1UZ8B

Anti-lewis x fab fragment in complex with lewis x
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
212
structure length
212
Chain Sequence
b'EVKLLESGGGLVQPGGSQKLSCAASGFDFSGYWMSWVRQAPGKGLEWIGEINPDSSTINYTPSLKDKFIISRDNAKNTLYLQMSKVRSEDTALYYCARETGTRFDYWGQGTTLTVSSATTTAPSVYPLVPGGSSVTLGCLVKGYFPEPVTVKWNYGALSSGVRTVSSVLQSGFYSLSSLVTVPSSTWPSQTVICNVAHPASKTELIKRIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG FAB (IGG3, KAPPA) LIGHT CHAIN 291-2G3-A
publication title Structure of an Anti-Lewis X Fab Fragment in Complex with its Lewis X Antigen
pubmed doi rcsb
molecule tags Immune system
total genus 42
structure length 212
sequence length 212
chains with identical sequence H
ec nomenclature
pdb deposition date 2004-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uz8B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uz8B01
2DYPB 2A0LD 4PG2C 1CDJA 5E70A 1F4WH 5A16A 4PTUB 4GBXD 1S3KH 1I1AA 1OB1B 2DWEA 3BO8A 4JR9H 2GITB 5JTWA 2Q3AA 4LSRL 5GRXG 3KJ4B 4HH9A 2AJ3A 4NFDA 2Z31A 3B9EA 3OZ9H 1DBJH 4R4NC 4N8VA 5IBUG 3BWAA 2A73A 5D1QC 4KZDL 1KCSH 3L3GB 4JFDB 1HXYB 1J8HB 5T3XL 5B39G 1SVZA 4G8IB 5FO9A 4JM2D 4PGEA 1J05A 2L7JA 3FFCD 1N0XH 4O4YH 2A6IA 5JOFA 4OCSH 2CGRL 5DD5H 4MX7A 2PCPA 1IAOB 4QXTB 5C8JB 3V4UL 2BY1A 3IDIA 1FZMA 2PXYB 5LCVH 2X4PA 4R4ND 4MJIA 4OKVB 3IDJB 5D1QD 4QOKB 3W0WE 4KUCF 1CXEA 5EWIL 1OSPH 5EUKB 3NPSC 3FAWA 2XNAA 2GSGB 4LQFL 2XA8L 1MAKA 1MFEL 3V6OE 2MHAA 3GDBA 2EDLA 1OF2B 3ZDXF 1RUPL 4PY7A 3O4LB 3BZEB 3TPUB 2YPKA 1ERNA 1KELH 5T3ZL 3P4MA 1NLBL 1UWEH 2UVEA 5TQ2H 3IDMA 3WE6B 2I24N 3KPQB 4JPVL 4L4JA 4OGXL 5BRZB 5L88L 5KSAA 5HDLA 4JO3L 3RQ3A 3T77A 4S1SH 1AO7B 2Q8AL 4Y1AA 4PP1C 2BNRA 2LTQC 2P1YA 2VWEC 4JY4A 4EZMA 2Y7QB 1LDPH 4PLNC 3TNNA 2Z0BA 4H26B 4XAKE 4Z7QF 3BT2L 1T03L 3REWA 1ULVA 2R0WL 1LHZA 1X5XA 2EO9A 5GRJH 5FUZH 3SJVE 1IGCL 3FQWA 1LEKA 4ONGL 4LLVB 2W9DH 3GMOB 1EFXA 4PP1D 2Q87A 2D4FA 3ULVF 4O2CA 3FB5B 4LAJH 3P4OB 4FQHA 3DSFL 4GKSA 4XNQA 32C2A 2YEZB 2V7HA 3VRJA 1P4LB 2QR0A 1YQVL 4PJCE 2DN7A 1MFCL 1MHEB 3UTSB 4P3CL 1FFNB 5E2TL 4U1NA 3KHQA 2EC9U 4R90L 4HXBL 4N9GB 2ZUTA 3CDYA 5KSUB 5IEHA 1GH7A 1QBLH 4LF3B 2DKSA 4PJ7A 3LEVH 2KZWA 2EKSA 4KJQC 3V4VH 1HYSC 4G7YL 1JI2A 3P4LA 1J1XH 1RZIA 1F8TH 1H0DA 5CP3H 3QIUA 2V17H 4OF6A 3QR2A 3P4NB 4UINH 4Z7UF 4NT6A 5IIEB 2LV4A 4XPAH 3RNQB 3SDXE 3HAEH 4G42A 3S88L 3OPZH 3TBTB 2X4TB 3UTZB 4E5XA 4XBGB 5KSBE 3SEPA 2XTLA 1CFTB 1YDPB 1NFDF 5IF0B 4NQDB 4GKNA 4TRPL 1HNFA 3MLXH 4P59L 1EMTL 3HE7B 1TVHA 4X7CC 3EJYC 2Y4SA 3QWOA 2J12B 4KJQD 1A14L 1D5IL 1GOHA 3U7WH 3EO1A 4XP4H 3O3DB 3QQ9C 4M48H 4JFFA 3M8OH 4XMPL 4ZS6C 1CU4H 1BIIB 4UQ2A 1JK8A 3UJTL 3BZFB 4K7FA 2RCSL 3RNKA 2FBJL 1WZ1H 1X5LA 5E2VL 2H45A 4N90E 3LMJL 3PNWA 3MRDA 4HIXL 3QXDB 3RA7H 2WQ8A 4LNVA 1A6VH 4QRUB 2E27L 2ITCB 3PWUB 2G5BB 1Q1JH 2DLEA 1BJ1J 4YDJA 3EJYD 1HIML 4NQCB 1IAII 9CGTA 5L0QC 1WZKA 3QUXB 1AGEA 1A0QH 3QQ9D 4AG4L 4NRXA 4ZS6D 3HLAB 4HUUA 1Q9LB 3OAYH 4P2QE 1I7ZB 1DQDL 4RFNC 5J9PA 5JW3L 3JWDH 5AZEH 4R3SA 4Z8FH 2GJ6E 4IMLA 3TO2A 2CDEB 4WFHD 4YFLF 1D5BA 4Y88A 3QG6B 2X41A 1DVFB 5SV3A 4QHUA 1KN2H 3WUWG 5I6XC 2DBLH 1FGVL 1MFBH 3QEQB 4Y16B 5HYQA 2WW8A 2APXA 1XF5B 2N7BA 4WEUD 4PV9B 1KJMB 4FG6C 5FV2A 3THML 1KYOK 4XNZB 4XB8A 3C6LA 3QEGH 5DHYA 2HTKC 2F8XC 4F8TA 4O9HH 3FB8A 4DN3H 3CUPA 5A3IC 3NH7L 1O5DT 4YDIL 1T1ZA 3E8UH 4TSBH 1WWAX 2H9GA 3ARDA 3GKZA 1OAQH 1DLHA 2QSQA 5JORB 4QTHB 3WJLC 4H1LA 4FG6D 1S7UA 1BGXH 3L3IA 1CXLA 4LLWA 2EYSB 3CLEH 1J11A 4GW4B 1XGUA 2D31A 1IGIL 1LO2L 5CP7A 4DAGL 2F54B 1ZT1B 2HTKD 1BJ1H 3JXAA 2ZG1A 5DZNA 3QHZL 3FONB 1BOGB 4LLDA 2KBGA 1OAUH 2RFXA 3N1MC 4RMQA 1DLFL 3V8OA 1B0GB 5EU6E 1XF2A 3W5MA 3IXTA 4L3ED 4U1HA 2ESVB 4OCXH 4GQ9H 3MA7B 4UB0H 5D1ZB 3HI6L 3RKDC 3GK8H 1DBAL 5D70H 1CL7H 4JDTL 2F53A 5DMJB 5EZIL 2YRPA 2R2CA 4D0DB 4E42B 3ULSA 3EOTH 3OX8B 5C0AB 4QNPE 5JXAH 3UROR 4JHWH 3BHBB 2WIIA 3UX9B 5J0BA 3GEWB 2HKFL 4PTTB 1U8NB 5JHDB 2GJZA 4XX1E 5DT1L 4M7LT 1TCRB 2BSRA 2A6KB 4LSQH 1MHCB 4HDIB 1P2CB 1OTUC 5DYOB 1WBYA 1NUNB 1T5XA 2R4SL 4FN0A 3RKDD 1A7RL 3SKJH 5C0FB 5F6HI 4JZOA 4QRPD 1CDBA 5C07B 4GKOA 5JXEC 1QVOB 1EBPA 5IM7B 4TNWK 5MHSE 4ODSH 4PB9H 1HKLH 5DR5L 4M1GL 1KB5A 3BN3B 5IR1A 2RB8A 4XBEL 1HI6A 3S8WA 4NNYB 4RAVA 5DVMA 3D48R 4MNQD 5DURB 1KT2B 5F9WB 2R29L 3KYKL 4JAMA 5KN5A 1RPQA 1FFPA 2IH1B 3VG0H 2ORBH 3FO2A 4F7CB 1OTUD 4P9HL 4L3CA 4M1DH 4I0CC 3RL1A 3LD8C 4ZO6A 1DUZA 3AVEA 3HFML 3U30C 5JXED 1HOCB 4NUJA 4PJFE 3LQAC 4PUBL 5LXGH 1P5VA 4PRIB 2DQIL 2QADB 1JPFB 4S1RL 1OAKH 2C3WA 5MP6H 1KXVC 4FP8L 4WFGD 2JIXD 1CDUA 5IFHL 4HEPG 4R6UA 3IFLL 3L1OL 5CWSA 3S5LB 1SJHB 3ESVF 3Q5YA 4UILL 4BUHA 2J8HA 2VL5B 5ENWB 4YX2H 5I1LA 5T5FH 1BLNB 1FPTL 2VE6A 4XH2A 1DBKH 3BJLA 1BEYL 4ODUB 2AEWA 4ZO7A 3QA3B 1M71A 2V7NA 4AIZA 4JFDE 3KGRA 1MCEA 1LO0H 3BP4B 3LV3A 3HI1A 1QSFE 3P9MA 4ISVB 3V7AE 3V6ZA 1DZBA 2AEIT 4OZ4A 3F7YA 4OD1L 1U41A 1CZ8H 4MMZC 1QG3A 5TE6L 1QPXA 5E6IC 4KDVA 1W8OA 2AJUL 3G5ZB 2GTWA 1QRNA 1QO3A 4WI6A 2BC4B 5ID1B 4NO3B 5B22A 3C08L 3QCUL 5CIPA 4WI5A 1BVLB 1S7TB 1WBZB 4BH7B 2X89A 4ZAKB 1OCWL 2F5BH 1U9KA 1ZSDA 4NP4H 3S36X 3MRJB 3CH8A 3PWPA 4FQLH 1F02I 4GFTB 4WDIA 3GJFH 4JANA 1IM3B 