1UZJA

Integrin binding cbegf22-tb4-cbegf33 fragment of human fibrillin-1, holo form.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
162
structure length
162
Chain Sequence
TDVNECLDPTTCISGNCVNTPGSYICDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCEMCPAVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Integrin Binding Fragment from Fibrillin-1 Gives New Insights Into Microfibril Organization
pubmed doi rcsb
source organism Homo sapiens
molecule tags Matrix protein
molecule keywords FIBRILLIN-1
total genus 29
structure length 162
sequence length 162
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00683 TB TB domain
A PF07645 EGF_CA Calcium-binding EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1uzjA01
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1uzjA03
3.90.290.10 Alpha Beta Alpha-Beta Complex Extracellular Matrix Fibrillin TGF-beta binding (TB) domain 1uzjA02
1Q4GA 4E1GA 3H5CB 1YUGA 1NT0A 3F6UL 5KIRA 4RRZA 3GCWE 2YGPA 2Y5FL 3TBDA 2BOUA 1N1IA 5L2ZL 2XC5L 2RHPA 1LMJA 4ZXXL 4C16A 3KQCL 2FZZL 1ATEA 2BQ6A 4Z0KB 3KCGL 2G00L 2WG3C 1PGEA 2VVVL 4XL1A 3LN1A 5FDQA 4Y7AB 4TGFA 2VVCK 1FAXL 4MMZB 1WHEA 1DX5I 1XKAL 1Z6EL 4Y76B 1XKBA 1HX2A 2FD6A 2P3UA 4AQTA 1SZBA 4BDWA 3NJPC 4O02B 1CCFA 2VH0B 1P9JA 3LTFB 4Y79B 3QMOA 3ASIA 2K2TA 1EBVA 3CA7A 5JVZA 2BOHA 2P16L 4RS0A 4ISHL 2P3FL 4M10A 2BZ6L 1CQEA 2MGRA 1KSNB 3KQBL 2Q1JB 3QCWA 4BXSA 1P0SL 1CEJA 1YGCL 1NZIA 3HS5A 5CKQA 4CUDA 1EMNA 1NFWB 1IVOC 1U67A 4RRYA 4Y6DB 2MHPA 1LPGA 3OLTA 2DDUA 3LIWB 4Z6AL 2Y38A 2VWMK 4BDXA 1EGFA 2BO2A 3ENSA 2I9AA 3MDLA 1IOEL 1TOZA 2Y7ZB 1TLEA 3HS7A 3KQEL 3IITB 2CJIB 4D90A 5IKRA 2RNLA 2I9BA 2VVUL 4CUFA 1G1SA 2P94L 2AYLA 3EGFA 4YT6L 4MMYB 4NGAL 4CSYA 1YUFA 2VJ3A 3HO3A 1HAEA 2KB9A 3LC3B 1MQ6L 1U8CB 3NTBA 4MMXB 1UZKA 4X8SL 2JKHL 4RRWA 1EZQB 4JZDL 3CS7L 1CVWL 5IKTA 4ZAEB 1IQHL 1IGZA 3M37L 4A7IA 2Y5GL 3SOQA 1WU1B 1EQHA 2FLBL 2P28B 2XC4L 3OLUA 5IKVA 3F1SB 3N8XA 2W3IB 1IQIL 1FAKL 2UWPB 5CKMA 1HJ7A 2MGPA 1MQ5L 1KIGL 5F19A 1IQNL 3IJEB 2KL7A 3LC5B 1EPHA 4X8UL 5I46L 3FFGL 1HREA 3M36L 2M74A 2W2QE 2UWOB 4OTYA 1IOXA 1F7EA 2EI6B 2GD4A 1JV2B 1CCVA 4PH9A 5F1AA 1F0SB 3BT1A 1COUA 1XFEA 2WPLE 4XBMA 3HO5A 1APOA 2BMGA 1HCGB 2WPJE 1IQML 3ZYJB 2FLGA 5JHWC 5COXA 3KL6B 1ADXA 1XDTR 5JBBE 2PR3B 2B7DL 1HT5A 1G2MB 3ELAL 2H9EL 4ZH8B 3DEMA 1DIYA 3KQDL 5JW1A 2P93L 1IQJL 1OB1C 3FCSB 1FJSL 1KLOA 2W2OE 4JYUL 4BTTA 2P3TA 2B0UC 1IQEL 1IP0A 4YT7L 2BOXA 1I0UA 1UZQA 3N8WA 2BQ7A 2J95B 3N8YA 5L2YL 1KSQA 1O5DL 2XBYL 3TK6B 2PHBB 3GCXE 1KLJL 3HO4A 3P5BL 2F9BL 4NA9L 1EMOA 1F0RB 2Y81B 3U7UG 2Y5HL 1IJQA 1CVUA 2XBVL 2WPHE 3CENL 4RUTA 2VWNL 2WG4B 3TH3L 4RRXA 5CKNA 2J34B 1C5MF 1APJA 5JBAE 2WPME 3CFWA 2TGFA 1PFXL 2K2SB 1M1XB 1GK5A 1LPZA 1AUTL 3BPSE 1JBUL 3HPTA 5IKQA 2NPRA 2J4IB 2Y82B 2W2NE 4XLWA 1IQGL 1YO8A 1G2LB 3MQEA 3SOBB 3NTGA 3FBYA 4BTUA 1G1TA 4ZXYL 1FFMA 4D0FA 1ATBA 3ZYGA 4JZFL 4BXWA 1PRHA 5JB8E 2WFXB 2WPIE 4Y71B 3PGHA 3V64C 1ATDA 5JBCE 3GISX 5JVYA 3N8WB 1BF9A 2RA0L 1RFNB 3KRKA 1EPIA 1DVAL 5K0HB 4Z0LA 1LPKA 1URKA 