKZH 2YD5A 2Q8BH 5I75B 4QRQA 3AUVA 2FDBP 4OKVA 4KKCD 4XPGH 4I5BB 4TVPL 5DJDB 5BV7C 1LO5A 4L5FH 3JV0A 2AEWA 1FE8L 3TBVA 4CVZA 4UI2A 5D2LA 3WJLA 5HHPB 4HH8A 3TVMA 4X83A 1GRWA 4FQXB 3L6FA 4NSKB 4BUHA 2BRQA 5L2JA 1NBYA 2P48B 4YHOH 3WXVH 4DEPC 4IOIB 4YBLB 4RGNB 1HNGA 3LKRA 4GLRH 2R0WL 2XZAH 5IHZA 4ZUUB 4OSUH 2DQJL 4BQBA 1SEBB 1CF8H 1NFDE 5DMJB 2E7LA 5HGGS 3X3FL 4KY1L 1I8IA 3DVGB 5HYFA 4WI3A 3QXTA 2L0DA 1B9ZA 1IGYB 1TJHH 2YPKB 3JTTB 5I8CA 4XX1E 4I0PB 4U0RB 2EKSB 3NN8B 2XRAH 1NCNA 1AKJA 2R4SL 1DJSA 5FCSH 3U46A 1YQ2A 3ZE0F 1QEWB 1WBYA 1X5GA 3MJ9H 5JW5B 2APWA 4B0MM 4GKSB 1XZ0A 3TVMB 1W0WB 1QRNA 3SCMB 5EIIA 2Q6WB 4G6KH 3CXDL 1HHGA 1I1RA 1RZJC 4OZFB 3KPSE 1E27A 2X1OA 1U2HA 1T1YB 1XIWA 1OQXA 2D2OA 3AFLA 4G80B 3L3JA 5D7IA 1BIHA 2HRPL 1XGRB 3C09B 4LCIL 3KDMA 4Y5VA 4ZOBA 1NGQL 5C3LD 4HUXB 5TGBB 1QR1A 1N4XH 2MFNA 4QF1A 5EC1B 2NY5L 4DN4L 4IRJD 3A67L 4RGMC 4KGJA 5C07D 1OSPL 1HH9B 4DTGH 4C83A 5GGVL 2ITDA 1T2JA 2R1WB 3DRTA 2X4UA 1LO0H 1IQWL 1L9NA 1NDMB 3BP6A 4FFZL 2FJFA 1BECA 4K7FB 1JPGB 3AS3A 1YEDA 1WK0A 3K3QA 2YD8A 5C2BH 1G7QB 4V2BA 1IAIH 3WS6C 1G84A 5TE4H 1GL4B 5A2IH 4WEUD 1P4IH 1BD2A 5I8KL 4LLUB 4FG6C 4HF5L 2YMXH 1KLUB 2DIBA 2GY5A 4P59H 1Q72L 2XYCA 4UUJB 2WNGA 5IOPB 1EHXA 5CD3B 5JPNB 5I8KH 1KELL 5B38G 3INUL 3K1KC 3F6LA 4DAGH 2GTZA 2QADC 2FBOJ 1NSNL 1LDPL 2Q1EA 4YXLH 4OM1H 5E8NB 2O61B 3VFOB 2JK5B 1NCTA 3PWLA 4HWEH 5C2BL 4NZTH 5C0ND 1KUMA 3MFFA 2J8OA 4XP6L 2V2XB 5D1XD 1KTLA 2ZOLB 1WLHA 4TTGA 4FFWC 2DQIH 3VXSE 2EYRB 2IFGA 1JI2A 4GKNB 5F7NC 4WI8A 4Y5YA 4JN1H 2CKNA 4NP4L 2DWDA 5C0JB 1JE6A 4PJIE 3ULVE 2AJYL 4NP4H 2CSPA 4R90H 3GMNB 1DVFD 3WJLC 4YDIL 4ZAKD 1CXFA 5EC2B 4MA1C 3IJHA 4QHKJ 1P9MC 2VDPL 1FNEB 4I18C 5IT2L 1BHGA 2ARJB 2OTUA 3GRWL 4CW1A 3BAEL 4JQIH 3AY4C 4MXWH 3LB6C 5J1AA 5C07A 5KVDL 2VL5B 2YD1A 1HIML 1QFWI 1WWBX 5INDB 4X5WB 1UT9A 4WUUE 2DQTH 2FJGB 4MXWL 3KWWA 4YWGH 