3SE4A 1I1CA 1ODAA 5K59E 2CIKA 2X44D 4KU1A 2AQ1A 2VQTA 3O4LE 1KB5L 3MRKA 2R56L 5E6ID 1UEMA 2QBWA 4N8VG 1E6OL 4OLWH 3F5WA 3P77B 1E4WL 1QNZL 4WNQA 2ZCLL 4DOHE 1EXUB 5EU4A 5HGDB 3EOBA 3VFSB 3GSUA 2BK8A 2QQQA 4HC1A 2VL4A 1EZVY 2F74B 1JN6B 1QEWA 4NC0B 5FYJH 3BZEA 3M1BA 1GPOL 2ZPKH 4S1DC 1PZ5A 1U8HB 2NY3B 2OLDA 4XMKH 3SDCC 3WS3A 1C12A 5HHMB 5ANMB 5JMRA 2NMSA 1UQSA 3D25A 4YDVB 4PYGA 4GAJL 1VDGA 1MHPL 2G9HB 4JFZL 2Y5TA 5EBLA 4JEGB 4TSAL 5JIKA 3SY0B 5D7SL 3KPLA 4N0UB 5I1EL 1K8IA 3TA3B 1AHWB 4NZUH 3F62A 4AH2B 4X6CF 1R6VA 1QLEH 4KDWA 1VFOA 5KJRL 4TULH 2Q1EA 2UWEB 4S1DD 1QFOA 4X0KA 4MQXC 3HZKA 4OTXL 5C0IA 3EO0B 3TIDA 3SDCD 4ZOCA 5T5NF 2C7UB 2YZ8A 1MJJA 3AU1B 4IHOA 1T21A 2FGWL 4PJIE 3MGOA 3MRBB 5AUMA 1W2KT 2ICWJ 3NFNA 3GHBL 5E6ZA 1NGZB 1S5HA 2FJFA 1YY8B 1RIVH 2JE8A 1AD9A 5EZJA 3MBEB 1L7IH 4MNGE 4UIMA 4MQXD 1MOEA 1IZKA 1WCBA 3LQZB 2EYTB 4HK0B 4KJYB 1TVDA 2B4CL 3D9AH 3DYMA 4UNUA 3WN5A 1Q8MA 5DC0A 2X7LA 1FORH 5EC2A 2VLJE 5ITBL 2EE3A 3SDDA 3W0WA 1C7SA 1B0RA 4Z0XA 1ZLWH 3QDGB 4LPCA 3SGDH 4WGWB 5SWQB 1NBYA 3FT4A 2DM2A 2XZQH 3B2VH 3JWNC 4DKAA 4HC1L 1I8LA 5DK0B 3T4AB 1ED3B 1ZHBA 4OLVL 4L4TA 4Y5VC 4KHXH 2MMXA 4Y4HB 4JO2H 1R5VB 3AMKA 4NZTL 1JZ8A 1VFBB 4P46B 2FH8A 5IVOA 3STZA 3V4PH 4GSDH 3QFJD 3O8XC 5KZCD 2XKSA 4HUWA 4JHZA 4P3DB 3PIQB 1Q94B 4LRIA 5CD3B 4I9WD 2R0KL 1FVCA 3NACL 4UAOC 1NAMA 3PABB 4PGCA 5SWSB 1XR9B 3HUJB 4KWUA 5D7LB 2AV1B 1U8LA 4OF0A 5I1IL 1EGJH 4PRAB 3WXVH 3ZDXE 4BK5A 2XTJB 5CZVH 1QYGL 3WLBB 2HMIC 4WHTB 4JZNB 2G60H 4OZIB 2FECL 3BPNC 5BV7C 4CADB 1QQDB 4HMEA 1H9VA 1RUAH 1K5NA 1CFQA 8FABB 3VGAC 3VFVB 3L3KB 5C0CD 4RGNB 4U33A 4TVPD 4WWKA 4BK4A 2YUXA 1RK0A 4MA7H 3OJDB 4GO6B 3KWWB 1UM5H 4YXLH 5ID0A 2NXYC 4XCEB 2BERA 3U6RB 3WFCH 1A7OH 2FJGB 1N6QL 4F58H 5M95B 2VXUH 4H5SB 1JV5B 1U93A 2H3NB 3H0TB 3RWIA 2HMID 4FFWC 1OAYH 2I60L 5ADOH 3L3HA 4MQTB 5CBEB 4Q9BA 4Z7VB 3ARBA 4LARH 4HWEL 2XT1B 1TZGH 2X4QB 3OHXB 1I9RL 4IOIA 5DJYA 1I7RA 2NXYD 3CFIC 5D2LF 1U92B 1A3QA 1KC5H 1NUGA 1N4XH 1KSRA 5D5MA 2JJTC 1F00I 2XN9A 1OW0A 2VDMH 2YUZA 4FFWD 4MD5B 3T8XA 3UDWC 5E8DL 1KGCD 4X4XA 3ZT6A 1NAKH 2IGFH 3CNKA 5CJ5A 1DUYA 2Z8VC 3IXAB 1JFQL 5KG9A 3LN5B 4YAQA 4U1SB 4NZJA 5EUOA 3PHOB 5SWZA 4CVZA 1P1ZB 1SY6H 2BVOB 4B50A 1WIPA 2M2DA 5CZXC 1MRFL 5IOPA 2CLZA 5I1AB 5FF6A 3C60C 3QO1A 3MQIA 1IAKB 1ROWA 1L7TH 5KSVA 4LMQI 2C1PA 1YMHB 4XPFL 1OOAA 5L9DH 2NY5C 5F7MC 2H26A 1KJVB 4HJJH 1LO5B 1NAML 5GIRA 1CLYH 2DQCL 3UJJL 5C08A 4HKZA 3C5SB 1EZVX 4MAYA 2R4RH 3D3VA 3PGDA 2PYEA 5GGUB 4OZFA 3RIFF 5D1XC 4N9OB 3PWLB 1O0VA 5DMYA 3SO5A 1WBXA 4Q2ZB 4CDHA 3DMMA 2W9LA 4H20H 3KXFA 2H41A 1ZHKA 4NHUB 5CZXD 2GJ6A 2FL5B 3C60D 5EH1A 1PG7W 4PRPD 4PJ8B 2CUIA 1N6UA 2VXTH 5D6CB 3L6FB 2E9WA 1LE9B 3SCMB 4PJ5B 4XCNA 1JYXA 1Z9SA 3S36L 4D3CH 4E41A 5DEGA 2AXGA 5EZOH 4W68A 2KUTA 1NGXA 5FK9A 2JELL 5EC1B 2X9XA 1YMME 2FRGP 5D1XD 5C0NC 1OP9A 3RFZC 2HLAB 3BDBA 5IB1A 2XRAH 3VXMB 3N06B 2C3VB 4P5KA 2HA1A 1LEGB 2K9UA 4J3TA 1QLRA 2D7OA 1KTKE 3CLFH 3TN0B 1CIDA 1M7DA 1N5AA 5GRZA 5CUSH 1N2RB 4JREC 2VLKE 3CZFA 1MIML 5JMOC 2Y06H 2YHGA 5E2UL 4IDJL 3MLTA 1WT5C 2AK4B 3RHWF 5C0ND 5C0BB 1MNUL 3MXWH 1NQBA 4DVBA 3OKOA 3DO7A 2KQNA 4I13B 3MLZL 4MA1C 1JGDA 1MF2L 1MSPA 3OAYK 5H37H 3I9GL 2CUMA 3D0VB 4JPWH 3AXLB 4I4WA 3CPLA 1I4FB 3MLPA 5E2WL 4P4KB 3R8BB 4JQXC 5E8EA 1NGPH 4GG6B 3I50H 1J5OL 4BFIA 1S7XA 4EIZC 3TV3L 3QEHA 2VDQH 4EUPA 5IEKA 1FYTA 4U1JB 4P48A 1YZZA 3O6LH 3QUZC 1LGVA 1MAMH 4UIKH 3VXNA 1RZ8A 5E08H 4C54A 4MJ6A 3BGMA 1MFNA 4OCWL 3EFFB 4JJ5A 5HYJA 2W9EH 2FNBA 5IBTH 2WSKA 1HDMB 3WDJA 4QHLB 1EAPB 5CEZL 5FYKD 4ZOBA 4ERSH 3SKMB 5GS3A 2IPKB 2V6HA 3DX7A 3ZSSA 1MI5A 2HFEA 4XPHH 3BPOC 1KTDA 5C2BL 4LCYA 2ED7A 3QUZD 3MUZ1 1QA9B 3EYOB 5TQ0L 3V95A 2J2ZA 3LS5L 3PQYA 2ZJSH 4G8FA 4YJZL 4L29B 1T04A 1X5KA 1VKXA 3S96B 3LPGA 2FR4A 4F9LC 2PR4L 1LK2A 2MKLC 3BPCB 4U4BA 5ESVA 3WL9B 4L8CA 1SM3H 4O2FB 1Y6KR 1MREL 1PSKL 1NC2B 4HUNB 4MCYA 4FQCH 1U2HA 2OR8A 4M6OH 4HFWB 3GHEL 3DV4B 5CJ8A 5I8CA 1NCWL 2JJVA 1DBML 1MCPH 1UFUA 4YHOL 3GGWA 4UU9A 3ECBA 4W4OA 2IAMA 5T3XD 4LK4A 1KG0A 5E5UB 2KH2B 4RWYH 4ETQB 4ELMB 4NN6B 1FIGL 3WNKA 3P9LB 3UZEA 1BJMA 3NZ8B 4MD0A 4GBXB 2XZAH 5I1CL 1PEZA 4JM4L 2VC2H 3OKKA 2Z4QB 4LEXH 3I6GB 3GMMA 1I3VA 1XR8A 3OV6A 1VFUA 4O00A 3VDCA 4L8BB 3Q5TA 3O6KH 3VA2C 3HB3C 5IB2A 1SJEB 2OR9H 5J11C 2JK5A 5GGRY 1LO4H 1WIOA 2GKIA 1SHMA 3HZYA 4JM2B 1KEMH 3N1PC 3FFCB 2DIJA 4H88H 4R26H 2DQGH 4FXGA 3VFUB 3VFOA 4C4KT 5DRZB 5T3ZD 3RVTC 1T22A 5DC9B 1E4XI 5D7KD 5F1SA 1HHIB 5D1QB 2P5WD 3EYQC 4XP9L 4KROC 3FQTB 1ORSB 2X4NB 4LFHG 2EIZA 2XV6B 4S1QL 4LIQL 3KLSA 3QDGE 3HKFA 3F7RA 1AXTH 3QT2A 5LQBH 4JFHE 3GI9L 3O2WL 3TBVB 4PB0L 3PGCA 3RVTD 5SX4I 1WZMA 4RA3A 5FM8A 1YJDL 4ZFZB 4OFIA 1MRCL 1BZ9A 1GZPA 2YC1A 3EYQD 4KROD 4OM0H 4BQ6A 2FX7L 3NPSB 1JGEB 2HN7B 1JZ7A 1OSZB 1T1XA 2JCCA 4G8EA 2VISB 3SDYH 1ZA6B 1IGMH 1NL0H 3GIZL 3CD4A 4HT1L 1C5DB 4IIQB 2ATPB 1BOYA 2NW2A 5A2KH 2X6MA 4GRMA 3CFCL 1PY4A 3QO0A 1PG7H 5EORL 3QH3B 5SWSE 3U4BL 5K33A 1DQTA 3BYTA 4HPOL 4Y4KA 1G7IB 1C1EH 1FNEA 2UZIH 2NLJB 5HGHB 1UM4H 4X7SL 1OARH 5INDA 1MQKL 3EHBC 5KSAC 2ZOKB 3CFEA 3KPOB 4YR6A 4MJID 2Q86B 1ND0B 4ZUSA 2VXSL 4RGNE 1IQDA 4Q6IA 4HPYL 1X4ZA 4KXZI 