1V10A

Structure of rigidoporus lignosus laccase from hemihedrally twinned crystals
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
494
structure length
487
Chain Sequence
ATVALDLHILNANLDPDGTGARSAVTAEGTTIAPLITGNIDDRFQINVIDQLTDANMRRATSIHWHGFFQAGTTEMDGPAFVNQCPIIPNESFVYDFVVPGQAGTYWYHSHLSTQYCDGLRGAFVVYDPNDPHLSLYDVDDASTVITIADWYHSLSTKAPPAPDTTLINGLGRNSANPSAGQLAVVSVQSGKRYRFRIVSTSCFPNYAFSIDGHRMTVIEVDGVSHQPLTVDSLTIFAGQRYSVVVEANQAVGNYWIRANPSNGRNGFTGGINSAIFRYQGAAVAEPTTSQNSGTALNEANLIPLINPGAPGNPVPGGADINLNLRIGRNATTADFTINGAPFIPPTVPVLLQILSGVTNPNDLLPGGAVISLPANQVIEISIPGGGNHPFHLHGHNFDVVRTPGSSVYNYVNPVRRDVVSIGGGGDNVTFRFVTDNPGPWFLHCHIDWHLEAGLAVVFAEDIPNIPIANAISPAWDDLCPKYNANN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure of Rigidoporus Lignosus Laccase Containing a Full Complement of Copper Ions, Reveals an Asymmetrical Arrangement for the T3 Copper Pair
pubmed doi rcsb
molecule tags Oxidase
molecule keywords LACCASE
total genus 130
structure length 487
sequence length 494
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2004-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v10A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v10A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v10A03
2EIKB 4BXSV 2Y69B 5LDUA 1XB8A 2I85A 1L9TA 4HIPA 1AS7A 3G5WA 3N2JA 1KCWA 2IWFA 1GY1A 4DP1X 6PAZA 2VW6A 3UADA 1W6WA 2WO2B 2XV0A 3PCYA 2BP8A 5TK2A 4E9QA 2ZXWB 3SBRA 1X9RA 6PCYA 2ZOOA 7PCYA 1CYXA 2AZAA 3FYEB 4HZ1A 3OMIB 2XWZA 2A3TA 2J57A 1BQKA 2PPFA 1L9OA 2IWEA 5I26A 2PPDA 3X1NA 4AI7A 3D12B 5B1AB 1NIDA 5F7BA 2BO0A 3ABKB 1TEGA 1E67A 1NPNA 5B1JA 5I6NA 4G70B 4KNUA 4G7SB 1HFUA 4RH4A 4YSUA 1AS8A 2YAEA 5AKRA 1GS7A 2PP7A 3WKPA 1WS8A 2GBAA 1ILUA 1OCOB 2VM4A 2GI0A 2XLLA 4UAHA 1NZRA 2HX7A 4L0PB 1JVOA 4DP5X 5I5JA 2FQEA 2YXWA 4BDVA 4NB7A 2I7SA 5AZUA 3X1BA 1NIEA 5B1JC 5I28A 2HRHA 1OCZB 2H47C 3PPSA 1SHWA 1HAUA 1T5KA 3UGEA 4ENZA 2DWTA 1PAZA 4KO5A 3NSFA 1NIAA 3TBCA 3JTBA 1OE1A 1CYWA 3BQVA 4FAAB 5B1KA 1W8EA 4DPCX 1SDDA 2YQBA 3IBOA 1ET5A 2N0MA 4UANA 1JZIA 3NYKA 1AAJA 3NJLA 4G7RB 1URIA 1KV7A 2OV0A 3TA4D 3V9EA 4GY4A 4WKXA 1ZPUA 1R1CA 3V9CA 4DPAX 2GC7C 5E9NA 2XV3A 3CVCA 4HCGA 3MBWB 2J5WA 3GYRA 2CCWA 2OCCB 1J9TA 5I5IA 2XV2A 3NJNA 1NDTA 3S3DB 1ET7A 1E30A 1MZYA 1ADWA 4GYBA 1M57B 2CUAA 4A2HA 2BW5A 2FQDA 1GSKA 1ILSA 1QHQA 2X87A 1JOIA 1L9QA 4BWUA 1F56A 1CUOA 4P5RA 2X88A 4PAZA 5I6OA 2RACA 4KOCA 1A3ZA 1PNCA 1X9UA 1SHXA 1GY2A 1V10A 3AG1B 3FT0A 4HCIA 1NINA 2XXGA 1QNIA 1GS8A 2J56A 2GB2A 3AY2A 1MDAA 2R7EB 3EHBB 4GXFA 4DP0X 4FA7B 4AX3A 2FQFA 3DIVA 4M4RB 1NWPA 1M56B 1M9WA 1AZUA 4DP2X 3CVDA 2BHFA 2YAMA 3MX0B 5I6PA 4YSDA 1NWOA 3AW5A 4HALA 2XXFA 1SFHA 3AG2B 1HAWA 1DYZA 4F2FA 1AZNA 1PLAA 3FYIB 1NIFA 2VW7A 1OCRB 5B1BB 1JXDA 3NJIA 3S3CB 5I6KA 4DP4X 4YSQA 3H56A 2ZONA 1EZLA 3H4FA 3X1GA 2IDQA 2W88A 4F2EA 3FU7B 1EHKB 4AKOA 2UXFA 5B7EA 3IEAA 1JVLA 1AG6A 1BXAA 2DYRB 2H5UA 2ZWNA 5F7AA 2HX9A 2E86A 1E65A 4YSOA 2XUWA 4YSTA 2UXGA 3PAUA 2OJ1A 1BYOA 4Q89A 1GR7A 1PF3A 3NSYA 1BEXA 3PAZA 1WA1X 2MTAA 3PAVA 2FT6A 2DY2A 2JKWA 2LLNA 1SF3A 3IN0A 1AR1B 2GIMA 2UX7A 2Q9OA 4E9SA 3FSWA 1BQRA 5FC9A 5ANHA 1AZRA 3ZDWA 4A66A 2GSMB 2PCYA 4BK5C 8PAZA 4UF7C 2VMJA 2IDSA 3PXLA 1A8ZA 1ZV2A 4AZUA 1ASPA 2XVBA 4N8UA 4DPBX 2IDTA 3OMAB 2FQGA 2VSMB 3EH3B 1JZEA 1PMYA 2DWSA 2VW4A 1KYAA 2BP8B 3NT0A 4KOBA 4E9WA 2DYSB 1J9SA 4CSZA 2HZHA 1FFTB 2CAKA 1OV8A 4WTQA 1UATA 1I53A 2MRYA 4HCFA 3TASA 2FWLB 3ASNB 4YSPA 1KBWA 5D4HA 1WS7A 1PNDA 2P80A 4DP6X 1IC0A 4A68A 1JZHA 3QJVB 2BWDA 3T6XA 2TSBA 3EH5B 4AKPA 1E5ZA 3WNIA 1SNRA 4KNTA 2BZ7A 3T71A 1KCBA 2YARA 1IUZA 3TBBA 4W1TA 3FU7A 1JXGA 1AS6A 1YLBB 3QJSB 2HXAA 3FPXA 2B08A 4ZK8A 2XX0A 4NERA 3TU6A 2IWKA 2GC4C 1NTDA 3N55A 3ERXA 4KO9A 2AANA 2BW4A 1BXVA 1SF5A 4KNSA 2HX8A 3GXUB 1ZIBA 3DKHA 3NSDA 3EH4B 3WKQA 1ASQA 4E9RA 1E5YA 1PY0A 3AG4B 3FS9A 1OCCB 2UXVA 2R7EA 3CZUB 3L45A 2IH8A 3RYMA 4GP4B 3T9WA 1JZGA 5I6MA 3S3BB 3NJFA 1QLEB 4AKQA 3SQRA 1BYPA 1V54B 4BWTA 1CURA 3OD3A 1AANA 4YSAA 2EIJB 4TXVB 2QDVA 3FPYA 3AZUA 1NPJA 2EINB 2CBPA 3QJRB 3GDCA 3NJGA 2H3XC 2AVFA 3NJJA 2EIMB 3ABMB 3C75A 3QJUB 5B7FA 4X4KA 4YL4A 5EHFA 4PCYA 4JKNA 1TEFA 2JFCA 1AACA 3X1EA 3NP3A 2IH9A 3ASOB 3UACA 3QJTB 4W9ZA 5I5MA 2XYBA 3KW8A 2TSAA 1PLCA 4YSRA 2B3IA 1FA4A 1KDIA 1L9SA 2JXMA 4YVUA 1ET8A 1KGYE 3FQYA 3ZBMA 1JXFA 1SDDB 2Y1AA 4A67A 2YAHA 2BWIA 4DP8X 4YSCA 5AFAA 2AFNA 4HHWA 3T6ZA 1AQ8A 1AG0A 1OE3A 1FWXA 2PPEA 3S8FB 1B3IA 2BZCA 2IDFA 3UABA 3UAAA 1DZ0A 2BP0B 2J55A 2YAPA 4E9XA 3FSVA 1L9RA 1MG2C 4QKTA 1BXUA 1CC3A 4KO7A 3QQXA 2FT7A 2PLTA 4NAJA 4E9TA 3OMNB 1MZZA 1BAWA 1ZDSA 2QPDB 5B3SB 4A2FA 1L9PA 2YAFA 4BDVB 1MG3C 3FSAA 4N4YB 3NJKA 1RKRA 2P80D 2WO3B 3OM3B 3WI9A 1ZDQA 1AZBA 1GW0A 3T6WA 2AZUA 3CVBA 4BWWA 2BP0A 3HB3B 2Q5BA 1OE2A 1PZCA 4M3HA 3S8GB 1ID2A 1XB3A 3BVDB 1V55B 2QPEB 5D4IA 2PP9A 4A2GA 2UX6A 2W8CA 1BQ5A 3NSCA 4MFHA 2CJ3A 1W6LA 1ETJA 1VLXA 2VN3A 1A4BA 3NJMA 4P5SA 1TKWA 4Q8BA 1J9QA 1A4AA 3X1FA 3WNJA 1A4CA 1J9RA 2EILB 2GHZA 5PAZA 2QDWA 2IAAC 2FT8A 2XX1A 3FU9A 5I6LA 4G72B 2VSKB 1XB6A 4BXVA 2HRGA 5TK4A 4YSEA 1SFDA 1PLBA 3AG3B 5IY5B 1N68A 3IE9A 2FNWA 2HLEB 1N70A 4KO6A 1TU2A 2QT6A 4A2DA 7PAZA 3SBPA 1PZAA 1ZIAA 3H4HA 2VM3A 4G7QB 4DP9X 2I7OA 1NIBA 2XU9A 5PCYA 3T6VA 4GP8B 4YSSA 3EF4A 4A2EA 4QLWA 3CG8A 1WA0X 1KDJA 3ABGA 1NICA 3DTUB 1GYCA 3X2QB 1PZBA 3QJQB 4E9VA 2YXVA 4JHVA 3NP4A 3FQ2A 1IBYA 1SJMA 1PCSA 1RCYA 5A7EA 4CSPA 3KW7A 1XMEB 4JHUA 9PCYA 3ZX1A 1OOWA 3U25A 1AIZA 4F7KA 1IBZA 2PPCA 3NJHA 3QPKA 4DP7X 1AZCA 5B7MA 4E9YA 3PLYA 5D4JA 3ABLB 4HAKA 1JERA 3CDZB 3CDZA 3IN2A 1A65A 2NRDA 2FTAA 3HEIB 2IDUA 1OF0A 1RZPA 4G71B 1GS6X 1J5CA 2PPAA 4K9JA 3ZIYA 3FSZA 2DV6A 3FU8A 2PP8A 1JZJA 2YAQA 2YAOA 4GP5B 1RZQA 3WG7B 3FQ1A 3OQRA 1JZFA 4HHGA 1J5DA 1IKOP 2PCFA 4EF3A 2FJSA 3UAEA 1ASOA 3JT2A 1WA2X 2UXTA 2CALA 1AOZA 1WAEA 1KBVA 2WSDA 4YVNA 3WIAA 3SBQA