2J38B 2KV4A 1FSBA 4FM5A 3N8ZA 3SEKC 3LAQA 2WYGB 2W86A 2P26A 2W2ME 3ZYIB 4JZEL 4NG9L 3TK5B 1HAFA 3KK6A 2VWOL 4O1ZA 2XC0L 1UZPA 2BOKL 1QFKL 2PUQL 1L5GB 3HS6A 2OYEP 1MOXC 1N7DA 2WYJB 3NT1A 5CISA 2YGOA 2EI7B 3LN0A 1KLIL 3K9XA 3SW2A 1EPGA 2J2UB 3U73A 4M11A 4D0EA 1NFXB 3TGFA 6COXA 1HRFA 2D1JB 2BQWA 1PTHA 1F7MA 5L30L 1EPJA 1G1RA 5JB9E 1FE2A 3POYA 1WHFA 1YUKB 1EAIC 3RR3A 2P3FN 1NPEB 4Y7BB 1APQA 1K36A 1IQFL 1IQLL 1DDXA 2FLRL 3Q7DA 4OTJA 2VWLL 2Y80B 3C9AC 4JYVL 1A3PA 5KN5C 4G1MB 3N8VA 3LTGD 1X7AL 1ZAQA 1LQDA 1IQKL 1G1QA 1W7XL 4ISIL 5E8DA 3HH2C 4LMFA 3TZIA 2WFTA 1NFYB 4X8TL 1Z6CA 2EI8B 2J94B 3V65B 1HZ8A 1J9CL 3R05A 3Q3KB 4X8VL 1JL9A 2WPKE 1TPGA 1IGXA 4BTIA 1NQLB 2W3KB 2VH6B 1EQGA 2Y7XB 3B4VC 3BT2A 1UZJA 2XBXL 2W2PE 2P95L 2ADXA 1CX2A 2OYUP 4ZHAB 1NFUB 3N8YB 2P6AC 2W26B 1HT8A 5EGMB 1W8BL 3QH0A 1PXXA 3SOVA 1V3XB 4COXA 4YZUB 1DQBA 1ATAA 2UWLB 4LORA 1B9WA 1K37A 4CUEA 2XBWL 1FF7A 1L3YA
chains in the Genus database with same CATH superfamily
1Q4GA 4E1GA 3H5CB 1YUGA 1LMMA 1NT0A 3F6UL 5KIRA 4RRZA 3GCWE 2YGPA 2Y5FL 3TBDA 2BOUA 1N1IA 5L2ZL 2XC5L 2RHPA 1LMJA 4ZXXL 4C16A 3KQCL 2FZZL 1ATEA 2BQ6A 4Z0KB 3KCGL 2G00L 2WG3C 1PGEA 2VVVL 4XL1A 3LN1A 5FDQA 4Y7AB 4TGFA 2VVCK 1FAXL 4MMZB 1WHEA 1DX5I 1XKAL 1Z6EL 4Y76B 1XKBA 4A94C 1HX2A 2FD6A 2P3UA 4AQTA 1SZBA 2WZPP 4BDWA 2HOXA 3NJPC 4O02B 1CCFA 2VH0B 1P9JA 3LTFB 4Y79B 3QMOA 3ASIA 2K2TA 1EBVA 3CA7A 5JVZA 2BOHA 2P16L 4RS0A 4ISHL 2P3FL 4M10A 2BZ6L 1CQEA 2MGRA 1KSNB 3KQBL 2Q1JB 3QCWA 4BXSA 1P0SL 1CEJA 1YGCL 1NZIA 3HS5A 4GU4A 5CKQA 4CUDA 1EMNA 1NFWB 1IVOC 1U67A 4RRYA 4Y6DB 2MHPA 1LPGA 3OLTA 2DDUA 3LIWB 4Z6AL 2Y38A 2VWMK 4BDXA 1EGFA 2BO2A 3ENSA 2I9AA 3MDLA 1IOEL 1TOZA 2Y7ZB 1TLEA 3HS7A 3KQEL 3IITB 2CJIB 4D90A 5IKRA 2RNLA 2I9BA 2VVUL 4CUFA 1G1SA 2BT8A 2P94L 2AYLA 3EGFA 4YT6L 4MMYB 4NGAL 4CSYA 1LK9A 1YUFA 2VJ3A 3HO3A 1HAEA 2KB9A 3LC3B 1MQ6L 1U8CB 3NTBA 4MMXB 1UZKA 4X8SL 2JKHL 4RRWA 1EZQB 4JZDL 2H9EC 3CS7L 1CVWL 5IKTA 4ZAEB 1IQHL 1IGZA 3M37L 4A7IA 2Y5GL 3SOQA 1WU1B 1EQHA 2FLBL 2P28B 2XC4L 3OLUA 5IKVA 3F1SB 3N8XA 2W3IB 1IQIL 2BSFA 1FAKL 2UWPB 5CKMA 1HJ7A 2MGPA 1MQ5L 1KIGL 5F19A 1IQNL 3IJEB 2KL7A 3LC5B 1EPHA 4X8UL 5I46L 3FFGL 1HREA 2VRSA 3M36L 2M74A 2W2QE 2UWOB 4OTYA 1IOXA 1F7EA 2EI6B 2GD4A 1JV2B 1CCVA 4PH9A 5F1AA 2HORA 1F0SB 3BT1A 1COUA 1XFEA 2WPLE 4XBMA 3HO5A 1APOA 2BMGA 1HCGB 2WPJE 1IQML 3ZYJB 2FLGA 5JHWC 5COXA 3KL6B 1ADXA 1XDTR 5JBBE 2PR3B 2B7DL 1HT5A 1G2MB 3ELAL 2H9EL 4ZH8B 3DEMA 1DIYA 2JJLA 3KQDL 5JW1A 2P93L 1IQJL 1OB1C 3FCSB 1FJSL 1KLOA 2W2OE 4JYUL 4BTTA 2P3TA 2B0UC 1IQEL 1IP0A 4YT7L 1V1IA 2BOXA 1I0UA 1UZQA 3N8WA 2BQ7A 2J95B 3N8YA 5L2YL 1KSQA 1O5DL 2XBYL 3TK6B 2PHBB 3GCXE 1KLJL 3HO4A 3P5BL 2F9BL 4NA9L 1EMOA 1F0RB 2Y81B 3U7UG 2Y5HL 1IJQA 1CVUA 2XBVL 2WPHE 3CENL 4RUTA 2VWNL 2WG4B 3TH3L 4RRXA 5CKNA 2J34B 1C5MF 1APJA 5JBAE 2WPME 3CFWA 2TGFA 1PFXL 2K2SB 2YGQA 1M1XB 1GK5A 1LPZA 1AUTL 3BPSE 1JBUL 3HPTA 5IKQA 2NPRA 2J4IB 2Y82B 2W2NE 4XLWA 1IQGL 1YO8A 1G2LB 3MQEA 3SOBB 3NTGA 3FBYA 4BTUA 1G1TA 4ZXYL 1FFMA 4D0FA 1ATBA 3ZYGA 4JZFL 4BXWA 1PRHA 5JB8E 2WFXB 