1V10A

Structure of rigidoporus lignosus laccase from hemihedrally twinned crystals
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
494
structure length
487
Chain Sequence
b'ATVALDLHILNANLDPDGTGARSAVTAEGTTIAPLITGNIDDRFQINVIDQLTDANMRRATSIHWHGFFQAGTTEMDGPAFVNQCPIIPNESFVYDFVVPGQAGTYWYHSHLSTQYCDGLRGAFVVYDPNDPHLSLYDVDDASTVITIADWYHSLSTKAPPAPDTTLINGLGRNSANPSAGQLAVVSVQSGKRYRFRIVSTSCFPNYAFSIDGHRMTVIEVDGVSHQPLTVDSLTIFAGQRYSVVVEANQAVGNYWIRANPSNGRNGFTGGINSAIFRYQGAAVAEPTTSQNSGTALNEANLIPLINPGAPGNPVPGGADINLNLRIGRNATTADFTINGAPFIPPTVPVLLQILSGVTNPNDLLPGGAVISLPANQVIEISIPGGGNHPFHLHGHNFDVVRTPGSSVYNYVNPVRRDVVSIGGGGDNVTFRFVTDNPGPWFLHCHIDWHLEAGLAVVFAEDIPNIPIANAISPAWDDLCPKYNANN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LACCASE
publication title The Structure of Rigidoporus Lignosus Laccase Containing a Full Complement of Copper Ions, Reveals an Asymmetrical Arrangement for the T3 Copper Pair
pubmed doi rcsb
molecule tags Oxidase
total genus 130
structure length 487
sequence length 494
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2004-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v10A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v10A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v10A03
2OJ1A 2DY2A 3T6XA 1SNRA 1GYCA 2JKWA 1NICA 2HX8A 3X1FA 2UXFA 5FC9A 2UX7A 1IC0A 3WNJA 2PP8A 1GW0A 4KOBA 2DYRB 3QJUB 4BXVA 1AS6A 4RH4A 2FWLB 1OCCB 3AG4B 1ZV2A 2CBPA 2FT7A 3NJNA 2AFNA 4HCFA 2VM4A 1JZGA 2BP0B 5I5IA 1BXUA 3ABKB 1BEXA 1NIAA 1PNCA 3S8GB 3X1BA 3JTBA 1KDJA 1XB3A 3T6ZA 1BQ5A 2AANA 2DYSB 4A66A 1V10A 2XV0A 1E65A 1JERA 2QT6A 3PLYA 1QHQA 2Y69B 1A8ZA 1HAUA 2GHZA 4F2EA 3S8FB 4G7SB 5I6NA 1TU2A 4F7KA 1YLBB 2PP9A 4KO7A 2BO0A 3V9EA 1KBVA 2A3TA 3ASNB 4E9VA 4JKNA 1CC3A 2YAOA 3CG8A 2YAMA 3NT0A 4EF3A 2J55A 1SJMA 2XVBA 2BP8A 5TK4A 3NJKA 4YSSA 3NSFA 1FA4A 1ASPA 1JOIA 4A2HA 2FNWA 3QPKA 3PAZA 5B1AB 3S3CB 3V9CA 3NJLA 2Y1AA 2YAQA 1A3ZA 1MG2C 4MFHA 1VLXA 4HZ1A 3CDZA 5I6MA 2DWSA 3UACA 2EINB 1BQKA 2DWTA 4PAZA 1MG3C 1SFHA 4YL4A 2EILB 1NINA 2WO2B 5E9NA 1J9RA 2H3XC 2CCWA 3ZDWA 3FSVA 4KO5A 3QJSB 1UATA 2R7EB 1A4CA 1NZRA 4YSEA 3BVDB 2FQEA 3CVBA 1XB8A 4YSUA 1KYAA 3PAVA 3S3DB 1GS6X 3T6WA 4GP4B 1NDTA 3UADA 1NIDA 5F7BA 2N0MA 4E9TA 3DTUB 1BYPA 2GBAA 2HRHA 4W9ZA 1AOZA 1X9UA 3QQXA 2YQBA 1BYOA 3TU6A 2Q5BA 2FJSA 4E9WA 5B1JA 1AIZA 2IH9A 1NWOA 3N55A 4KNUA 1BXAA 1PZCA 1V54B 1SF5A 2HRGA 3S3BB 1PMYA 2ZXWB 2QDWA 3IN2A 3UGEA 2IDSA 1IBZA 1JZFA 4KO9A 2JXMA 1SHWA 1SDDA 3SQRA 2XX1A 4BDVB 1ILUA 4DP8X 1L9OA 1HFUA 3T71A 2UXTA 2ZWNA 3AY2A 1AZCA 