2ID5A 3IB4A 4UOW1 5JA9A 1ZLVK 3U4EB 1JNLL 1RJYB 1HDMA 3G5ZA 3MZGB 4GMSH 4P2OD 2IBZY 3V7AE 5GRXG 4GAJH 4J4PD 5FDYA 4PS4H 4MDJA 5BXFB 3MRKB 2OZ4L 1SEBA 5KVEL 4M93C 5CEYA 4ODWB 3WN5C 1RY7B 3VE0B 2APTA 1MI5B 2VN7A 3GMRB 4ZUTB 4JVWA 4JFZH 5A3IC 2VDNH 5KVFL 1ACYL 4ZTPL 4L3EA 1D5XA 2WQRA 4NQDB 1DSFL 3V5HB 4DUXA 1T0MA 1D6VH 2F58H 3WKNA 3PWPD 1ACYH 3QAZB 2ZSVA 1UC6A 4RBPK 1P7QB 5J6GA 3LKQB 4ELMF 3U0WL 1RJZA 4OV5A 5J3HD 5DTFA 1FFOB 3EFDH 1ES0B 4JG0H 4J3TA 1CFSB 3GIVB 3BQUD 4OGAD 2GITA 5CIPB 4ENEC 4DW2L 1YPZF 5IEHA 3ZT6A 4N1HB 3P0VL 4HJGB 4PS4L 4MXQC 3LHPL 4R4BB 3KPSD 3O2DL 1IVLA 1E28B 3MLYH 2MPAH 3VXQA 2MSPA 3VRLF 1RZ8A 3L1OH 4NKDA 5I1GH 1F45A 3SDXA 5L7XH 1KIUA 4HXAL 1OP9A 1H8SA 5FM8A 5CGMA 1U8QA 1RFDL 3O4OC 3MLYL 4DFHA 1JWSA 1NCCL 1UCBH 1NEZG 5KOVC 1NGZB 3MROA 3SO3B 1TJIH 5JHDD 1UXSB 3G6AA 1G9ML 4QHMB 3OZ9L 5ECJE 1LEKA 4PRIB 1J05B 1C1EL 3FTGB 4TOYL 1B3JA 1ZWIB 3S96B 3VWKD 4L9LA 3VE0A 2DYPA 5DD1H 3O0RH 1RU9L 4X7FC 2LFGA 5IEHB 1T03H 3LKOA 4LPUA 1J1PH 4FQ1L 2VQ1A 3JBG7 4ODXA 2JLLA 5JZ7D 3NOIA 3SBWC 5BVJB 3PGDA 4LVOC 3CK0L 2Z31C 3IDMB 4MJIA 5ESAB 3RNQB 4EXKA 4JO2L 5AZ2H 3RNKA 4NO0A 4KHTH 3OAZK 4HT1H 4ZFOB 3P30L 1EVTC 2EC8A 4ONFH 2V7HB 5F1OB 4QYOA 1ES0A 4DN3H 1I8IB 3JWDH 1SEQL 2ZJSH 4IIQB 5JOPD 1CIUA 3OKKA 3I6KA 4JY5L 4KI5F 3F58H 3GI8L 1TCRA 4J7RA 3NTCH 3O8XC 5CZKA 3HI6L 1CDYA 4ELME 3BJ91 4XZUB 3SO5A 4HMDA 5JUEL 5DMKB 4B41A 3QJHB 4YK4C 1LK3H 1WBXA 2GAZB 1ZK9A 3JWOH 5LG1A 3DROB 3HE7B 4Z0BL 3OV6A 3R0NA 1DN0A 4M93B 4LLQB 1LK3L 3NH7H 5IIEA 5C92A 4JY6A 3L9RB 5I1KH 1U95B 1DFBH 3VXUB 5GIRA 4M48H 5BW7C 1MRDH 1PLGH 2AEPH 4NWUH 1R3KB 2UWEF 4HWZB 4MMZC 1RK0B 4GG6B 3D39E 4OCYH 4L3CB 4KDWA 4QOKA 3OJDA 5SWSD 3NTCL 4X7EC 4NNYB 1TTUA 4NO0D 1FL6B 1IAKB 3HG1D 3QQNA 4RSVA 4CN4A 1I9IH 1IL1B 3CAFA 3TWCH 1CL7I 1X4XA 4LSVL 4Y19B 5EB9A 1A1MA 3PGFL 3S4SA 2AK1H 1U6AH 3FT2B 4JPIA 2X1XR 