2XXMB 2FGZA 1F3DJ 3D39E 3VFNB 4U6XB 1BX2A 1GAFH 1PJ9A 4M7ZB 5AAMA 1BM3H 3BW9A 1NCDL 3GJFK 1KTLA 3MV11 4FRWA 3X12A 3T0DA 3T3ME 3FT3A 3B5GA 1KACB 2IJ0C 3EHBD 3I6LE 4S10A 3VD7A 2AJYH 3LQAH 5KSAD 4Y5XA 4Y1AD 2WQRA 3QUMH 3VFWA 2R2HB 3KYNA 5DRNA 1JGVL 2BNRD 2WLZA 1MVUB 3WIFB 1N7ML 1ZA3A 2HRPL 2CH8A 2VSDA 3CVHB 2I07B 4X6CE 3EOAA 1WWWX 1X5HA 3DXAB 4MSWA 4P4RA 3SPVA 4L8DB 5IVXB 2DD8H 1V7NH 3RZWA 2Z35A 4ZO8A 4EOWL 5EOQL 1KFAH 2XG5A 3QQNA 5B3JF 3ZL4H 2BDNL 3BE1L 1EFXD 2C3XA 3INUL 5EFIA 1WFTA 4G9FE 3QIUC 3QFDB 2JLLA 4M9PA 1F3JB 4HGMA 4NRYB 4TUJB 1D6VH 2B2XL 5EO9B 1YNTA 1Z5LB 4GAGH 4DKEL 4DJMA 1SYSB 4W81A 1EEYA 3BRFA 2R0LH 1MLBB 3ARGC 2V5RA 1CLZH 2W91A 3MODL 1Q9KB 3STBA 5DXWA 4M5ZL 1SEQL 3L7EB 1F3DH 1OVZA 5J3HC 5FHAH 3H9SD 1RUKH 4I18C 5ALCL 3QIUD 3LRSA 43C9A 1VADA 4F7MB 3K0WA 1CFSA 5FYJE 1GGCH 1DFBL 2EYRA 2HWZH 4TQEL 5B3NA 3FRPA 3LSOB 5ITFB 3KPRE 5GRWA 3QIBA 5IMKB 5CHNA 5T1MA 5J6HB 2VDOH 2XFXA 3ARGD 3SE3A 1KCRH 3WIHH 2XXCB 1KPRA 3G9AB 4KFZC 4ZUWB 4BZ1L 5D2NA 5DHVA 1P84J 3TBYB 4LASL 1ZS8B 5DZLA 2UY7A 5J3HD 1HXMB 3KNBB 1J1OL 1K4DB 3GBLA 2JKXA 3BAEL 2PW2A 3FJTA 5HGBB 4JFFD 1FBIH 4NIKB 2CRZA 3CZJA 1ZLWK 5I6XB 2E3VA 3L7FA 5DS8B 1IGJB 4KZEL 3X3FL 3R8QA 1ZEAL 1MCIA 3GO1H 1AE6L 1IGYB 2WUCH 1N8ZA 4FQ2H 1KIRA 2EIBA 4OZFG 4XXCA 1XMWA 3FB6A 4YGAB 5ETUA 4K23L 1L9NA 1MCOH 5CJOH 5KOVC 4M03A 2I5YL 1U8QB 5JO5A 2QKIB 5C0RH 4NRZB 4XNUH 4YIQA 1A1MA 3VFPA 5IJKC 4OB5H 3GSQB 1OQOA 2HH0H 2VH5H 3C6LC 1L6ZA 1U8KB 1AI1L 1WFOA 4P9HC 3DWTA 3G6AA 4CU7A 4L3EB 4ODWA 3AS3A 1P4BL 3IFOA 1ZTXH 2P24B 4TUOA 1DQLH 4JGJA 3QCTL 5IHZB 3AS0A 2DQUH 5I8KH 4UDUB 3MRGB 1RV6X 5DFTA 3ARDC 3N1FC 4JFPA 4ZFGL 1A4KA 3GNML 2O5ZH 1IM9A 5LKNA 5BS0B 1FGNH 4NQXB 5KS9B 4ETYA 1BBDL 1D5MB 1N3NB 4JQIL 1RY7B 3WO3B 4Z7UA 3KAAA 1CD9B 1U8OB 3C6LD 5K93A 2C3GA 5CEYA 4OAWA 3DX8B 4WU7B 3ARFA 4M00A 5D2LE 3BH8B 1ORQB 4GQPH 1NFDA 1HH9B 1NGQH 2XWBA 4HS8H 3RUGF 3G5YA 3ZYOA 1UH4A 2OSLA 3ARDD 4OD3L 4CUCA 3NBNA 1CI5A 2DRUA 2IPUG 4MXQC 2HG5B 2CSPA 4HUKB 4E9LA 1S7QB 4BH8A 1CQKA 4RSVA 1RD6A 4MJ5B 3MJ9A 4M7KH 3PXJA 3BPLC 2NX5D 4MNQB 5IMMB 4KAQH 4YO0B 1Q9OA 2CIIB 2I9LA 1VACB 4O5LH 3T3PF 5EIVA 1VGEL 1A3LL 4JDVB 1KCLA 3WFDH 4NZRH 1RIHH 3HZMB 1OAXL 1FDLH 4C56A 4EUPG 1NEZG 4XMLL 5CBAA 2WBKA 3VXSB 4KPHL 2CMRH 1X3DA 4MXQD 4X6DB 4IOFC 1S3KL 3TYFB 3BEWA 4JR9L 3IF1B 4TVPH 4ODHH 4CW1B 3OZ9L 2JIXB 4XX1G 4ELME 5FKPB 1S7WA 2J8UB 1KCSL 5IQ9A 2Z91A 4F7PA 4YXKL 1XCQA 3ULVL 4JLRA 3AFLA 5EIIB 4JFXA 3LD8B 4ONFH 5AAWA 3D6GA 5IBLC 2K3TA 1QBBA 2YUWA 4J1UB 1N0XL 5BV7H 1OGAA 1TMCB 4O4YL 3ZDZF 2VLKA 3TBWA 4OCSL 3HR6A 1R5WB 4IOFD 4M8QA 1GZQB 2VKXA 3HPLB 3UJIH 3B5HA 3MUJA 3KPMA 5E4EB 1NDMB 1YNKL 3BZ4A 4X6FA 4JFEA 5H35A 3ARXA 4OGYH 1MH5B 3QHFH 1AQDB 3WDHA 5ICYA 2P4AB 4JKMA 1F6AB 3OKMB 5HHNA 1UH2A 3BKCH 4ORGA 1DSFL 5GGVY 5IBLD 4YEEA 1RULH 3JUZA 3MLRL 3BN9C 4XT1C 4G6JL 1CGYA 2D0HA 4KJWC 3UPRA 3IKKA 4FQXD 1KELL 2AV7A 1UWEL 5TQ2L 4DTGH 3HCVA 2CKNA 4LCUB 1A7PH 1DQQA 2IH3B 2WBJC 4XB7A 5C9JB 5KTEH 1IQWH 2OL3B 1TQBC 4L4VA 4MWFA 4TUKH 2EE2A 1EIBA 4GUPA 4X5WB 1T20A 5C0DA 1HHHB 2J6EH 3JVGC 5E6IB 3MJ9L 1UCBH 3OXRB 1RUQH 4QTIH 4X4YB 3QDMA 1MJUH 2CRYA 3BN9D 2C3HA 2MCPH 3IU3B 4RDQG 4HEME 1G0YR 4XHJC 3LKQB 5IG7B 4BFBD 4KJWD 4LSSL 1D3CA 1H3WM 4NSKB 5GGRA 1Q9WB 1R3HB 5FUZL 1MFAH 4JRXE 4YLQT 3H3KA 3M17B 1AXIB 2WBJD 2W9DL 3V7AG 1TIUA 1I7TA 1CICA 1O7VA 2FBOJ 3T4YA 4Y2DA 1TENA 4YHKL 3F7QA 3WNOA 4BKLB 3UTOA 4QY8A 4M6ML 3MACL 1T3FB 5KVDH 4G6AC 4I2XB 3HPJB 5E9DE 2OXHA 4IRJB 2B4CC 1K9TA 1U8PA 3SE4C 4XHJD 2IBBA 1JI1A 1MLCB 4ZODA 1UB6A 4NNXA 2VWEE 3ARZA 2NZ9D 2GIYA 1QRND 1YEHH 2IANA 5EN2B 3D18B 2GTZA 4V1DE 2MFNA 2PTTA 1R0AL 1J87A 2R0ZL 4HS3A 1C5BL 1CLOH 1J1XL 1N5YL 4YE4H 2KPNA 1F8TL 3K4ZA 1X7QA 3CSGA 2X89D 4UINL 3SDCB 2DWDA 4G6AD 1LP9F 2B0SL 3OPZL 5HPOA 1BP3B 4KQ4H 3W39B 1KLFA 2V2XA 5LGKA 2V5TA 3SGKC 5DSCB 1XGQB 3FO0H 3HS0B 4PGZA 3AC0A 5F1IA 1GC1L 2VLLA 2WIMA 4XXDB 3L9RB 1UJTA 2CDFB 3D85B 3S37X 3X3GH 1KLGA 2NY6C 4OM1H 4Q58C 5IBUB 5C09E 4X4MA 4KRMB 4KHTH 3M8OL 3VDAA 4F7EA 2IWGA 3IRPX 4CKVX 3TT3H 4YHYC 4QRRA 1F90H 3FCTA 1KUMA 4NKOB 4U1LB 5F7DB 4HS6B 1A6VL 3V6FB 4PREB 3NA9L 3FO9A 5F1NA 1G84A 3O3BA 2ICEB 1TLKA 1G7JB 2VOTA 2NTFB 1RJYB 2YBRA 1KIPA 2NY6D 1N6VA 3NN8A 4X6EA 4RNRA 5DMGC 4R0LA 5FYKH 4LFHD 1G0DA 4UOJA 3JTTB 3MV8E 3IDUA 5D7IA 4YGVA 1I7UA 1RURH 4Z8FL 1A2YB 1NFIA 2EDDA 5DQJB 2XKUA 1LD9B 1MPAH 4CDGC 4UV7L 3PJSB 2BHUA 1BHGA 2OTWB 3QFJB 2DBLL 3LHPL 4LHJB 1MFBL 4Q9QH 1G1YA 4L5FH 5C3LD 3WN5C 1D5XA 4U1IA 4H0GA 5DJCA 1GHFH 3DI3B 4PJXF 3LKSB 4F80A 2FO4B 4XVJH 3SDDC 2AERT 1AGBA 1H15B 5DMGD 4M61A 1A4JA 4NNPH 4HCRA 3HC3L 1TZHB 3ZTJG 1W0WB 5CMAA 4KI5F 4LSRH 3GUTB 3MRCA 3TO4A 3TC9A 3CXDL 4DGVH 3U7YH 1ACYL 4KV5F 4WW2F 1FNGA 3CFJB 4KZDH 1U8JA 2AXFB 5DGRA 1U3HB 5C6TH 3E8UL 2LVCA 4TSBL 3MRRB 4U1MB 3X14B 5C0CB 5ISZE 3S35H 1MCNA 4O58H 2WZPD 3NMEA 3SDDD 3W0WD 2AI0H 4JGMA 2CGRH 2QQLH 4ZUTA 3GB7B 4X80H 3V4UH 3MOAL 1G7QB 5GJTH 3D39A 4LRIC 1FFOA 1HHJA 2ZUQB 4WI4A 3OR6A 5EWIH 2RBLA 3VGAB 1U91A 1OAUL 2W0FB 4HKBA 4L4TD 4LQFH 4Z5RA 2YD7A 3BUYB 5JUEH 5FYJU 3RGVC 2EZ0C 2NXYB 1CN4A 4M6AA 3FRPG 5D70L 2BVPA 1RUPH 4RRPA 5GRUL 1CL7L 3BUTA 5BJTA 