1GR7A 1N70A 4YVNA 2I7OA 1L9RA 2B08A 2PCYA 3IE9A 3ZBMA 1E30A 4JHUA 1NTDA 1OOWA 3FSWA 1L9TA 1AS7A 3H4FA 3QJRB 4G70B 4W1TA 1SHXA 4YSRA 2GC7C 5AKRA 4M4RB 1J5DA 2E86A 2CALA 1N68A 2ZOOA 3MBWB 1PY0A 5I5JA 3N2JA 4TXVB 1AZUA 2PPFA 2YAPA 3WNIA 4DP2X 4G72B 2YAHA 3SBRA 2PPCA 3H56A 3NP4A 4UAHA 3EH4B 3WIAA 2EIMB 5I6LA 3KW8A 4JHVA 4NERA 1A4AA 2HZHA 2VSMB 1QNIA 2XLLA 2FQFA 2QDVA 2OV0A 1NIFA 3IN0A 4GP5B 3X2QB 2BWIA 3QJQB 4QKTA 2HXAA 3D12B 4YSQA 2RACA 4HALA 3SBPA 2VSKB 1XMEB 2EIKB 4DP4X 1SF3A 2I7SA 1PLCA 2HLEB 4HCGA 2PP7A 2CUAA 3EH5B 1XB6A 1NIBA 3FT0A 2MTAA 1KCBA 4DP7X 2AVFA 1RZPA 1DYZA 4BWWA 2BZ7A 4HIPA 3TASA 3FYIB 4G7QB 9PCYA 3OD3A 1MZYA 5D4IA 2XV3A 2IDUA 1OF0A 4GP8B 4A2EA 1A4BA 2W8CA 1ID2A 3FQYA 1AR1B 1NWPA 2XU9A 3IBOA 1GY1A 4HHWA 1E5YA 1BAWA 1HAWA 1DZ0A 1OV8A 3G5WA 1KCWA 3DKHA 4YSDA 2YAEA 1QLEB 2HX7A 4NAJA 4NB7A 4ENZA 2GI0A 3DIVA 1IKOP 3L45A 1CYWA 1E67A 2NRDA 3GYRA 2X87A 1ZDSA 3NP3A 1GY2A 3SBQA 4HCIA 1KGYE 2TSBA 5D4HA 1M56B 2JFCA 3T6VA 1ET8A 1L9SA 5B3SB 1KBWA 3FU9A 5B7MA 1ILSA 3ZX1A 1TEGA 1GSKA 1BXVA 2J56A 3FU7A 2IDTA 2QPEB 5F7AA 3X1NA 4M3HA 4AKQA 5AZUA 1WS7A 1J9SA 4DP9X 1NPJA 2BZCA 2CAKA 5D4JA 3X1GA 2H5UA 4KOCA 3FSAA 3FYEB 1PF3A 2GC4C 1IBYA 1E5ZA 4GYBA 2X88A 3CDZB 2P80A 2BWDA 4KO6A 2WSDA 1CYXA 5PAZA 3FPYA 3AG3B 5I6PA 1PCSA 4QLWA 2OCCB 3FU8A 1WA0X 3IEAA 3NJGA 1T5KA 1PAZA 1J9QA 1FFTB 3X1EA 4YSCA 4X4KA 2GB2A 1ZIAA 2XXGA 1JVLA 2PLTA 1W6LA 3NJIA 2HX9A 4N4YB 1WAEA 1JXGA 3AW5A 1PZAA 3CVCA 1ASOA 1AZBA 1OCRB 2B3IA 1EHKB 2TSAA 5LDUA 3FS9A 4BWUA 1ZIBA 2XUWA 4WTQA 4CSPA 1RCYA 1W6WA 6PCYA 3CZUB 1OE2A 1TEFA 4A68A 4FAAB 1L9QA 1I53A 4YSPA 2UX6A 6PAZA 1PLAA 1MDAA 1WA1X 2BP0A 1AS8A 4UF7C 3QJTB 3TBBA 1ET5A 3FPXA 3UAEA 4DP6X 4KNTA 3OM3B 1L9PA 4E9RA 2EIJB 4KNSA 4GY4A 1JZEA 4F2FA 2QPDB 1SDDB 3PXLA 1AG0A 5I6OA 3MX0B 3NSDA 1JZIA 1OE1A 2FT6A 4YVUA 3AZUA 2W88A 2J5WA 3ZIYA 2VW7A 4E9YA 5PCYA 1TKWA 3ABMB 4A2DA 4AKOA 4DP1X 1ETJA 2IDQA 3NJHA 1PZBA 2LLNA 1AZNA 2BW5A 2ZONA 2VM3A 3C75A 2IAAC 4HAKA 3PCYA 1MZZA 2BHFA 4Q8BA 2FQGA 2I85A 1CURA 3ERXA 3WG7B 3OQRA 2AZUA 5IY5B 2FT8A 3JT2A 3EHBB 4G71B 1M9WA 1WS8A 1OCZB 1X9RA 3NSYA 8PAZA 1NPNA 4WKXA 1ZPUA 2BW4A 4PCYA 3TBCA 4YSTA 4HHGA 3WKPA 2UXVA 4DP0X 2GSMB 3U25A 1AQ8A 4L0PB 2GIMA 1GS8A 4G7RB 5A7EA 3RYMA 2R7EA 2CJ3A 2FQDA 2IDFA 5B1BB 2UXGA 4A2GA 4CSZA 1ET7A 5B1KA 3AG1B 1AZRA 7PCYA 1KV7A 5I6KA 4AKPA 4E9SA 5I5MA 1IUZA 3FQ1A 1JVOA 4DPBX 4E9XA 1ZDQA 1J5CA 1URIA 2IWEA 3GDCA 3CVDA 3FQ2A 1AG6A 3QJVB 3H4HA 4DP5X 3OMNB 4FA7B 1SFDA 2IWFA 2YXVA 3UAAA 1CUOA 2XYBA 2DV6A 2IH8A 5EHFA 1F56A 3AG2B 1M57B 1R1CA 2BP8B 3BQVA 