chains in the Genus database with same CATH superfamily
2XZCH 4F5CE 2ZSWA 4PSPA 3BP6B 3IS1X 4JFDE 5F7NC 1I1AC 5C0CD 4U7SA 4KNQA 3T8VA 1T0MA 4PRAB 3PXHA 4KKLC 4MQTB 1HTYA 2H8PB 1QMUA 4YUEH 1IGTB 3DYMA 3H6AA 2WO2B 3PCYA 1S7SB 4I1RA 5F9WC 5HDWA 2UWEA 2BP8A 3M8OH 4WK2B 2Q86B 1BP3B 3MV9A 4QRPD 1EEQA 3MLXL 2RHEA 3S8WA 4AY0A 2NDGA 3OZLA 4LDOB 1DSFL 3D12B 3PP4L 1NIDA 4OQTL 3MUHL 3DROA 1IT9H 4L3EA 3NA4A 2A9ML 2HJKB 3TIEB 4K9EL 2YA1A 1WFOA 2GBUA 4IBVA 2GI7A 3POCA 4HDIA 1E2ZA 4RDQF 4A37A 1JD7A 1KXVC 3GMNA 1AGCB 3HPJB 2BINA 1PVHA 1TYRA 4JCLA 1FL6A 5IB5B 3TCLA 4F8PA 4ONHA 5CP7A 4J1UB 3U2SB 3BKJH 1J1PL 2WBXA 4UAHA 4G9DB 3VG9C 5JHAA 4L0PB 2RIKA 1JVOA 2GJ6D 4JNXA 4BIKA 3CXHK 5I5JA 2FQEA 3LNHA 1WBXB 4X6BB 4ODSH 5DMGC 1P4LA 4MLSA 1AJ7H 5C9JB 4P4KB 2ZX8A 3GS0A 2FSDA 2GFBA 1A7RH 2VN7A 1DQJB 1ZK5A 3VWJC 4F2MB 1LP9F 3U4BL 2NCEA 4M7JL 3Q2CA 3O3DA 1J5IA 4DWHA 2PR4L 3PGDA 1OE1A 1CFBA 5CJOL 5D93B 3C6SB 4KMQA 4BKSC 3C6LC 2CG9X 4P5KA 1IE5A 4L37B 3DXAA 3RVUC 1KC5H 4UANA 3T2NL 1NAML 1NCAH 3CBRA 2A99A 5EA0H 3K3QA 5JQIB 1DO5A 1U8PB 4I0KA 4H88H 4I9WE 3OJDB 4UMSA 2HG5B 4I77L 5C0CA 1Q94A 2CBTA 2BFGA 3CVCA 2CIIA 2D7MA 2XTJB 4PS3A 5FYKD 5C0BB 2A4CA 5T1KD 2CCWA 3OHMB 4AEHH 4BKTC 3UTTB 3W0WA 3VXSE 4YBLB 4PP2A 3P1VA 4P23D 3TN0B 4OD3L 1VPOL 2OL3B 4DJMA 1EWHA 1ZLDA 3F83A 3B3IA 2B0SH 2X38A 3HBGA 5LWYH 5BUPA 3GTVA 3OPZL 4S0HA 4OU3A 4PSRA 1JG9A 4UTAA 5EIIG 3F04A 4NLAA 4WI6A 4WFHD 1BA9A 1IEBA 1ZANL 3I3EA 1JHKH 2ZG2A 4ZFOL 1HSAA 3R1GH 3B1UA 3GK8H 4RX4D 3SPIA 4EI5B 4OCMC 4MNQB 2WQSA 3IJHA 4M1GL 1TTUA 3HG1D 4EPSA 2FX9H 1MY7A 4FA7B 4RFOL 5E99H 4EMZA 1HOCB 3BHBB 1ZLVK 4M9PA 1DFXA 1JGEB 2HKHL 5F7KC 3MV8A 1I9JH 3CDCA 2BHFA 1RUAL 3PWVB 3P4NB 4P2QB 5H4YA 3C8KB 2XXFA 3FRUB 2F58H 1HAWA 2AJUL 5INCA 2R51A 4F7CA 1F13A 3UAJA 3IDNB 5D6DC 1O6SA 5B1BB 3UTQA 1VKXB 3NK4A 4ZFFA 5DUJA 3ZLQC 4I18C 3QO0B 4PW4A 5FUOL 5SWZD 4PTUB 2UXFA 1WYJA 4P5TD 1T1XA 5ALCH 2C9PA 1AG6A 4ZW8A 2DYRB 2K0RA 4OM1L 4CC0A 2Q7YA 5AKSA 4BFOA 1H3WM 5SX4I 4HS6B 2E27H 4Z3JA 2ZXDA 4KROD 1KENH 3BUPA 5DEGA 2JJTA 5DZAA 4F27A 3FTZA 4LGPB 3GS7A 1UKSA 4YXLL 2X6BA 1Z9MA 4ONFL 1ZK9A 5GS1A 2YGOA 2Z3FA 3IWUA 3QEGL 5IB5A 1JMXA 1GAFH 1T3FB 1E6JH 3TC9A 4A55A 2WBJC 4M62H 3ATFA 2V8LA 4CAGA 5CFHA 3IN0A 4M1DH 4BZ2H 3LXUX 4ZMOA 4NC0B 5CSZB 2QMKA 2YHGA 3DMMC 1RLBA 1J5OH 2W0KA 3VXNA 1UM5L 2R23B 1A3QA 5KBLA 4OV5B 4KQ3L 4TNWF 3N9GH 4WNSA 3TZVD 1FDLH 2Q1EA 5BRZD 2EDOA 2XWXA 3LN9A 4P5MA 4R4ND 4UF7C 2IDSA 1FNLA 5IQ9B 2C9QA 3IJEA 4G11A 4ZPVA 5ECJE 4LDLB 1WZ1H 1R24B 4W70A 2FQGA 3EYFB 4MYWB 3L4WA 1I7TB 4LSVL 4LO9A 2VXQA 2OPCA 1NFIA 3IDUA 4M1CD 4W9DC 5CJQH 1E5BA 5AOJA 3NESA 1HNGA 1S7SA 5JYLA 1QR1B 1T66D 1WQVT 3CDGB 4YDVB 5TGBA 2E0PA 3NCXA 1C5BL 4ZDHA 1MW1A 5KAQG 1XXFC 1YSOA 1T0MB 2VLJA 3MRPB 2YXMA 5IVOA 4FABL 5KG9A 1BVLA 4YLQT 4HCFA 2Y6SC 2HRPH 3P54A 3L6FB 1AZZC 1A5FH 5DS1A 5JA9A 5CJ5A 4JFQA 5CP3A 3ZR5A 5E2VL 4NAQA 1WCQA 2XNAB 4CGUB 2ZKMX 4KXDA 4GS7B 4TTGA 3WHXA 5FS5A 4JMNA 2BWDA 3QRLA 1XH1A 3EH5B 1KWKA 2JQAA 4Y1AE 1SEQH 2HT4D 2NY4D 4G1EA 5MEQB 1NGXA 4H5SA 5IVZA 3U83A 4A38A 2XI9A 3HZKA 1L9MA 3VG9B 2NXZB 4K2UL 1TF4A 4O02H 3VXUD 3QE5A 3SE9L 1TOXA 1WZKA 2UWEE 4PJGF 1UA6L 1AI1H 2NYZA 1PG7H 4KTDH 4TUKL 1M7IA 5D2NB 1MREH 5HVWA 1M42A 1MF2H 5A16A 4JW3A 5A6IA 4KKLD 2EDXA 4CUCA 2CXKA 4FKEA 4JPWH 3FT3B 1RJZA 1JN6B 1SF5A 3CLFL 1ZS8B 7FABH 4UIMA 1WUZA 4B95C 5BJTB 2WMPA 3MQIA 4F5CA 1OP5K 3T8XB 5F7UA 1RUPL 5DJ2B 4TS6A 1FGVL 4AQ8C 2P1YA 3ULUD 4FG0A 4XB8A 4Y5XC 3PRZA 4UZSA 3N41B 1F02I 4DOHE 1DVUA 4MAYC 1EZSA 3JWNG 3DO7B 1SEQL 3UJTH 2ZWKA 4CSSA 3OKNB 3CX5J 4NZUL 3L5WA 5LQBH 2G9KA 2EE0A 4ANUA 4HT1L 5B38B 4ZO8A 4RGND 3K6SA 3EBAA 4EEEA 1ZANH 4Z7AA 4HBQA 3M46A 3RTQB 4ODVL 2NNFA 4FCAA 1UA6H 3GBMH 2HTLD 2XBZA 4N2CA 1NPJA 5C0GA 5IJVA 2BJMH 4I0CC 3GB7B 1ZLSL 3SPHA 4XOBA 2X9ZA 1TZHA 3KLDA 2J8UB 5EHFA 2M83A 4LVHC 2PTVA 4MJJA 3F2LA 3FSOA 2R9HC 4FQ2H 2FYYA 4L3CB 4XCNB 5E2JA 3H1ZA 2VDLB 5KSBB 3O6LH 3ASOB 5A43C 2ARJB 4GRLC 5T1LA 3I2CH 2TSAA 4OLVH 5ISZD 1T1ZB 3SDDC 1FA4A 5CZRA 5JOPE 4L4VE 1KGYE 4YNYB 5DUPH 4WF7A 3WFEH 5IHUL 3GJFK 4A67A 5JIHA 1ZGLP 3VRLE 4J3WA 1OE3A 1PAMA 4HLJA 4EZJA 2EYRA 4HUNB 1M05A 4ZG1A 2BZCA 3DX6A 3TT3H 3DX2A 4L8DB 1RSYA 2VDKL 3VXUE 1NAMA 1SN2A 5KVEE 1FBIH 5AAMC 3AFLA 1YN7B 3AC0A 4HKBA 1M7DB 1SVBA 1IAII 1MG2C 3LNDA 4DIXA 4F57H 4HX1A 3HZMB 1DVXA 4IEFB 3HC2A 4JDTL 3I3BA 2D73A 5DRWB 4C56B 1YYLL 4JHAL 5AVQB 3RWFA 4IEFA 3FCSA 4P4RA 5EORL 1YNLH 5LGJB 3WY3A 1KN2L 3KAAA 1YN7A 4FNRA 4HKBB 4NO0D 4OVUA 5F72S 1KYOK 4N0CD 1Q9KA 1EO7A 2GIXA 1BLNB 2XWCA 1HEZB 4QXGL 5HHOA 