3MV9E 1NLBH 4OGXH 1AGDA 2FJHB 4WWKC 2DQFB 1CD1B 3EOTL 3UPAA 1EO5A 3DBXA 4K94H 43CAB 3ROLB 4JFYB 3HRZB 4XAKD 1DANT 3BQUA 4LCCB 3DVIA 4XVSL 2E7BA 4LSQL 4Z7VF 3RAJH 3QQ4B 3IU4L 3CAFA 1SJXA 4ZXBB 3RGVD 3J8F7 1ZWIB 2EZ0D 2IPTL 2X10A 3SKJL 2APTA 3BT2H 4G9FA 1T4KB 2FCBA 1M4KA 4XGZA 1B4RA 2R0WH 4PGJA 2XWJB 3ARBC 2HT4C 4W4NA 3UYRL 4WWKD 3RL2B 4FOMA 4JB9L 1HKLL 2WWKO 4CMMB 1AD0B 1H5BC 2R2BB 5EBMA 4HCRL 2ZSVA 1UA6L 2QL1A 4DEPB 3UTQA 1FL6B 1YEKH 5I0DA 5M94B 4QRPE 4TSCL 3DSFH 1HH6A 1NCBL 1OW0C 2R1XA 5JDSA 2CK2A 3VG0L 2ORBL 3HZVA 3VXOB 1YQVH 4P5MB 1MFCH 1HN1A 4EVNB 1QPPA 5B3JE 1ZVSB 1X5AA 1UH3A 3C60B 4HXBH 4PRPB 2E8ZA 3O2VL 3ARBD 5FECB 5LVEA 5JLZA 1HILB 4PRNA 1YPZF 5LXGL 2M1KA 5MP6L 3JV6A 4PD4J 1CS6A 3ARWA 1EX0A 1L4IA 4RGMC 4LPTA 3MLWH 4PV8B 4OD2A 1BD2E 5IESL 5D1XB 4X6DE 1ONQA 4EKXA 5MI0C 5DK2A 4HSQA 3S88H 3C5JA 1E28B 5T5FL 7FABL 4RAUB 1OHQA 3DO3A 5C86A 1NEUA 4MAYC 1D6EB 3K80A 4TRPH 5DI8A 1Z9LA 3NABL 3QIWA 4NOFA 3NFSL 5SWZD 4KK6C 3DMMC 2YRLA 4PJDB 5DD0H 3IDGB 4N90D 4ZFFA 5I2IA 2EDFA 5E00B 2HJFB 1RAMA 2SEBB 3LKNB 3S3SA 3GI8L 3OKLB 4XMPH 1FN4A 3TJHC 2IFFL 1XIWA 3IJYA 1S8DA 4X8JA 1EVTC 2ENYA 5FGBA 5E2VH 1NDGB 3WEXB 5C08D 3LMJH 4MAYD 4ODVH 1XZ0A 3D3VD 1EFQA 2AJSH 3MREA 2E27H 3O4OB 4NQSB 4ZG1A 3STLA 1G7MB 2VDKH 2VXVH 3MROB 5CEZD 3DMMD 4P2QD 1A7QH 1HIMH 3KXFD 1QBML 1G6RB 3I75A 3KJ6L 4JREB 2GJ6D 3V0VA 2QHRL 2F5BL 1DQML 1FO0B 4FQLL 4AG4H 3WKMH 4GRLC 3TJHD 1UADC 3RWGA 1A1OA 3EGSB 4Z7WB 2W65A 3EFDH 1G1CA 2X09A 1ZT7A 4E41D 3WYRA 3BJ91 3MV01 1ITCA 5FDWB 4OLWL 1MWAA 4MA1B 4X83A 2YA0A 1W0VB 1CK0H 1IKNC 2DJUA 4D0BB 2AQ3A 2WBWB 4G80A 1NGWB 4U3HA 4FA8A 1AGCB 2NW3B 3QNYB 1YNLL 5IFJA 5D2LA 3S37L 4G8GA 4RMRA 1ZMYA 3RI5F 4NCC2 3THMH 3V52L 1F5WA 5FGRA 1BREA 3NCEB 4GRLD 5CFHA 2UV3A 3VXUA 3UBXA 3QUZB 1UVQA 4E0RA 1EO7A 3HAEG 1Q0YH 4XMKL 3UTPE 4BELD 3QQ3B 3CFKB 2X4RA 3CFBA 5ESAA 5CSBA 2VLRB 2X1OA 3PF2A 3G5XA 3H2WA 1OY3B 3BDYL 3K1DA 3JV4A 3NH7H 2FEEL 4F33A 5BZDA 4J8RB 2E7CA 5BO1H 5KAQF 3GIVA 4KI1A 3QP3A 4C59B 4QHNB 3T0XA 5IW6A 2XG4A 3SO3B 3BPOB 3N85L 4NFCA 1BQSA 4TULL 4MZ2A 4OBSA 1J12A 1XGRB 1IGIH 3K2UH 4OFYA 1LO2H 1J0YA 3G6JB 3RUGE 3ZLQC 4YFDB 2GFBB 4NKMB 3VH8G 3E0GA 1S9YB 3VA6A 1Y18B 4A2LA 4MA8H 1C5CH 3E2HB 4JPIB 1WGOA 1FYTD 3QHZH 2MPAL 3TH2T 5EO0A 1AR2A 1DLFH 4WEBL 3SGEH 3OAUL 2FX9L 1KNOB 3D2UA 5E94B 4UT7H 1MCBA 2V9RA 1RIVL 5CEXB 5EU5A 3DX9A 4LOUC 4JZJA 1NBZA 5E5MB 3HI6H 4G43A 4TTDC 4FABH 2N1KA 4PGBB 2A6DA 2GAZA 3N1GC 4JDTH 1P84K 4NO0A 4P23C 1FH5H 3MJGX 4BZYA 2EDNA 3B6SB 3MFFB 4NYLA 1CGSL 4QRTA 4HIHA 1K8DB 1WICA 3QHTC 8CGTA 1HYRC 3OJ2C 5DT1H 3RWCA 4W4OC 2IAMC 4QRQB 2Q6WA 2BVQB 3PQYD 5MHSD 2X4OB 1MWAL 4LOUD 5TPWL 2R4SH 4DVRH 4PJAF 1A7RH 1AY1H 4TTDD 2CKBB 4JO4L 3F12B 3Q1SH 1FVEB 3TLRA 3QJHB 1ZLSL 4WUUE 4GMTL 4P23D 5J11B 5FO7A 2ZSWA 2DOCA 1ZHLA 4OIAA 3WFZA 2OK0H 4X6BB 3ZDZE 3WKNA 3MYZA 5DR5H 4FFVC 1J9CT 4WW1A 3PWVB 5FM4A 3L3DA 4FQJH 1OGTA 1JPTL 2IAMD 2R29H 3KYKH 4JO2L 4K3JL 4CMHC 2ADFL 5FB8B 2FSEA 3S6CA 4P9HH 3V4PL 1OD7A 4MMXC 3BIAX 3QDJA 4AL8H 5TE4H 5CCKL 4JRYA 3MLYL 4KROB 3X17A 2X42A 4UUJB 5GGVL 3OKDB 1CFBA 4N5UA 1YEIH 4PUBH 1I3RB 3ILPB 4H1LH 4FFVD 3RZCA 1JWSB 4MLSA 1G6VK 3FOMB 4N8VB 3BWAB 4S1RH 3Q3GB 4FP8H 2W0LA 2P5EE 2G60L 5IFHH 3IFLH 1ZANH 3L1OH 1RUAL 4UILH 1RJCA 1QFWH 3SOBH 4OZHA 2NY2C 4PJGF 2NNAA 4L9LB 4XPBL 4Q9RH 1Z6JT 4A6YA 5JOFB 4HV8A 4MA7L 4MX7B 2W0PA 1UM5L 3K7UA 1FFRA 1A7OL 4F58L 4MJIB 5IT2H 3SDAD 3CDFA 3SKOA 3R0NA 5C0CE 1FRGL 5BMFH 3PHQA 4V1DA 4TVPE 1FVDA 3ALPA 2IC2A 2XNAB 2P7TA 3L3JB 4YNYB 5HPMA 3FB7A 2NY2D 4TTGA 5TE6H 2R69H 4IJ3C 4M6NH 2MHAB 4LARL 4XNYH 3PWJA 1TZGL 5D7JD 5E0QA 4PY7B 4CGTA 3IDMB 1VPOL 5DUPL 2AEPL 2OI9C 3C08H 1N4XL 4WHYH 3WMSA 3QCUH 1HSAB 3G08A 1JUFA 2W59A 2R1YA 1OCWH 4M5YH 4X9GA 2BNRB 1W0YT 5DJ0A 3I6KA 2IGFL 2HFFA 3V6BR 4MQ7B 2W38A 1ZGLB 1ZVYA 1JNLL 4FQ1L 1AJ7H 1PQZB 5DDHA 2E5EA 1E6OH 5J1TC 4MB4A 4Q6IC 4R96B 5JPMA 5JW5A 3MYJB 1E4WH 3T0WA 3QZWA 1LP9E 5L8KB 3C8DA 3WHXA 1L7TL 2ID5A 1EFXB 1FIEA 2IFGA 4TPRH 3ZZ1A 5L9DL 4HJJL 4O2CB 2R15A 1CLYL 2MNUA 1T89A 3ZE2E 2VXQH 4PJEF 1KCKA 1GPOH 32C2B 5F89B 4UOW1 4DCQA 4HD9A 3OF6A 4KK8C 4Y5XC 2R4RL 4AZ8A 3I3EA 4UTAL 4U1NB 2HJKA 1FYHB 2X4UA 4PTUA 4S0SD 4RMSA 1CTOA 5HYFA 2HFGH 4WCYL 3B43A 1OB1A 3DGCR 3MV8A 2GITA 5AYUH 2E6QA 4PJ7B 5D7SH 5I1EH 1MIEH 4EI6A 4A6YL 4M9OA 4ZOEA 3H9SB 3DVGB 4NQEB 1A7NH 1H0DB 2HYMA 3QIUB 4RRPG 4D3CL 4YBLC 5EZOL 4PJHE 5F3BB 1H3UA 2DBJA 4KK8D 4OTXH 4PRPE 3AAZA 4E5XB 5T5NG 4D9LH 2FGWH 3ARGB 4QXTA 4KMTH 4BUGA 5LBSL 1TVHB 2YZ1A 4YHML 3U1SL 5HBBA 4ZUUB 3EO1B 4QOKA 1BFVH 3EW3B 4I18B 1X4XA 5EUKA 4Y4FB 5CUSL 4R97C 4Y89A 2GSGA 2VLJD 5CIPH 3P30H 2VZSA 4PJXE 1OP5H 4FQPA 5I76B 2CQVA 1P69B 4WFFE 3MRDB 4JY6B 3EO9H 2B4CH 3K4AA 1T2XA 3KPQA 4MCZB 5ITBH 4YDJB 4GS7C 4CNIB 2WLYA 3V5DB 3QIBC 4KV5E 4RFEB 4JJHA 1AGEB 4RBPH 1NGPL 2F9BT 5I1KH 1LVEA 3ES6B 4HUUB 4EJ1C 4AK1A 3BH9B 2Y7QA 5D2NC 4HC1H 2VDQL 4H26A 3O6LL 4KUCD 1V5JA 4RWHA 4TVSa 4WFED 4OLVH 3TO2B 2ADGA 5E08L 4QF1A 4KRPC 4POZC 2N56A 3GMNA 3ILQC 2W9EL 4URTB 3VJ6B 3MLUL 3RWFA 3UMTA 3GMOA 5IMLA 5IBTL 1S9VA 4DKDC 3ZTNH 3GJEA 3P73B 4ERSL 2F58H 2G75A 4XXCC 4HIIA 4X9BA 4Y8DC 2BVYA 2DICA 1MHEA 