1UZJA

Integrin binding cbegf22-tb4-cbegf33 fragment of human fibrillin-1, holo form.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
162
structure length
162
Chain Sequence
TDVNECLDPTTCISGNCVNTPGSYICDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCEMCPAVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FIBRILLIN-1
publication title Structure of the Integrin Binding Fragment from Fibrillin-1 Gives New Insights Into Microfibril Organization
pubmed doi rcsb
source organism Homo sapiens
molecule tags Matrix protein
total genus 29
structure length 162
sequence length 162
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00683 TB TB domain
A PF07645 EGF_CA Calcium-binding EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1uzjA01
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1uzjA03
3.90.290.10 Alpha Beta Alpha-Beta Complex Extracellular Matrix Fibrillin TGF-beta binding (TB) domain 1uzjA02
2BOXA 2MHPA 1YUKB 2Q1JB 2XC4L 4OTJA 1ADXA 2VWMK 1CX2A 2BOUA 4YT6L 2W2OE 3NJPC 2P16L 4Y71B 2XBWL 4ZAEB 4A7IA 1L5GB 1HX2A 3N8WB 1PGEA 3LTFB 2WFXB 4Y7AB 2Y5GL 1PTHA 4BDWA 2BQ6A 2XBXL 5CKQA 1WU1B 2Y38A 1UZPA 1WHEA 1EZQB 2W2QE 3CS7L 4LMFA 2FZZL 2D1JB 4FM5A 4M10A 1G1TA 2EI8B 5JW1A 2P3FN 2FD6A 4O1ZA 5JVYA 3LIWB 1NFWB 1XFEA 4Y7BB 1HT5A 2P26A 2W86A 4X8SL 4YZUB 3KL6B 1DIYA 2VVCK 2WPME 5CISA 1EGFA 1P9JA 1IVOC 4JZFL 4D90A 1IQKL 4YT7L 2Y5HL 4ZXXL 1Z6EL 3Q7DA 2J38B 2EI7B 3N8XA 1EMOA 2XC5L 1IQJL 1J9CL 3HS7A 4RRYA 3FBYA 3FFGL 4JZEL 2EI6B 2W3KB 2J95B 1G2MB 1Z6CA 2J34B 3POYA 1CQEA 2I9AA 3N8YA 2PUQL 2GD4A 1UZQA 2VWLL 1C5MF 2BMGA 1FAKL 1KLIL 1TOZA 2P28B 2RNLA 2WYGB 2K2SB 4Z6AL 3LN1A 3CA7A 1NZIA 2UWLB 2YGPA 2XC0L 2Y7ZB 2FLGA 1CEJA 3B4VC 4AQTA 1FAXL 5KN5C 1HCGB 4NGAL 3EGFA 5JBBE 2WPKE 1XKBA 1DVAL 2BOKL 3U73A 4Z0LA 2WPJE 4ZHAB 1AUTL 2ADXA 3BT2A 1NQLB 1G1SA 2WG4B 1MQ6L 3DEMA 3HS5A 3V64C 3KCGL 2B7DL 4ZH8B 3TZIA 1MOXC 1XDTR 1I0UA 2KB9A 3K9XA 2WPLE 4RRWA 3KK6A 1P0SL 4BTIA 5IKRA 2J2UB 1DQBA 2J4IB 2UWPB 2VVUL 4O02B 2BOHA 2VVVL 1HZ8A 1LPZA 1Q4GA 1EPJA 2Y81B 1BF9A 4D0FA 3NTBA 1ATBA 1HT8A 4COXA 1NFYB 5JB9E 3GCXE 1IQNL 1EPIA 3BPSE 3TGFA 4BDXA 2Y7XB 2W26B 1G1RA 3RR3A 1IP0A 1EQGA 1EAIC 1JL9A 3OLUA 3M37L 1M1XB 2MGPA 1N1IA 2BZ6L 2FLBL 5FDQA 5K0HB 1PFXL 5KIRA 1SZBA 3CFWA 2YGOA 4RRZA 2P95L 2P94L 4BTUA 3LN0A 4XBMA 1YUFA 1U67A 1FJSL 2W2NE 3SEKC 3N8ZA 1YO8A 2WG3C 4NA9L 1CCVA 5JB8E 2WFTA 5IKVA 1NFXB 3MDLA 3MQEA 2H9EL 2K2TA 2VWNL 1YUGA 3OLTA 2WPHE 3SOBB 3NT1A 5EGMB 1ATDA 1IGXA 5JBCE 1HAEA 3CENL 4X8UL 4MMZB 2BQWA 1WHFA 1KLJL 1KLOA 1KSNB 4OTYA 1KSQA 3TK6B 1FSBA 3R05A 3C9AC 3N8WA 3HH2C 3ELAL 2Y82B 4CUFA 3HS6A 3GCWE 4D0EA 2RHPA 1HREA 1PXXA 1CVUA 4Z0KB 1APOA 4MMXB 5CKMA 1IQFL 3IJEB 5JHWC 1F0RB 1L3YA 2Y5FL 2M74A 3F1SB 4BXWA 2WYJB 1IGZA 5JBAE 1F7MA 3LAQA 1NFUB 2UWOB 4CUDA 3ASIA 2Y80B 5E8DA 2NPRA 1RFNB 4Y76B 2VH0B 4E1GA 1FF7A 3TK5B 2P3UA 2XBVL 1X7AL 1HAFA 1EQHA 4X8TL 2P6AC 3ZYGA 4CUEA 2AYLA 3BT1A 3Q3KB 1DDXA 1IQHL 2W2PE 1V3XB 4NG9L 2VWOL 1KIGL 4M11A 2VJ3A 1EBVA 2OYEP 2P3TA 4RS0A 4JZDL 1EPHA 1COUA 