2WPIE 4Y71B 3PGHA 3V64C 1ATDA 5JBCE 3GISX 5JVYA 3N8WB 1BF9A 1V1HA 2RA0L 1RFNB 3KRKA 1EPIA 1DVAL 5K0HB 4Z0LA 1LPKA 1URKA 2J38B 2KV4A 1FSBA 4FM5A 3N8ZA 3SEKC 3LAQA 2WYGB 2W86A 2P26A 2W2ME 3ZYIB 4JZEL 4NG9L 3TK5B 1HAFA 3KK6A 2VWOL 4O1ZA 1QIUA 2XC0L 1UZPA 2BOKL 1QFKL 2PUQL 1L5GB 3HS6A 2OYEP 1MOXC 1N7DA 2WYJB 3NT1A 5CISA 2YGOA 2EI7B 3LN0A 1KLIL 3K9XA 3SW2A 1EPGA 2J2UB 3U73A 4M11A 4D0EA 1NFXB 3TGFA 6COXA 1HRFA 2D1JB 2BQWA 1PTHA 1F7MA 5L30L 1EPJA 1G1RA 5JB9E 4GU3A 1FE2A 3POYA 1KKEA 1WHFA 1YUKB 1EAIC 3RR3A 2P3FN 1NPEB 4Y7BB 1APQA 1K36A 1IQFL 1IQLL 1DDXA 2FLRL 3Q7DA 4OTJA 2VWLL 2Y80B 3C9AC 4JYVL 1A3PA 5KN5C 4G1MB 3N8VA 3LTGD 1X7AL 1ZAQA 1LQDA 1IQKL 1G1QA 1W7XL 4ISIL 5E8DA 3HH2C 4LMFA 3TZIA 2WFTA 1NFYB 4X8TL 1Z6CA 2EI8B 2J94B 3V65B 1HZ8A 1J9CL 3R05A 3Q3KB 4X8VL 1JL9A 2WPKE 1TPGA 1IGXA 4BTIA 1NQLB 2W3KB 2VH6B 1EQGA 2Y7XB 3B4VC 3BT2A 1UZJA 2XBXL 2W2PE 2P95L 2ADXA 1CX2A 2BT7A 2OYUP 4ZHAB 1NFUB 3S6XA 3N8YB 2P6AC 2W26B 1HT8A 5EGMB 2KNIA 1W8BL 3QH0A 1PXXA 3SOVA 1V3XB 4COXA 4YZUB 1DQBA 1ATAA 2UWLB 4LORA 1B9WA 1K37A 4CUEA 2XBWL 1FF7A 1L3YA
chains in the Genus database with same CATH topology
1Q4GA 4E1GA 3H5CB 1YUGA 1LMMA 1NT0A 3F6UL 5KIRA 4RRZA 3GCWE 2YGPA 2Y5FL 3TBDA 2BOUA 1N1IA 5L2ZL 2XC5L 2RHPA 1LMJA 4ZXXL 4C16A 3KQCL 2FZZL 1ATEA 2BQ6A 4Z0KB 3KCGL 2G00L 2WG3C 1PGEA 2VVVL 4XL1A 3LN1A 5FDQA 4Y7AB 4TGFA 2VVCK 1FAXL 4MMZB 1WHEA 1DX5I 1XKAL 1Z6EL 4Y76B 1XKBA 4A94C 1HX2A 2FD6A 2P3UA 4AQTA 1SZBA 2WZPP 4BDWA 3NJPC 4O02B 1CCFA 2VH0B 1P9JA 3LTFB 4Y79B 3QMOA 3ASIA 2K2TA 1EBVA 3CA7A 5JVZA 2BOHA 2P16L 4RS0A 4ISHL 2P3FL 4M10A 2BZ6L 1CQEA 2MGRA 1KSNB 3KQBL 2Q1JB 3QCWA 4BXSA 1P0SL 1CEJA 1YGCL 1NZIA 3HS5A 5CKQA 4CUDA 1EMNA 1NFWB 1IVOC 1U67A 4RRYA 4Y6DB 2MHPA 1LPGA 3OLTA 2DDUA 3LIWB 4Z6AL 2Y38A 2VWMK 4BDXA 1EGFA 2BO2A 3ENSA 2I9AA 3MDLA 1IOEL 1TOZA 2Y7ZB 1TLEA 3HS7A 3KQEL 3IITB 2CJIB 4D90A 5IKRA 2RNLA 2I9BA 2VVUL 4CUFA 1G1SA 2P94L 2AYLA 3EGFA 4YT6L 4MMYB 4NGAL 4CSYA 1YUFA 2VJ3A 3HO3A 1HAEA 2KB9A 3LC3B 1MQ6L 1U8CB 3NTBA 4MMXB 1UZKA 4X8SL 2JKHL 4RRWA 1EZQB 4JZDL 2H9EC 3CS7L 1CVWL 5IKTA 4ZAEB 1IQHL 1IGZA 3M37L 4A7IA 2Y5GL 3SOQA 1WU1B 1EQHA 2FLBL 2P28B 2XC4L 3OLUA 5IKVA 3F1SB 3N8XA 2W3IB 1IQIL 1FAKL 2UWPB 5CKMA 1HJ7A 2MGPA 1MQ5L 1KIGL 5F19A 1IQNL 3IJEB 2KL7A 3LC5B 1EPHA 4X8UL 5I46L 3FFGL 1HREA 3M36L 2M74A 2W2QE 2UWOB 4OTYA 1IOXA 1F7EA 2EI6B 2GD4A 1JV2B 1CCVA 4PH9A 5F1AA 1F0SB 3BT1A 1COUA 1XFEA 2WPLE 4XBMA 3HO5A 1APOA 2BMGA 1HCGB 2WPJE 1IQML 3ZYJB 2FLGA 5JHWC 5COXA 3KL6B 1ADXA 1XDTR 5JBBE 2PR3B 2B7DL 1HT5A 1G2MB 3ELAL 2H9EL 4ZH8B 3DEMA 1DIYA 3KQDL 5JW1A 2P93L 1IQJL 1OB1C 3FCSB 1FJSL 1KLOA 2W2OE 4JYUL 4BTTA 2P3TA 2B0UC 1IQEL 1IP0A 4YT7L 2BOXA 1I0UA 1UZQA 3N8WA 2BQ7A 2J95B 3N8YA 5L2YL 1KSQA 1O5DL 2XBYL 3TK6B 2PHBB 3GCXE 1KLJL 3HO4A 3P5BL 2F9BL 4NA9L 1EMOA 1F0RB 2Y81B 3U7UG 2Y5HL 1IJQA 1CVUA 2XBVL 2WPHE 3CENL 4RUTA 2VWNL 2WG4B 3TH3L 4RRXA 5CKNA 2J34B 1C5MF 1APJA 5JBAE 2WPME 3CFWA 2TGFA 1PFXL 2K2SB 2YGQA 1M1XB 1GK5A 1LPZA 1AUTL 3BPSE 1JBUL 3HPTA 5IKQA 2NPRA 2J4IB 2Y82B 2W2NE 4XLWA 1IQGL 1YO8A 