5DHYB 3UTSA 1FFNA 2OX5A 4ONOA 3RY4A 3FB8B 5I1IH 3CJJA 3ULVC 5FUCC 1QYGH 5FYKE 5KSUA 2D7TL 4P49A 1V7MH 1T1ZB 4KRPD 4POZD 3ILQD 1VHPA 3ABZA 1NH6A 3ARDB 4X4ZA 4FFZH 2VDPL 4HBCH 1DLHB 3IDNB 1A5FL 1XAUA 3L3IB 3N9GH 4D0CB 4FQCL 4LLWB 1GGBH 4HK3J 3PWNB 2NX5B 4PY8I 3RNQA 5K9KB 4OGAC 5IMOA 3TBTA 2X4TA 3OKNB 1N6QH 2R2EB 3NIDF 3ULVD 4XBGA 1CFTA 1YDPA 2MCG1 3L95B 5IF0A 4NQDA 5BOPA 4LLDB 4XP5H 4RWYL 3HE7A 3DX6B 2OJEB 4K7PY 1NBQA 3ARFC 1KB9J 3MJ6A 4U1HB 1CFVH 4JRWA 3G6JE 2VC2L 1FZOA 4LEXL 3MRIB 2YD4A 4POYA 3BPLB 4NUGL 1BIIA 3BZFA 1Q72L 4OGAD 5EOTB 3O6KL 2BCKB 2CXGA 3VXRA 2WIIB 2VDLL 3RTQC 1EERB 4QRUA 2GJZB 5E8DH 1PDKA 1KEML 4OLXH 4X8XA 5I16A 4JFQA 2G5BA 2Y25A 3UBXG 1YPZE 2RQ8A 4H88L 1YEGH 3ARFD 3MX0A 1T5XB 4NQCA 4LSUL 3QUXA 2DMKA 1Z0MA 2YS4A 3LY6A 3QUMA 1MUJB 4QYOB 2J8UF 5DWUH 3T1WA 1MRFH 1I7ZA 5IW1A 1XEDA 3RTQD 1KB5B 3TVMA 2CDEA 2BMKA 3CVIH 4X99B 5IFAL 4RAVB 5IB3A 1BAFH 5D7KE 5KN5B 4JAMB 1VA9A 2DQCH 2LABA 3U9PL 1IKFH 2BX5A 4GKZB 3QEQA 5MENB 5LQBL 3F6IA 4Y16A 4NO2B 1IZJA 4OQTH 3U0WL 2P5WE 1G7PA 4PV9A 1KJMA 4FQXB 1QSEB 3SHSA 4C56D 1DUZB 5L2JB 2B20A 4YPGB 1PX3A 1WFUA 1AQKL 5DD3H 3RI5K 1R24B 3KHOA 4B53A 1U6AL 4H25B 3KPSB 4OM0L 2FZ3B 1FHGA 4KGLA 3BIKB 3HNVL 2CLVB 1IGML 1NL0L 4JKWA 4YFLI 3S36H 3DUUB 4PRBB 3WDIA 3DI2B 5I1LB 2JELH 5IJVB 4QTHA 2LE9A 5HDQH 1GC1C 3MOQA 4Y19A 2EYSA 5J12B 1OGAD 3QJFB 4GW4A 4X9FA 2UZIL 2VLKD 2WBJB 1ZT4B 6FABH 1M71B 2F54A 1ZT1A 4YWGL 2V7NB 5FO8B 3LDBC 4MDJB 4AIZB 4Q0XL 2QSTA 4EN3A 3B9AA 4AQ1B 4LCIH 3FTGA 3FONA 5J06A 1BOGA 3P0VH 3P9MB 5HHQB 4OZ4B 3MV7A 3F7YB 1FZJB 4IDJH 2ESVA 4P9ML 3MA7A 3FQXB 1MNUH 3Q48A 1GAFL 1QO3B 4S2SA 4MJIE 2CDGB 3MLZH 1VENA 4E42A 5C0AA 1JL8A 5CIPB 5F70A 4LLQB 3BHBA 1OT1A 2AKRA 5EIQA 1DANU 2AJYL 4PTTA 2ADJB 5JHDA 1TCRA 4WDIB 2A6KA 4HZLB 3QUML 5EULV 2ZCHH 5HI3C 5F7YC 4HDIA 4L4VD 1P2CA 4PD4K 4DKFH 2PW1A 3VFRB 4Y2DC 5E8OB 3TV3H 2G2RB 3MRKB 3T0EB 3ROOB 4OFDA 3B9KD 1H3XA 1FG9C 3LIZL 3QDMD 4C57C 1JGUL 2YMXL 1A9EB 1NC4D 4WNQB 4W70A 4Y1AE 3OB0H 1QVOA 1WEJH 4OCWH 3EOBB 4K55A 1V7NL 3GSUB 4LVNC 4DFIA 4OCYH 1QEWB 4IM8A 1IL1A 4NNYA 5CEZH 3CDCA 5IV2A 3BD4A 4MGXA 3L5XH 1A1NB 2EXYC 2FD6H 4TN9A 5HI3D 3TFKC 4F7CA 1C8PA 1CXKA 1PZ5B 3H7BB 1V3MA 4Y2DD 3VWKA 5J6GB 5IWLA 3S34H 5C2BH 4K2UL 3WS3B 4WUUA 3DSNA 5TQ0H 3OG4B 3LCYA 3UP1A 1D6VL 3D25B 2GUOB 3LS5H 4GAGL 3C09C 5EBLB 1HOCA 4LKCB 3LS4L 4OI8A 1QFPA 4PRIA 1G9NL 3RJDA 1CLZL 2R1WB 2VKWA 1JPFA 4GXUM 4G9DB 4YHYB 4R4BA 4U1GC 2EXYD 3BISA 3MXVH 3TFKD 5FHAL 5LAXA 3GHEH 1SJHA 4NBYB 1TETL 4WI8A 2VL5A 2A74A 2IG2H 5C0IB 1JHKL 1NCWH 5HHPA 5I19L 1DBMH 4WUKL 1BLNA 4YHOH 3K1KC 4FNLH 3ZMRA 4PJAE 4HXAH 4ENEC 1T21B 3QDAA 1A9BB 3WFBL 1Z9MA 3GM8A 4ODUA 3MGOB 5AUMB 1KPUB 1F4XH 1X5GA 2NXZC 2VDOL 4KKBC 1FIGH 5EUOF 2BRRL 4HLZG 4LCWE 5H37G 4K3HA 5I1CH 3BD3A 3ZYZA 4ISVA 1UACH 3QZWG 4K7PX 4UIMB 1WCBB 2E6JA 3VXQA 3MPCA 2OJZL 3G5ZA 4QRRD 4ENED 2DKUA 1G7HA 1CL7I 3WN5B 5ID1A 2X7LB 4NO3A 2NXZD 3RX7A 3GO1L 2R8SL 4EUPH 1I3GH 1W72B 3W0WB 1BVLA 4JFFE 1S7TA 3CFDB 1IC7H 4BH7A 1P7QA 4Z0XB 1JGLL 3F6LA 4ZAKA 4DUVA 4HJ0C 2R39A 3MRFA 4OUUB 4JQVA 5F7FA 5ALBH 2Z93A 1IM3A 3IJSB 3C8HA 1YY9C 1MRDH 4JFHD 2JJSC 4KKAC 4PJGE 4AT6B 5CJXA 4NN7C 4XNUL 4OB5L 4WO4B 1HQ4A 1KIQA 2VH5L 3N1QC 2FIKB 2OR7A 3MUHL 4S1QH 4G7VL 2XICA 5HGDA 4H0IA 5IW3A 3VFSA 3REVB 3GI9H 3O2WH 1TTGA 2F74A 5I8KL 4HJ0D 4PB0H 4HUWB 3RPKA 2VR4A 4B0MM 1YJDH 4LHQB 2O5ZL 1M7IB 2G5RA 1FVCB 2H1PL 1MRCH 3QB7C 1NAMB 1FGNL 1ES0B 3QEUA 5B21A 1U8HA 4PGCB 4KKAD 5JPNA 1T0NB 1T0MB 2FX7H 2BHZA 4Z76B 1KPVB 5ANMA 3U36A 3OB8A 1WCQA 3RGVB 3SY0A 5A2JH 1K5NB 1G0XA 3HC0A 3S35X 1NGQL 3TA3A 4F2MA 1YEEH 4WV1B 4I5BA 3TZVA 4JDZB 1EUUA 4PJCB 5FCUL 2UWEA 3CSPA 3EYFA 3GSNB 3H42L 4WI2A 3TCLA 4YZFE 3EO0A 2E9JA 4M7KL 3TNMB 4X7SH 3SBWC 4GW5A 1NKOA 2BY3A 2K7PA 3D39D 4O5LL 3MRBA 1NGZA 3R1GL 4XNXH 3BQUC 2VXSH 4NM4H 4XCCL 1FDLL 1E27B 3KYAA 4HPYH 4DK3A 3L3HB 3IFPA 2CMRL 5E2JA 3ARBB 3SDXB 3VD5A 4PJEE 4IOIB 5DJYB 1NCDH 1H5BB 1OQXA 3FZUC 3LQZA 4J6RH 3LOWA 5KSBB 4ODHL 3QBTB 5D5MB 4HK0A 4KJYA 1KJ2B 2VZ3A 5CGYC 2DQEL 5GISL 3VFTA 3BQUD 1SJVA 1A6UH 1DUYB 1LK3H 1JGVH 3RDTD 1BFOB 3RVUC 2HRPH 2F53E 1OTTC 3CSYA 4YAQB 1C08B 4CVZB 5FYKU 1S5IH 1QFHA 5I66A 3FZUD 3ZDYF 4G9FD 2LAGB 5DK0A 5IOPB 2CLZB 1JWUB 4OGYL 3QO1B 1BJ8A 3RY6A 5KSVB 3T4AA 2GHWB 2C1PB 4RGMB 2DQJL 1ED3A 4YK4C 5EOQH 3HN3A 2H26B 1H8NA 5CGYD 3ZE1F 2VDRL 1DQJA 4Y4HA 5F6IC 5MI0B 2BDNH 5GIRB 3BE1H 1R5VA 2HVJA 4PIRF 4ZUVB 3CH1B 3INUH 4WW2A 3W81A 4P46A 1FL5B 2IADA 4DZ8B 5C08B 3IAGC 5MEOB 3RVUD 1RULL 4MAYB 3D3VB 4L3AA 3BWUC 3DVFA 4L1DA 1OTTD 1OPGL 4OZFB 1VESA 5D9SA 5FCSH 1Q94A 1CG9B 5CD3A 5JZ7C 2B2XH 5GHWL 4WU5A 5EBGA 2ARWA 3DMMB 4P2QB 3PABA 1RSFA 1BVKA 4EXKA 1ZHKB 1XR9A 3HUJA 2CXKA 4QKXB 2GJ6B 5D7LA 1OL0A 4PRAA 3QIWC 4LLMA 4ELKB 1AFVL 3WLBA 4M5ZH 4WHTA 1NANH 4JZNA 4OZIA 3KPRD 4CADA 4E41B 1QQDA 5DEGB 1JPSL 3D87B 1UCBL 1CD8A 2AXGB 5L6YL 4RDQF 1RUQL 1T6WA 4QTIL 8FABA 5ESQA 1MJUL 4KQ3H 2VZ1A 5FK9B 2QSVA 1WITA 5FDYA 2BJML 3VCLB 1DFBH 5I1JL 1ITBB 2ZCKH 5FHBH 3C6SB 2BY0A 5IB1B 1I9EA 3C2SA 1MFAL 4XCEA 4P5KB 2FJGA 2AXJA 1OP5K 5DRWA 3EDFA 4H5SA 1QLRB 3D0LB 3QIWD 4GRLB 1JV5A 2H3NA 2Q8BL 3H0TA 1WLHA 4BZ1H 