4ISIL 1F0SB 2F9BL 2RA0L 1U8CB 1CVWL 2WPIE 2J94B 3LTGD 3PGHA 3IITB 1IQIL 4TGFA 1APQA 1LPKA 1MQ5L 1IQLL 5IKQA 2OYUP 2P3FL 1LPGA 4C16A 2KV4A 4JYUL 1YGCL 2W2ME 4RRXA 1IOXA 1JBUL 1PRHA 1ATEA 2W3IB 3N8VA 1JV2B 3LC3B 1QFKL 3H5CB 1K36A 3QH0A 3GISX 4RUTA 5I46L 3NTGA 2DDUA 4Y79B 1EMNA 3TBDA 3TH3L 1W7XL 1ATAA 1IQGL 3M36L 4Y6DB 2P93L 2B0UC 4LORA 1F7EA 5COXA 4XL1A 1O5DL 2MGRA 3SW2A 1N7DA 1ZAQA 4G1MB 3V65B 3ZYIB 4PH9A 4ZXYL 3F6UL 5F1AA 5JVZA 5L2ZL 3P5BL 2PHBB 1TPGA 2JKHL 4MMYB 1TLEA 2VH6B 4XLWA 3ZYJB 2FLRL 1CCFA 3U7UG 6COXA 1XKAL 1IOEL 4CSYA 1GK5A 1UZKA 3KQDL 2BQ7A 2TGFA 1K37A 3FCSB 4ISHL 3ENSA 2G00L 1IQML 2KL7A 3KQCL 5CKNA 2PR3B 1DX5I 1UZJA 2I9BA 3KQEL 1NT0A 3LC5B 1APJA 1FFMA 3HO4A 2BO2A 1IJQA 1G2LB 1EPGA 1LMJA 3KRKA 1W8BL 3QCWA 5IKTA 1URKA 3QMOA 5L30L 5F19A 1LQDA 3SOQA 3SOVA 1HRFA 1B9WA 1FE2A 4BXSA 3HO5A 4X8VL 5L2YL 4BTTA 1OB1C 2CJIB 1HJ7A 3HPTA 1A3PA 3N8YB 1IQEL 1G1QA 4JYVL 3KQBL 1NPEB 2XBYL 3HO3A
chains in the Genus database with same CATH superfamily
2BOXA 2MHPA 1YUKB 2Q1JB 2XC4L 4OTJA 1ADXA 2VWMK 1CX2A 2BOUA 4YT6L 2W2OE 3NJPC 2P16L 4Y71B 2XBWL 4ZAEB 4A7IA 1L5GB 1HX2A 3N8WB 1PGEA 3LTFB 2WFXB 4Y7AB 2Y5GL 1PTHA 4BDWA 2BQ6A 2XBXL 5CKQA 1WU1B 2Y38A 1UZPA 1WHEA 1EZQB 2W2QE 3CS7L 4LMFA 2FZZL 2D1JB 4FM5A 4M10A 1G1TA 2EI8B 5JW1A 2P3FN 2FD6A 4O1ZA 5JVYA 3LIWB 1NFWB 1XFEA 4Y7BB 1HT5A 2P26A 2W86A 4X8SL 4YZUB 3KL6B 1DIYA 2VVCK 2WPME 5CISA 1EGFA 1P9JA 1IVOC 4JZFL 4D90A 1IQKL 4YT7L 1QIUA 2Y5HL 4ZXXL 1Z6EL 3Q7DA 4GU4A 2J38B 2EI7B 3N8XA 1EMOA 2XC5L 1IQJL 1J9CL 3HS7A 4RRYA 3FBYA 3FFGL 4JZEL 2EI6B 2W3KB 2J95B 1G2MB 1Z6CA 2J34B 3POYA 1LK9A 1CQEA 2I9AA 3N8YA 2PUQL 2GD4A 1UZQA 2VWLL 1C5MF 2BMGA 1FAKL 1KLIL 1TOZA 2P28B 2RNLA 2WYGB 2K2SB 4Z6AL 3LN1A 3CA7A 1NZIA 2UWLB 2YGPA 2XC0L 2Y7ZB 2FLGA 1CEJA 3B4VC 4AQTA 1FAXL 5KN5C 1HCGB 4NGAL 3EGFA 5JBBE 2WPKE 1XKBA 1DVAL 2BOKL 3U73A 4Z0LA 2WPJE 4ZHAB 1AUTL 2ADXA 3BT2A 1NQLB 1G1SA 2WG4B 1MQ6L 3DEMA 3HS5A 3V64C 3KCGL 2B7DL 4ZH8B 3TZIA 1MOXC 1XDTR 1I0UA 2KB9A 3K9XA 2WPLE 4RRWA 3KK6A 1P0SL 4BTIA 5IKRA 2J2UB 1DQBA 2J4IB 2UWPB 2VVUL 4O02B 2BOHA 2VVVL 1HZ8A 1LPZA 1Q4GA 1EPJA 2Y81B 1BF9A 4D0FA 3NTBA 1ATBA 1HT8A 4COXA 1NFYB 5JB9E 3GCXE 1IQNL 1EPIA 3BPSE 3TGFA 4BDXA 2Y7XB 2W26B 1G1RA 3RR3A 1IP0A 1EQGA 1EAIC 1JL9A 3OLUA 3M37L 1M1XB 1LMMA 2MGPA 1N1IA 2BZ6L 2FLBL 5FDQA 5K0HB 1PFXL 5KIRA 1SZBA 3CFWA 2YGOA 4RRZA 2P95L 2P94L 4BTUA 4A94C 3LN0A 4XBMA 1YUFA 1U67A 1FJSL 2W2NE 3SEKC 1YO8A 3N8ZA 2WG3C 4NA9L 1CCVA 5JB8E 2WFTA 5IKVA 1NFXB 3MDLA 3MQEA 2H9EL 2K2TA 2VWNL 1YUGA 3OLTA 2WPHE 3SOBB 3NT1A 5EGMB 1ATDA 1IGXA 5JBCE 1HAEA 2H9EC 3CENL 2BT8A 4X8UL 4MMZB 2BQWA 1WHFA 1KLJL 1KLOA 1KSNB 4OTYA 1KSQA 3TK6B 1FSBA 3R05A 3C9AC 3N8WA 3HH2C 3ELAL 2Y82B 4CUFA 3HS6A 3GCWE 4D0EA 2RHPA 1HREA 1PXXA 1CVUA 2WZPP 4Z0KB 1APOA 4MMXB 5CKMA 1IQFL 3IJEB 5JHWC 1F0RB 1L3YA 2Y5FL 2M74A 3F1SB 4BXWA 2WYJB 3S6XA 1IGZA 5JBAE 1F7MA 3LAQA 1NFUB 2UWOB 4CUDA 3ASIA 2Y80B 5E8DA 2NPRA 1RFNB 4Y76B 2VH0B 4E1GA 1FF7A 3TK5B 2P3UA 2XBVL 1X7AL 2HORA 1HAFA 1EQHA 4X8TL 2P6AC 3ZYGA 4CUEA 2AYLA 3BT1A 3Q3KB 1DDXA 1IQHL 