1G2LB 3MQEA 3SOBB 3NTGA 3FBYA 4BTUA 1G1TA 4ZXYL 1FFMA 4D0FA 1ATBA 3ZYGA 4JZFL 4BXWA 1PRHA 5JB8E 2WFXB 2WPIE 4Y71B 3PGHA 3V64C 1ATDA 5JBCE 3GISX 5JVYA 3N8WB 1BF9A 2RA0L 1RFNB 3KRKA 1EPIA 1DVAL 5K0HB 4Z0LA 1LPKA 1URKA 2J38B 2KV4A 1FSBA 4FM5A 3N8ZA 3SEKC 3LAQA 2WYGB 2W86A 2P26A 2W2ME 3ZYIB 4JZEL 4NG9L 3TK5B 1HAFA 3KK6A 2VWOL 4O1ZA 2XC0L 1UZPA 2BOKL 1QFKL 2PUQL 1L5GB 3HS6A 2OYEP 1MOXC 1N7DA 2WYJB 3NT1A 5CISA 2YGOA 2EI7B 3LN0A 1KLIL 3K9XA 3SW2A 1EPGA 2J2UB 3U73A 4M11A 4D0EA 1NFXB 3TGFA 6COXA 1HRFA 2D1JB 2BQWA 1PTHA 1F7MA 5L30L 1EPJA 1G1RA 5JB9E 1FE2A 3POYA 1WHFA 1YUKB 1EAIC 3RR3A 2P3FN 1NPEB 4Y7BB 1APQA 1K36A 1IQFL 1IQLL 1DDXA 2FLRL 3Q7DA 4OTJA 2VWLL 2Y80B 3C9AC 4JYVL 1A3PA 5KN5C 4G1MB 3N8VA 3LTGD 1X7AL 1ZAQA 1LQDA 1IQKL 1G1QA 1W7XL 4ISIL 5E8DA 3HH2C 4LMFA 3TZIA 2WFTA 1NFYB 4X8TL 1Z6CA 2EI8B 2J94B 3V65B 1HZ8A 1J9CL 3R05A 3Q3KB 4X8VL 1JL9A 2WPKE 1TPGA 1IGXA 4BTIA 1NQLB 2W3KB 2VH6B 1EQGA 2Y7XB 3B4VC 3BT2A 1UZJA 2XBXL 2W2PE 2P95L 2ADXA 1CX2A 2OYUP 4ZHAB 1NFUB 3S6XA 3N8YB 2P6AC 2W26B 1HT8A 5EGMB 2KNIA 1W8BL 3QH0A 1PXXA 3SOVA 1V3XB 4COXA 4YZUB 1DQBA 1ATAA 2UWLB 4LORA 1B9WA 1K37A 4CUEA 2XBWL 1FF7A 1L3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q4G A;  4E1G A;  3H5C B;  1YUG A;  1NT0 A;  3F6U L;  5KIR A;  4RRZ A;  3GCW E;  2YGP A;  2Y5F L;  3TBD A;  2BOU A;  1N1I A;  5L2Z L;  2XC5 L;  2RHP A;  1LMJ A;  4ZXX L;  4C16 A;  3KQC L;  2FZZ L;  1ATE A;  2BQ6 A;  4Z0K B;  3KCG L;  2G00 L;  2WG3 C;  1PGE A;  2VVV L;  4XL1 A;  3LN1 A;  5FDQ A;  4Y7A B;  4TGF A;  2VVC K;  1FAX L;  4MMZ B;  1WHE A;  1DX5 I;  1XKA L;  1Z6E L;  4Y76 B;  1XKB A;  1HX2 A;  2FD6 A;  2P3U A;  4AQT A;  1SZB A;  4BDW A;  3NJP C;  4O02 B;  1CCF A;  2VH0 B;  1P9J A;  3LTF B;  4Y79 B;  3QMO A;  3ASI A;  2K2T A;  1EBV A;  3CA7 A;  5JVZ A;  2BOH A;  2P16 L;  4RS0 A;  4ISH L;  2P3F L;  4M10 A;  2BZ6 L;  1CQE A;  2MGR A;  1KSN B;  3KQB L;  2Q1J B;  3QCW A;  4BXS A;  1P0S L;  1CEJ A;  1YGC L;  1NZI A;  3HS5 A;  5CKQ A;  4CUD A;  1EMN A;  1NFW B;  1IVO C;  1U67 A;  4RRY A;  4Y6D B;  2MHP A;  1LPG A;  3OLT A;  2DDU A;  3LIW B;  4Z6A L;  2Y38 A;  2VWM K;  4BDX A;  1EGF A;  2BO2 A;  3ENS A;  2I9A A;  3MDL A;  1IOE L;  1TOZ A;  2Y7Z B;  1TLE A;  3HS7 A;  3KQE L;  3IIT B;  2CJI B;  4D90 A;  5IKR A;  2RNL A;  2I9B A;  2VVU L;  4CUF A;  1G1S A;  2P94 L;  2AYL A;  3EGF A;  4YT6 L;  4MMY B;  4NGA L;  4CSY A;  1YUF A;  2VJ3 A;  3HO3 A;  1HAE A;  2KB9 A;  3LC3 B;  1MQ6 L;  1U8C B;  3NTB A;  4MMX B;  1UZK A;  4X8S L;  2JKH L;  4RRW A;  1EZQ B;  4JZD L;  3CS7 L;  1CVW L;  5IKT A;  4ZAE B;  1IQH L;  1IGZ A;  3M37 L;  4A7I A;  2Y5G L;  3SOQ A;  1WU1 B;  1EQH A;  2FLB L;  2P28 B;  2XC4 L;  3OLU A;  5IKV A;  3F1S B;  3N8X A;  2W3I B;  1IQI L;  1FAK L;  2UWP B;  5CKM A;  1HJ7 A;  2MGP A;  1MQ5 L;  1KIG L;  5F19 A;  1IQN L;  3IJE B;  2KL7 A;  3LC5 B;  1EPH A;  4X8U L;  5I46 L;  3FFG L;  1HRE A;  3M36 L;  2M74 A;  2W2Q E;  2UWO B;  4OTY A;  1IOX A;  1F7E A;  2EI6 B;  2GD4 A;  1JV2 B;  1CCV A;  4PH9 A;  5F1A A;  1F0S B;  