4Z7WF 1M7DB 3SE9H 1D5ZB 1J1OH 4ZO9A 2W1NA 2ERJB 5C71A 3NCCB 4HWNA 3H3BC 4Z7VA 1J86A 2X4QA 4DVBB 3NIFF 4NFBA 3OHXA 1GOFA 4RBPK 3PDOB 5E99H 3X3FH 1YEHL 2EH7H 1ZEAH 1J88A 4KY1L 5I71B 5JNYA 4YE4L 3OL2A 4K23H 4MB3A 3ZTJH 5EU6B 1QRNE 3DECA 2I5YH 3KR3L 4KQ4L 4NKQB 1FYTB 1NEZB 5B8CA 3SGDI 2LAAA 2H32H 3LKRA 3FO0L 1P1ZA 1AI1H 2BVOA 1BBJA 5HHOE 5BW7C 4JJ5B 5I1AA 4DWHA 1QD0A 1IAKA 3PWPE 3MCKA 3NIDE 4NJAH 4J2XA 1LO5A 1YPZA 1X6NA 2YD2A 5E6YA 3UBXI 4ZFGH 1GXEA 3GNMH 1U42A 4I3RL 3O41B 3UTTA 3TT1H 3TT3L 1F90L 4K7PL 5GGUA 5LJYH 1BBDH 3VXUD 3MNVB 4LCYB 2ZUUA 3PWLA 2YSSA 2UYLB 3PQYB 4Q2ZA 2OQJA 4Z6AT 2YPLE 5CAYB 4NHUA 1DN0A 2ICWI 2FL5A 4XI5C 1LK2B 1FSKB 4KTEL 2FEDC 5D6CA 3L6FA 4L8CB 1GSMA 3SCMA 4P23B 4PJ5A 4OFPA 3T0AA 2CK0H 3W9DA 3QXWA 3LKOA 4JZJC 2EDEA 5I8CB 5EC1A 3GGWB 3ECBB 1RURL 1TVBA 5DHVH 4OFYD 5DUBB 2HLAA 3O11B 1KG0B 3DRTA 1VGEH 1A3LH 5BVJA 3AY4A 1T6VN 3BD5A 3UCRA 1LEGA 4ODXB 1BQHA 2FEDD 2D2OA 5HYIA 4MD0B 4XMLH 3VDBA 4KPHH 3TN0A 4XVJL 1S7RB 3D2UD 4ZQKA 3OKKB 4ESKA 4NNPL 4GJTB 1N2RA 1QZ1A 1XR8B 3OR7B 4XP6H 4NO0D 5C0BA 3NOIA 3U4AA 3X11B 3U7YL 4DGVL 2YWZA 4CMHB 4AENA 1HCFX 1NJ9B 3JSSA 1DDHB 4YXKH 5C6TL 3ULVH 1FNSL 1NGYB 3D0VA 3S35L 1RU9H 3AXLA 1QSFB 1I4FA 4O58L 1J0KA 4P2OC 2AI0L 4P4KA 2QQLL 3U0TB 4GG6A 4KH2A 4X80L 5GJTL 3SDAB 1YNKH 3ARYA 5I75C 3D1MC 4U1JA 2Y5EA 4BSJA 1JF1B 3U83A 4XZUB 1FC1A 1FLRL 3MFGB 3RZCC 5A2LH 1DSFH 5F3HA 1FCCA 1U8IB 3A6OA 1S7SA 5D7JB 3MLRH 5JUEL 1HSBA 4QHLA 4M62H 1EAPA 4NO5B 4P2OD 1A6AA 2GK2A 4G6JH 1AP2B 1KB9K 3SKMA 1LNUA 1BZ9B 4P2CG 3QDJD 4L4TE 4JRYD 2YC1B 4K94L 1QA9A 3EYOA 4DOHB 3OAZH 4QXGH 3ZHKA 1JCKA 3LN4B 4LKXB 4L29A 1NFKA 4JRXD 4IJ3B 3RAJL 3MJ9H 2DKMA 4GRMB 5C2UB 3ARTA 2B5IB 1G7LB 2OI9B 1TDQA 3SGJA 4HFWA 4LSSH 3DV4A 4XPTL 4NKDB 2V5YA 1F11A 1NMAH 5E9DD 2Z92B 5INDB 3VE0A 4XNMB 1F4AA 3EIFA 1B6DA 1MCLA 1YEKL 3Q6GH 4PGDB 4YHKH 4I0PA 4ETQA 4M6MH 4ZUSB 3MACH 3UYPA 4KK9C 4K9EH 4PR5B 4V1DD 5J13C 3P9LA 4Q6IB 4AEHH 3NZ8A 1U0QA 1U8MA 4GBXA 5TE7H 3O6FA 1M7XA 1CE1H 3FRUB 3J7HA 1UJ3A 4PJAA 1KTLB 5EBWB 3X12B 1ZLUH 3SKNA 4NJ9L 4PJIB 1R0AH 2R0ZH 1A8JH 1C5BH 1N5YH 4JM2A 4AEFA 3IGAA 3MLWL 3VFWB 3OB0K 4LCWA 3JV0A 2AJXL 4XAWH 5IQ7L 4KK9D 5DRNB 4OV5B 4LHUA 3VFUA 2V5SA 3PV7A 2B0SH 2BFVL 3MMEB 4MNGB 3GMRA 5EO1A 1T89C 5DRZA 1A6TA 5K9QG 5FFLA 4MSWB 5C09D 2OTUA 4RX4A 5D5ME 3RPIB 2J4WH 2UUDH 2XN9E 2DDQL 4HGWB 3V8CA 4DW2H 1GC1H 4OLEA 3FOLA 4X9HA 4Y5YB 1YUHA 5CKAA 1HYSD 3A67L 5DD0L 4N1CA 1ORSA 4YBLB 1K2DB 2VLJB 5HHVH 5IP4A 5GS2D 3HE6A 2CR3A 25C8H 5EFIB 4LSTL 1L6XA 4JG0H 4KK5C 5C7XH 5EUOE 5SWZE 2IEPA 4ZPVB 2I9TA 1JNHA 4YC2C 5D6DC 3OF6D 3FHQA 4ODVL 4ZFZA 3F8UB 2AJSL 2PF6A 4K71C 4PJGA 1JZ5A 3NA9H 4QCIB 4BSVA 5JIPA 1I85C 2VDKL 2JTDA 2VXVL 2XQBH 4WJ5A 3IJHA 1JGEA 3MV8D 1A7QL 4KKCC 4HWBA 5L2KA 5GS0L 5C08E 3D5OF 3D3VE 2PYEE 3WKML 3VRIB 1C5DA 1CGTA 4IIQA 2ATPA 4KK5D 1HQRA 1MCQA 3EFDL 43C9B 3MRQB 1LEIB 5CEZE 1WVZA 1CFSB 3KXFE 3M45A 2EYRB 3QH3A 2IPUK 4X98A 1NKRA 1CK0L 4GS7B 2A77L 2BSTB 4J3XA 5HGHA 2V2WB 4UV7H 5BQ7A 5T1MB 2HFTA 3SQOH 3LHPH 2XFXB 3TPKA 1WTGT 4KKCD 4E41E 5FA4B 3IFNH 3T0VA 3KPOA 3HC3H 1WISA 3ALWA 3CDGB 5GGTA 1OD9A 5GGSB 5ERWB 2PW2B 4NZDA 5ACLA 3L3OA 1Q0YL 3MJ8A 5ISZD 1MCFA 2D3VA 1I1RA 1QFUL 3VFNA 3CXDH 4KRPB 1ACYH 3L7FB 3JBG7 2L4OA 5BO1L 2BZDA 2QJDA 1WWCA 3N0PB 2V5MA 4GOSA 1RZFH 3FB6B 3FQNB 1EEUA 2H2SC 2R2HA 1BFTA 3MOAH 1SQ2N 3K2UL 1IGFH 3WIFA 3DV6B 3GSVA 5JO5B 3CVHA 4CAGA 5HYSA 2PNDA 2YKLH 1ETZB 4PJEA 3DXAA 1OP3H 3UEZA 3OKEA 1C5CL 4MA8L 2KL6A 5A3ID 1B9ZA 2OZ4A 1IGTB 3G6AB 3T2OA 3U79A 4L8DA 3MV9D 4ODWB 2PKDA 5IVXA 4XRCB 4AMKL 1K85A 4FTVE 4UT7L 2C1OB 1I8KB 4U1KB 2H2SD 1T83A 1FYTE 4FABL 4IDLA 3VXPB 5GRUH 2FWOB 3MCLL 3NCYP 4I0KA 5DQ9B 3WFHB 2WM0A 1FH5L 3BMVA 4HWBL 1GGTA 3WD5H 1GGYA 5HYJE 3RWJB 1F3JA 2HVKB 4NRYA 4TUJA 1F6LL 5EO9A 1PYWB 4Z0BH 4XVSH 2BVEA 4LMQE 5ADPH 3TEUA 5T1DL 1YYLH 3IU4H 1IT9H 3BEVA 2WP3T 1O7SA 1MI5E 1Q9KA 4DVRL 2IPTH 3AS2A 4LIQE 1AY1L 2A1WH 3Q1SL 1MVFA 3DNKA 5GSVA 1YEDB 1Z3GL 3B3IA 3RTQB 3UYRH 3PQYE 3AREC 4MZ3A 2OK0L 4JB9H 5EPMB 2AJZB 1GGIL 1Q9OB 4HMCA 4HCRH 2I9LB 4I3GA 3F7VA 3LSOA 1UA6H 4FQJL 1NCAH 5IMKA 3ZDYE 4TSCH 5J6HA 1NCBH 1F4YL 4ZTOL 3Q2CA 5F7UA 4LGRB 2AVGA 3RIAK 1UZ6F 5DGQA 5CBAB 3ZE1E 4B5EA 1RQ5A 1ZS8A 5TE4L 4AL8L 1HXMA 4U6VL 1K4DA 1DL7L 3BEWB 4QXUH 3O2VH 3Q0HA 1BD2D 1WK0A 3QUXC 3ARED 1YMMB 5HGBA 4F57H 3F58L 3U9UA 1YEIL 3MRNA 1NMBH 3T09A 3AB0C 1S7WB 5CILH 4OJFL 5IQ9B 3RBSA 1IGJA 2E7HA 3VXRD 4F7PB 2E9BA 1XCQB 1TJGL 1ZANL 4POUB 3TVMC 4RIRA 1I9IH 2R23A 1QFWL 3CVHL 2DMCA 4FFYH 4LPYA 3L5WB 4MYWB 3SOBL 3T1FB 1RK1A 4MAUH 4Q9RL 7FABH 2VLKB 2NTSP 3TBWB 2OZ4L 1I1YA 4FXLA 1CE6B 1JP5A 4NQCD 2IQAA 3MZTA 3NABH 3QUXD 3I3BA 2NZIA 7CGTA 3NFSH 1URLA 2QKIA 4P2YA 3HAEB 5IT2L 5ICYB 3CMOL 3GSQA 4MA3A 5EA0L 5BMFL 1U8KA 5HHNB 4Q9CA 4HKXB 3A0OA 3GI8H 4RISL 3TVMD 5D7IF 2IFFH 2P24A 2EEAA 5IHZA 3MGTB 3AS1A 1JHTB 1MHHA 2R69L 1WJ3A 3QEQD 4M6NL 4XNYL 4FXKB 3LDBB 5BS0A 4BM7A 1G9NC 3FO1B 4EQ3A 2X1PA 3HCVB 1JTPA 4KVCH 5KS9A 1N3NA 1BQHG 1UC6A 3VH8B 1QBMH 3KJ6H 3SQBA 4NWUL 1IAIL 3WUZA 5HHOA 2QHRH 4M5YL 1DQMH 3A6BH 2GY7B 4EN3C 3BH8A 1ORQA 2CUHA 2AEQL 4OF8A 3B9KB 5J57B 1AJ7L 3QDMB 4EDXB 