1KKEA 2W2PE 1V3XB 4NG9L 2VWOL 1KIGL 4M11A 2VJ3A 1EBVA 2OYEP 2P3TA 4RS0A 4JZDL 1EPHA 1V1IA 1COUA 4ISIL 1F0SB 2F9BL 2RA0L 1U8CB 1CVWL 2WPIE 2J94B 3LTGD 3PGHA 3IITB 1IQIL 4TGFA 1APQA 1LPKA 1MQ5L 1IQLL 1V1HA 2OYUP 2P3FL 5IKQA 1LPGA 4C16A 2KV4A 4JYUL 1YGCL 2W2ME 2VRSA 4RRXA 1IOXA 1JBUL 1PRHA 1ATEA 2W3IB 3N8VA 1JV2B 3LC3B 1QFKL 3H5CB 1K36A 3QH0A 3GISX 4RUTA 5I46L 3NTGA 2DDUA 4Y79B 1EMNA 3TBDA 3TH3L 1W7XL 1ATAA 1IQGL 2YGQA 3M36L 4Y6DB 2P93L 2B0UC 4LORA 1F7EA 5COXA 4XL1A 1O5DL 2MGRA 3SW2A 1N7DA 1ZAQA 4G1MB 3V65B 3ZYIB 4PH9A 4ZXYL 2KNIA 3F6UL 5F1AA 5JVZA 5L2ZL 3P5BL 2PHBB 1TPGA 2JKHL 4MMYB 1TLEA 2VH6B 4XLWA 3ZYJB 2FLRL 1CCFA 3U7UG 6COXA 1XKAL 1IOEL 4CSYA 1GK5A 1UZKA 3KQDL 2BQ7A 2TGFA 4GU3A 1K37A 3FCSB 4ISHL 3ENSA 2G00L 1IQML 2KL7A 3KQCL 5CKNA 2PR3B 1DX5I 1UZJA 2I9BA 3KQEL 1NT0A 3LC5B 1APJA 1FFMA 3HO4A 2BO2A 1IJQA 1G2LB 1EPGA 1LMJA 3KRKA 1W8BL 3QCWA 2HOXA 5IKTA 1URKA 3QMOA 5L30L 5F19A 1LQDA 3SOQA 3SOVA 1HRFA 1B9WA 1FE2A 4BXSA 2BT7A 3HO5A 4X8VL 5L2YL 4BTTA 1OB1C 2CJIB 1HJ7A 3HPTA 1A3PA 2BSFA 3N8YB 1IQEL 1G1QA 4JYVL 2JJLA 3KQBL 1NPEB 2XBYL 3HO3A
chains in the Genus database with same CATH topology
2BOXA 2MHPA 1YUKB 2Q1JB 2XC4L 4OTJA 1ADXA 2VWMK 1CX2A 2BOUA 4YT6L 2W2OE 3NJPC 2P16L 4Y71B 2XBWL 4ZAEB 4A7IA 1L5GB 1HX2A 3N8WB 1PGEA 3LTFB 2WFXB 4Y7AB 2Y5GL 1PTHA 4BDWA 2BQ6A 2XBXL 5CKQA 1WU1B 2Y38A 1UZPA 1WHEA 1EZQB 2W2QE 3CS7L 4LMFA 2FZZL 2D1JB 4FM5A 4M10A 1G1TA 2EI8B 5JW1A 2P3FN 2FD6A 4O1ZA 5JVYA 3LIWB 1NFWB 1XFEA 4Y7BB 1HT5A 2P26A 2W86A 4X8SL 4YZUB 3KL6B 1DIYA 2VVCK 2WPME 5CISA 1EGFA 1P9JA 1IVOC 4JZFL 4D90A 1IQKL 4YT7L 2Y5HL 4ZXXL 1Z6EL 3Q7DA 2J38B 2EI7B 3N8XA 1EMOA 2XC5L 1IQJL 1J9CL 3HS7A 4RRYA 3FBYA 3FFGL 4JZEL 2EI6B 2W3KB 2J95B 1G2MB 1Z6CA 2J34B 3POYA 1CQEA 2I9AA 3N8YA 2PUQL 2GD4A 1UZQA 2VWLL 1C5MF 2BMGA 1FAKL 1KLIL 1TOZA 2P28B 2RNLA 2WYGB 2K2SB 4Z6AL 3LN1A 3CA7A 1NZIA 2UWLB 2YGPA 2XC0L 2Y7ZB 2FLGA 1CEJA 3B4VC 4AQTA 1FAXL 5KN5C 1HCGB 4NGAL 3EGFA 5JBBE 2WPKE 1XKBA 1DVAL 2BOKL 3U73A 4Z0LA 2WPJE 4ZHAB 1AUTL 2ADXA 3BT2A 1NQLB 1G1SA 2WG4B 1MQ6L 3DEMA 3HS5A 3V64C 3KCGL 2B7DL 4ZH8B 3TZIA 1MOXC 1XDTR 1I0UA 2KB9A 3K9XA 2WPLE 4RRWA 3KK6A 1P0SL 4BTIA 5IKRA 2J2UB 1DQBA 2J4IB 2UWPB 2VVUL 4O02B 2BOHA 2VVVL 1HZ8A 1LPZA 1Q4GA 1EPJA 2Y81B 1BF9A 4D0FA 3NTBA 1ATBA 1HT8A 4COXA 1NFYB 5JB9E 3GCXE 1IQNL 1EPIA 3BPSE 3TGFA 4BDXA 2Y7XB 2W26B 1G1RA 3RR3A 1IP0A 1EQGA 1EAIC 1JL9A 3OLUA 3M37L 1M1XB 1LMMA 2MGPA 1N1IA 2BZ6L 2FLBL 5FDQA 5K0HB 1PFXL 5KIRA 1SZBA 3CFWA 2YGOA 4RRZA 2P95L 2P94L 4BTUA 4A94C 3LN0A 4XBMA 1YUFA 1U67A 1FJSL 2W2NE 3SEKC 3N8ZA 1YO8A 2WG3C 4NA9L 1CCVA 5JB8E 2WFTA 5IKVA 1NFXB 3MDLA 3MQEA 2H9EL 2K2TA 2VWNL 1YUGA 3OLTA 2WPHE 3SOBB 3NT1A 5EGMB 1ATDA 1IGXA 5JBCE 1HAEA 2H9EC 3CENL 4X8UL 4MMZB 2BQWA 1WHFA 1KLJL 1KLOA 1KSNB 4OTYA 1KSQA 3TK6B 1FSBA 3R05A 3C9AC 3N8WA 3HH2C 3ELAL 2Y82B 4CUFA 3HS6A 3GCWE 4D0EA 2RHPA 1HREA 1PXXA 1CVUA 2WZPP 4Z0KB 1APOA 4MMXB 5CKMA 1IQFL 3IJEB 5JHWC 1F0RB 1L3YA 2Y5FL 2M74A 3F1SB 4BXWA 2WYJB 3S6XA 1IGZA 5JBAE 1F7MA 3LAQA 1NFUB 2UWOB 4CUDA 3ASIA 2Y80B 5E8DA 