4TUKH 2AK4B 4UOQA 2JB5L 4GO9A 4K3JH 3SGEI 2IGTA 3CPLA 4YLCA 4AVKA 3WTYA 3N04A 3NA9H 4HUCA 1V55B 5D4IA 3IKCB 3O3BA 3GXPA 4PRHA 3TEUA 2JKTM 2MCMA 1FNEA 1TR7A 3LEXA 4ZFGL 5A7BA 1IGCH 4PJHE 1I1YA 5K9KB 4MQSB 4ELKA 1I3RB 5J6SA 3OKKB 3O9WC 4KKAD 4X0NA 1J9RA 4AIZA 1S5HB 4UOJA 3VCLA 4K71B 1NGQH 1T04B 4UZGA 4ZQTA 1SUJA 1SFDA 2AXGB 2V8MA 2J8UA 3O2WH 5EZOL 5J1AB 5I1DA 1MNUH 3A3YB 3QNYB 4UT7H 5CXPA 3RNKB 3SJVD 5DJZA 5CGYC 1DUYA 3KR3H 2Z9TA 4MTMA 5AW6B 3SKOA 2X89A 3SE6A 5L8JB 3VXPB 3GIZL 2NUPB 4F8QA 5BV7B 3RUGF 3VTTA 1TQWA 4MNHB 1WA0X 1DVFD 1B0WA 2OP4H 3B2UC 3OKNA 3WXWH 2YXVA 1IGFH 4HGMA 1DCLA 3FQUA 4NN6B 1ODUA 3SPVB 4AZ8A 3VE0B 5B8CA 2VZVA 3RL1B 4LLQB 2NY4C 1TYJA 4DKTA 1L3WA 4G8IB 2VNCA 4NKQB 1USZA 4H7VA 1QTPA 2DF3A 1MFVA 4PLKD 1V3KA 1JERA 5EF1A 3MLSH 2BZDA 2H3KA 4OD3H 1MJ7H 1J8HE 2YQ2A 2YJQA 4Y19B 1N5AB 3BDYH 3DA0A 1OALA 4X4ZA 1ERNA 2EO7A 1N26A 4RISL 4E0RA 4Y4KB 1UEYA 4A7UA 2JCCE 3BP7A 3LRHA 3ECBB 4FG6C 4CDGC 5KYYB 2PN5A 5ACZB 3KGRA 4KK5D 1OTTC 3GKZA 5DD1L 2G2PA 3II1A 3KPLA 3P0GB 3V0VA 3HUJB 3C5SB 1KTBA 4M48L 5F9OH 4Q6KA 3ATDA 1U2YA 3N1PC 4G7YH 5ERWB 1DUYB 2R4RL 5ICYA 4Z7UB 1JNNH 1C5CH 1GY1A 1LWHA 4GRLA 1HC1A 3N40P 1QNZH 2FRGP 3LQAL 5D7KD 4JG0H 43C9A 3QEQB 2XFXB 3KXFD 1Y1UA 1ZE3C 2ZXWB 4XCFH 5AUMA 1S78C 7PCYA 4F9LA 1OTUC 2VABB 3FYEB 4I0PC 3MJ9H 4Z18A 4YWGL 2PPFA 4YBHA 4CA4A 3WTSA 5BRPA 1KJ3L 5FK9A 3VGAC 2O30A 3SCMA 3LKPB 5C3LD 2ERJB 5HYSG 1K4DB 4FERA 4ZO9A 1FNEB 4A1RA 3ZL4L 4QJ5B 5C97A 1FVCB 1RSFA 3KYKL 3QJFA 3TNNA 5KSAC 5HPMB 5LAPA 4QRTA 4XPFH 3GZPA 2M2DA 5B1JA 2F5AH 4KK6D 1PKOA 5GJTH 2D3VA 4G70B 4AQ8A 4GAYA 1VSCA 4FNTA 3W9EB 2G5RA 1BLNA 1ML0A 1N9PA 5B22A 1T03L 5GJSH 4OZHA 4DZBA 2XZCL 1ACYH 3H3PL 1OB1A 4X80H 3ZPDA 4E42A 2Q7YB 5J7CC 4PB9H 3MJ9L 3AT0A 3R7RA 4TVSa 5EN3A 4UTAL 1ZS2A 5EWIH 3CFNA 4M6ML 2JJSC 1LO4H 5EU5B 3X17A 1V3MA 1KCUL 3CZFB 5AB0A 2O5ZL 2E9BA 4JFOA 4FHBD 4P2QA 5B1KA 4B7IA 3HC0A 4DPCX 3F65A 4L18A 2Q10A 5CUSH 2J72A 2WYZA 5C0CE 1CZ8L 5GS2D 2N0MA 4O02B 3VD2A 4TVPH 2CLRA 3NYKA 1BFSA 4FI6A 5HHQB 1JP5A 1OD9A 4XVJH 3ATEA 4XNBA 3V9CA 3E6HB 1I1RA 4EI5A 2GC7C 5E9NA 5IKCA 3DVGB 1YNTA 3QQ3A 5FM5O 3WTVA 2ED9A 2H1PL 2JH2A 2D7QA 3LKNB 3NJNA 4U0RB 5F1NA 5L88L 1II4E 3D0VB 1BQSA 4PI0A 5KYXA 2OMXA 4NEHB 3UTTE 4W9HC 3MLWH 4JFPB 4PJEB 4LOUC 4GUOA 4QD2E 2IPTH 4GAJH 2ERJC 3EFOA 4EKJA 4LBEA 3DLQR 2EKJA 2XY1A 1I31A 5CGBA 1VJSA 4FFYA 1E8YA 5BS0A 2ZWYA 4NNXB 3QAQA 3L9RB 4YJZL 5K5YA 3L81A 3KM2A 2F74A 3EUDA 4RGNB 3K5RA 3MTRA 1Q0YL 1SHXA 2DW5A 4F80A 5L2KB 3OG4B 5L4JA 3CLEH 2Z0UA 4L3AA 2A7BA 4AX3A 1BG1A 1HI6A 2UZPA 3BWSA 4YH6A 4PBXA 5GS1C 4AW4A 2XPYA 1M56B 4U1LA 3SO3B 4EUPB 1WGVA 3H9YA 5IMMA 3CPUA 4OCNC 4PJ7B 2Z0BA 5K9QG 5DT1L 1AXSA 4AV0A 3KL3A 4YSDA 1A6ZB 4UAOB 4X7CC 1U9KA 4YGVA 3QYCA 2YGPA 3D3VD 2B4CC 3TM6A 2O61B 2G75B 1JXDA 3O2DL 4ZUVA 2KS0A 2R4SL 1UCBL 4M8QB 3F7VB 4GAJL 5ICZA 5KYWB 4GG6A 4YSQA 3EO1B 3V0FA 1BAFH 1EHKB 2GFBB 1I9EA 3VWJB 5FIEA 1DANT 1TO4A 3WIFA 3HN3A 4Q0XH 3T2LA 1BXAA 2GIYA 4JDZB 2ZAIA 1XX9C 4BEIA 3IPEA 2BSSB 5J13B 5F7AA 3WV0A 4MB5A 5C2UB 3N44B 3BFOA 1W72A 5EOCL 3HMXA 5D96B 4OF3A 4HVBA 3SGKC 2H2PD 3D39B 4BSJA 2R1WA 1MAML 2CKBA 2CO2A 4TLKA 3LQAH 3L3IA 2IPUK 3DV4B 3N85H 3MROA 5KW9L 3L6FA 4DGUA 3GJEB 2B2XH 2AK1H 3FN0H 2XRAH 4ZMZA 3DTXB 1NC4A 1OAUH 4MQXC 5FC9A 3GBDA 3STZB 5HGHB 4QTHA 4X9GA 4BH8B 1YYMH 3N42F 1NFDF 4F33B 1EANA 1UVQA 4QO1B 1X5JA 2NNRA 4NHCL 1S7TB 3LD8C 4FFYL 5DK2B 5GHWL 3LMJH 4PJXB 4N8UA 2VSMB 3QFJE 3EYFA 4YX2H 2Z93A 5I15L 4FTVD 2AEIT 4G3YL 2EZ0D 2VW4A 1P7HL 1BZQK 2VXUL 3NT0A 3CX2A 4WQOA 5DJ8A 3VXMA 2PWHA 4CSZA 4V1DE 3F58H 3PQYB 3BUIA 1HH6A 3G6JF 4GS7C 4J3UA 1SXSA 4HIEB 4KVCH 5KVGH 3G5XB 5EFIA 3RUGA 4E41B 4TTDD 5HYSA 4GSDL 2DMGA 1L0YA 3L7FB 2ZNXA 5CIPA 2L4OA 1U42A 2XIDA 4YSPA 1T3FA 4ZQKB 4YZWA 4W4OC 1WS7A 1MPAL 3OAZK 5G4MA 4IU2A 2P80A 3FB5A 3JWOC 4PJ9D 4G82A 1UKTA 5EBLA 1FQ9C 2TSBA 4R0LB 5IB4B 3FTUA 1E5ZA 1TSHA 3QP3A 3N3EA 2ED8A 1BFVH 3KE0A 5D5ME 1OY3B 1QSED 7CGTA 1O5DT 2ZKHL 4J27A 4IRSB 3L7EA 1MCLA 2R0WH 2B15A 4IBSA 2J25A 2VL5A 1FZOA 2CO6B 2Y0SA 2ESVA 2Q7NA 3H9HB 2HVJB 3TWCH 3GIZH 2BM3A 2E7BA 3BAIA 4IBYA 3M88A 2XX0A 4B9KC 4UI2A 1IGYA 2JELL 2QV2A 4QCIB 4R4BA 1A6UH 4FP8L 1WWAX 1FIEA 1DBBH 2EO1A 1BXVA 4FEMA 3RP1A 2VSCA 4PRPB 4HOZA 1H15B 1R34A 4WNQB 2YD8A 3CVHB 4ZFZA 3V5DA 1RFDL 3LIZL 1ASQA 3SQBB 4JVPA 5BVJB 4GO8A 5T5FL 4WFGD 2V2XA 3FFOA 3B5TA 3RIFK 1SLVA 5IMKB 3WXWL 2OMWA 2AV7B 3QUYA 4TNVK 5C0EB 3D0AA 1ZD6A 5D1XB 5I6MA 2NYYD 5J6HB 1DBKL 1V3LA 3OC8A 5BV7C 3DYPA 2CGZA 3VD4A 2UY7A 4B5EA 4DEWA 5FECB 3K91A 2A73B 2FVNA 4X6CE 5GZND 1QPKA 4NPYA 1B0IA 2DM2A 3NA9L 2YD6A 3QIUA 5FWQA 2IH1A 4MMZB 2GJ6A 2ZP9A 3KLSA 3MJ8B 2VDQL 4QAWA 1VGKB 5DO8A 3VFPA 2VAAB 3UTTA 4XX1G 2Q0ZX 3FTXA 3W0WB 2BVQA 2EYTA 2QHLA 5TDOB 3D85B 2KLSA 4NHUB 5SWZE 2P52A 4MXVF 4ZMNA 5I73B 2JV6A 4N2BA 5FFLA 4J8QA 5EIVA 1HCZA 2A1WH 2YD3A 5H8DA 1KBGH 2BDNH 5EU6E 1BD2E 1RXLA 1WISA 2ATPA 3BP4B 3GFUA 1R5IA 3FQYA 3NJXA 3BSGA 2GK0A 1I8LC 2DEXX 3DX8A 1JXFA 4JDVB 1IQWH 1ZTMA 1AG0A 1P4BL 3NN8B 3ULUL 4P04A 3S8FB 1E4KC 3MHZA 1OT2A 2R2HA 3V0IA 3CN3A 1QUPA 3B6SA 1DZ0A 2BP0B 2C9SA 5KVDE 5F71A 1QEWA 4PJFF 4BHUA 5LXGL 4XGZB 1YYLH 1DVFB 1CFSB 1F41A 2ICEB 5H94B 3I6GB 5E9DE 4U6YA 