5CZKA 4PP2B 3GSXA 1NC4B 3EYSL 2HG5A 1KF9B 5GGRB 2Y72A 1S7QA 4PLOB 3BKJL 2JCCE 5F71A 4Y19D 4MJ5A 3UTPD 1YNLH 5IMMA 1I7TB 2YPLA 4YO0A 3S37H 2CIIA 4TPRL 3VU2A 4YXHH 4Y2DB 4EN3D 3V52H 1V3KA 4JDVA 2VXQL 3HZMA 4Z7NF 3VXSA 3MV7D 3VI3F 2GK0A 3MBXL 5JXEA 1Z9OA 4XWOC 1PY9A 3NTCH 3QWQB 2EKJA 2ITDA 3BDYH 2HFGL 4ZS7L 3TYFA 4B41A 1A3RL 5JW4N 5AYUL 3ZKSD 4CW1A 3EYVB 1MIEL 1S78C 3T0BA 5FKPA 5KAQG 2J8UA 5C0AD 3N85H 1A7NL 2XPGA 2M26A 4ZMAT 1ZXQA 1X7QB 5EIIA 2DWDB 5FYLL 5DHXB 5GJSL 2DI9A 4J1UA 4JO1L 3QISA 3C09B 2YD3A 4XWOD 2N4IA 4I1NB 5IWLC 1R5WA 2NY4B 3VWKC 4EDWL 4D9LL 3W2DL 5F97E 3MRLB 4KMTL 2MPAH 4UNTA 5F1IB 2XKNB 1CVSC 3O3AA 4WEBH 1MH5A 3OAUH 5DJAB 5F9AC 2FX9H 4U1GB 4RZCB 1S78D 1BFVL 1HEZA 3OKMA 3W11C 3WCYA 3B9DA 2QADC 1TJIH 1E4JA 1K3ZA 3DIFA 1YYML 5AZ2L 1CR9H 4QRRB 3FCTB 3P30L 3O3EA 5HJ3B 1FLTX 3MRMB 2MKWA 3P0GB 3EO9L 3VWKD 1CGSH 2NXZB 3DUSA 3ARVA 4QHMB 4WUUD 4GT7A 1FAIL 4LCUA 4J23A 2IH3A 5C9JA 2YBRB 1JYWA 1MWAH 4OZGF 4X6EB 5TPWH 3W11D 3DRQB 4PRID 1L0QA 4RNRB 4X5WA 2QADD 4JO4H 4HG4J 1HHHA 5E8PB 5I1KL 1ZLSH 5E6IA 3HA0A 1A02N 4GMTH 5FEBA 1DEEB 4JFOB 5C6WH 2XY2A 3IU3A 3TBSB 3LKQA 4JVPA 5IG7A 1NFIB 4Z77A 5F96L 2P46B 1T7XA 5F7KC 1Q9WA 1R3HA 2E7LC 4R4FL 1JPTH 2FATH 3E6HB 4GRWH 4K3JH 1IBGH 2ADFH 3M17A 4LHUG 1YN6B 1TPXB 1SYVA 4QGTA 4U1IB 1YEJH 1TTUA 5E4IA 5J89A 1EK3A 3WNLA 2XQYK 4HF5H 4Z95L 3VRLF 3ZTNL 4WFEE 1AGBB 1F58H 4M61B 4BKLA 2F58L 5EZLA 5ACZA 5CCKH 2P5ED 3IB4A 4NN7B 5CMAB 1HHKB 4ZAKC 2Q20A 3MLYH 4RCAA 4I2XA 4JCLA 4JQVC 3BOVA 3HPJA 1JZ4A 5GGVH 4IRJA 1A64A 3VGHA 1GVIA 1S9WB 1RZJL 3GRWA 5DEFB 4OQTA 2VQ1A 1XH3B 4DGYH 2J3SA 1FNGB 1IEAA 1VB9A 5CJXC 1X5IA 3QG7L 3LZFH 1V7ML 4N0CC 2P8PB 1C16A 1JRHH 5D2NE 4WIQA 4LDLB 5IROA 4FFZL 5E1AA 4C55A 4HBCL 3O8XD 2DM4A 1UZ8B 4XPBH 1KXTB 3D69B 1CFNA 3N9GL 4HJGB 1XT5A 2H8PA 1P7QD 3P40A 4ZAKD 3KDMB 4ZUTB 1GGBL 2ADIA 4G5ZH 3D39B 3RVVC 4GG8B 4KKLC 3F65A 3W39A 4Z7QE 4LEOB 5LG1A 1UXWB 3EOYG 1IVLA 3HS0A 1FRGH 4P57B 4YH6A 1U91B 4N0CD 4XP5L 3RX5A 4XXDA 5JQ6L 2JB6A 3L9RA 4Z5RB 2CDFA 3D85A 2W0KA 5DRXA 1CYGA 1CFVL 4MQSB 3ULVE 3LQMA 5FUCE 3OAZK 5INCA 2UZYB 3WV0A 3U4EB 1QHOA 3TA3C 2CLRB 2BVPB 1X5YA 4X6CB 3RVVD 1VPOH 4OF3A 2AEPH 4KKLD 4I8DA 5DUPH 3TZVC 3VWJC 4NKOA 3DBXB 4U1LA 5F7DA 5ICXB 2IALA 1MCHA 5IHUH 3BQUB 1JWMA 2ARJQ 4PREA 4GRWF 3RDTB 4OSUH 1CF8L 4OLXL 1YEFH 1EHLH 5DVNA 5HY9A 15C8L 2ZUSA 1G7JA 1CDGA 1YEGL 2NTFA 1JNLH 4FQ1H 1EEZB 4ZYKA 3CX2A 2ZUYA 1KENL 4G9FB 1INQB 4AIOA 3ME0A 4Z7UE 5HGGS 5KSBF 4F8QA 4XGZB 1SEBB 5KVMC 1U58A 3GJFB 5TDOB 3TZVD 5DWUL 3DLQR 3VWJD 5DUML 3MNWB 4WRLA 4H1LG 4MNHA 1NFDE 5DQJA 5EBMB 2ZSVB 1CGUA 3CVIL 2UVFA 3OGOE 1LD9A 1BAFL 3MGAA 4PRHE 2OTWA 5TF0A 1IKFL 5JDSB 1ZLUK 4OQTL 3PG2A 5HYSG 3U82B 3LKSA 2FO4A 4UTAH 1MEXH 5DJXB 5J1SC 1H15A 4OV6F 4OF7A 5DD3L 1T1WA 1HWGB 4WCYH 3IDXL 1IC4L 2VLME 5JLZB 4J4PA 3EAKA 5IB4A 1XF3A 3GUTA 5CJBA 4A6YH 1JYNA 1IEBB 3KPRB 3QCVH 3CFJA 4C56E 3JV6B 2AXFA 1U3HA 4PLKC 3RY6C 4KI5C 2UUDK 2ZNWA 3MRRA 2ZWLT 2HJLA 3WHE1 3X14A 3MRHA 3RRQA 4Y4HC 5DK2B 4U3CA 1UEYA 4WW2C 2MWCA 5HDQL 4A2MA 3GB7A 5HYEA 1MFDH 2DTML 5DJDB 3QIWB 5H2BB 5LBSH 6FABL 4AM0B 1LDSA 4YHMH 3NZHL 4WHYG 5I2IB 4ZFFB 4LCIL 3U1SH 4WFFD 2VITA 2PTVA 3BXNB 3P0VL 4PLKD 3VG9C 4KI5D 5F7NC 2W0FA 1OGAE 1BZ7A 1FN4B 1OT2A 3L5JA 2DLHA 3WFEL 4Y4HD 3BUYA 3UO1L 2XWTA 5C0EA 2ATKA 4JFEE 4LPWA 4RFOH 4XWGH 1XZ0B 5FA3B 5CJQH 5D96C 3ZYIA 2QTEA 5FKAB 3WNMA 3R06A 2YRZA 3STLB 1CQYA 2FJHA 2DQFA 1CD1A 2X1XR 5HVHB 4HLZH 3ROLA 4JFYA 3KYMA 4LCCA 1FE8L 4L8SA 1Z2KA 3MNZA 4FTVA 3VFMA 4MD4A 1X5FA 2ZCHL 3RWGB 5J7CC 2UZXB 1A1OB 3QQ4A 4DKFL 2W65B 5GS2H 1U95A 4ZXBA 4X7EC 1ZT7B 1AGFB 1MWAB 1T4KA 1NSNL 3MRPB 3NCMA 4OZHF 2XWJA 3WXWL 1WEJL 3RWHA 3RL2A 2VABA 4FZEH 2DLGA 4L4VE 3MLUH 3M07A 2VJXA 5IFJB 2R2BA 1J10A 4OCYL 5D2LB 2EDWA 3QDME 1FL6A 3L5XL 2QV2A 2FD6L 2YK1L 3VXUB 3UBXB 4K07A 3QI9B 4K3GA 4P5MA 3S34L 3NCBB 4EVNA 4QNPF 3CFBB 5ESAB 4HQQH 3C60A 1EV2E 4F33B 5B8CC 2D7TH 2I25N 4D9RE 3GIVB 5FGCE 2VDPH 2EO1A 1WAAA 2ICWB 1R3JB 3BI9X 4CVXB 1A5FH 1OP3K 5C92A 3E1F1 3MXVL 5D1XA 2PN5A 2IG2L 1E28A 5HI5C 4LRNH 4FNLL 4DFHA 3VD9A 4RAUA 4HXAL 3GMQB 4BQ9A 3TF7C 4CRPA 2IANE 4F7TB 1J0HA 1D6EA 4QGYA 2BXZA 3V5KA 3NCJL 4PJBF 1F4XL 1P9MA 3MUGB 2GJJA 1VGKB 3BESR 3QRFM 3Q5OA 3D2UB 4NGHH 4PJDA 3IDGA 4LPVA 4IRSC 1CBVH 2WP3O 2JJUA 2L0DA 3LKNA 3KLAB 4G43B 5JOPE 1CDCA 1UACL 3OKLA 4QEGA 4NUGH 2X70B 4K94C 2JB5L 3SCMC 3LPFA 4NO0B 1G9ML 3W82A 2JJWA 1EEQA 1Q72H 1UZ6E 3GSWB 5HI5D 4PJFF 4U7KA 3UTTD 4YHIB 5L8JB 1NDGA 3WEXA 2VDLH 2XI9A 2QHLA 4QRTB 4JN1H 3O3UN 3BRDA 2XA3A 2OTPA 2Q7YB 3RWCB 5TDPB 3DETC 3V9FA 3MROA 1I3GL 4X4ME 5JA8B 1IC7L 4N1EA 1KCVL 2DM3A 4IRSD 1CTNA 4QRRE 5F88A 3T2QA 4LSUH 4EI5A 5ALBL 1FO0A 1MCJA 4U6YB 3GKWL 3GZKA 3SCMD 4Z7WA 2XY1A 1MRDL 4J7RA 4JG1H 4LAQH 2J5LC 1WQVT 3HB3D 2O5YH 1ZHLB 1Y0LA 2WMPA 1I1AC 5T1LD 5TDNB 4JHBA 4WW1B 4PRDB 1W0VA 2Z31C 5IFAH 4X9IA 4NPYA 1OGTB 4FZ8H 3DETD 1LMKA 3U9PH 1AGCA 4P2OB 1KJ3L 1WC7B 1GYAA 3U0WH 2PTUA 1MCSA 3TJEH 4HLJA 4UV4H 4ZDHB 4GAYB 4ZFOA 4W6YB 5I75B 4F9PA 5D7IE 1BPVA 1AQKH 5KANG 1WF5A 4P4KC 5MEPB 1U6AH 4D9QE 3I85A 3QQ3A 1I1AD 3CFKA 4YHPB 2VLRA 3HNVH 4JRXB 5HHXH 3K8MA 2Z31D 3OKYA 1AC0A 