2NPRA 1RFNB 4Y76B 2VH0B 4E1GA 1FF7A 3TK5B 2P3UA 2XBVL 1X7AL 1HAFA 1EQHA 4X8TL 2P6AC 3ZYGA 4CUEA 2AYLA 3BT1A 3Q3KB 1DDXA 1IQHL 2W2PE 1V3XB 4NG9L 2VWOL 1KIGL 4M11A 2VJ3A 1EBVA 2OYEP 2P3TA 4RS0A 4JZDL 1EPHA 1COUA 4ISIL 1F0SB 2F9BL 2RA0L 1U8CB 1CVWL 2WPIE 2J94B 3LTGD 3PGHA 3IITB 1IQIL 4TGFA 1APQA 1LPKA 1MQ5L 1IQLL 5IKQA 2OYUP 2P3FL 1LPGA 4C16A 2KV4A 4JYUL 1YGCL 2W2ME 4RRXA 1IOXA 1JBUL 1PRHA 1ATEA 2W3IB 3N8VA 1JV2B 3LC3B 1QFKL 3H5CB 1K36A 3QH0A 3GISX 4RUTA 5I46L 3NTGA 2DDUA 4Y79B 1EMNA 3TBDA 3TH3L 1W7XL 1ATAA 1IQGL 2YGQA 3M36L 4Y6DB 2P93L 2B0UC 4LORA 1F7EA 5COXA 4XL1A 1O5DL 2MGRA 3SW2A 1N7DA 1ZAQA 4G1MB 3V65B 3ZYIB 4PH9A 4ZXYL 2KNIA 3F6UL 5F1AA 5JVZA 5L2ZL 3P5BL 2PHBB 1TPGA 2JKHL 4MMYB 1TLEA 2VH6B 4XLWA 3ZYJB 2FLRL 1CCFA 3U7UG 6COXA 1XKAL 1IOEL 4CSYA 1GK5A 1UZKA 3KQDL 2BQ7A 2TGFA 1K37A 3FCSB 4ISHL 3ENSA 2G00L 1IQML 2KL7A 3KQCL 5CKNA 2PR3B 1DX5I 1UZJA 2I9BA 3KQEL 1NT0A 3LC5B 1APJA 1FFMA 3HO4A 2BO2A 1IJQA 1G2LB 1EPGA 1LMJA 3KRKA 1W8BL 3QCWA 5IKTA 1URKA 3QMOA 5L30L 5F19A 1LQDA 3SOQA 3SOVA 1HRFA 1B9WA 1FE2A 4BXSA 3HO5A 4X8VL 5L2YL 4BTTA 1OB1C 2CJIB 1HJ7A 3HPTA 1A3PA 3N8YB 1IQEL 1G1QA 4JYVL 3KQBL 1NPEB 2XBYL 3HO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BOX A;  2MHP A;  1YUK B;  2Q1J B;  2XC4 L;  4OTJ A;  1ADX A;  2VWM K;  1CX2 A;  2BOU A;  4YT6 L;  2W2O E;  3NJP C;  2P16 L;  4Y71 B;  2XBW L;  4ZAE B;  4A7I A;  1L5G B;  1HX2 A;  3N8W B;  1PGE A;  3LTF B;  2WFX B;  4Y7A B;  2Y5G L;  1PTH A;  4BDW A;  2BQ6 A;  2XBX L;  5CKQ A;  1WU1 B;  2Y38 A;  1UZP A;  1WHE A;  1EZQ B;  2W2Q E;  3CS7 L;  4LMF A;  2FZZ L;  2D1J B;  4FM5 A;  4M10 A;  1G1T A;  2EI8 B;  5JW1 A;  2P3F N;  2FD6 A;  4O1Z A;  5JVY A;  3LIW B;  1NFW B;  1XFE A;  4Y7B B;  1HT5 A;  2P26 A;  2W86 A;  4X8S L;  4YZU B;  3KL6 B;  1DIY A;  2VVC K;  2WPM E;  5CIS A;  1EGF A;  1P9J A;  1IVO C;  4JZF L;  4D90 A;  1IQK L;  4YT7 L;  2Y5H L;  4ZXX L;  1Z6E L;  3Q7D A;  2J38 B;  2EI7 B;  3N8X A;  1EMO A;  2XC5 L;  1IQJ L;  1J9C L;  3HS7 A;  4RRY A;  3FBY A;  3FFG L;  4JZE L;  2EI6 B;  2W3K B;  2J95 B;  1G2M B;  1Z6C A;  2J34 B;  3POY A;  1CQE A;  2I9A A;  3N8Y A;  2PUQ L;  2GD4 A;  1UZQ A;  2VWL L;  1C5M F;  2BMG A;  1FAK L;  1KLI L;  1TOZ A;  2P28 B;  2RNL A;  2WYG B;  2K2S B;  4Z6A L;  3LN1 A;  3CA7 A;  1NZI A;  2UWL B;  2YGP A;  2XC0 L;  2Y7Z B;  2FLG A;  1CEJ A;  3B4V C;  4AQT A;  1FAX L;  5KN5 C;  1HCG B;  4NGA L;  3EGF A;  5JBB E;  2WPK E;  1XKB A;  1DVA L;  2BOK L;  3U73 A;  4Z0L A;  2WPJ E;  4ZHA B;  1AUT L;  2ADX A;  3BT2 A;  1NQL B;  1G1S A;  2WG4 B;  1MQ6 L;  3DEM A;  3HS5 A;  3V64 C;  3KCG L;  2B7D L;  4ZH8 B;  3TZI A;  1MOX C;  1XDT R;  1I0U A;  2KB9 A;  3K9X A;  2WPL E;  4RRW A;  3KK6 A;  1P0S L;  4BTI A;  5IKR A;  2J2U B;  1DQB A;  2J4I B;  2UWP B;  2VVU L;  4O02 B;  2BOH A;  2VVV L;  1HZ8 A;  1LPZ A;  1Q4G A;  1EPJ A;  2Y81 B;  1BF9 A;  4D0F A;  3NTB A;  1ATB A;  1HT8 A;  4COX A;  1NFY B;  5JB9 E;  3GCX E;  1IQN L;  1EPI A;  3BPS E;  3TGF A;  4BDX A;  2Y7X B;  2W26 B;  1G1R A;  3RR3 A;  1IP0 A;  1EQG