3CFMA 4X6BA 2NOYA 3HHSB 3IMUA 5IBTL 3GJFB 2WB7A 3JWNE 3WHE0 3FSAA 4RGMB 3D39D 3NJKA 1LD9A 3BPNB 2RJMA 3KYNA 2BSDA 1AZBA 1QEWB 4MMYA 5HXMA 1WV7T 3P02A 3ZTCC 3Q01A 1FNHA 3LDBB 3ORJA 1DBAL 4OJCA 2Q5BA 2DRUA 4TKWA 1ES0A 2DZEA 4JG1L 4M5YL 1PZCA 4MXVE 2XN0A 1XMWA 2A9NH 5LBSL 5F0MB 1T7XA 5DUPL 3HLKA 3TYGL 1PZ5A 2AGJH 2W8CA 3HBPA 3KVDD 1AP2A 2ZCZA 3MMEB 3QT2A 1ACXA 1BQ5A 5D1XC 4PJAA 3V5KB 3AADB 4NQVA 5F7DB 2ZP0T 1TKWA 2DWDA 4Q8BA 1AO7A 2MPAH 4N9GB 4R6UA 3HAEA 1G7LB 2E27L 5PAZA 3R06A 1C08B 2BIMA 3EOYG 4IDLA 4FHKA 3O8XC 3CH1A 2UWEB 4OCRL 3VFPB 4KKBC 2YPLE 3LRLA 3COOA 1MPAH 2Z31B 5DEFA 2K7QA 1KG0B 1RZGA 4GQ9L 2PO6C 3NCMA 4MDJA 1UM5H 5KJRH 4I2XA 3WJJC 3WN5B 2I7OA 1KTCA 4HSCX 4XPGH 5SWZB 1NMCC 2UY7B 4KX9A 2XWBB 4FGMA 4GP8B 5E00A 4A2EA 2MHAB 1EBPA 2YO3A 4JFEB 1GGYA 3GRWH 4JN2A 1NICA 4KHTL 1HHGB 3BAJA 3QWOB 2ZNWA 1HSBB 3JWDH 1G6RA 5ICXA 2OXGB 3P73B 1AGEB 3KW7A 4BCZA 3KBHE 5KJ4A 2CDGA 5EUOB 1PKQE 4RMUA 2PXYC 4WNQA 3Q43A 1DBBL 3NJHA 2G60L 1J05B 5LCVA 1NCBL 3W39A 2VXVH 1FORH 5DR5H 2HRPL 3CDZA 2X6AA 2EDDA 1NOLA 5DA0B 4MA3A 2QFRA 4P9ML 4GG8B 2Y25A 2PPAA 4GT0A 4ZW3A 3U1SH 1JZJA 2VGLM 1P9MA 2D31B 4GP5B 3PWJB 3RL2B 4BRVA 3IB4A 4KTYA 2O5YH 4UDUB 5K9OB 3GSOA 2QSCL 4FNUA 1MRFH 4G6KL 2FJSA 4IHBA 4NXKA 1HSBA 1UOLA 5E6ZA 4EF3A 4UZUA 1ASOA 3PE9A 2V2WB 3IXAB 3LS4L 5JHDE 4N2GA 1NGPH 5CHNA 3X14A 2WSPA 4RBPH 5ISZE 4JO2L 3SDCB 1FDLL 4GSDH 3L7FA 5LNGA 3SBQA 5HYSB 5EZLB 3IFPB 3CN2A 4KJPD 4XXDA 1E0OB 5LDUA 1INEL 1I1AD 5E4IA 3NIGB 5EU6A 2VUKA 2RCSL 4DKEL 1A3LH 2W60B 5FO2A 3SJVE 1CICA 2WZPA 1BVKB 1E8XA 4WRLA 1Z9SA 3QA3A 3M1OA 4OZIE 3LSOA 1MVFA 1CF1A 3UBHA 2ROYA 5ID1A 3MA9H 4XH2B 1DL7L 4HZ1A 1ZEAH 3AACA 4IGBB 2VRQA 2YOAA 3DUUA 4RMTA 3BEWA 1N59B 3X1NA 4N9GA 1OGPA 2FHCA 4M00A 1G6RL 1PQZB 2ED6A 3GMOA 5CJOH 4FQ2L 3KWXA 4KXCA 2AJSL 5ACMA 1GOFA 5HGHA 1S7QA 5I6NA 2G5BA 4NS0A 2Z7YA 1OSYA 5DI8B 2BK8A 1XGTB 2BJML 4G7SB 5DK0A 3TPKA 4WY7H 1KT2B 1O6VA 2DLEA 3UEQA 3VI4F 4Y4FC 2AERT 4YSUA 4LGRB 5AKRA 3KLHC 2HT3D 4AH2B 3VO0A 2VITA 4YXLH 2X05A 2H4EA 2XFGB 2B1OA 1ZTXL 5EIQA 5HHOE 4GRLD 1CICC 2IBZX 4P2QD 1YN6B 1FN4A 4MB4A 1W72B 4BDVA 2YLHA 5E8DH 2A77H 2VDPL 1U4EA 2IAND 3ISRA 3JV6A 3D9AH 5SV4A 3EO9H 4JDZA 2J1YA 4HEPG 4CN6A 1ZA6A 2JQMA 3L3HA 2FYVA 4M1CC 4I48B 5BMFH 2WLMA 3DOIA 1CDJA 1LO2L 3UJJH 2IAMB 2N01B 5D7IB 5DQDH 1SHWA 2ZYSA 1HAUA 5L4FA 5F8QC 4ENZA 2DWTA 4FLHA 3BOVA 4K9EC 4KI5F 1WJ3A 4NKDA 3TT3L 3VSTA 4JFWA 1LDPH 1HQRB 1W15A 2WP3T 3CN4A 1W8EA 1OP5H 3SYOA 1XH0A 1FYTA 3LYRA 5FCUH 3SDCC 5CM1A 3WSQH 1F4XL 4L8SA 3C12A 2UVFA 1C5DA 3NAAH 4NJ9H 4QHLA 2V5SA 1DTUA 4AYGA 2YEVB 4ZXBC 3RWDA 1EMTL 2WBWB 3M8OL 1QW9A 1J7VR 1LWJA 4MA8H 1IAMA 2B8OT 3P30H 4HCGA 3WNKA 4F9PA 3KHOA 4XVSH 3ETBF 4YDIL 1X44A 3SDAB 2WTPA 2F74B 2CRZA 1JTOA 4XP5L 1AFVH 5DZOA 3F01A 1UQSA 5BS0B 4ODBD 4F7MB 3TA3C 3O4LB 4XHJC 1C16B 3V0WH 3OB0H 1J0ZA 2GJ6B 1M57B 1QSFA 2XTJC 4HIQA 1DZBA 4EO5A 1U91B 1GJWA 1EFXB 5ENWA 3AWEA 4L9LB 3SDXA 4BWUA 3KWTA 4LSSH 3BPCB 1SXAA 3FO1A 5I6OA 4NZRL 5FGCB 3NGBB 1Y6NR 4YQXL 4XVUD 1RPQA 5J6HA 2V2TB 4KXZI 3ATAA 1A66A 3C08H 3TT1L 3D08A 5HVGB 2AJVH 1KJMA 1NINA 4B9PA 1MWOA 3F7QA 2VXUH 1JYWA 3VXRD 5IOPA 4JZOA 1P84J 5FKAA 3GWJA 3HZ3A 1IGJA 4LCYB 2XG4B 2J1WA 3DXAD 4KJQD 5CAYB 4EIUA 4OCSH 1WO2A 4I3RH 2NUTA 4PJBA 2YA0A 2FECI 4QCIA 3SDYH 1IGYB 4R4BB 3R0NA 5T8IA 2AXFB 3VSQA 3K74B 4XX5A 1LDSA 4WI7A 2PWFA 5GRUL 5C0FB 1IGML 5BVPL 3FU7B 4LLMA 5KUMA 1W72L 3DVNB 5G55A 5HYQB 4OZFG 4OUOA 3RWCB 4QXVA 1K5NA 1UYWH 4B0MM 4KITB 2LABA 5KAQF 2VDPH 1J11A 2ZTBA 1AKJB 1BBJA 1TVHA 2NY6D 3EDEA 2QQQA 4Q2ZA 4YSTA 4GUQA 1NDGB 1XF5B 5EBLB 3QORA 1KPVA 3WMQA 1L3NA 1QPPA 4FQCL 3H3KA 5E2WL 1P7KB 4NPKA 3BKYL 1PF3A 4TUOB 2XWDA 5F3BB 1BVNP 4Q6YA 2WBJD 4PD4J 4YO0B 3WKML 1JZDC 5AAWA 5D5MF 1OARL 1MHHA 4FNPA 1YECL 1LL1A 2H3NA 3KS0J 4MNQD 3FSWA 3NCWA 4MRBA 4OGXL 5EEVA 5C6TH 2GSMB 4Y2DD 1G6RH 1NCIA 2XQBH 3PXLA 4QHKI 3PQYD 1F90H 1ASPA 5KVEH 4DPBX 3T77B 4UT6A 3VD0A 5J5EA 5MERB 2ADJB 1NC2B 4PVLA 5D7JA 5D7SL 3GT6A 3PQYE 2FAUA 3SN6N 2VDQB 5FHBH 2RAMA 2W38A 2OAAA 4DESA 2KZKA 1EXUA 3OJVC 1KCRL 3S9DB 2YBRB 2J73A 2GJZA 5IFJA 3FQTB 2F8OA 5E6YA 5ICYB 3KPRD 4FYTA 1AOHA 3IDIA 3A67L 4Z7WF 1G0YR 4IKIA 3RFZC 4X8GA 1GYUA 1CI3M 3EKCA 4LVNC 4NQDA 3T65A 3T09A 5JR1H 1QUNA 1B0RB 2FECL 3C5SA 3ESVF 3IVKA 1DLHB 3EBGA 1IC0A 4ZFOB 4FXKB 3QXTA 3OHXB 1KPVB 1WITA 2CJUH 2G3NA 5IBUB 1RVFH 3W9DA 4YHZL 2AJVL 5T1MA 3II3A 4BD4A 2MKLC 3ECBA 3BZ5A 1NFDB 3K5SA 4H25B 1RK1B 2CMRL 3IFNL 2WWKT 4MS8D 5CKAA 3B7SA 5I2IA 1A64A 4E0RB 2X0UA 3KM1A 5AYUL 3CBKB 4JLRA 3DVNA 2DWEB 4PJEE 3ZL2A 3FU7A 4LLMB 3M7FB 4Y19A 3WSQL 5I17A 1XAUA 1X5HA 4KC3B 4UILH 3TU6A 1JF6A 1OAUL 3HAEG 3NPSC 5FM4A 1NTDA 1A6ZA 3MX0A 5TE6H 1MHPL 1UWXK 5KZCB 1LM8V 1KWGA 2HX8A 4CU8A 4OGYL 5GZOD 2XN1A 3HZVB 3OXSA 4LLQA 5E6RB 3CFCL 4M7KL 1T0OA 2BNRE 1BREA 3DOSB 5CZVH 5IROA 3SPVA 4AZ8B 3NAAL 1K3IA 5F6IB 2I69A 2N0KA 1TQUA 3WN5C 4D0DA 1UENA 3ULAB 4ZUWB 3VFTB 4G42B 1A22B 1A8JH 4MAUL 1QBLH 3HG1E 1MCCA 3U4EA 2W59A 4JL2A 2QPUA 3UZQA 3REWA 5DZ9A 4OFPA 3MSPA 3HIZA 1QSFB 4IRJA 1F6AB 1INDH 4W93A 4TSAH 3KWWB 3O4LA 5JPMC 1UJ3B 3ABMB 4WW2F 2BIHA 4KUZH 5L88H 1UZ8B 3RZWA 2MNUA 4CBPA 1IZKA 2NXZD 3VFWA 4FQHB 5I5MA 3T0XA 4AIZB 2MOQA 3MLZH 