5ID1B 2YC1B 1RMFL 1KLUA 1QG3A 3PHQB 1FVEA 1CWVA 1ROWA 2F5AH 3MMEA 4M8QA 4WHTB 4LDOB 4NWUL 4W68A 5FV2A 3RDTC 1JGDB 5JMOC 5HHMD 3NH7L 4FFYH 5D7JD 4NO3B 1QSZA 3B2UD 4KRPC 5D1QC 1QRNE 2WBJD 3UJJL 4W70A 3KLSA 1BLNA 3MRJA 1LD9B 4U7SA 5DJZB 2ESVE 4R9HA 3ZHDA 1BQLL 5DUBA 1UJ3A 4HULB 4R4FH 1LWRA 4PLOB 5TGBA 3H6JA 4YH6A 5JUEH 3KDMB 5EO9A 1EGJH 4M5YL 1UA6H 5E6IA 2J7LA 1E28A 4EI5C 2AXJA 5L2KB 1UJTA 4XXCC 3B6SB 1O7SA 3OQ3B 3Q6GH 4HPYL 5FYJU 2MKLC 4YFLI 1AO7A 1JZ3A 1KOAA 1NC4A 3WHXA 3HC0A 4PRHE 4H20H 4U6XA 4MDIB 5DWUL 4TVPE 2O5YL 5E2UH 3BSZL 3UO1L 4Y19D 3QJHA 3SEPA 3SKOB 4FFYL 2ESVB 4X7SH 5K9QG 3GHEL 3ARFB 4U1SA 4HMEA 4L1DA 2HLFC 2BNQB 1W8NA 4LOUC 3W5MA 5HDBE 2X4OB 3IFLL 4ZXBA 1OAYH 3RQ3A 3WS6A 3PQYB 3QIBA 2HG5B 3BZ4B 5KTEL 3VG0L 5CJXC 1KJ2A 3BZDA 3VJ6B 4YHML 4ZFZA 5I30H 3NIFF 3KWWB 2I27N 1TETL 3HLAB 3QISA 3RZCD 1F6LL 4NNYA 3UJTL 4ETQA 3CH8A 4FXKB 5GHWH 3NCCB 1HI6A 6FABL 2XWBB 3EBAA 4DKDC 3MXVH 4MA8H 1MCLA 3MRMA 4BZYA 1T6VN 3DRQB 3GKZA 1ZHLA 2PYFA 4S0SD 3IF1A 2J8UE 4PJ9B 5IF0A 4JFYB 2Q8AL 5ISZD 3EO9H 3HI5L 1BJ1H 5C2UB 3MRHB 4KK9D 1NGPL 4LF3A 2Z8VC 4PJIA 4UQ2B 1URLA 5EUKA 2Q8AH 4FQJL 4PJDE 4NBZB 2BVEA 4TVPH 2JJTA 2KQMA 4N0RA 2VXQL 3Q2CA 4XCYA 1ORQB 3ZMRA 1NBYB 4M5ZL 2PNDA 1AHWC 3L5IA 3UROR 4F7PA 5DDHA 1UB5A 1A7QL 2BNRD 2AXHA 4WUKH 4D9RE 1X4YA 2BHUA 2I60L 4YGVB 4M6NL 2WWMD 3PQYD 5KJRL 3MGTA 4U6HB 3MRMB 4OKVB 4CU7A 4ZPTA 3MJ7A 1F4XL 4O58H 1LE5B 1NH6A 5IT2H 4OM0H 4R3SA 4NKDB 3B2UC 5HI5C 5E70A 4G9DB 1WZ1H 1OCWH 1JGUL 5JO5B 2YRPA 5HHXL 3GSWA 3FCTA 2HH0H 3VXOA 4MLSA 4HPOL 4P0DA 1HILA 3LSOB 4DZ8B 4PJIF 3SDYH 1C12A 3BZFA 3TPKA 4JFPB 3IDNB 5JDSB 1KIPB 5GRWA 5IB4B 5IK3B 2D31B 4BK4A 2XRAL 3QFJD 4GMSL 3IJYB 3M8OH 2CKBL 4OZGE 4X6BA 1YN7B 3M17B 1KN4L 5DJAA 4N0YH 4H0GA 1PSKH 4L3ED 5GRJH 1MAKA 1C08B 3LKSB 3CVHA 4OZHE 1CF8L 1CXLA 3QIBB 4F15B 1IQDA 3VXMD 1SBBA 1HXYA 4NC1E 4NRZA 