A;  1EAI C;  1JL9 A;  3OLU A;  3M37 L;  1M1X B;  2MGP A;  1N1I A;  2BZ6 L;  2FLB L;  5FDQ A;  5K0H B;  1PFX L;  5KIR A;  1SZB A;  3CFW A;  2YGO A;  4RRZ A;  2P95 L;  2P94 L;  4BTU A;  3LN0 A;  4XBM A;  1YUF A;  1U67 A;  1FJS L;  2W2N E;  3SEK C;  3N8Z A;  1YO8 A;  2WG3 C;  4NA9 L;  1CCV A;  5JB8 E;  2WFT A;  5IKV A;  1NFX B;  3MDL A;  3MQE A;  2H9E L;  2K2T A;  2VWN L;  1YUG A;  3OLT A;  2WPH E;  3SOB B;  3NT1 A;  5EGM B;  1ATD A;  1IGX A;  5JBC E;  1HAE A;  3CEN L;  4X8U L;  4MMZ B;  2BQW A;  1WHF A;  1KLJ L;  1KLO A;  1KSN B;  4OTY A;  1KSQ A;  3TK6 B;  1FSB A;  3R05 A;  3C9A C;  3N8W A;  3HH2 C;  3ELA L;  2Y82 B;  4CUF A;  3HS6 A;  3GCW E;  4D0E A;  2RHP A;  1HRE A;  1PXX A;  1CVU A;  4Z0K B;  1APO A;  4MMX B;  5CKM A;  1IQF L;  3IJE B;  5JHW C;  1F0R B;  1L3Y A;  2Y5F L;  2M74 A;  3F1S B;  4BXW A;  2WYJ B;  1IGZ A;  5JBA E;  1F7M A;  3LAQ A;  1NFU B;  2UWO B;  4CUD A;  3ASI A;  2Y80 B;  5E8D A;  2NPR A;  1RFN B;  4Y76 B;  2VH0 B;  4E1G A;  1FF7 A;  3TK5 B;  2P3U A;  2XBV L;  1X7A L;  1HAF A;  1EQH A;  4X8T L;  2P6A C;  3ZYG A;  4CUE A;  2AYL A;  3BT1 A;  3Q3K B;  1DDX A;  1IQH L;  2W2P E;  1V3X B;  4NG9 L;  2VWO L;  1KIG L;  4M11 A;  2VJ3 A;  1EBV A;  2OYE P;  2P3T A;  4RS0 A;  4JZD L;  1EPH A;  1COU A;  4ISI L;  1F0S B;  2F9B L;  2RA0 L;  1U8C B;  1CVW L;  2WPI E;  2J94 B;  3LTG D;  3PGH A;  3IIT B;  1IQI L;  4TGF A;  1APQ A;  1LPK A;  1MQ5 L;  1IQL L;  5IKQ A;  2OYU P;  2P3F L;  1LPG A;  4C16 A;  2KV4 A;  4JYU L;  1YGC L;  2W2M E;  4RRX A;  1IOX A;  1JBU L;  1PRH A;  1ATE A;  2W3I B;  3N8V A;  1JV2 B;  3LC3 B;  1QFK L;  3H5C B;  1K36 A;  3QH0 A;  3GIS X;  4RUT A;  5I46 L;  3NTG A;  2DDU A;  4Y79 B;  1EMN A;  3TBD A;  3TH3 L;  1W7X L;  1ATA A;  1IQG L;  3M36 L;  4Y6D B;  2P93 L;  2B0U C;  4LOR A;  1F7E A;  5COX A;  4XL1 A;  1O5D L;  2MGR A;  3SW2 A;  1N7D A;  1ZAQ A;  4G1M B;  3V65 B;  3ZYI B;  4PH9 A;  4ZXY L;  3F6U L;  5F1A A;  5JVZ A;  5L2Z L;  3P5B L;  2PHB B;  1TPG A;  2JKH L;  4MMY B;  1TLE A;  2VH6 B;  4XLW A;  3ZYJ B;  2FLR L;  1CCF A;  3U7U G;  6COX A;  1XKA L;  1IOE L;  4CSY A;  1GK5 A;  1UZK A;  3KQD L;  2BQ7 A;  2TGF A;  1K37 A;  3FCS B;  4ISH L;  3ENS A;  2G00 L;  1IQM L;  2KL7 A;  3KQC L;  5CKN A;  2PR3 B;  1DX5 I;  1UZJ A;  2I9B A;  3KQE L;  1NT0 A;  3LC5 B;  1APJ A;  1FFM A;  3HO4 A;  2BO2 A;  1IJQ A;  1G2L B;  1EPG A;  1LMJ A;  3KRK A;  1W8B L;  3QCW A;  5IKT A;  1URK A;  3QMO A;  5L30 L;  5F19 A;  1LQD A;  3SOQ A;  3SOV A;  1HRF A;  1B9W A;  1FE2 A;  4BXS A;  3HO5 A;  4X8V L;  5L2Y L;  4BTT A;  1OB1 C;  2CJI B;  1HJ7 A;  3HPT A;  1A3P A;  3N8Y B;  1IQE L;  1G1Q A;  4JYV L;  3KQB L;  1NPE B;  2XBY L;  3HO3 A; 
#chains in the Genus database with same CATH topology