2DBLH 1S9XB 1G9MH 5DJXA 2QSQA 1F4AA 2ITDA 4FFWD 3RIAK 4DVRL 5SX5K 1PZDA 4RIRB 4QGTA 5FYLH 3M45A 5HGBB 1VFMA 1XF3B 3T3ME 4M93C 3T2OA 4B0MB 5BVPH 2AFNA 1N7ML 2R56H 4XPTH 3ECQA 1HXYB 4XPGL 3GLAA 3L3OA 4JE0A 1HEZA 1DJHA 2Y23A 4I9XA 1HZKA 2YAPA 3GDBA 5L0QC 5E4EC 5IB3A 5TPWH 5DD3L 4YHYC 2QFPA 5TE7L 2BY2A 1ZDSA 4YHLH 4NP9A 4Y16D 2C1PA 1R47A 3OMZA 5ANME 1T20A 1KXVA 1MG3C 4OJFL 3ILDA 1BMZA 1YN6A 4ODXA 1CXIA 5DQ9A 1EHLH 3B3BA 3S34L 5IHWA 1MSPA 2DQIH 1E4WH 2WGNB 2DLGA 1G1OA 5I18L 4MXQC 1MCFA 3SGKA 1HWGB 3MRRB 4NQEE 5ALBL 1PFCA 4NKOB 5IROD 4FE9A 1M1XB 4JRWA 4M3HA 4FS0A 3MJ7B 1JVKA 1SXNA 4NRXB 3ZE1B 4Z7NF 3BVDB 2X4NB 1X5IA 1DHKA 5C7XL 4HK0A 4OZHF 1O7DE 4FQXA 3RZCB 5EIIA 2NSMA 3U6XS 3NSCA 1FVCA 2F19L 3QJFB 1WBYB 1ETJA 2BFVH 3UOAB 2VN3A 4WV1C 3OKLA 1MI5E 2AJZB 1T5XA 2BVPB 3SPJA 2OMVB 4BH7B 3L3KA 3V4VL 4X0KB 1KYUA 1A4CA 4FADA 2BPBA 4DN3L 4JM2B 2NNXA 5E5MA 5T1LB 4CL7A 4JZJA 1HNYA 4L3EE 2GY5A 4A7VA 3FU9A 4XH2A 4X98B 5HI3C 2OSYA 3RJQB 2JIXA 2DQCH 43C9B 3AG3B 3ZZQA 5L7XL 5JR1L 1GTFA 2GITA 5A3IC 4PY8I 4CW1B 2W60A 5IBLC 1UXMA 2B5IB 3MRJB 5E24E 5JIMA 3MZTA 5I1GL 1ZXKA 4PH8A 1ZT1B 3QCUL 1YUHB 5FWRA 5KVFE 3ULSA 4AJWA 4FHJA 1Q0XH 2H6OA 4WEUD 4RAHA 4KTEH 1EBAA 5EZJA 2GBTA 4XCEA 4JFDA 3H9SD 2D9CA 3KPLB 5FYJE 2X4RA 1WT5A 3V6ZA 5AL8A 2W80C 1DJGA 1XHHA 1PZUB 3IFOB 5GRJL 2OW7A 3T3MB 5A2FA 3G7TA 3B43A 4LKXA 3G5ZB 2AXHA 2DYPA 1N8ZA 3JT0A 1JV2A 4Q7DA 4TVPE 3KMDA 4OGAD 3MRDB 3B9KA 1E2VA 1YEEL 1KGJA 1WFMA 3UFIA 3OAYK 4HW6A 4NRZB 2EP6A 3QUMB 1AE6L 1UA7A 4JG0L 4E9YA 2DICA 2HB0A 4PBDA 4X9IA 3GXDA 4ZT1A 4EI5C 3VXTB 1QI4A 5D70L 4ZMTA 2X44D 3U0TA 3FQXB 3FB6A 3HEIB 1VFBA 1SGKA 4H8HA 2FEEI 4PG2A 4X5XB 1CF8H 5I9QB 2ID5A 4LNRB 4XX1E 3QZWG 2HLAA 1GSMA 2XICA 2OMYB 3I9IA 3GRGA 5F7EH 5HI5D 5I30H 4BFIA 1VZHA 3AS2A 3BC9A 4Z7QF 1H9VA 4ZPTA 1HZHL 2H0FA 1JZFA 5DMKB 3DHJA 4ZNCD 3FQUB 5GRJH 1SJEA 1GZQB 3CN0A 3OSKA 2KYIA 2L8AA 4L9LC 3B7YA 2NXYC 4MMZC 3GRWL 2VN4A 2VDOB 1EEYB 3NEXA 5EBWA 1TPXC 1S3RA 2IAMD 3M6DA 3W11D 4AJ0A 3AGVA 3VXPA 1FE8H 4PTTB 4ZSOB 1IM9A 4CGTA 1EEZB 4JG9A 4LU5L 1FYTE 3MR9A 4FP8H 5IHZB 5DHVH 2VQUA 4MDIA 3SE9H 3D34A 1JGLH 4Y1SA 4I9WD 3HKFA 2WINA 4WI2A 5IB2B 1P7QD 3CCHB 3DGGA 5KS9B 1W6WA 4NKMB 3L5XL 2ITCB 3CH1B 4E9QA 1XEUA 4ZD3H 5LN8A 1Z3RA 2PO6B 3GXFA 4HH9A 4Z7NB 3R06B 3OMIB 4EXPX 4XT1C 4HWBA 4GKSA 1TJHL 4QUOA 3B2VH 1L0QA 5C0AB 2DBLL 3WY1A 4NZJA 1UD3A 32C2A 1A6VH 1G5AA 1FF5A 1SQMA 4DK6A 3IK2A 5D9SB 4RZCA 3UBXA 3I6LE 3IKCA 4TULH 5JOEA 1Q1JL 2XG5A 3PNWA 4OZFA 1H5BC 2VLKB 2A6KB 4OZGE 1MRDL 3FBKA 4IS6A 5HHOB 2YAEA 4L05A 1WD9A 4EBQL 4WK4B 2NTFB 5DGRA 1ONQA 2AEPH 4QNPE 2F68X 2P8MA 3BZDA 3INUL 3J07A 2FR4B 2DQTH 2F7RA 5ICUA 1U21A 2C3GA 3MNWA 3KPQA 4U33A 2RB8A 1I7UA 4XMKH 4KVNL 5KANG 4NI6A 1B4JL 3IDGB 1KXTB 2ALWA 3MCYA 5I28A 4NDMB 1CFSA 1H3TA 2ICEA 3AXIA 3SIKA 5I16A 4RRPG 3EO0A 5E23A 5EOTA 1U8HA 5F1OB 1U3HD 3HFFA 4QY8A 3B6SB 3IDNA 3S37H 3JTBA 3SZKC 4A6YH 5INCB 3DNKA 2IALA 2NXYB 3VMPA 1BBDH 1ESOA 3FRUA 3ZDYF 1XZ0A 4X4YB 1IMHC 2R2EA 1OPGL 4LASH 3NRFA 2LVEA 5C09A 4JPSA 3MTXA 1MEXH 3EJYD 3LRSA 4Y16C 2E7MA 4MHHI 1YHPA 5C0RL 1GTNA 2XA8H 4NENA 2DMBA 2W9DL 3T0EB 2Z31C 1A7NH 2OV0A 2GKIA 3HR5A 4R4FL 4UDTA 2F61A 2BVQB 2CR3A 4W6XB 2RQ8A 5CBEA 4LVOB 4ISVB 4N24A 4K5OA 1VGKA 3LPPA 1U8MB 4ZS7H 3S35L 3OSVA 3S3DB 2BOLA 2P5WA 2SEBA 3H8NA 1NEPA 4FKKA 5D1ZC 5EEXA 3DHMA 3GB7A 5B8CC 1YMMB 3Q8FA 4PJ8A 4X7FC 3NZ8A 3UBXG 5JXEA 2BW5A 2C7UB 2W07A 4PJDF 3GM8A 1E28A 4IOIB 3VACA 3SDXF 1T7ZA 2SEBB 3HC3L 3BWAA 4K07A 2WTRB 3KYOB 4Y2DB 1PNCA 1X9UA 4QOKE 4CN4A 1ETB1 3K6DA 3IETB 1SUHA 5CJ8A 4DKFL 4L1LA 2OMWB 3QUYB 2J56A 2GB2A 4NIYE 5H37G 4D9RE 4WEBL 4NENB 2CDEB 5HYIA 4OZ4B 4OZGB 1NWPA 4Z77B 5ESVB 1H15A 1TTCA 3GGWB 1FV1B 4XPBH 1JDCA 3AY4C 4N2OA 4Y4KC 5HDQL 5JPNB 2ZWSA 4LCWE 1BZOA 3BQUD 3BVTA 4V33A 4X6DE 1JPEA 1NMAH 3LZLA 3RGVB 4BKLA 4LSUH 2VQ1B 5D2NA 2QVMA 4HPYL 5HVFB 1A14H 5I0YA 3BESR 2P43B 3L3GB 2ZG3A 2EZ0C 4OQTH 2N1KA 2YRLA 2IDQA 3H9HA 4Q9RL 4G3YH 1VESA 2AQPA 1E6JL 1DQIA 1PX8A 3L7EB 4ZAKC 3TBTB 4B7LA 4ZO7A 5FYLL 2W94A 4FQCH 1S3KL 2E7HA 5IGXL 1N5YL 4UNIA 1DR9A 5G5DA 2BOBA 1H0DA 2VB5A 3FT4A 3Q6GL 3QJZA 3OGCA 4Y4HA 1JZ8A 1PJWA 4P2AA 4G8EA 1SVZA 2NTFA 3T0EC 4FFVC 2VWEE 4PS4L 4XNQB 2IF7A 2QELA 4PJAE 3VD3A 4Y16B 2CJTA 1BGXH 1MIML 5I1IH 4NQXB 2CBQA 3R0MA 5CR8A 1TQVA 2XTLA 2GJRA 2FH6A 1BQRA 4JHWL 3PQYA 1S46A 4D3CL 2WIMA 2HJKA 4XPFL 3SD5A 4UBDC 3T6QC 3P9MA 4TQIA 5D9SA 1OM3H 2YGNA 2BNRA 2BS8A 3R4RA 1SZNA 2CLVB 4JHZA 4GLRH 5FEBA 2JKLA 1FZKA 2HSIA 4L4TD 2ENSA 2E6JA 3FB7A 4WU7A 3D3VA 1I7TA 2PYEE 3BMWA 3EJUA 3V0HA 2UYLA 2X41A 3KBPA 2PO6A 4V1DB 3MRMB 4YHLL 4X99B 4NKMA 3RDTC 3RFRA 1LWRA 3LVTA 3OAYH 3MLUL 3E7JA 1EDYA 3A67H 5IQ7L 2Y3AA 3UBXI 4Y19E 1UUNA 3H53A 1R3IL 4XN5A 3GMQB 4QHUB 4ORGA 3G6AA 4FN0A 4PS7A 4X8CA 2OSLA 4BUGA 3A4EA 3CDYA 4JY4B 4K71C 4ZS6D 1F3JA 2X28A 1KBWA 2FK9A 2YRBA 3Q8CA 2VCOA 3V6OE 2RBLA 4PRID 4UQIM 3ZTNL 3HE6A 5GGTH 5HP5A 4AQ1C 4Z7UE 4MJID 1E3FA 3ARGA 4AM0B 2K70A 4AOFA 3MRKA 4KNTA 3RWEB 5L9DH 3WIHH 4IIQB 4N3TA 3ZRSA 2EXWD 2EE9A 3TBTA 4WWKC 1HDMA 2XZZA 3CHPA 4RESB 1ACZA 3V0GA 2G9HA 1E7VA 3LPOA 1A9VA 5KYWA 1VEMA 2J3SA 3VTMA 2B08A 2OQJA 2X7LB 1F1AA 3GHPA 4ZFFB 5D55A 1ZVNA 3FMGH 1T7VA 2IWKA 3TOPA 4HPYH 