4BK5C 1NIEA 4E9QA 4BDVA 1KDIA 1RZQA 3PPSA 1PNDA 3GXUB 1A65A 1JZJA 2XX0A 1OCOB 2WO3B 4N8UA 1JXFA 4AX3A 3KW7A 3NJJA 3NSCA 3ABGA 3NJFA 3NYKA 7PAZA 2Q9OA 3TA4D 2MRYA 1BQRA 1PLBA 1RKRA 3ABLB 1W8EA 2H47C 5B1JC 4BWTA 4Q89A 1GS7A 2XXFA 2YXWA 4P5RA 4GXFA 5I28A 3NJMA 3OMIB 1J9TA 5TK2A 5I26A 5ANHA 2FTAA 1AACA 2VW6A 2PPDA 4AZUA 3FU7B 2VW4A 3HB3B 4A2FA 1JZHA 5B7EA 4P5SA 2PPAA 1EZLA 1ADWA 2PPEA 3WI9A 3ASOB 1OE3A 3OMAB 1JXDA 3WKQA 1AANA 2P80D 2IWKA 2PCFA 4K9JA 3EF4A 2YARA 2XV2A 4DPCX 4AI7A 3EH3B 1AAJA 2VMJA 5B7FA 2YAFA 4A67A 4YSOA 5AFAA 3FSZA 1V55B 4ZK8A 4DPAX 4BXSV 1WA2X 1ASQA 2AZAA 1FWXA 2XWZA 1B3IA 3UABA 2J57A 4UANA 2VN3A 3HEIB 3PAUA 3T9WA 4YSAA
chains in the Genus database with same CATH superfamily
5FK9B 4NUJA 3AB0C 2XWRA 5GRVK 3LRKA 4OB5L 2YD2A 3ML8A 3WIHH 1LWRA 1TZHA 3CK0L 3O3DB 1H9VA 3ZN6A 3WFBH 1D5MA 4EVNA 5DJCB 5FDWB 5L2KE 4DGVH 5E4AA 3S35X 5T3ZH 4D8PB 3BEVA 3A23A 3AWFA 3QDJD 3UAJC 2EKSB 2VO8A 2WWKT 4NLAA 5JMRA 4QRQB 1ZA3A 2VM4A 4G8GE 4L4TD 1MJUH 2VLJB 5DFTA 4ZPTB 3D25A 5TFSL 1ZMYA 4JHAH 5JNYA 2H26A 2MKWA 4HH9B 5D2NE 4FMVA 4FLOA 4IRJB 5JO5B 5ID0A 2K78A 1XO8A 3HNTL 1CFVH 4HK0A 2DQTL 3MLWL 1ZV9A 5HHOE 3C09C 2BSED 1JGLH 3DHMA 3L3HA 3QPXH 1IU1A 2EIEA 2QT6A 5GJSL 2K7QA 5DUMH 5BV7L 2NY6D 1YJDC 1FO0L 2WQRA 1JYVA 3LIUA 1U93B 3NOIA 3CXHK 2E74C 4GBXA 4PJDE 2HG0A 5SWZD 1CLOL 2VXQH 2Z4QA 1DO6A 2KQNA 1CVSC 1I7UA 4UYQA 4QJ4B 2EIDA 2N1TE 4R0LB 3EXLA 1QQDB 3GSUA 4PYGA 2WANA 4Y19E 3TPUA 5JXED 1AD0A 2VDMH 5KYWB 1CC3A 4MQXD 2YWYA 3RJOA 1F4HA 5BOJA 4KXCA 1TQSA 2P45B 3GWJA 1U8NB 1Q1JL 4A2HA 2P5PA 3QXVA 4NBZB 4JFFD 2ZUUA 3X12A 3CDZA 4EEEA 5C9KA 5E23A 4PG9B 2AK4A 3RHWK 5AG8A 1YPZB 5TF0A 4B6ZA 4B9FA 2J7LA 2CGRL 3FBQA 4FL4C 3RRQA 3V0AC 2M26A 4NO5B 1OK0A 3MRPA 3RB5A 5CZXD 4TUOA 3WKNA 3IFNL 5JPMC 5FYKE 3WOVA 4AITA 5I66A 2YUXA 2AV1B 3IXAB 2IH3A 4KRPC 5CD5C 4BSVB 1QFHA 1SLUA 3AT9A 3QJSB 4MJ6B 5B38G 1AGFA 3T65A 4KUCD 3BDYH 3N44F 4FKEA 2C9XA 3AUWB 5I76A 4HFWA 3MLYL 4R9HA 3T6WA 1QTSA 1FV1A 3L3KA 4M93C 4X0NA 1PEZA 1HVXA 1QRNA 2D7PA 3DDGA 5ID1A 4UAOB 5MEOB 1MLBA 3CH8A 2HJFB 3GXPA 1NA8A 4DFHA 3RWFB 4J27A 1A4JB 4P23A 4WUUD 2X4SA 2X4PA 2NSQA 5FYLE 1H3PL 2OX5B 2QQLH 2OI9B 3LH2H 2GY5A 2IH9A 1NGXB 4NYLB 1BJMA 3B1UA 2VMFA 3U9PH 4R7DB 5BOPA 4MCYA 5E8DL 2IDSA 2EXYD 1JZFA 1UGKA 4HGWB 4AMKH 1N64H 4L3ED 4C83B 4PJGB 2FIKA 4IIQA 1HFUA 3T77B 1E6OH 4C56B 5AAMA 5IB3B 5C86A 2GSGA 4L05A 4U1MA 1IV8A 2XN9B 2C9VA 2ED7A 1RJLB 1IGTB 4CJ0A 2WKGA 1OL0A 2F54D 4O02L 3EBHA 2VH5H 4MJ5A 3TV8A 3OMZA 1JTPA 1AS7A 2XT1B 3HMXL 5E99H 4YQXL 4QHPA 3CSBA 5FGCE 5TDOA 3ZZ1A 3HE7B 