 2BOX A;  2MHP A;  1YUK B;  2Q1J B;  2XC4 L;  4OTJ A;  1ADX A;  2VWM K;  1CX2 A;  2BOU A;  4YT6 L;  2W2O E;  3NJP C;  2P16 L;  4Y71 B;  2XBW L;  4ZAE B;  4A7I A;  1L5G B;  1HX2 A;  3N8W B;  1PGE A;  3LTF B;  2WFX B;  4Y7A B;  2Y5G L;  1PTH A;  4BDW A;  2BQ6 A;  2XBX L;  5CKQ A;  1WU1 B;  2Y38 A;  1UZP A;  1WHE A;  1EZQ B;  2W2Q E;  3CS7 L;  4LMF A;  2FZZ L;  2D1J B;  4FM5 A;  4M10 A;  1G1T A;  2EI8 B;  5JW1 A;  2P3F N;  2FD6 A;  4O1Z A;  5JVY A;  3LIW B;  1NFW B;  1XFE A;  4Y7B B;  1HT5 A;  2P26 A;  2W86 A;  4X8S L;  4YZU B;  3KL6 B;  1DIY A;  2VVC K;  2WPM E;  5CIS A;  1EGF A;  1P9J A;  1IVO C;  4JZF L;  4D90 A;  1IQK L;  4YT7 L;  1QIU A;  2Y5H L;  4ZXX L;  1Z6E L;  3Q7D A;  4GU4 A;  2J38 B;  2EI7 B;  3N8X A;  1EMO A;  2XC5 L;  1IQJ L;  1J9C L;  3HS7 A;  4RRY A;  3FBY A;  3FFG L;  4JZE L;  2EI6 B;  2W3K B;  2J95 B;  1G2M B;  1Z6C A;  2J34 B;  3POY A;  1LK9 A;  1CQE A;  2I9A A;  3N8Y A;  2PUQ L;  2GD4 A;  1UZQ A;  2VWL L;  1C5M F;  2BMG A;  1FAK L;  1KLI L;  1TOZ A;  2P28 B;  2RNL A;  2WYG B;  2K2S B;  4Z6A L;  3LN1 A;  3CA7 A;  1NZI A;  2UWL B;  2YGP A;  2XC0 L;  2Y7Z B;  2FLG A;  1CEJ A;  3B4V C;  4AQT A;  1FAX L;  5KN5 C;  1HCG B;  4NGA L;  3EGF A;  5JBB E;  2WPK E;  1XKB A;  1DVA L;  2BOK L;  3U73 A;  4Z0L A;  2WPJ E;  4ZHA B;  1AUT L;  2ADX A;  3BT2 A;  1NQL B;  1G1S A;  2WG4 B;  1MQ6 L;  3DEM A;  3HS5 A;  3V64 C;  3KCG L;  2B7D L;  4ZH8 B;  3TZI A;  1MOX C;  1XDT R;  1I0U A;  2KB9 A;  3K9X A;  2WPL E;  4RRW A;  3KK6 A;  1P0S L;  4BTI A;  5IKR A;  2J2U B;  1DQB A;  2J4I B;  2UWP B;  2VVU L;  4O02 B;  2BOH A;  2VVV L;  1HZ8 A;  1LPZ A;  1Q4G A;  1EPJ A;  2Y81 B;  1BF9 A;  4D0F A;  3NTB A;  1ATB A;  1HT8 A;  4COX A;  1NFY B;  5JB9 E;  3GCX E;  1IQN L;  1EPI A;  3BPS E;  3TGF A;  4BDX A;  2Y7X B;  2W26 B;  1G1R A;  3RR3 A;  1IP0 A;  1EQG A;  1EAI C;  1JL9 A;  3OLU A;  3M37 L;  1M1X B;  1LMM A;  2MGP A;  1N1I A;  2BZ6 L;  2FLB L;  5FDQ A;  5K0H B;  1PFX L;  5KIR A;  1SZB A;  3CFW A;  2YGO A;  4RRZ A;  2P95 L;  2P94 L;  4BTU A;  4A94 C;  3LN0 A;  4XBM A;  1YUF A;  1U67 A;  1FJS L;  2W2N E;  3SEK C;  1YO8 A;  3N8Z A;  2WG3 C;  4NA9 L;  1CCV A;  5JB8 E;  2WFT A;  5IKV A;  1NFX B;  3MDL A;  3MQE A;  2H9E L;  2K2T A;  2VWN L;  1YUG A;  3OLT A;  2WPH E;  3SOB B;  3NT1 A;  5EGM B;  1ATD A;  1IGX A;  5JBC E;  1HAE A;  2H9E C;  3CEN L;  2BT8 A;  4X8U L;  4MMZ B;  2BQW A;  1WHF A;  1KLJ L;  1KLO A;  1KSN B;  4OTY A;  1KSQ A;  3TK6 B;  1FSB A;  3R05 A;  3C9A C;  3N8W A;  3HH2 C;  3ELA L;  2Y82 B;  4CUF A;  3HS6 A;  3GCW E;  4D0E A;  2RHP A;  1HRE A;  1PXX A;  1CVU A;  2WZP P;  4Z0K B;  1APO A;  4MMX B;  5CKM A;  1IQF L;  3IJE B;  5JHW C;  1F0R B;  1L3Y A;  2Y5F L;  2M74 A;  3F1S B;  4BXW A;  2WYJ B;  3S6X A;  1IGZ A;  5JBA E;  1F7M A;  3LAQ A;  1NFU B;  2UWO B;  4CUD A;  3ASI A;  2Y80 B;  5E8D A;  2NPR A;  1RFN B;  4Y76 B;  2VH0 B;  4E1G A;  1FF7 A;  3TK5 B;  2P3U A;  2XBV L;  1X7A L;  2HOR A;  1HAF A;  1EQH A;  4X8T L;  2P6A C;  3ZYG A;  4CUE A;  2AYL A;  3BT1 A;  3Q3K B;  1DDX A;  1IQH L;  1KKE A;  2W2P E;  1V3X B;  4NG9 L;  2VWO L;  1KIG L;  4M11 A;  2VJ3 A;  1EBV A;  2OYE P;  2P3T A;  4RS0 A;  4JZD L;  1EPH A;  1V1I A;  1COU A;  4ISI L;  1F0S B;  2F9B L;  2RA0 L;  1U8C B;  1CVW L;  2WPI E;  2J94 B;  3LTG D;  3PGH A;  3IIT B;  1IQI