3BT1 A;  1COU A;  1XFE A;  2WPL E;  4XBM A;  3HO5 A;  1APO A;  2BMG A;  1HCG B;  2WPJ E;  1IQM L;  3ZYJ B;  2FLG A;  5JHW C;  5COX A;  3KL6 B;  1ADX A;  1XDT R;  5JBB E;  2PR3 B;  2B7D L;  1HT5 A;  1G2M B;  3ELA L;  2H9E L;  4ZH8 B;  3DEM A;  1DIY A;  3KQD L;  5JW1 A;  2P93 L;  1IQJ L;  1OB1 C;  3FCS B;  1FJS L;  1KLO A;  2W2O E;  4JYU L;  4BTT A;  2P3T A;  2B0U C;  1IQE L;  1IP0 A;  4YT7 L;  2BOX A;  1I0U A;  1UZQ A;  3N8W A;  2BQ7 A;  2J95 B;  3N8Y A;  5L2Y L;  1KSQ A;  1O5D L;  2XBY L;  3TK6 B;  2PHB B;  3GCX E;  1KLJ L;  3HO4 A;  3P5B L;  2F9B L;  4NA9 L;  1EMO A;  1F0R B;  2Y81 B;  3U7U G;  2Y5H L;  1IJQ A;  1CVU A;  2XBV L;  2WPH E;  3CEN L;  4RUT A;  2VWN L;  2WG4 B;  3TH3 L;  4RRX A;  5CKN A;  2J34 B;  1C5M F;  1APJ A;  5JBA E;  2WPM E;  3CFW A;  2TGF A;  1PFX L;  2K2S B;  1M1X B;  1GK5 A;  1LPZ A;  1AUT L;  3BPS E;  1JBU L;  3HPT A;  5IKQ A;  2NPR A;  2J4I B;  2Y82 B;  2W2N E;  4XLW A;  1IQG L;  1YO8 A;  1G2L B;  3MQE A;  3SOB B;  3NTG A;  3FBY A;  4BTU A;  1G1T A;  4ZXY L;  1FFM A;  4D0F A;  1ATB A;  3ZYG A;  4JZF L;  4BXW A;  1PRH A;  5JB8 E;  2WFX B;  2WPI E;  4Y71 B;  3PGH A;  3V64 C;  1ATD A;  5JBC E;  3GIS X;  5JVY A;  3N8W B;  1BF9 A;  2RA0 L;  1RFN B;  3KRK A;  1EPI A;  1DVA L;  5K0H B;  4Z0L A;  1LPK A;  1URK A;  2J38 B;  2KV4 A;  1FSB A;  4FM5 A;  3N8Z A;  3SEK C;  3LAQ A;  2WYG B;  2W86 A;  2P26 A;  2W2M E;  3ZYI B;  4JZE L;  4NG9 L;  3TK5 B;  1HAF A;  3KK6 A;  2VWO L;  4O1Z A;  2XC0 L;  1UZP A;  2BOK L;  1QFK L;  2PUQ L;  1L5G B;  3HS6 A;  2OYE P;  1MOX C;  1N7D A;  2WYJ B;  3NT1 A;  5CIS A;  2YGO A;  2EI7 B;  3LN0 A;  1KLI L;  3K9X A;  3SW2 A;  1EPG A;  2J2U B;  3U73 A;  4M11 A;  4D0E A;  1NFX B;  3TGF A;  6COX A;  1HRF A;  2D1J B;  2BQW A;  1PTH A;  1F7M A;  5L30 L;  1EPJ A;  1G1R A;  5JB9 E;  1FE2 A;  3POY A;  1WHF A;  1YUK B;  1EAI C;  3RR3 A;  2P3F N;  1NPE B;  4Y7B B;  1APQ A;  1K36 A;  1IQF L;  1IQL L;  1DDX A;  2FLR L;  3Q7D A;  4OTJ A;  2VWL L;  2Y80 B;  3C9A C;  4JYV L;  1A3P A;  5KN5 C;  4G1M B;  3N8V A;  3LTG D;  1X7A L;  1ZAQ A;  1LQD A;  1IQK L;  1G1Q A;  1W7X L;  4ISI L;  5E8D A;  3HH2 C;  4LMF A;  3TZI A;  2WFT A;  1NFY B;  4X8T L;  1Z6C A;  2EI8 B;  2J94 B;  3V65 B;  1HZ8 A;  1J9C L;  3R05 A;  3Q3K B;  4X8V L;  1JL9 A;  2WPK E;  1TPG A;  1IGX A;  4BTI A;  1NQL B;  2W3K B;  2VH6 B;  1EQG A;  2Y7X B;  3B4V C;  3BT2 A;  1UZJ A;  2XBX L;  2W2P E;  2P95 L;  2ADX A;  1CX2 A;  2OYU P;  4ZHA B;  1NFU B;  3N8Y B;  2P6A C;  2W26 B;  1HT8 A;  5EGM B;  1W8B L;  3QH0 A;  1PXX A;  3SOV A;  1V3X B;  4COX A;  4YZU B;  1DQB A;  1ATA A;  2UWL B;  4LOR A;  1B9W A;  1K37 A;  4CUE A;  2XBW L;  1FF7 A;  1L3Y A; 
#chains in the Genus database with same CATH topology