1JYWA 1MREH 4BFGA 1UADC 3JQOB 2WSPA 3MV01 4WQOA 1G4MA 1OXYA 2CALA 2ENPA 2ICES 2OMVB 3NK4A 3MBWB 5AOLA 1CZ8H 4BKSC 2CU9A 3DO3A 1JMXA 4U6VH 1K2DB 4XP5L 5F6HI 3VFSA 5MHSD 1SLVA 5DHVA 2MCG1 3TO4A 5K9QI 4AYGA 4IOIA 2ICWB 3IGFA 2CUHA 4XC3L 5DC0A 4YDVB 4IW4C 2MNWA 4OGXH 4O2CA 4UQCA 5K1NA 4K3EL 3C6SA 4WGKA 1GGTA 1Z2KA 2WIIA 3VWJC 4N0UB 1KLUA 3RUGB 4YXKH 4E41B 4OZIE 2WBJC 3HR5A 1MRDL 4HWEL 4NFCA 3CFCH 4Z78B 5E2TL 1HOCA 2H3NB 5EUOE 5SX4H 1WZMA 4JGMA 2H1PH 1KELL 3PWLB 1E28B 4PV1C 5CCJA 3GMQA 4LLMB 3OF6D 5I0VA 1IT9H 3WIFA 2V2TA 4NKMB 4GW5B 4V1DA 1C1EH 1S9VA 3I02B 2HKHL 4HCRA 4K2UH 3DNKA 4OFVA 1CMOA 4PP1D 3RIFK 2ICEB 3QDJE 1A7RH 3AFLA 1NIBA 5EU7E 3IJEA 3FT0A 3L95A 3EZJB 4DP7X 3IGLA 3DV6A 2YKLL 5C7XL 2CXGA 5GSVA 4N6QA 4P2RD 2ZCLH 4QF1A 5CCKL 3UTZA 3A6CH 4J8RA 3SCMA 2V3FA 4GP8B 3VI4F 1NCHA 4PW3A 1A4BA 4YX2L 4KKAD 4WI0B 2WVUA 3WLBA 2AEIT 3ULVC 4FF9A 4HJJL 3B2UD 3ZLQC 4AH2A 3MLZH 1A0QL 3VVWA 5SWZE 1KCWA 1VADB 1LWJA 2OW6A 5DLML 4FZ8L 3MTXA 5G4OA 5J06A 2X6AA 4QY8A 4U4BA 3MR9B 1RZ8B 1IJNA 3IS1X 4FQJL 1KYUA 1D7FA 5B39A 5IZ7A 4QI3A 2QHRH 1L4IA 3WO4B 5CP7A 2P8MB 1L0QA 4M61A 1NLDH 2YSTA 5LCVL 4XAWH 4PJ9B 1BXVA 2B15A 1LEKA 3VXPB 3HN3A 1C5BL 2Y2WA 5IQ9B 2VR3A 5CZKA 2WHVA 1DQDL 1EFXD 1ZLSH 3OKEB 3OKNA 1UD5A 2IGFH 1WCBA 2PO6C 2OR7A 3MA7B 3VRLF 3VO0A 3LKSB 5AOKA 5BRZD 4OKVB 1M2VA 2LV4A 3K72A 4XP6L 3LOWA 2C9SA 5T5FA 5D70L 2V2XB 2YSSB 5L9DL 1EXUA 3B5HA 3Q6GL 3B3IB 1CF1A 4B41A 2BSTB 5DJXB 2XQBH 5IWLA 3SDDC 5AYUL 1KXVA 4MQSB 3OLGA 3PXJA 3GSVB 1G7IB 3DURA 3P4MA 4MSWA 4N2KA 1XF1A 3L4YA 4U1JB 4I77L 3NFPB 5KSBB 4XHJD 3PGFH 3BP5B 1XH1A 3QIUB 3AW5A 2X4NB 2R1WA 3C5ZB 1VGEH 2MSPA 4FFVC 5MENB 4U1NA 4IU2B 3N04A 1OAYL 4Z8FL 1LO5A 4RFEA 3BHBB 1F02I 2X6BA 4FXKC 2PXYB 4WUUE 5FEBA 1IGJA 4PN6A 4DUWA 2A9AA 5CZVH 5EU3B 4A68A 5GJTH 1TCMA 1YNTA 3GQFA 4N2IA 2VC2L 4IU3B 4Y2LA 2R56L 3QJTB 1GHFH 3CV5A 4XVJH 4NQXB 3OM3B 1TVDA 3WNKA 5CILL 1NUFA 3VYOA 1LP9E 4ZMQA 1MCJA 4GSQA 1HU8A 2RAMA 4CC1A 1U3ZA 2EP6A 3I2CL 5F7MC 3UTSA 2DL9A 5BO1H 2HLFC 3JSSA 2E7CA 1OGAB 4P2OC 3VG0H 1AZVA 2CIIA 1HILA 2QKIA 4QEGA 2ZXBA 1PYWB 2DBLL 2FEEL 2OM5A 1VENA 1N5AB 3F12B 3ULUL 5D7LB 4ZX4A 1J0KA 2IAMA 4PREA 1ACZA 2ZX7A 3RNQA 4PLNC 3VTTA 2VUOA 5JUEH 3VUAA 5MHSE 2ENSA 4Y2DC 1AQDA 4DKEL 5E4OA 4R2GB 1ZLDA 3IJHA 4KX9A 1GYVA 2GPZA 1XEDA 2BRQA 1RUMH 1CD1A 3D85B 2BIPA 4KJWC 5LBGA 1M42A 4JG1H 4OGAC 3IMBA 1FL5B 1RFDL 1H5BB 1DTUA 2NX5E 4WFEE 4EBQL 1F42A 3SOBL 5GIRB 2MCAA 1T4KA 4JUSA 4LP4A 3VFRA 5CSZA 5LHDA 4R4BB 3IDYC 4NO0A 4OBRA 3C8DA 2R2CA 2OMXB 3C9NB 3FKUS 4L0PB 3FU3A 1S5IL 1K3IA 3D2UB 1M05B 