L;  4TGF A;  1APQ A;  1LPK A;  1MQ5 L;  1IQL L;  1V1H A;  2OYU P;  2P3F L;  5IKQ A;  1LPG A;  4C16 A;  2KV4 A;  4JYU L;  1YGC L;  2W2M E;  2VRS A;  4RRX A;  1IOX A;  1JBU L;  1PRH A;  1ATE A;  2W3I B;  3N8V A;  1JV2 B;  3LC3 B;  1QFK L;  3H5C B;  1K36 A;  3QH0 A;  3GIS X;  4RUT A;  5I46 L;  3NTG A;  2DDU A;  4Y79 B;  1EMN A;  3TBD A;  3TH3 L;  1W7X L;  1ATA A;  1IQG L;  2YGQ A;  3M36 L;  4Y6D B;  2P93 L;  2B0U C;  4LOR A;  1F7E A;  5COX A;  4XL1 A;  1O5D L;  2MGR A;  3SW2 A;  1N7D A;  1ZAQ A;  4G1M B;  3V65 B;  3ZYI B;  4PH9 A;  4ZXY L;  2KNI A;  3F6U L;  5F1A A;  5JVZ A;  5L2Z L;  3P5B L;  2PHB B;  1TPG A;  2JKH L;  4MMY B;  1TLE A;  2VH6 B;  4XLW A;  3ZYJ B;  2FLR L;  1CCF A;  3U7U G;  6COX A;  1XKA L;  1IOE L;  4CSY A;  1GK5 A;  1UZK A;  3KQD L;  2BQ7 A;  2TGF A;  4GU3 A;  1K37 A;  3FCS B;  4ISH L;  3ENS A;  2G00 L;  1IQM L;  2KL7 A;  3KQC L;  5CKN A;  2PR3 B;  1DX5 I;  1UZJ A;  2I9B A;  3KQE L;  1NT0 A;  3LC5 B;  1APJ A;  1FFM A;  3HO4 A;  2BO2 A;  1IJQ A;  1G2L B;  1EPG A;  1LMJ A;  3KRK A;  1W8B L;  3QCW A;  2HOX A;  5IKT A;  1URK A;  3QMO A;  5L30 L;  5F19 A;  1LQD A;  3SOQ A;  3SOV A;  1HRF A;  1B9W A;  1FE2 A;  4BXS A;  2BT7 A;  3HO5 A;  4X8V L;  5L2Y L;  4BTT A;  1OB1 C;  2CJI B;  1HJ7 A;  3HPT A;  1A3P A;  2BSF A;  3N8Y B;  1IQE L;  1G1Q A;  4JYV L;  2JJL A;  3KQB L;  1NPE B;  2XBY L;  3HO3 A; 
#chains in the Genus database with same CATH homology
 2BOX A;  2MHP A;  1YUK B;  2Q1J B;  2XC4 L;  4OTJ A;  1ADX A;  2VWM K;  1CX2 A;  2BOU A;  4YT6 L;  2W2O E;  3NJP C;  2P16 L;  4Y71 B;  2XBW L;  4ZAE B;  4A7I A;  1L5G B;  1HX2 A;  3N8W B;  1PGE A;  3LTF B;  2WFX B;  4Y7A B;  2Y5G L;  1PTH A;  4BDW A;  2BQ6 A;  2XBX L;  5CKQ A;  1WU1 B;  2Y38 A;  1UZP A;  1WHE A;  1EZQ B;  2W2Q E;  3CS7 L;  4LMF A;  2FZZ L;  2D1J B;  4FM5 A;  4M10 A;  1G1T A;  2EI8 B;  5JW1 A;  2P3F N;  2FD6 A;  4O1Z A;  5JVY A;  3LIW B;  1NFW B;  1XFE A;  4Y7B B;  1HT5 A;  2P26 A;  2W86 A;  4X8S L;  4YZU B;  3KL6 B;  1DIY A;  2VVC K;  2WPM E;  5CIS A;  1EGF A;  1P9J A;  1IVO C;  4JZF L;  4D90 A;  1IQK L;  4YT7 L;  2Y5H L;  4ZXX L;  1Z6E L;  3Q7D A;  2J38 B;  2EI7 B;  3N8X A;  1EMO A;  2XC5 L;  1IQJ L;  1J9C L;  3HS7 A;  4RRY A;  3FBY A;  3FFG L;  4JZE L;  2EI6 B;  2W3K B;  2J95 B;  1G2M B;  1Z6C A;  2J34 B;  3POY A;  1CQE A;  2I9A A;  3N8Y A;  2PUQ L;  2GD4 A;  1UZQ A;  2VWL L;  1C5M F;  2BMG A;  1FAK L;  1KLI L;  1TOZ A;  2P28 B;  2RNL A;  2WYG B;  2K2S B;  4Z6A L;  3LN1 A;  3CA7 A;  1NZI A;  2UWL B;  2YGP A;  2XC0 L;  2Y7Z B;  2FLG A;  1CEJ A;  3B4V C;  4AQT A;  1FAX L;  5KN5 C;  1HCG B;  4NGA L;  3EGF A;  5JBB E;  2WPK E;  1XKB A;  1DVA L;  2BOK L;  3U73 A;  4Z0L A;  2WPJ E;  4ZHA B;  1AUT L;  2ADX A;  3BT2 A;  1NQL B;  1G1S A;  2WG4 B;  1MQ6 L;  3DEM A;  3HS5 A;  3V64 C;  3KCG L;  2B7D L;  4ZH8 B;  3TZI A;  1MOX C;  1XDT R;  1I0U A;  2KB9 A;  3K9X A;  2WPL E;  4RRW A;  3KK6 A;  1P0S L;  4BTI A;  5IKR A;  2J2U B;  1DQB A;  2J4I B;  2UWP B;  2VVU L;  4O02 B;  2BOH A;  2VVV L;  1HZ8 