 1Q4G A;  4E1G A;  3H5C B;  1YUG A;  1LMM A;  1NT0 A;  3F6U L;  5KIR A;  4RRZ A;  3GCW E;  2YGP A;  2Y5F L;  3TBD A;  2BOU A;  1N1I A;  5L2Z L;  2XC5 L;  2RHP A;  1LMJ A;  4ZXX L;  4C16 A;  3KQC L;  2FZZ L;  1ATE A;  2BQ6 A;  4Z0K B;  3KCG L;  2G00 L;  2WG3 C;  1PGE A;  2VVV L;  4XL1 A;  3LN1 A;  5FDQ A;  4Y7A B;  4TGF A;  2VVC K;  1FAX L;  4MMZ B;  1WHE A;  1DX5 I;  1XKA L;  1Z6E L;  4Y76 B;  1XKB A;  4A94 C;  1HX2 A;  2FD6 A;  2P3U A;  4AQT A;  1SZB A;  2WZP P;  4BDW A;  2HOX A;  3NJP C;  4O02 B;  1CCF A;  2VH0 B;  1P9J A;  3LTF B;  4Y79 B;  3QMO A;  3ASI A;  2K2T A;  1EBV A;  3CA7 A;  5JVZ A;  2BOH A;  2P16 L;  4RS0 A;  4ISH L;  2P3F L;  4M10 A;  2BZ6 L;  1CQE A;  2MGR A;  1KSN B;  3KQB L;  2Q1J B;  3QCW A;  4BXS A;  1P0S L;  1CEJ A;  1YGC L;  1NZI A;  3HS5 A;  4GU4 A;  5CKQ A;  4CUD A;  1EMN A;  1NFW B;  1IVO C;  1U67 A;  4RRY A;  4Y6D B;  2MHP A;  1LPG A;  3OLT A;  2DDU A;  3LIW B;  4Z6A L;  2Y38 A;  2VWM K;  4BDX A;  1EGF A;  2BO2 A;  3ENS A;  2I9A A;  3MDL A;  1IOE L;  1TOZ A;  2Y7Z B;  1TLE A;  3HS7 A;  3KQE L;  3IIT B;  2CJI B;  4D90 A;  5IKR A;  2RNL A;  2I9B A;  2VVU L;  4CUF A;  1G1S A;  2BT8 A;  2P94 L;  2AYL A;  3EGF A;  4YT6 L;  4MMY B;  4NGA L;  4CSY A;  1LK9 A;  1YUF A;  2VJ3 A;  3HO3 A;  1HAE A;  2KB9 A;  3LC3 B;  1MQ6 L;  1U8C B;  3NTB A;  4MMX B;  1UZK A;  4X8S L;  2JKH L;  4RRW A;  1EZQ B;  4JZD L;  2H9E C;  3CS7 L;  1CVW L;  5IKT A;  4ZAE B;  1IQH L;  1IGZ A;  3M37 L;  4A7I A;  2Y5G L;  3SOQ A;  1WU1 B;  1EQH A;  2FLB L;  2P28 B;  2XC4 L;  3OLU A;  5IKV A;  3F1S B;  3N8X A;  2W3I B;  1IQI L;  2BSF A;  1FAK L;  2UWP B;  5CKM A;  1HJ7 A;  2MGP A;  1MQ5 L;  1KIG L;  5F19 A;  1IQN L;  3IJE B;  2KL7 A;  3LC5 B;  1EPH A;  4X8U L;  5I46 L;  3FFG L;  1HRE A;  2VRS A;  3M36 L;  2M74 A;  2W2Q E;  2UWO B;  4OTY A;  1IOX A;  1F7E A;  2EI6 B;  2GD4 A;  1JV2 B;  1CCV A;  4PH9 A;  5F1A A;  2HOR A;  1F0S B;  3BT1 A;  1COU A;  1XFE A;  2WPL E;  4XBM A;  3HO5 A;  1APO A;  2BMG A;  1HCG B;  2WPJ E;  1IQM L;  3ZYJ B;  2FLG A;  5JHW C;  5COX A;  3KL6 B;  1ADX A;  1XDT R;  5JBB E;  2PR3 B;  2B7D L;  1HT5 A;  1G2M B;  3ELA L;  2H9E L;  4ZH8 B;  3DEM A;  1DIY A;  2JJL A;  3KQD L;  5JW1 A;  2P93 L;  1IQJ L;  1OB1 C;  3FCS B;  1FJS L;  1KLO A;  2W2O E;  4JYU L;  4BTT A;  2P3T A;  2B0U C;  1IQE L;  1IP0 A;  4YT7 L;  1V1I A;  2BOX A;  1I0U A;  1UZQ A;  3N8W A;  2BQ7 A;  2J95 B;  3N8Y A;  5L2Y L;  1KSQ A;  1O5D L;  2XBY L;  3TK6 B;  2PHB B;  3GCX E;  1KLJ L;  3HO4 A;  3P5B L;  2F9B L;  4NA9 L;  1EMO A;  1F0R B;  2Y81 B;  3U7U G;  2Y5H L;  1IJQ A;  1CVU A;  2XBV L;  2WPH E;  3CEN L;  4RUT A;  2VWN L;  2WG4 B;  3TH3 L;  4RRX A;  5CKN A;  2J34 B;  1C5M F;  1APJ A;  5JBA E;  2WPM E;  3CFW A;  2TGF A;  1PFX L;  2K2S B;  2YGQ A;  1M1X B;  1GK5 A;  1LPZ A;  1AUT L;  3BPS E;  1JBU L;  3HPT A;  5IKQ A;  2NPR A;  2J4I B;  2Y82 B;  2W2N E;  4XLW A;  1IQG L;  1YO8 A;  1G2L B;  3MQE A;  3SOB B;  3NTG A;  3FBY A;  4BTU A;  1G1T A;  4ZXY L;  1FFM A;  4D0F A;  1ATB A;  3ZYG A;  4JZF L;  4BXW A;  1PRH A;  5JB8 E;  2WFX B;  2WPI E;  4Y71 B;  3PGH A;  3V64 C;  1ATD A;  5JBC E;  3GIS X;  5JVY A;  3N8W B;  1BF9 A;  1V1H A;  2RA0 L;  1RFN B;  3KRK A;  1EPI A;  1DVA L;  5K0H B;  4Z0L A;  1LPK A;  1URK A;  2J38 B;  2KV4 A;  1FSB A;  4FM5 A;  3N8Z A;  3SEK C;  