4P3CL 4U1JA 3CMOL 3O41A 5KSVA 4RQQA 3BKMH 1AXSB 4LMQE 1CIDA 4KNSA 5HI4D 3S36X 3B9KB 1DEEA 1CL7I 2F08A 1ORSB 1LE9B 3OX8A 5T3ZE 3S6CA 4BQ8A 4Z3GA 1PY0A 4QRQB 2UY6A 4PCSA 3RY6C 1D5XA 1NMBL 3WL9B 2Z8WC 1GPOH 5E9DD 5GS0L 2X4RB 4FZEL 1GZHA 3O2DA 1XSIA 4PHZA 5EZJB 2FJFA 4GEIA 4KJYB 1T1WB 4P3DA 3CZGA 4WLCA 1G43A 2EC9T 2FGWH 5ILTH 1CLYH 3HHRB 1NCTA 3V4VB 3L2MA 4ILDA 1YMMA 4GQZA 4JFPA 3MRJA 3QQ9D 2V33A 2X3AA 3BAXA 3MOAH 2WVTA 3P2TA 5KYXB 5J6GA 2ZX9A 4W9KC 3I74A 4RRPA 3TN0A 5KVGL 1U8MA 3LZNA 4JKNA 4M7ZC 1KV3A 2IH9A 1KZYA 4ZX6A 1OLZA 2ENYA 4C58B 5E5MB 3RWJB 2YMOA 4QRSB 1YRKA 4QYAA 1I3GL 3RFZB 1NEUA 1U8PA 2P3YA 1YQ2A 4U1KA 3FB8B 4Q0XL 4YAQA 2VRKA 1E4XI 5EUKB 5EIIB 3D4GA 1M1SA 3JV4A 1KGCE 3CFBB 3ARPA 3B1TA 5AFAA 4QRRE 4JRXA 2Q3ZA 4X4YA 2G3XA 4JO1L 5ISZB 1GCFA 1P6FA 2ORBH 3EXJA 1BZ9B 1L0XA 3BFWA 4WWKB 4KJWC 4U1SB 1M71A 3EO0B 3HA0A 3LVEA 2BSRB 1QX1A 4N9OB 3VWKD 3ECVA 2CH8A 2CRYA 5B3SB 5KVDL 5CEXA 1RFDH 5HGAB 4YPJA 1NGQL 3FRPB 4L3FA 2WBJA 2NR6D 1X5MA 2P80D 4XNAA 2P8MB 4J1UA 4DEUA 3BQUC 4MNGE 1FL6B 2NY1B 4YDZA 3TCLB 1NCOA 4ADGA 1JPFA 5F0LB 2OTUB 3DC0A 5E2UL 5A2CA 3PV7A 1P5UA 3U9PL 1OE2A 3EIFA 4CKVX 4EI0A 4UYQA 2BCMA 5F1KC 5AZEH 3AROA 3ZUNC 4EXKA 1WICA 1U8NB 1N0LB 1OT1A 4HDIB 3DX9A 4H8QA 3U7WH 3EFFA 3ZGIA 3DARA 2QPEB 1L7TH 4Z3EA 4URKA 5DMIL 5JW4Q 4YHIB 4XP5H 4GXUN 3QNXA 4PI2A 4D9QD 3HB3C 3T0DA 1CE1H 1J9QA 1P7BA 3UAJC 1I1AB 2VABA 4OAWB 1GPOL 4HH9B 4KK8D 4I89A 2R29A 4YK4C 3WUWB 3UPRA 3NOIA 5EU7E 4HWBL 5BUAA 3S5LB 3IE9A 3N1QC 3C60A 1IEAA 4DAGH 3PWNB 3MDJA 4PUBL 1IM3D 2Y36L 4MDIB 3IBEA 1O75A 2B9AA 4O9HL 1OGSA 3BT0A 3GBML 5C0ND 1R33A 5ECGA 4KI5D 1XCQA 1RHFA 4G6JH 3U4EB 4YPGB 2IVFC 3SO5A 2A83A 3EF4A 3ZZ1A 4QLWA 3CG8A 4FI8A 2EDEA 3U1QA 5E6IA 5F0PB 2FATH 4M29A 1GYCA 2D9QB 3NZHH 1U93A 5JZ7D 5GS2H 1GZQA 3FQ2A 2OJEB 5EZIL 1TZIA 1TNMA 1RCYA 4I3GA 5D6CB 4GBXA 1BVOA 4ZPTB 2FJHB 3K6IA 3U4AA 3AREB 1W80A 2O5NA 3NCYP 4J6RL 1RJCA 2PPCA 5JW4R 2ISDA 2GTZA 1QFPA 4OGQC 1LQBC 5DURD 3KBFA 5I6XC 3IFLH 3RB5A 3D50A 4IU3B 2R2BA 1KCSH 3LV3B 1AI1L 1J0KA 2CPUA 5DHEA 3UYPB 1TQSA 3JSSA 5E8EB 4ZS6C 1YPZA 1JFQH 5HHMB 1CFTB 3UG5A 4KVNH 4XVTH 3AWGA 1HL5A 3LKRA 4KY1L 3QZNA 2Q3AA 4R26H 3LN4B 3VE0A 3WG7B 4DQAA 5B8CB 1BQHA 3DIFA 3L4CA 4HXBH 4PGDB 2QSTA 1UACH 4LKCA 4YLBA 1BAFL 5AWNH 3SE4C 2YQ3A 5IQOA 3FOLA 2FEDC 4Y9GA 4Z7VF 2CHWA 4HFWB 2YD0A 3S35X 3G5VA 3FO2B 2VOTA 4P2OC 4IBLT 5K39B 4S1DD 5H37A 3QNYA 4NZTH 3F64A 1A1MA 1I9RL 1RZ8A 3EJQA 3JTTB 2X5PA 3OF6D 1P4BH 1OSPL 1NGPL 4JUSA 5J89A 3RX8A 4BFBD 1OTUD 1PD1A 3VI3A 4JO2H 2RQEA 1LP9E 1DJIA 3AU0A 3PPEA 5FM5M 3ELAT 3VI4E 6PCYA 3VCLB 2ADJA 5D7JB 1XVSA 5KN5A 4WIQA 1S5HA 2A3TA 3HMXH 4PRDA 1NCJA 1BWMA 5FF6A 4X0KA 4TQ8A 1VFAB 1M2OA 3MLYL 3FUHA 2M1KA 4F7TA 4LVHB 4HUWA 1HN1A 1MKFA 4JHWH 5EG6C 2MQ3A 5F9JB 4GJTB 1BOYA 4U6VL 5JQ6H 3OBAA 1HFUA 5CCKL 4KHXH 4K5MA 4ODWA 3IAGC 4BZ1L 5AB9A 1MH5A 1REIA 3CFTA 2VSDA 1E27B 4CVXB 2GK2A 1HZHH 2HX7A 3RWFB 3QEUB 3GTTA 1KJVA 5GGUA 2LTQB 1OTSD 1U8IB 4IBTA 3X1BA 4LPUA 4RZKA 1NIEA 5CZXD 2NXYD 2OR9H 4ZUSB 2HT3C 2EH7L 5J0BA 1H9DA 5CUSL 4UINH 3L5XH 5HDLA 5HYQA 1V7NH 2Y7QA 3FO0H 4LCVA 4XP4L 1ZOXA 2UZYB 5B39A 4FQQB 5IM7B 2QLVB 2X89D 5LGHH 4F92B 5CEZE 3ZDXE 3ESUF 4UU9B 4GW4B 3GZKA 3N42B 3U46B 3L3OB 5CILL 5IR1A 3BE1H 3MUGA 3T04D 1C5BH 2I32A 3T3PE 2P5WD 3U2IA 3DWTA 4X6EA 3VG0H 3WNOA 3Q13A 1EO8L 3NFSH 4GQ9H 2Y6TE 4P2RB 1G1CA 3FUKA 3VH8B 1Z9PA 1IGJB 5BMFL 4TYUA 4CVWA 1YEKL 4NSKA 4PRHD 4GI9A 2IFFH 4JO8A 4YIQB 2NY5C 4HXBL 4HZLA 2H0PA 4Q74A 4AENB 2ATKB 5TQ2L 4WHCA 1LE5A 3RIAF 1ZEAL 2EDMA 1ADQL 2FYYB 4L3CA 4XCNA 4MD4B 5KSBA 4BSWB 1MXDA 2BFVL 5KSAA 1IC4L 2JCCA 5HPOA 1UJ3A 2X4SA 1SM3L 1DQQA 1LK3L 5C0DB 1CFVL 4HAGA 1UURA 2VR4A 3U6RA 4IRJB 4PJFB 4M62L 4TNVF 2IOMA 3U6XA 2EIDA 4H0HB 1VPOH 3WOVA 3KR3L 4P5RA 5B38A 4XNMB 2RACA 4R97B 4JO3H 3SDAA 1QBML 2NW3B 4FL4B 4ZUWA 3VFTA 4AENA 3L1FA 2YKLL 4D0DB 1UOKA 2XXGA 1YJDL 3GQFA 1IGFL 5CD5C 2A0LC 5EZIH 1WZ1L 3Q6FA 5DJ2A 1KY6A 1X7TA 1FHNA 4WI8A 3ELQA 3MREA 4L8SB 3RWGB 3LKSB 2OK0H 2JLPA 1HHKB 5HYJE 3AWFA 4E9LA 4X6EB 5I6PA 1ACCA 3FCTA 2OMBA 4M8UA 1A2YA 2WQUA 5E5RB 1HU8A 5KS9E 2VDLH 3NJIA 2NYYC 4L8CB 4Q14A 1LEIB 2CWRA 3DBXB 1W8OA 2ENPA 1OLLA 1M9SA 2ZOWA 4LSQL 4MD0A 4JLRB 4FFZH 1NGXB 2VZTA 4H5SB 5DJ6A 3L3HB 3FU3A 2YPLB 3WS6A 2EXYD 1QFOA 2LU4A 4J4PC 1IFHL 3AS1A 2ZCKL 3ZDXB 3DYOA 3WHXB 5AD0A 1BYOA 4P9HL 5GSVB 1D7FA 1B0RA 4HJEA 1OWRM 3C5ZD 5FA4B 1K85A 1NBVH 4OQTA 4WWNA 2F6AA 1IAKA 2ZJSH 1F00I 1O7DC 1NGYA 3QEGH 3QQDA 4WKZB 5BUGA 4RMBA 3E3QC 1D5BA 3FFDB 1AZRA 1EXUB 2VMEA 2CIKB 3B5HA 4KROC 4A66A 4PJ5A 5ID0A 3QG6B 3VFVB 3TN0C 1ZGLA 1U41A 5B38G 1N59A 2X6VA 1OD7A 5IQNA 2FX9L 5ACLA 3JTSA 5KN5B 1DE4A 4O51A 4O5LH 1U95B 4S1QL 5GGTA 5KUKA 5IQ9A 4U6XA 1HL4A 2P49B 3F7YB 1FAIH 3G04B 3DO4A 3QDGD 3KWUA 1G9HA 2MPAL 2HJLA 2NY3B 4HPOH 4KX8A 4AGPA 3HS8A 1BQHG 5JW5A 2R23A 4NO5B 5C9JA 1XSJA 2H3NB 1AQHA 5HYJD 1UATA 1JTTA 3K8MA 4S1SL 2MRYA 4ZFQA 2ZUUA 3GPEA 1FCGA 1JYXA 5FHAH 3NUKA 4HHAB 3DX4A 4AC2A 4FJ6A 4YS4A 1IQWL 2VXQL 4LFHD 2EUWA 5FHBL 2AXJA 2HN7A 4UINL 3FOLB 4P4KC 4N25A 1JZHA 3RE0A 4PGDA 2YKLH 3QS2A 2FLRT 3RGVC 3F12A 1AR1D 1XR9B 2DM7A 2YARA 4JKLA 1RZKH 4YN3A 2NNAB 1OXYA 3UDWA 1CF8L 4Z3IA 3LQMA 2HKAA 3ESNA 4GG8A 