4XPGL 2EEXA 2R7EA 4ZS6D 3BWAA 2IDFA 1S78D 1LNUB 4G1EA 2BPBA 4HS3A 2K0RA 2XJLA 2VITA 4RRPA 5D7SH 2DLIA 2W07A 5CJ5A 3B83A 3LZRA 3WMPA 2C3WA 1AZRA 4TNVK 4IMLB 2VQ1A 1FC2D 4KI5D 1P4LA 2QV4A 5F9JA 4P2RE 3OPZL 1S7TA 2R39A 2BVTA 4ZTOH 1CICA 5GGTH 4JFOA 5C08A 5JIMA 3O4OC 4P46A 4LBEB 3MXWH 3HC0A 3U4BL 4JAMB 4HA1A 1CUOA 1WAAF 3L3GA 4NQEA 4U3XA 4GB9A 2IH1B 3TV3L 5BS0B 1XV8A 4QJ5B 4XNXL 2BP8B 4N9GB 4WTZA 4LVEA 5DSCB 3IE4A 5JW4R 4E9QA 1B88A 1KDIA 1UKTA 4GKOA 2F1BA 4OUOA 2Y1YA 3FRUB 4LL9A 5IFJA 2F53B 3V5DA 4DUVA 3ARDC 3TEUA 3GSRB 2J8OA 4YEFA 2R0ZH 2QVFB 4JKMA 4FQCL 1OCOB 3W9EB 3MRMB 1TCRB 4JPKL 4QT5B 5JQHC 1NAMH 4ODWB 4PR5B 5IOKA 3BLPX 3QDMB 2ALWA 2VMEA 5FUCE 4NUGH 3ABLB 2IADB 3OJ2C 4JDEB 1EMTL 1AC0A 4NP9A 1JK9B 4M3KB 4N8CH 2HVKB 3NK3A 1PQZB 1A6UH 1T1WA 1QKZH 4AQZA 3AXLA 3ZTJH 4JFUA 4QO1A 3HFFA 1YDPB 5BRZE 1F6AA 3HB3B 5FUOL 2HP4A 3VXOB 1FAIH 1N7ML 5FFGA 3NCEB 2AXFA 1SBSL 2YUVA 3KJ4B 2ZSVA 1U8QA 3U1QA 5T3ZD 4X4YB 5DGQA 1AIFA 2YQGA 2B2XL 4GG8B 4PJ8A 5TDPA 5IQMA 1KYFA 4KXAA 1QUNA 2HTLD 4OCMC 2COQA 1U8MA 4MJJA 5I1JH 5K9JH 4KZEH 1AO7B 4X6DA 4LBAA 2F5BH 5H2BA 2ENJA 4RIRA 5ESVA 1TVBA 4XP9H 1JPGB 4ORGB 5GRUL 5D5MF 5DWPA 1KENL 5GZOC 3ZKNC 2FE0A 2L4OA 1RZJH 1P5UA 2DPKA 3FB6B 2UZYB 3HZ3A 4BSWB 1EK3A 4YN3A 4CC4C 3CZNA 4RAVA 3GTVA 1O9VA 4Y4KA 4HDIB 1HSBB 5L8JB 1YNKH 4ZX5A 4CKVX 2UXFA 4N0RA 3Q8CA 3T4AC 1EGJH 1KB5B 4TF4A 1SQMA 1ADQL 2XTSA 4C58B 2LLGA 2FB4L 2ZX8A 3K0WA 4YFLF 4F2MA 3NJXA 3IMSA 4UT6H 3GF8A 3JT0A 2VLJD 4Y2OB 1OW0C 4PJHA 1BZ9B 2CK0H 5KZCB 1LO2L 3QDHA 4IRJD 2RH0A 5AB1A 3WEMA 4QXUL 2ZOKA 4XE5B 1G7HA 3EJQA 4KJQC 2OTUB 5HVWA 1P5VA 4BFOA 4LPCA 4CAGA 2HUHA 2FD6H 3QRLA 3CPUA 2BS9A 4PJEE 4J1UB 3QAQA 1HAUA 2OXHB 1KIRB 2XTJB 2FHCA 3HHRB 2MEJB 1FBIH 4M62L 1H0DA 1R3IL 4G7SB 4B5ZA 4M7JL 2OMWA 4Y1AE 3KPTA 1IC4H 1KB5H 1ND0B 3IKCA 2Z0BA 4WW2B 5D7IF 4P4RA 3L1FA 1Q72L 1RIUL 1V5JA 1L5GA 5DMYA 1FPTL 1KT2A 2EYRB 1FFQA 2FJFB 4RAHA 5CAYB 3C5XA 1IBDA 2PTTB 4XPFH 4EF3A 4E0RB 2DRUA 4PW9A 3L5WB 2WQWA 3AMLA 2C34A 3CFJA 3H9ZA 5B1AB 4XZ4A 4MJIB 4LCYA 5E5MA 1JV2A 5AW5B 2DH3A 4O9HH 3SGEI 1YQVH 1MG2C 1NEUA 2W92A 3L3DB 4ELDA 3CQPA 3M1CA 4JFHD 1NOFA 1VLXA 4WHDA 3SODB 2EVJA 2ZAIA 3G5ZA 3KDMA 2ZPKL 5DD3L 4RFNB 1XIWB 3CFNA 4KZCA 4Y1SA 3QPQD 1WBZA 2EDJA 5L4JA 4Y4FC 3AT0A 2NY3B 3MRKB 3QWNA 5EBWA 4DO5A 4KO5A 4Z7WB 2XWJA 3UC0L 4KI5E 1J8KA 5F6HJ 5J12B 2F18A 4BH7B 3VMPA 2NR6C 2VUKA 2JV6A 3ZTNL 4KTGA 4EZMA 3INUL 2W9DL 3MFFA 2XBDA 4ERSL 4E9TA 4U31A 4ZSOB 3UG3A 1ZA6A 4YFDB 1BYPA 2R2EA 1ZHNB 1EERB 2ZWKA 5DEGB 1HYSD 1R6VA 4N87A 3SZKC 2D2OA 4CU7A 4BFIA 4GRLC 3GM8A 