3LAQ A;  2WYG B;  2W86 A;  2P26 A;  2W2M E;  3ZYI B;  4JZE L;  4NG9 L;  3TK5 B;  1HAF A;  3KK6 A;  2VWO L;  4O1Z A;  1QIU A;  2XC0 L;  1UZP A;  2BOK L;  1QFK L;  2PUQ L;  1L5G B;  3HS6 A;  2OYE P;  1MOX C;  1N7D A;  2WYJ B;  3NT1 A;  5CIS A;  2YGO A;  2EI7 B;  3LN0 A;  1KLI L;  3K9X A;  3SW2 A;  1EPG A;  2J2U B;  3U73 A;  4M11 A;  4D0E A;  1NFX B;  3TGF A;  6COX A;  1HRF A;  2D1J B;  2BQW A;  1PTH A;  1F7M A;  5L30 L;  1EPJ A;  1G1R A;  5JB9 E;  4GU3 A;  1FE2 A;  3POY A;  1KKE A;  1WHF A;  1YUK B;  1EAI C;  3RR3 A;  2P3F N;  1NPE B;  4Y7B B;  1APQ A;  1K36 A;  1IQF L;  1IQL L;  1DDX A;  2FLR L;  3Q7D A;  4OTJ A;  2VWL L;  2Y80 B;  3C9A C;  4JYV L;  1A3P A;  5KN5 C;  4G1M B;  3N8V A;  3LTG D;  1X7A L;  1ZAQ A;  1LQD A;  1IQK L;  1G1Q A;  1W7X L;  4ISI L;  5E8D A;  3HH2 C;  4LMF A;  3TZI A;  2WFT A;  1NFY B;  4X8T L;  1Z6C A;  2EI8 B;  2J94 B;  3V65 B;  1HZ8 A;  1J9C L;  3R05 A;  3Q3K B;  4X8V L;  1JL9 A;  2WPK E;  1TPG A;  1IGX A;  4BTI A;  1NQL B;  2W3K B;  2VH6 B;  1EQG A;  2Y7X B;  3B4V C;  3BT2 A;  1UZJ A;  2XBX L;  2W2P E;  2P95 L;  2ADX A;  1CX2 A;  2BT7 A;  2OYU P;  4ZHA B;  1NFU B;  3S6X A;  3N8Y B;  2P6A C;  2W26 B;  1HT8 A;  5EGM B;  2KNI A;  1W8B L;  3QH0 A;  1PXX A;  3SOV A;  1V3X B;  4COX A;  4YZU B;  1DQB A;  1ATA A;  2UWL B;  4LOR A;  1B9W A;  1K37 A;  4CUE A;  2XBW L;  1FF7 A;  1L3Y A; 
#chains in the Genus database with same CATH homology
 1Q4G A;  4E1G A;  3H5C B;  1YUG A;  1LMM A;  1NT0 A;  3F6U L;  5KIR A;  4RRZ A;  3GCW E;  2YGP A;  2Y5F L;  3TBD A;  2BOU A;  1N1I A;  5L2Z L;  2XC5 L;  2RHP A;  1LMJ A;  4ZXX L;  4C16 A;  3KQC L;  2FZZ L;  1ATE A;  2BQ6 A;  4Z0K B;  3KCG L;  2G00 L;  2WG3 C;  1PGE A;  2VVV L;  4XL1 A;  3LN1 A;  5FDQ A;  4Y7A B;  4TGF A;  2VVC K;  1FAX L;  4MMZ B;  1WHE A;  1DX5 I;  1XKA L;  1Z6E L;  4Y76 B;  1XKB A;  4A94 C;  1HX2 A;  2FD6 A;  2P3U A;  4AQT A;  1SZB A;  2WZP P;  4BDW A;  3NJP C;  4O02 B;  1CCF A;  2VH0 B;  1P9J A;  3LTF B;  4Y79 B;  3QMO A;  3ASI A;  2K2T A;  1EBV A;  3CA7 A;  5JVZ A;  2BOH A;  2P16 L;  4RS0 A;  4ISH L;  2P3F L;  4M10 A;  2BZ6 L;  1CQE A;  2MGR A;  1KSN B;  3KQB L;  2Q1J B;  3QCW A;  4BXS A;  1P0S L;  1CEJ A;  1YGC L;  1NZI A;  3HS5 A;  5CKQ A;  4CUD A;  1EMN A;  1NFW B;  1IVO C;  1U67 A;  4RRY A;  4Y6D B;  2MHP A;  1LPG A;  3OLT A;  2DDU A;  3LIW B;  4Z6A L;  2Y38 A;  2VWM K;  4BDX A;  1EGF A;  2BO2 A;  3ENS A;  2I9A A;  3MDL A;  1IOE L;  1TOZ A;  2Y7Z B;  1TLE A;  3HS7 A;  3KQE L;  3IIT B;  2CJI B;  4D90 A;  5IKR A;  2RNL A;  2I9B A;  2VVU L;  4CUF A;  1G1S A;  2P94 L;  2AYL A;  3EGF A;  4YT6 L;  4MMY B;  4NGA L;  4CSY A;  1YUF A;  2VJ3 A;  3HO3 A;  1HAE A;  2KB9 A;  3LC3 B;  1MQ6 L;  1U8C B;  3NTB A;  4MMX B;  1UZK A;  4X8S L;  2JKH L;  4RRW A;  1EZQ B;  4JZD L;  2H9E C;  3CS7 L;  1CVW L;  5IKT A;  4ZAE B;  1IQH L;  1IGZ A;  3M37 L;  4A7I A;  2Y5G L;  3SOQ A;  1WU1 B;  1EQH A;  2FLB L;  2P28 B;  2XC4 L;  3OLU A;  5IKV A;  3F1S B;  3N8X A;  2W3I B;  1IQI L;  1FAK L;  2UWP B;  5CKM