A;  1LPZ A;  1Q4G A;  1EPJ A;  2Y81 B;  1BF9 A;  4D0F A;  3NTB A;  1ATB A;  1HT8 A;  4COX A;  1NFY B;  5JB9 E;  3GCX E;  1IQN L;  1EPI A;  3BPS E;  3TGF A;  4BDX A;  2Y7X B;  2W26 B;  1G1R A;  3RR3 A;  1IP0 A;  1EQG A;  1EAI C;  1JL9 A;  3OLU A;  3M37 L;  1M1X B;  1LMM A;  2MGP A;  1N1I A;  2BZ6 L;  2FLB L;  5FDQ A;  5K0H B;  1PFX L;  5KIR A;  1SZB A;  3CFW A;  2YGO A;  4RRZ A;  2P95 L;  2P94 L;  4BTU A;  4A94 C;  3LN0 A;  4XBM A;  1YUF A;  1U67 A;  1FJS L;  2W2N E;  3SEK C;  3N8Z A;  1YO8 A;  2WG3 C;  4NA9 L;  1CCV A;  5JB8 E;  2WFT A;  5IKV A;  1NFX B;  3MDL A;  3MQE A;  2H9E L;  2K2T A;  2VWN L;  1YUG A;  3OLT A;  2WPH E;  3SOB B;  3NT1 A;  5EGM B;  1ATD A;  1IGX A;  5JBC E;  1HAE A;  2H9E C;  3CEN L;  4X8U L;  4MMZ B;  2BQW A;  1WHF A;  1KLJ L;  1KLO A;  1KSN B;  4OTY A;  1KSQ A;  3TK6 B;  1FSB A;  3R05 A;  3C9A C;  3N8W A;  3HH2 C;  3ELA L;  2Y82 B;  4CUF A;  3HS6 A;  3GCW E;  4D0E A;  2RHP A;  1HRE A;  1PXX A;  1CVU A;  2WZP P;  4Z0K B;  1APO A;  4MMX B;  5CKM A;  1IQF L;  3IJE B;  5JHW C;  1F0R B;  1L3Y A;  2Y5F L;  2M74 A;  3F1S B;  4BXW A;  2WYJ B;  3S6X A;  1IGZ A;  5JBA E;  1F7M A;  3LAQ A;  1NFU B;  2UWO B;  4CUD A;  3ASI A;  2Y80 B;  5E8D A;  2NPR A;  1RFN B;  4Y76 B;  2VH0 B;  4E1G A;  1FF7 A;  3TK5 B;  2P3U A;  2XBV L;  1X7A L;  1HAF A;  1EQH A;  4X8T L;  2P6A C;  3ZYG A;  4CUE A;  2AYL A;  3BT1 A;  3Q3K B;  1DDX A;  1IQH L;  2W2P E;  1V3X B;  4NG9 L;  2VWO L;  1KIG L;  4M11 A;  2VJ3 A;  1EBV A;  2OYE P;  2P3T A;  4RS0 A;  4JZD L;  1EPH A;  1COU A;  4ISI L;  1F0S B;  2F9B L;  2RA0 L;  1U8C B;  1CVW L;  2WPI E;  2J94 B;  3LTG D;  3PGH A;  3IIT B;  1IQI L;  4TGF A;  1APQ A;  1LPK A;  1MQ5 L;  1IQL L;  5IKQ A;  2OYU P;  2P3F L;  1LPG A;  4C16 A;  2KV4 A;  4JYU L;  1YGC L;  2W2M E;  4RRX A;  1IOX A;  1JBU L;  1PRH A;  1ATE A;  2W3I B;  3N8V A;  1JV2 B;  3LC3 B;  1QFK L;  3H5C B;  1K36 A;  3QH0 A;  3GIS X;  4RUT A;  5I46 L;  3NTG A;  2DDU A;  4Y79 B;  1EMN A;  3TBD A;  3TH3 L;  1W7X L;  1ATA A;  1IQG L;  2YGQ A;  3M36 L;  4Y6D B;  2P93 L;  2B0U C;  4LOR A;  1F7E A;  5COX A;  4XL1 A;  1O5D L;  2MGR A;  3SW2 A;  1N7D A;  1ZAQ A;  4G1M B;  3V65 B;  3ZYI B;  4PH9 A;  4ZXY L;  2KNI A;  3F6U L;  5F1A A;  5JVZ A;  5L2Z L;  3P5B L;  2PHB B;  1TPG A;  2JKH L;  4MMY B;  1TLE A;  2VH6 B;  4XLW A;  3ZYJ B;  2FLR L;  1CCF A;  3U7U G;  6COX A;  1XKA L;  1IOE L;  4CSY A;  1GK5 A;  1UZK A;  3KQD L;  2BQ7 A;  2TGF A;  1K37 A;  3FCS B;  4ISH L;  3ENS A;  2G00 L;  1IQM L;  2KL7 A;  3KQC L;  5CKN A;  2PR3 B;  1DX5 I;  1UZJ A;  2I9B A;  3KQE L;  1NT0 A;  3LC5 B;  1APJ A;  1FFM A;  3HO4 A;  2BO2 A;  1IJQ A;  1G2L B;  1EPG A;  1LMJ A;  3KRK A;  1W8B L;  3QCW A;  5IKT A;  1URK A;  3QMO A;  5L30 L;  5F19 A;  1LQD A;  3SOQ A;  3SOV A;  1HRF A;  1B9W A;  1FE2 A;  4BXS A;  3HO5 A;  4X8V L;  5L2Y L;  4BTT A;  1OB1 C;  2CJI B;  1HJ7 A;  3HPT A;  1A3P A;  3N8Y B;  1IQE L;  1G1Q A;  4JYV L;  3KQB L;  1NPE B;  2XBY L;  3HO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...