4UMSA 2I27N 3ZGIA 4MXQC 4URKA 5E08H 5FCSH 3GT6A 2XWBA 1NCUA 3VFWB 5EZIL 4NWUH 3L5IA 2OCFD 3EDKA 2XN9D 3PV7A 5D71H 2CDGA 4S1DD 4KQ3H 2H6PB 2OSLA 3F6JA 4UWQB 4NKOA 2DQFA 3BSHA 2CKNA 3DXAA 5I17A 4YHPA 1H3GA 3HE7D 4NOBA 1ZT7A 4OV6F 4NC1C 2WXKA 1PW3A 5AKRA 3LKNA 5KVMC 4TV3A 3AY4A 1WGOA 3ARFA 3CVIH 1QW9A 4S11A 3I6GB 4JO2H 5DUPL 4AT6A 1HDMA 3RTQA 2BFGA 4WFHD 2N7SA 3FUEA 1VEMA 1UQSB 4OZHB 3ULUF 2X0UA 3QJHA 3WIAA 5GRYA 5HDBE 1S6NA 1U3HB 3KW8A 4E68A 4NERA 1U2CA 2H0PA 4IHBA 4E41D 3QZMA 2YS4A 1HJCA 5FUZH 3RWIA 1QTPA 1FH5L 1S7VA 5C6TL 3FDWA 2OV0A 1NFDF 1IX2A 3Q2NA 1VKXB 1WWWX 4XO9A 5GRVL 3C8KA 1XHHA 4ACTA 4FXGA 4L1SA 1G7MB 2VMDA 3QG7L 2ZKWA 3P54A 3HNVL 3LPFA 3VWJA 3BVWA 3VD4A 3DTDA 2QFRA 2WBJA 3GHEH 1E3XA 4AGLA 1R9FA 4F58L 1ZSDA 4HV8A 4U6YA 4U7SA 4DGVL 1R33A 2VLJE 3CFQA 3PJNA 1E9OA 4F93B 1DYZA 4V2BA 3GSXA 5SWSB 3S7GA 3E9UA 3R4RA 3S36X 2UY7A 4JHAL 2UVEA 3TXAA 5IP4A 1QZ1A 4K23L 2CR6A 3WKML 5DA0B 4UBDD 1CFVL 3EGSA 3LDBB 4UILL 5T1LB 2NSMA 4DCQA 2FSEA 1MXGA 3H8NA 3JVGC 5D1ZA 5B4MC 1JGLL 4GQ9L 2EJ1A 4NHUA 3NABH 2E56A 4NN5C 1OV8A 5D6CA 5HI5D 3G5WA 4ALAL 4ZW5A 5DZVA 1KF9B 4RQQB 3DMMB 1JWSA 4FYTA 4N6RA 4XNDA 3RX7A 1CYWA 1HWHB 2VXQL 1W91A 1S5HB 3WJLC 2VIRB 3JXAA 4X98A 2E7DA 4X80L 4Z7AA 2IALB 1LWHA 3CZKA 3QT2A 3O3BA 5IBLD 1FVEA 2DIBA 4PSPA 5D4HA 1KEGH 2C5DC 1KCUH 2VDML 4PJ9D 5B3SB 4YLQT 3WY1A 5CJOH 3NH7H 2FZ3B 1I8AA 1IKFL 3VD1A 4JO4H 3A67H 3VFVB 1JK8A 3OHXC 4JO5A 4DP9X 1JWMA 4JFHE 3ZDZF 1YPZE 3PF2A 3ULSB 4KKBC 5AOZA 2H5UA 2PKDA 5F7DB 4NQCE 4UIKH 3LEVH 5EG6C 2BOCA 2CO2A 1E5ZA 4UT9A 5TPWH 3RWCA 3TN0D 2EAEA 3FOLB 1I9IH 3HZVA 3TGXA 1I1AA 1ZGLP 4KPHL 4OGZA 5DD1H 3V4VB 3S9DB 1V3KA 3HI6H 3ZE1B 2FATL 4YHYC 1HHHA 2WZ6A 1QHOA 5AW1B 2B1HH 2X9YA 1G6RA 2E9BA 3HBQA 4UQEA 3OXRB 3QIUD 4X9FA 5GGRA 1ZVSA 5SWQB 3C5ZD 2P3YA 1SLXA 1I8KB 3X13B 5MEND 4HJEA 1NOLA 1EHKB 2PXYD 3KGSA 3N85L 3FSOA 3VDAA 1QR1B 3HHSA 1DDTA 3SKNB 2N01B 1JHLH 4P4KB 3MREA 4L9LC 4F5CE 1CLYL 5CJXC 1W0VB 2C7UB 3LH2L 3LSOB 4I0PB 4Y5XA 3TBYA 2W9LA 3KD4A 2Q0ZX 4OCWL 3F2LA 5AB0A 3S36L 4PJGE 4JO8A 3V4VH 3NAAH 5I2IB 4PGEA 2EVHA 2Y6SD 2ZXDA 4NO2B 4W9HC 3MHZA 3PGDA 2NW2A 1OF2A 1D7BA 1J8HA 2R69L 3V0WH 3ZTCC 5F0JB 2DWDA 4JRLA 4NP4L 1Z9SA 4FQ1H 4M6NH 1OGAD 4H8QA 3FQWA 4OF0A 4RX4A 5HHVH 3O8XB 1JF6A 4JZNA 1KXQE 5CLYA 2VH5L 2H6UA 5D7LD 2G0LA 4G11A 4JFEA 3IU3B 3KYNA 2DQEL 1ETJA 3QXTA 3PHAA 1MREL 1MRCL 4M6ML 5JDSA 3CIAA 1YYLH 5E7FA 3UYRH 2FRGP 4R2GD 5F7EH 3WXVH 4PWIA 3D85D 3BOVA 5JIIA 4JY5H 4YHLL 3KPRE 1AJ7L 4YE4L 3SO3C 3PHOB 4HUUB 4RZKA 2MPAH 3TFKD 1SYSA 1C8PA 1JNHB 2FT8A 3CUPA 1WH0A 2R2BB 