A;  1HJ7 A;  2MGP A;  1MQ5 L;  1KIG L;  5F19 A;  1IQN L;  3IJE B;  2KL7 A;  3LC5 B;  1EPH A;  4X8U L;  5I46 L;  3FFG L;  1HRE A;  3M36 L;  2M74 A;  2W2Q E;  2UWO B;  4OTY A;  1IOX A;  1F7E A;  2EI6 B;  2GD4 A;  1JV2 B;  1CCV A;  4PH9 A;  5F1A A;  1F0S B;  3BT1 A;  1COU A;  1XFE A;  2WPL E;  4XBM A;  3HO5 A;  1APO A;  2BMG A;  1HCG B;  2WPJ E;  1IQM L;  3ZYJ B;  2FLG A;  5JHW C;  5COX A;  3KL6 B;  1ADX A;  1XDT R;  5JBB E;  2PR3 B;  2B7D L;  1HT5 A;  1G2M B;  3ELA L;  2H9E L;  4ZH8 B;  3DEM A;  1DIY A;  3KQD L;  5JW1 A;  2P93 L;  1IQJ L;  1OB1 C;  3FCS B;  1FJS L;  1KLO A;  2W2O E;  4JYU L;  4BTT A;  2P3T A;  2B0U C;  1IQE L;  1IP0 A;  4YT7 L;  2BOX A;  1I0U A;  1UZQ A;  3N8W A;  2BQ7 A;  2J95 B;  3N8Y A;  5L2Y L;  1KSQ A;  1O5D L;  2XBY L;  3TK6 B;  2PHB B;  3GCX E;  1KLJ L;  3HO4 A;  3P5B L;  2F9B L;  4NA9 L;  1EMO A;  1F0R B;  2Y81 B;  3U7U G;  2Y5H L;  1IJQ A;  1CVU A;  2XBV L;  2WPH E;  3CEN L;  4RUT A;  2VWN L;  2WG4 B;  3TH3 L;  4RRX A;  5CKN A;  2J34 B;  1C5M F;  1APJ A;  5JBA E;  2WPM E;  3CFW A;  2TGF A;  1PFX L;  2K2S B;  2YGQ A;  1M1X B;  1GK5 A;  1LPZ A;  1AUT L;  3BPS E;  1JBU L;  3HPT A;  5IKQ A;  2NPR A;  2J4I B;  2Y82 B;  2W2N E;  4XLW A;  1IQG L;  1YO8 A;  1G2L B;  3MQE A;  3SOB B;  3NTG A;  3FBY A;  4BTU A;  1G1T A;  4ZXY L;  1FFM A;  4D0F A;  1ATB A;  3ZYG A;  4JZF L;  4BXW A;  1PRH A;  5JB8 E;  2WFX B;  2WPI E;  4Y71 B;  3PGH A;  3V64 C;  1ATD A;  5JBC E;  3GIS X;  5JVY A;  3N8W B;  1BF9 A;  2RA0 L;  1RFN B;  3KRK A;  1EPI A;  1DVA L;  5K0H B;  4Z0L A;  1LPK A;  1URK A;  2J38 B;  2KV4 A;  1FSB A;  4FM5 A;  3N8Z A;  3SEK C;  3LAQ A;  2WYG B;  2W86 A;  2P26 A;  2W2M E;  3ZYI B;  4JZE L;  4NG9 L;  3TK5 B;  1HAF A;  3KK6 A;  2VWO L;  4O1Z A;  2XC0 L;  1UZP A;  2BOK L;  1QFK L;  2PUQ L;  1L5G B;  3HS6 A;  2OYE P;  1MOX C;  1N7D A;  2WYJ B;  3NT1 A;  5CIS A;  2YGO A;  2EI7 B;  3LN0 A;  1KLI L;  3K9X A;  3SW2 A;  1EPG A;  2J2U B;  3U73 A;  4M11 A;  4D0E A;  1NFX B;  3TGF A;  6COX A;  1HRF A;  2D1J B;  2BQW A;  1PTH A;  1F7M A;  5L30 L;  1EPJ A;  1G1R A;  5JB9 E;  1FE2 A;  3POY A;  1WHF A;  1YUK B;  1EAI C;  3RR3 A;  2P3F N;  1NPE B;  4Y7B B;  1APQ A;  1K36 A;  1IQF L;  1IQL L;  1DDX A;  2FLR L;  3Q7D A;  4OTJ A;  2VWL L;  2Y80 B;  3C9A C;  4JYV L;  1A3P A;  5KN5 C;  4G1M B;  3N8V A;  3LTG D;  1X7A L;  1ZAQ A;  1LQD A;  1IQK L;  1G1Q A;  1W7X L;  4ISI L;  5E8D A;  3HH2 C;  4LMF A;  3TZI A;  2WFT A;  1NFY B;  4X8T L;  1Z6C A;  2EI8 B;  2J94 B;  3V65 B;  1HZ8 A;  1J9C L;  3R05 A;  3Q3K B;  4X8V L;  1JL9 A;  2WPK E;  1TPG A;  1IGX A;  4BTI A;  1NQL B;  2W3K B;  2VH6 B;  1EQG A;  2Y7X B;  3B4V C;  3BT2 A;  1UZJ A;  2XBX L;  2W2P E;  2P95 L;  2ADX A;  1CX2 A;  2OYU P;  4ZHA B;  1NFU B;  3S6X A;  3N8Y B;  2P6A C;  2W26 B;  1HT8 A;  5EGM B;  2KNI A;  1W8B L;  3QH0 A;  1PXX A;  3SOV A;  1V3X B;  4COX A;  4YZU B;  1DQB A;  1ATA A;  2UWL B;  4LOR A;  1B9W A;  1K37 A;  4CUE A;  2XBW L;  1FF7 A;  1L3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...