5C3TA 1YEEL 2P47B 3G5VA 5CGTA 3PP4L 1BWMA 1KN4H 3TCXA 5TF1L 3ZKXC 2B1AH 5I9QC 1RJZB 3RVXC 2F19L 5E9DB 4UT9H 1XGRA 4P4KD 5IHBA 4YWGH 4ALAH 2LTQB 4NKMA 4Q0XH 1FL3B 3IS1X 1S9YA 1T2JA 3EYUL 2AGJH 3ZKQD 4F9LA 3MR9B 4V1DB 1TZIA 1FVDB 4WTXA 3ELAT 5T33H 4XNXL 2P7TB 3N50A 4NM4L 5E94A 3C9NB 5CEXA 4BYHA 1FJ1A 2AJVH 2MTPA 4P9MH 4HIJB 5E5MA 2H6PB 5A1AA 3RVXD 4PGBA 1QR1A 4Z7NE 4XP1L 1W8NA 2WWKT 1INDL 4J6RL 4OBRA 3VFGL 2ICES 4DZBA 4JKKA 3RWEB 3SGJC 5GS0C 3VMNA 3VI3E 1PZUB 1JUFB 1FO0L 4GH7B 3I02B 1K8DA 2R1YB 2VAJA 1U3YA 2VIRA 5J13B 2NY1C 1PGRB 4PYHA 3I6KB 5F1KC 2HFFB 5TGBA 3BRGC 3ESUF 3FQUA 1A6UL 1LK3L 4M7LH 2E7MA 2XACC 1MCRA 2X4OA 2Y6SC 5C09B 4I0PC 5DDHB 5DQDH 4NN6C 4U31A 4W6XB 2CKBA 3LIZH 3F12A 5JPMB 1A47A 1JGUH 3QJHA 2YMXH 1S5IL 2GEEA 1LE5B 3O6FC 3ZHLA 4R8WL 3P9WB 5GS0D 2NY0C 4X6BA 2QQNL 3KYOB 3IRZA 3OXSA 4OI9A 1UJ3C 3PWVA 3CXHJ 4ZFOL 3WLWC 5E56A 2NY1D 2H32A 3V7MA 1FZKA 5FB8A 1EO8L 5F7EH 4I0PD 4X7TB 4K2UH 1XF1A 2HJKB 2X4UB 4U2YA 2X9YA 4U0RC 3S4SB 1XGPB 5DO2C 3O6FD 4UUJA 2LU3A 1CXIA 2DAVA 3MV8B 5DZOA 3OKDA 4J3UA 2NY0D 3LS4H 3IDYC 1I3RA 3ILPA 1QACA 2W92A 1G9NH 1JWSA 1YC8A 4X5XB 5AEAA 4EI6B 3EBAA 3FOMA 5C9KA 3Q3GA 3WLWD 2A6JB 4F3FB 1R5IB 3GMPB 1S7VB 3B5TA 1TETH 4YC2B 1BFSA 4QRSB 5I19H 5EB9A 3HE6C 1JHKH 4KQ3L 4OZGE 4WUKH 4K71B 1R3IL 4L9LA 4LCWD 3AAZB 3IAQA 4LHUD 3WFBH 2ZCKL 1EHNA 5DO2D 5FHBL 4MB5A 2D0GA 3BX7C 4RX4D 5L0QB 4BZ2H 5E1HB 5SV4A 2BRRH 2VZOA 2IMNA 5I30L 3C2AH 5E03A 3QWRA 3SE9L 1SVCP 4HX1A 5ISZB 3MOBL 3L3JA 4RFNB 4YNYA 3SGEI 3CCHB 5DLMH 3U46A 3HE6D 4IIQC 3VRLE 2OJZH 4LLYB 1G9EA 3CC5B 3IETB 4V2BA 1UT9A 3ZHDA 3RVWC 4OT1L 5E99L 3RWDB 3U2SB 2GSIB 3KPNA 2EH7L 1T7ZA 2R8SH 1HSAA 5DJZA 4IS6A 3VMPA 5IVNA 1AXSB 1UGNA 2CKBL 2NY7H 1JGLH 5DJ2B 3U48A 3P11H 2DIBA 5KVFL 1E4XL 4MQ7A 5L2KD 1ZGLA 2W60B 2XZZA 1PQZA 3ET9F 1I8MB 4HBQA 3RU8H 4R96A 4PBWD 3MV9B 4NDMA 5FIEA 1R3KA 2ADGB 3MYJA 3A6CH 3RVWD 4G7VH 4QF1B 2Q7NA 3HNTH 3GMNB 1WTLA 2DTSA 3RWFB 4M7ZC 5GS1A 1TFHA 3WNNA 4NJAL 5IMLB 1S9VB 2O61B 3TP4A 3OGCB 3GJEB 5EU7E 4XCFH 1EJ6A 2G75B 5KBNC 2H1PH 4U2ZA 3TT1L 4HIIB 4NOBA 5F89A 2J1KA 5DD6A 1BQLL 3EDDA 2CO6B 2EE6A 2ZG3A 1X9QA 4KVNL 4S11A 3RJQB 4PPTA 5I74C 4UMGA 3RIFK 4G8GE 2IF7A 4DN4H 3MCG1 4WY7H 4GW1A 3VXUE 3H9SA 4PRHA 4QRPB 2Y07L 3DVGA 2F5AH 4GRWE 4NQEA 2CK0L 3DGGB 3GSOB 3KG5A 2Y36L 1D9KA 4GXVL 3H42H 3MJ7A 5FCUH 4R7DB 1QFWI 4RQQB 5F3BA 4HG4K 5MEQA 1T83C 1H3TA 5IMOB 5I1DB 3GBNL 4Z78A 2QSCL 2XOTA 4NKIH 2P48B 4C83B 3ARGA 1J0ZA 5DVKA 1I1FB 3DXAD 5E24E 3R1GH 3BFOA 4LGSB 4XCCH 4YHNB 5LGHL 2P44B 4ZUUA 5GPRA 4KUZL 4I18A 4Y4FA 1BD2B 3AREB 3B4NA 1FZOB 4J3VA 5FOBB 4P3WA 4XP6L 5I76A 4NCC1 3RGHA 3QXAB 2O5XL 3VXRB 2F53D 4JY6A 3KLHC 2C26A 3V5HB 3JWOL 5DD1L 5TH2A 2COQA 3RHWK 4AEIH 2DQEH 5DF0A 1V3LA 5GISH 5I16B 4JFQB 3HG1A 4MCZA 4P2RE 3ARPA 3HMWH 3C87A 4CNIA 3V5DA 3U30B 4LPXA 1RU9L 2FHFA 4RFEA 4LBEA 3X13B 1WUNT 1II4E 1OAZL 3TIEB 2W07A 2LVEA 1M05A 3TH4T 4HKJB 3BP6B 3ES6A 3WHE0 4HUXA 2OS7A 5J8OA 3BH9A 2BSSA 3AB0B 5EOCL 3QUMB 4LGPB 3IKCA 3B8YA 3JTSA 4MHHG 4ZSOE 5IW1B 2YA1A 3E3QE 2BRQA 3KLHD 2DQJH 5MERB 1JMZA 2FYYB 3TVMB 1UM6H 2BMKB 2VDRH 5IB3B 3KPTA 3VMOA 1RZGA 1HNGA 1A6ZA 3VJ6A 5LGJB 1G7PB 2C5DC 1IRAY 4M62L 1OPGH 1CDYA 3P73A 5DMIL 1KXQE 2BOBA 1DR9A 4HWZB 5GHWH 2RJMA 4G6FD 5C0GB 5IJKA 2Y9RT 1SBSL 4GMSH 4QXWA 4NBXB 5GGQL 1M1SA 4QXGL 4Y7MA 3GMLB 1AFVH 1BMGA 5B38A 4X7FC 1U36A 5I1GH 3MLSH 3LEYL 2ZKHH 3QDJE 1JPSH 2YD1A 5L6YH 1BF2A 4JRYE 4LNRB 3IDNA 2BJMH 2X1WL 4D0CA 5I1JH 4Y19B 3PWNA 2NX5A 5K9KA 1Y6MR 1PLGH 5KOMC 4HUVB 1NMAL 3ULUH 1OM3H 2XZCL 1JJUA 3OKNA 4EN3B 2R2EA 2QQKL 3LEXA 3C8KB 2FDBP 5FYLD 2Q8BH 3L95A 3FTGB 3L5IA 4OZHE 3Q6GL 4N8CH 3DX6A 5DMKB 2OJEA 2ARJB 3MV7B 2WK2A 4K9EL 4MXWL 4AEHL 3PUCA 5HTSA 5BZWA 4M3JA 5TE7L 4CVWA 1X44A 5HSFA 2P8MB 2X40A 5AWNH 1CE1L 1EVUA 1QKZH 3MRIA 3RUGB 4S2SB 1AR1C 2QLVB 5EOTA 2BCKA 4RMWA 3U0PA 5JR1L 1PKQE 5BS0D 1GGUA 2AKRB 1QR4A 4KY1H 4D8PB 2PO6A 4XAWL 5HHOD 2PW1B 4I48B 3PWPD 3KR3H 1NBVH 3BGAA 1DN2A 1AR1D 2J4WL 5D71H 1MUJA 4QYOA 4DW2L 3ARQA 5HXMA 3VW3L 5CSZA 4H0HB 4K8RH 3I2CH 1BIHA 4G6KL 4Z18A 2UWEF 1IL1B 5HHVL 3FQRA 4PJBE 5J56B 4X99A 5IV2B 3PGFH 4TNVF 2YPLD 1AIFA 1WFNA 25C8L 4I3RH 4V2CB 4GKZA 1RZJC 4JG0L 5MENA 5C7XL 5B39B 4NO2A 4K7PH 1NMCC 3VWKB 3PL6A 5L7XL 4FQXA 1QSEA 4WUUB 3OWEA 5L2JA 1U2CA 4YPGA 5C70A 3VXSD 4YHLH 1R24A 4O51A 1JPGB 3ULUF 3NAAH 2XQBL 4H25A 3KPSA 1QLFA 2FZ3A 12E8H 1RIUH 4KTEH 3BIKA 5E4EC 1S9XA 2CLVA 1A7BA 3IVKB 2A9NL 2WANA 4R4BB 1PW3A 2FECI 5LAXB 2X4SA 3DUUA 4PRBA 5I15H 1HZHL 2AABH 2A74B 2I27N 5HHPB 2VAAB 5CS7A 5IJVA 4NC2B 3QAZC 2CJUH 4R7NB 4I77H 5M7QA 4U7SA 5KANI 4Z9KB 3QJFA 2WBJA 2ZUWA 3GFUA 1ZT4A 5KZCB 3SQOL 5FO8A 4MDJA 4NWTH 4MXVF 1HHGA 4QO1A 1J8HE 1QTYT 4WTWA 1MQ8A 4PG9A 2P5EB 1YN7B 2IQ9L 3IFNL 3JVGA 3DURA 1RJLB 3QNZB 5HHQA 1EH9A 4UTBH 4JKLA 1DEDA 4J3WA 1FZJA 2FX8L 3TWCH 2KDGA 4OLUL 4JPKH 1M6OA 4Y5VB 1V05A 3VXQB 3FQXA 5C0JA 2HTLC 1I8LC 5H94A 1G7HB 1DJSA 2CDGA 1TITA 4QOKE 1CDIA 3O8XB 1F6FB 4LPUA 4QLRA 1FNSH 4U6HB 4LLQA 5BXFA 1JE6A 5ECJE 1P7QB 1RZFL 4HIEB 4UAOB 3MRFB 5IGXL 2ADJA 3V0WL 3HR5A 3HUJF 1UYWL 4HZLA 5FV1L 5J4MA 2Z93B 3ZYJA 5AD0A 3EDJA 2L7UA 2EE9A 3VFRA 1IGFL <