1IAOB 5JPNB 1UOKA 4O5LH 5CKAA 1XF3B 3RUGE 4OGXL 2D0FA 4X5LA 1DSFL 3DUSB 5E5LA 3KLAA 3OG4B 3QK0A 1BVZA 1F2QA 4LOUC 4KMQA 3UIZA 4XNMB 3CGTA 5HYIA 2GSMB 4MNQB 3BEWA 3D2UD 1CFNA 3LB6D 2NTSP 1IZJA 1DR9A 3NN8B 2X6CA 4X7SL 1AQ8A 2JCCA 5FGSA 2XN0A 3IDIB 4NQVB 2VRKA 2VC2B 1OVZA 5IHZA 1IT9L 1D5BB 4EZLA 5J11C 4K2UL 1WZAA 3GK8L 3DPDA 3O0RL 4E9XA 3GSOB 1ZDQA 3BPOC 1SOSA 1DBJH 2VXUH 2GJRA 2IWEA 5G5DA 2EVFA 3FQ2A 3H7BB 3W57A 4FLQA 2F1EA 4Y5VC 4XBPB 3A6CL 5EIIA 2V6HA 2EEAA 5BS0D 4XBEH 1F1DA 2B20A 4G6AC 4XO5A 3BUIA 3GMLA 4MCZA 4PGCB 2WXRA 2JIXB 3SGEH 2ICCA 4Z3EA 4W9KC 1UOWA 3UZVB 3E3QE 1S7WB 2A77H 3FO2B 1Y7VA 4LASH 2F53D 3Q6FA 2BHYA 1INEH 3MLZL 3GS4A 1M1SA 3DX6A 3IGUA 3R18A 3VMNA 3GXUB 3K8LA 3HR6A 2NT1A 2Y07H 4YL9A 1V3LA 3T0AA 2ADIB 3QDMD 1ZLEA 4ZUTB 3FN9A 3O11A 3CC5A 4WO4A 3KCWA 4MX7B 3SKUD 3MRRA 5EOQL 3EGDA 2UWEB 1LEGB 4HIXL 4OGYH 2APFA 2HT4C 4WWPA 2OJEA 1CG9B 2XQ0A 2IPKB 4XAWL 2G4GA 4UDTA 4M4RA 1CBVH 3ZYIA 5DHEA 2VW6A 1ZLSL 3HG0A 1Z5LA 4WI3A 2RIKA 5D2NC 5I1KH 5B7EA 1EJ8A 3QHZL 3B5TA 5I1HH 4JDVA 4MB5A 1U2HA 2YOAA 1ADWA 3BZDA 1A66A 1Q9OB 2YRLA 3T0XA 2PW2A 5F93C 2XQBL 5HGAA 2VXTL 2K1MA 4XX1E 1NBVH 3A21A 1RAMA 4N8VB 4Q0XH 1ESOA 2CO6B 4JHWH 3RG1C 3DRQA 1AO7D 4JLRB 5DA4A 5KSBE 4XI5D 1D5XA 4PJ7F 5IBUB 2NY1B 1I8LC 2QADC 2FWOA 1U8CA 1U8PA 1JRHI 3KHOA 1OEZW 3N9GL 3DYPA 1W0WB 3GMOB 4TLSA 2J57A 4F8OA 3HEIB 5I1DB 2WUBL 3FNKA 1VGEL 5LNGA 4X4XB 4JCMA 2YUWA 3MLTA 5HDQH 1SNRA 3CZLA 1PKQE 4F33B 3ROLA 2EE9A 4K3JL 5CZVL 2EO1A 4S0SD 4TTDC 5DZAA 1WQVT 1M7IA 3ZDXB 2N59A 3LQMA 4MWFB 2GI7A 4QTHB 1PD0A 4N2LA 1N6UA 3A4DA 3SO5A 3T8XA 3BUPA 2XQYA 5KZCD 1GHFL 4JQVC 3MROB 3VD3A 4ANXA 4JKPH 1FZMA 1MQKH 3ABKB 3T4AA 3K4DA 3SKJH 3JTBA 4Z7VF 4W6XB 1KBKA 3DX9A 4AYSA 4ELMF 3JWOC 2DYSB 3FU0A 2ZAHA 3BAYA 1E65A 4O58L 1DVFC 5AKVA 2AEQH 5KSAB 3CDYA 4NM8H 1T5XB 1E3ZA 1D5IL 2XTJD 4ODXA 1KLFB 5D7LE 4KFMA 3VG0L 5C3IA 1DLFL 4QHUB 1FN4A 2AI0H 4WWKC 2R1YA 3AACA 4APQC 2WXOA 3QW9A 2NSXA 2WCPA 2ZKXA 2C9QA 3BMVA 1UWXH 3T1WA 5LAXB 2D31A 5JUEL 1KNOA 3FN0L 1K8DB 5DD6B 4PI0A 4AW7A 5CBAB 1PDKB 3WUWG 2OULB 4E9VA 1RZKL 3HPJB 4HLJA 5FO9A 1SMDA 1KBGH 1L9MA 4JO3L 4LVHC 3VI3A 4JCLA 1F18A 4M7KH 4JG1L 2AXHA 4MJID 3CLWA 2VWEE 1EXGA 4Y1TA 1XZWA 1INQB 1OTUC 1AI1H 3BUQA 1WZKA 1T66C 3IGAA 4WV1C 2VL4A 4HJ0D 4R90H 2C1PA 4G9FA 4EN3A 4DUXA 5AAPA 5FKPA 3W38A 2YC1A 4YHML 1XIWD 5IJBC 4PV9A 4M7ZB 2IJ0C 1KGCD 1H6TA 1XGUB 1OP9A 2NNCA 3RWEB 1IL1B 1V7NH 3GJEA 3NZHH 4MVBC 4QRPE 5A2KH 1Z9PA 3W9DA 4EUPH 1FDLH 1BM7A 1T7VA 3GMRB 2OMNA 5D7SL 3I75A 1PZ5B 5E6IB 5AYTA 3QZWA 3KWVA 3P30L 4U3SA 2XZCL 3EYFB 