4LP4A 2VLRA 2DLFL 1FP5A 1NUGA 3MUGB 4EVNA 1NCWL 3D85B 2ZUUA 1WGOA 3C5JB 5DJ0A 4WCYL 3WIFA 3RWGB 3DARA 3HA0A 3WV0A 2B1AH 3QUZC 4WWKA 4OZGA 4LSRH 3VWJC 5F6IB 4PGBB 1OM3L 1HH9A 1YYMH 4PLJD 2A9MH 2H8PB 4U1LA 1TQBB 1ZAGA 2VDMH 4JG0L 4OZHA 5D7IF 3ULUH 15C8L 1JZ7A 1MIEL 1HILB 3SE3A 1Z2KA 4ISVB 4HKXA 1FFRA 5E6ZA 3FO9B 1CD8A 4YDVB 5CMAB 5DQDH 1XH3A 3VFSA 3W82A 2W07A 4I13B 3U0PA 4BZ2H 1MIEH 1AXIB 3RVXD 4XP6H 4ZDHB 3VI4E 1MFEH 1NGYB 3J8F7 2ZPKH 5IG7A 3LN4B 3O6LH 4CMMB 3P77B 1SVCP 1RZ7L 3GNML 3Q48A 2YBRB 4RQQA 5DJ8A 4OUOA 1CBVL 2X44D 2AJZB 2B1AL 4M7JL 1IQDB 4MDJB 3O3AB 2CUHA 1J8KA 2OBGA 4JVPA 3EW3B 1U8JB 1G7IA 4RGOL 4AMKL 5DK0B 1QNZH 4Z7QF 4KZDL 4CDGC 3IRZA 3LHPH 1KV3A 1FSKB 1G6RH 1O0VA 3SCMD 4G3YL 4MNHA 5HGDB 4JFDA 3WN5B 3GNMH 4GKSA 5T33L 2X4PB 4XPFL 4PGBA 1V8HA 4PJFE 4TSCL 2OK0L 3P4MB 1L9MA 1JUFB 1L7IH 2HJFA 3QZWG 3WIIL 3QXWA 1A14H 2XN9B 1M71A 4D0CB 4H1LG 4H26A 2AEQH 2CRIA 2R23A 4PP2B 5GSRA 3TJHC 2NY1C 3UCRA 2B4CC 2Z91A 1OPGH 4QRPB 2W0FB 4XPBL 4TULH 1VPOL 2AJSH 3S34H 2B8OT 1AJ7H 1ZEAH 2YUXA 2OM5A 4OZ4A 3LDBB 5KW9L 1NL0L 3S34L 2FJFB 1TTFA 1W0VB 5F7FA 4A2MA 2OXGA 3ECBA 1XF2A 2ZCLH 1UXWB 4AT6B 3PJSB 4KK8D 2H2SC 3NCJL 4XXCA 3GMOA 4XAWH 4RGNE 1MF2H 4U1JB 2DQUH 4MDIA 4M6MH 3GIZL 4BKLA 3H42L 1P84K 4L4JA 4EI6A 2X4TB 1G6VK 4QOKE 4G8IB 5IB3B 4NGHH 4CUCA 2MWCA 4YHLH 1MFNA 4NM8L 3D1MC 1EZVY 1U36A 4K8RH 1H3TA 1K3ZA 3MRQA 5F1IA 1NCCH 1IM3B 3VGHA 4Q74A 5AEAA 3FZUD 3PV7A 1PAMA 3MACH 3SDXE 4Q97A 4MA7H 1FNGA 4AMKH 5FYKD 4UDTB 3FB8B 1KTDA 4K9EH 2YXFA 4LLWA 4P2YA 3GM8A 4X4XB 3TN0B 5B4MD 2HFTA 1N6QH 3IXAA 2WBJA 5IP4A 1FC1A 1S7RA 5IB5B 1MCKA 4NM8H 3DMMC 4KJWD 5DO2D 2VLJA 4MAYC 1DBKL 3JV5A 4W81A 2VDKH 4Y1AB 2EDRA 3QZWA 5EFIA 2FECL 4UT6H 2EDLA 1IRAY 4HHAB 4LCYB 1A7NL 1WT5C 3PP4H 3ZYJA 4U05A 3VXME 4B50A 4XX1G 5AYQA 2X4PA 3TZVA 4PY7A 5CJQL 5TDNA 2F58L 3ZYZA 5BZWA 3P11H 5F9DC 4K8RC 4I48B