3NFSL 2P28B 1EJOL 4QHNB 3LH8A 3IRZA 3VXSD 3QRGH 3VXME 4F7CB 2DQJL 3PWPB 4PB0L 4ZOBA 3VW3L 1NCHA 2NZIA 3LAFA 2OR8A 1PG7L 4JJHA 5TQ2H 1KLFA 4EZLA 4LCYA 1MVUA 5MP6H 1HOCA 3HRZB 2ZAGA 4J6RH 1LLAA 3WKQA 1HH9B 4PJGA 3E8UL 2CUIA 3MJ9A 3D39E 3IJ7A 4TUUA 5HTSA 1L6XA 2R83A 3RWHA 2OX5A 3IT8D 2GT9A 1FI8C 4L4TE 3SZ6A 2G4GA 1HHGA 2QV4A 1TZGH 1CDCA 1MFBH 2ZOKA 3JZYA 4X9FA 2MHAA 3IXTB 4TN9A 5ANMA 2A83B 1JNHA 4XZ4A 5F7HA 2BNQA 4NCDA 2B59B 3GXMA 4LARH 4DGWC 4YSAA 1M2VA 3N41F 4MDJB 5F6IC 1U91A 1KCRH 1JCVA 5I1CH 2XOTA 2XRAL 2OL3A 4B27A 2X6UA 4JDEA 4PCYA 4UQBA 2HRLA 1MFNA 2DQIL 3MBWA 1NCGA 1BG9A 4P06A 5I5RA 3QRBA 3HAEB 2B3IA 5GGQL 4LAQL 4NQVB 1AHWA 3RKDD 4KRPD 1SBBA 3OR6B 4P5KB 4AEFA 3E3QE 1TCRA 1RH8A 3U2JA 2ZUXA 3C6SA 2GW5A 4HHWA 3QO1A 4OCWH 1FH2A 5T1LD 2Y6SD 3NG5A 2EABA 3F7PC 1JPGB 1T5WA 4WI3A 5FOJA 4Z7OE 1BIHA 1WAAA 4UNTA 4F2MA 2VC2L 4OJYA 2WIIB 3KYNB 4PJEF 1OAZL 1ZGLM 4KI5E 1Q0EA 1XEDA 4X5WA 3QI9C 3QQXA 4MBRA 5L7XH 1WZLA 3FT9A 2NY1D 1NMBH 3CE1A 1ORQB 4Q6IA 5CD5D 4KXZH 4BQ6A 1I9IH 4A2FA 1O0VA 5FO7B 3CVIL 5BS0E 5C0JB 1S6NA 4BDVB 1XTMA 1YEWA 4NM8H 2VZ1A 1LVEA 4PGBB 5LGKA 2EEXA 3QQ4B 1ZWIB 1EUTA 2AZUA 3EJCA 5TE6L 2VRAA 5T1DH 1JF1B 3EJSA 4U1NA 1A6TB 4BGDA 2PTTA 3MLWL 2E9WA 5DK0B 5I1LA 4DF9A 4B9IA 3NN8A 2GUOA 2IXQA 4G8AC 3GHBL 5FW8A 1B2YA 3TZVB 1KNOA 4I4WA 4RGOL 5BRZB 3PG2A 4LESA 4MJ4A 2VDRB 4K9EH 1J8HD 1TMQA 2RFXA 3C5XA 2X4UB 3O6FC 1A4AA 4U4BA 3D0LB 4XVUC 2WN3A 4BBWA 1RIVL 1IARB 4ZXBD 3C87A 1CGXA 1IM3A 4XOAA 5GZOA 4YHZH 1UEMA 4JRFA 1FG9C 4NO2A 3RI5F 2YA2A 4TSAL 4UQCA 3ZZLA 2QPFA 3ZVVA 2Z8RA 2NPLX 3VWKC 4HP5A 4PRAA 4U3XA 5T1DL 5IFAL 2I60H 4O2CB 5AB2A 3WS6C 2FHBA 3H4HA 1M2VB 5DHMC 3V4VA 1GGUA 1ZAGA 2Z92B 4IOFC 2WQWA 3ARRA 4XAKE 3EOBA 3FUNA 4OFIA 3MRHB 3O6KL 4AIEA 3X2QB 2XKNB 1B2WL 4AYFA 3P11H 2FZ3A 3FN3A 2AHIA 4IRJD 4YZFF 4X8JB 4I7ZC 3MNZA 4R90H 5DD3H 3T0WA 1TG8A 3BXNB 1N6UA 1CXFA 4I18B 5AW0B 1AIZA 3BH4A 4GSUA 1CE1L 3NDYE 1GGIH 1NAMH 5B7MA 3GSVA 3SBWC 2JJTC 5EC1A 1QBAA 4N0RA 5F89A 4DVBA 5I8EA 2C1OA 3KNBB 2ZYRA 3N06B 1JPST 2J8UF 4LLUA 3IS0X 1PG7X 3BT2L 5CSGA 1FL5B 4F2ME 3C5ZC 4YXHL 5ABDE 3FKUS 4F3FA 1CXHA 1JZ4A 4OI9A 4H2CA 4MRCA 2AEQH 4DPRA 2HT4C 4GSRA 1AGEA 3ZIMA 4Z3FA 5IHHA 1D5ZA 1COBA 4R0LA 5F44A 1JRHI 6CGTA 2AP2A 2AVGA 3HC3H 3CLEL 2OLDA 3FB5B 2TAAA 4FYSA 5IF0A 1OAYH 2D7OA 2R0ZL 2WSDA 3VFSA 4G59C 3E2HC 3RNQB 1TFPA 3GSWB 3ZDZF 2VH5L 1Q8MA 2NY7L 5M7QA 5D7KE 4P3CH 4ZW5A 3VGBA 3ARGD 2K6YA 3PUUA 5F9OL 1HH6B 1RZGB 2CUHA 1GVIA 1TQCC 1M3IA 1YMHA 5FCSH 1EHXA 5SWQA 3WCYA 1LO0L 4NO2B 5DJ8B 4X7EC 3CFDB 3VXMB 5L8LB 1CI5A 4O4YL 2DTMH 3HS0B 2HFEA 1B4RA 4LLDA 3B2UD 4P3WA 2XT1B 2XWZA 4K23H 2Q2LA 1JWUB 3CK0H 1VERA 4PRHE 2G2RA 1X6NA 2BVYA 4TF4A 1PL3A 2J2ZB 3QG6A 1ZTXH 3RZCC 1R3HA 2KUTA 4BH8A 4AXWB 3RVVD 3PABB 4PREB 5KEZA 1YEHH 2ADIB 1KNOB 3STZA 5DCCA 3WEXB 1GYVA 2V3FA 2GUOB 2IXQB 3P3SA 3MA7A 3CLWA 1U8QB 1IAOA 2LTQC 3QK0A 3WAJA 1FVDA 1SOXA 1RUQH 1WS8A 2F5AL 5FA4A 2APTA 2GBAA 3EYQC 3Q6GH 4MMYB 2GI0A 3I2CL 3BQUB 3MUUA 5CN3A 3WTTA 1QSZA 5IK3A 3HN5A 1NANI 4Q6IB 1AMYA 4Q9CA 5IBTH 2Q6WA 2IGLA 4UMGA 2ADYA 4Y2LA 1EGJH 5IVNA 3VWJA 3GHBH 4G43A 5MHSD 2BIIA 2HH0L 3L3GA 2VDLL 4F58H 1ZT7B 4X5RA 2VKXA 3VG0L 1FGNH 1NDMA 2ORBL 2X9YA 4U2ZA 5DRXA 2GEQA 2K7PA 4L29B 4LOEA 1VIWA 2FBOJ 4FTDA 5AW8B 3TF7C 3BUYB 5H2BB 3S98A 5TQ0L 5T1KB 5GS0H 2W65A 2EECA 1FRGL 2WWNA 4Z77A 5C07D 4PJHA 3TFBA 3NJLA 1QA9B 1K5WA 4N2AA 2QQLL 3CFJB 1QSVA 4NWUL 4ZD3L 1CLVA 4WKXA 1ZPUA 1R1CA 4JRXD 1CD8A 2F15A 2DKSA 5EDXA 2FBJL 4MCYA 4FKHA 1PS3A 4PRIA 1XCTB 3MFGB 2Z35A 3NIGE 3VW3H 1IKFL 2X4PA 4PGCB 4YE4L 3SJVB 3STLA 4H0GA 3EJRA 4JZJC 5IIEB 4PJ8B 4XNZB 3ULUH 2HP4A 3D09A 3AT8A 1TJXA 1EJOH 1QHQA 3BWUC 3FO0L 4XP4H 2MQCA 2V4LA 2X4SB 4WUKL 1CUOA 2Q8AH 2W9EL 4PRPD 1UZ6F 1EO5A 3BAWA 3NPZB 3U7YH 2NR6A 3BIKB 3VFOB 5DZJA 1MW0A 5EU7C 3W2DL 2BRQA 4Y4KD 5DO2D 3UGUA 1DL7H 5I71C 3QZPA 5HJ3A 1U3HB 2GBVA 4HV8A 4ADIA 4G8GE 4N0YL 4NWUH 4QWWD 2EIZA 4KMLB 2J71A 4M61B 2I07B 3GKWH 4X8XA 3DIVA 3APFA 4JAMA 2R69A 3HRZA 3QI9D 3QH3B 4M4RB 5FV1L 4D7BA 3HFML 3VH8A 3F5WA 1N4XH 4CKQA 3R8QA 1A1NB 2DKMA 4R7VA 1ZPLA 4HH8A 1U33A 1QLRB 4IHOA 4Z7UF 1CICD 2PKDA 1SFHA 3J27A 3WTWA 2VW7A 4OZIA 2FSEB 1QI3A 2D0GA 3JVGC 3MRBA 3P4MB 5EOTB 1XF2A 2P46B 4AUUA 4F2EA 2ESVB 2J6WA 3LEVL 1N7MH 4RFNB 4X7DC 1G87A 2UZIL 3CJJA 1DLFH 1CG9B 4RNRA 4JM0A 5T3XL 3FNKA 3AU1A 2ZUYA 2EJ1A 3M1BB 3L3OC 4K94C 3F12B 5GGUB 2O5YL 2W0FA 4R7XA 1BFVL 2YD5A 4OCXH 1J86A 2FR4A 1SDAB 3LEYH 4O2EB 4GI6A 3C60C 3H42L 1YVLA 4K3DL 1S7XA 4IU2B 4ZZFA 3RAJH 4JHBA 4DOHB 2L7JA 3S88H 2YEQA 4LE8A 4M56A 4YHYB 3T5WA 4QRBA 1G7HB 5DWUH 3SGJA 4E41A 1WH0A 1NSNH 5A3ID 1G1KA 1ZHKB 3G5XA 4IGBD 4AEIL 2XZQH 1IBDA 4ZMWA 4HIEA 1G7JB 2XG5B 4L1TA 5F9JA 3VFMB 1DVZA 3TBVA 3ZE0B 1HINL 1TJIL 4PIRF 4TULL 1W0WB 5CINH 1TO5A 1VACB 3D2TA 3VXMD 5I23A 2QEJA 4F7TB 4CMMA 1YY8B 3QUZD 4ZUTA 5C2BH 4HS3A 3LKPA 1NAKL 3QR0A 1NBZB 3VD1A 1A4JA 2FLBT 1A8ZA 4U6HA 5FK9B 1OP4A 1E9QA 3AMKA 5T3XH 5E6SB 2Z93B 2A5UA 4OM1H 4RWYL 2W0LA 2AV1B 4PJXA 4Y7MA 5ADPL 5KSBE 4BQCA 2ITCA 1OSPH 1CJYA 4E9WA 1ETA1 1NA8A 4F33A 3PIQA 1JI1A 1Q9LA 2KERA 4L5FL 4LLWB 4PJ5B 4Y5VA 5HI4C 5BO1L 3JTTA 1NLDH 2WWMC 3HNSL 1NUNB 2DWXA 4AC4A 5HD8C 5DJ0A 1CFNB 3FO2A 3V0JA 1I53A 4HIXH 2XQYK 5E8PA 3ULUF 3G5VB 1CFQA 4HXAL 4FMFA 1WEJL 4XCYA 1EJ6A 1BV8A 1Q9WB 3HUJA 3DGCR 2ZWLT 3UYOD 1OKEA 4RFOH 5E99L 5JHMA 1MCWM 2C5DC 4WW2B 3ZOAA 4A68A 1BOGA 4WHTB 1CK0L 4AKPA 2XA3A 4C59B 4XP6H 1KBBA 3RGVD 4FXGA 3V6OC 4PEEA 3T71A 4JHAH 4JPIA 3QAZC 5T33L 3DPBB 1GMEA 5EH1A 4HGWA 3AQDA 1NKRA 2QVIA 2J6EA 4I3SH 4Y1AD 4S0SD 3U36A 4Z78B 2BNUB 1LK2A 2HXAA 4P2YA 4U6VH 3QS3A 3RGBA 3K1DA 4AQEB 3VD7A 5DXWA 1INEH 3QUMA 4PJXF 1T2XA 2IV8A 3D1MC 3A5VA 1JGVL 3P9LB 4CNIA 5FPIA 4JFED 1UWFA 5EZOH 1YO4A 2C3XA 5FLUA 3DBSA 1SYSA 1E5YA 4FNQA 1XR8A 5D6CA 4APQA 2R7EA 3WY4A 4HJSA 1QP1A 2C9AA 5AVZB 2XQYA 4A63A 2WOBA 5IHLB 4QKXB 4MNHA 4FNLL 4AKQA 3GHEH 4ATWA 4XNMA 1BYPA 7FABL 4QF1B 4NO0B 1AHKA 4BWTA 1FZMB 3O2DH 1SOKA 2KI6A 3SKOB 4ODUB 3ULSB 5D7LE 2XZQL 2ZUWA 5DJZB 4PJEA 1BIIA 4TNGA 3KZ8A 1YECH 3VXSA 5AVTB 3W0WE 1VHPA 3GDCA 3HTLX 3V6FA 2A9NL 2AVFA 1HYSD 2V0AA 1TU2B 2GITB 3NJJA 1IEAB 3R18A 4R3SA 5B7FA 3M1CA 1JWSA 2B3RA 3SKJH 3WTUA 3X1EA 1EZUA 3WUWA 3UPRB 4RFEB 4I5BB 4W9ZA 4JZJB 2X2JA 2IOOA 5CLWA 3Q44A 3P3UA 4QXUH 3DVFA 1T5XB 2BVPA 3K2IA 3CSGA 5AAWC 5ADPH 3N1FC 4NQDE 1ND0A 4J12A 1ET8A 2ADGA 3BKCL 1MCNA 5FUOH 1FFPA 2IO5A 3GJFH 1P1ZB 1YCSA 3QORC 3HC0B 4DCQB 4L4VD 3DX9B 1HCVA 1AQ8A 1LEKA 1QSEA 1T21A 2PPEA 5MEOA 1B3IA 2KQNA 4KKRA 2YUZA 4WW2C 1J9CT 4X4XA 4XNYL 3I75B 3FTGB 2VN6A 3MKKA 4MS8C 5AW1B 5LO7A 1U36A 5IM7A 2PABA 2UZYA 3QUZB 1CC3A 3TO4D 4KU1A 2D7TH 1LO3H 3PHOB 4E9TA 1MCPH 3GMMB 2FB4L 3TLRA 1DLFL 1L9PA 3VYNA 4DQOH 3T4YA 1KEGL 3ZK0A 2H26B 4Y0GA 1C7SA 3ZKXB 1WAAE 2C9UA 3O6MH 3OM3B 2CDFB 2CLZA 4PLOB 4P23B 4DSYA 1NQBA 4Y89A 5HYJA 4K94L 3S48A 2GABA 2Y06H 2GSIB 4FI7A 3N9GL 1S9VB 1MH5B 3NIFF 4L48A 3TYGH 1IVTA 4X4XB 3CTTA 2C3VB 3L3JA 3QXAA 1Q90A 5EF2A 1WG3A 4ETQB 3PU7A 3C8HA 2ENJA 3BO8A 2DQGH 2P8PA 2F8IA 4MFHA 4PJ9B 1ZJBA 2ZF8A 4U1KB 4P5SA 3LQZB 3HBZA 2XJKA 4RETB 2QADD 4A04A 3D2UA 2ZKHH 1JNLH 1HS6A 3HFMH 3GMRA 2ESVE 3EGDA 4NUJB 5F3HA 2FT8A 2XX1A 4RFEA 4FMKA 2J21A 5DFAA 4Q9QH 5FW6A 3JXAA 3RWIB 5TK4A 2EEAA 5I75B 4KRMB 3VM5A 1WEJH 5D5MA 2Z7WA 1E4HA 4MWFA 5JPMB 2YGQA 4LSTL 2WP3O 1KTDB 1E42A 4R2GC 1CU4H 4JR9H 3DECA 1QG3A 4LP4A 4OH2A 4WO4D 1F6AA 2KLRA 2CK0L 3HNSH 5J57B 2WXIA 3S96A 1RPKA 4ODUA 1F4YL 3QCTH 4ODTH 5PCYA 3WFCL 5F7WC 1GC1H 4J23A 1EIBA 4G42A 3BH9B 3IU4H 4PPTA 4DAGL 2EC8A 2QJDA 3AS3A 4HLZH 4LKCB 3ZO0A 1D5XB 2MOVA 4Q56A 5LNEA 1R19A 3H9SE 1PCSA 4PWHA 1FFQA 3T1FA 5A2AA 4CSPA 5MI0B 4AEEA 3G6DH 4MMXA 3KPSE 1KZQA 3MJ6A 1JZ7A 1MFUA 3MPCA 1H6FA 5IJKC 4BZYA 4GUCA 5IW1A 3GBEA 4XBPB 2MCAA 2IWGA 3MZGB 4HMDA 2P26A 5DRNA 1OARH 4P59L 2K6WA 1A65A 1ZE3H 5IZ7A 1L5GA 2FTAA 2VYRE 4UILL 1YEIL 4YE4H 1KEML 5D1QE 1HIMH 1ZT4B 1J5CA 5KSAD 4G8IA 3Q5YA 3GSNB 4FQIL 2PXYD 5B21A 2ALAA 4AQOA 1R0AH 1LQSR 1TQTA 4H1LA 4P46C 1NBYB 3T1FB 1TZIB 1TJGH 4CBZA 1S7UA 1CTOA 3IMVA 4NP4L 1DLHA 4IMKC 2WZPD 5E56A 3QIWA 2VLLA 3ZXAC 3HLAB 4L5FE 2FEEL 4CU7A 2YQGA 2EIKB 4OQ1A 3MRLB 3L1EA 3B5GA 3V95A 1A6UL 5KG9B 2I85A 2M8XA 3FAXA 1U8JA 5IFJB 1RPUA 2YBRA 2C26A 3E0GA 3ALWA 1IU1A 1KTDA 1W0VB 1EHLL 5TGBB 1TQBC 2VW6A 3KLAA 3K8KA 4MWFB 3A6BL 4KV5E 2P42B 4I87A 3CK0L 3OTTA 4X99A 4U1MA 1QTSA 1CL7H 4PWFA 3TA3B 1T04A 4R90L 4YX2L 4V1DA 4OKVB 4WDIA 1UOWA 5I26A 3IJEB 3VVVA 3KPSA 1NBZA 4DHLA 4P5MB 1YY8A 2BNRB 2XETA 5FYJH 1J1PH 3UZEA 4DT2A 4PRHB 4FXLA 3RURA 3TBVB 4PVNA 1RULL 1A3RH 3KG5A 1YEFL 4RMVA 1XGQA 3TJEL 4G7YL 5CSZA 4NZFA 2A6IA 2DD8L 5GRVL 1FO0L 4P9MH 4ZMLA 5GS3A 3HG1B 3OXRA 3LIZA 2BRRH 4PWJA 4YDKL 4YO0A 5FM8A 1PJ9A 4FOMA 5GGRY 4PLNC 3U0PB 1I75A 1DDHA 3RVVC 2KC0A 2YXFA 3S3PA 2IANE 3FT4B 4LCCA 1A6AB 5AVYB 4NB7A 2I7SA 1RIUL 2F8VA 3GMMA 2C9RA 2FDBP 4V2BA 5ITBL 1H6EA 3HZMA 4GRWH 3UYRH 4H20L 4XBEH 3GIVB 5BZWB 3Q06A 1T5KA 2D0FA 3TEZA 2F8XC 1VEPA 3NFPA 4LSDA 4MHHG 1IIIA 2YPLD 4OCSL 1JZ6A 2K4AA 2GCYB 3RG1C 2EYRB 3V6OA 1Z32X 3B4NA 3DO3A 3KLHD 43CAB 3ZKXC 4DFIA 2XQ0A 4GI8A 4PW3A 3NDZE 1U92B 1ET5A 3QIWD 3H7BA 1S7WB 3K6NA 2ADGB 3MV8D 3QH3A 4M4RA 2OK0L 1JZIA 4OIAA 1QKZH 3LMJL 3MNDA 1PYWB 1T1ZA 3FH8A 3TA4D 3RWJA 1ZSDA 3I02A 1KJMB 3VXOB 2WXLA 3ROOA 1BF2A 5KYUA 1JCKA 3S5YA 4ESKA 1KJ2B 3ZY7A 4OTXL 1PEZA 2PYEA 3QFJB 3BWAB 3D69B 3GSXA 4ZTEA 3RRQA 1E30A 5KOVC 1TVBA 4RA0C 2GJPA 1WDAA 1EFXA 1BIIB 3NZ8B 2ED7A 1BM3L 5IIEA 4LOUD 4OFKA 1ILSA 1L9QA 4XNUH 5CF3A 3TV8A 3IM1A 3TX4A 2NW2B 4QF1A 2FJFB 4KJYA 4PP2B 1IFRA 1KJ3H 1NOFA 1CLOH 2QPSA 5BZXA 3UX9B 1QOKA 4R2GB 1S3KH 5EORH 5DLML 3MRCA 3HPLA 4K5PA 2UY6B 1UJ3C 1UFUA 3H2QA 3CFCH 4M7KH 3ZTNH 4OLWL 3OX8B 4PJHB 3QDJA 4QMEA 3LRSB 1DCEA 4L37A 5LDSA 3TF4A 1FYTB 4FYQA 3BUYA 1J8KA 3W81A 4FNSA 1GCYA 3O41B 1A7QH 1OGAA 1DYZA 3ARVA 4PR5A 3L5IA 5KJRL 1OCRB 3P3YA 4AGNA 2X7LA 4AYDC 2D2CC 3S7GA 3BCDA 2CCLA 3OJMB 1A25A 1JGUL 4B9CA 3ZR6A 4KPHH 4Y7OC 1MFBL 1UD6A 5CMAB 1X9QA 1EX0A 4X6DA 6TAAA 5AW9B 2Z8SA 2OYLA 2EDQA 4XHJD 3JWDL 3LDBC 5KVMC 4Q9QL 5IK3B 4PGEA 3MUY1 2HX9A 2ITFA 3MNWB 3MACL 2EYSA 3RQ3A 3P77B 5L4IA 2CRIA 1EZVY 5CWSA 4B50A 3FONA 4JFQB 4WEEA 4OF8A 5M94B 4H1LG 4LPXA 5EU3A 5DD6B 4JY4A 3L4ZA 4DN4L 3LZOA 1FE8L 1TCMA 1WFIA 3VGEA 1LK3H 2XIIA 3Q2LA 4LRIC 4ELME 3H2PA 4DO6A 4N90E 3PABA 3ZDWA 1B4TA 4OGAC 5IVXE 2AKRA 2PCYA 4TLSA 3ZYZA 1CGSL 3KJ6H 2P7TA 2XA8L 1ZV2A 1BSIA 4B9GA 3TEXA 1RAMA 4LRIA 2DI7A 4J39A