1YEHL 3AM8C 1HH9B 3MCYA 3SPCA 4LHUB 4IOFC 3TH2T 1TTBA 5GZND 4ZPVA 4FFZH 5GGTL 2XNAA 3TIEB 4M7LL 1NGZB 2EEDA 3IAPA 3EAKA 2JKIS 3SYQA 3EJPA 3TYFA 1TZAA 4HU8A 4J4PA 2F53E 1T4WA 3BP4B 1G7PA 2ZX5A 1QA9A 2HJKB 3D33A 5DRWB 2ZKMX 4KRNA 3J7HA 5L0QC 8FABB 2ZIDA 3T2LA 4Q4IA 3S96A 2JXMA 1SDDA 2VE6B 3QDME 4JFDB 2R0ZL 4DEPC 3VDBA 3BQUB 5HXMA 3T71A 1NAML 3IETA 4AQ8A 1NCDH 5FB8B 2EC9T 1UM6H 1AGEB 2H32H 3PL6A 5FA4B 3ZBMA 2BCKB 4R84A 1E30A 2PYFA 4JHUA 5DJYA 5LB1A 4BKLA 1L9TA 2MPVA 4N8CL 1QASA 3H4FA 1A6UL 2BNRB 3Q06A 1QKZL 5CSBA 2ZUTA 3GXIA 5AENA 3BGAA 3DSFL 2VZOA 4RISL 4J3XA 3OGOE 4NOFA 1NBZA 5LN8A 2VLLB 5KANG 3MRIB 4WFFD 3KPSE 2D3VA 2VKXA 4P5KB 4WHYH 2NY6C 3BAJA 2F7PA 3MJ8B 4IS6B 5EFIB 3WHE1 4AEHH 1F4XH 4FNLH 5TE6L 5F7HA 5J6HB 2WYTA 3U7AA 4XN5A 2FYYA 1JFHA 1AO7E 3QZNA 4X7TA 1FL3B 1NC2B 1U3HD 3QC5X 2PCFB 2XPYA 3BPNC 2SODB 4J6RH 1RL1A 5IGXH 2Y5EA 1WHOA 4LDCA 5KWYC 2Y5QA 1WGVA 4JHVA 4PRAB 4X0KA 2E7LC 3EO1A 1U91B 2F5BL 4JDZA 1MY5A 5JXEC 5CJBA 4MQXC 1JGUL 3O9WB 2E7BA 4BE5A 1ZRUA 1B4LA 3IDMB 4NN6C 4OFYD 4B0MM 5J3HD 1MAJA 1SDYA 2HXAA 3ARGA 2X4OA 3AUVA 4HSCX 1TMQA 4NUJB 1FC1A 1TVHB 5IFHL 4A7QA 1S7RA 4BFNA 3BP6A 3IJYA 1EGJL 1HXMA 1TZHB 1T6VN 2LU5A 4HD5A 4NAQA 4RBPH 1VZGA 2O1AA 1XB6A 1D5MB 1OTSD 5E56A 5SWSD 3SQBA 4EVNB 5CZXC 4UT6L 5DVOA 1MJJA 4PTTA 3RBGA 5KW9H 2A4CA 4TOYH 2GQHA 2NY5C 3BEVB 4HISA 5D4IA 4MD0A 5DYFA 4OFQA 1WUZA 4IEFA 3DHJA 5T1LD 1ZA3B 3WY3A 3D25B 3BT0A 5JNYB 2H26B 3TNMA 5ID0B 4KJPD 1R46A 3ZRFC 5K9KA 4HK0B 3OLIA 5ISZA 4AJVA 5HPMA 1ZE3H 1ZSHA 3QEHA 3DMMD 3L3HB 2PF6A 2HX7A 2FSDA 2EDDA 4OLEA 3WDIA 3BN9D 3JVGA 1TQTA 1VACA 4GBXB 3HLAA 4LK4A 2Z4QB 3R8QA 1JZ8A 3CFEA 1I7UB 3EO9H 4KTEH 5EO0A 1KBWA 1T2QL 3GSUB 3ZX1A 2VDOB 2JB6A 1GSKA 3TPUB 1AD0B 4GSDH 4PS3A 2AQTA 3UJJL 4O9HL 2XY2A 4G80A 4IRZL 1TT6A 1BQUA 2GVYA 2IBZY 4JGUA 5B3JE 2R0LL 4TYUA 5C0BE 5FPIA 1FZKA 3O6MH 2CRMA 3X12B 2H8PA 3CDZB 1E4XH 3ZR5A 1RUKH 2AK4B 4CKQA 1PCSA 4Z7WE 4PRHA 1YRKA 2WK2A 1SN5A 2Q86A 3MRPB 3VG9C 4PCTA 4TUOB 1J9QA 1DVYA 5I66B 1ZT4A 1JF1A 1MCOL 2IH3B 3JWNG 2XXGA 4MB1A 2VISA 1EEYA 1AGFB 4ZSOE 3T65B 3ZSTA 1S7UA 3CVCA 3TEXA 5BZDA 5C0IA 4WZ9A 5I76B 4HFWB 4BWUA 5IVNA 1FV1B 3L3KB 4P4KD 1RCYA 1QRNB 3HUJF 3UTOA 5ID1B 1MCDA 1MLBB 1NEZA 2ITFA 4I0PD 4X9IA 4CSTA 1DLHA 2UX6A 4P23B 5FW6A 3TCTA 2X4SB 4K0OA 2IPUG 2WKOF 2X4PB 4XPHH 4PS4H 2BIQA 4FHJA 1DDHB 1CPUA 4NNXA 2JSFA 2EIJB 4KNSA 4MCYB 4WGVB 5HGHA 3R7QA 4OLXH 2V8MA 1U8KA 4KMTH 3NRFA 1U3JA 4P07A 3RILA 1K6QH 3LNDA 2FIKB 5J89A 3O8XD 3W5NA 1SY6A 2WLZA 4PP1C 1JRHH 1QEWA 4GT7A 4KQ3L 4W4OA 4ZYKA 2GSGB 3GRWA 1TYRA 3QR1A 4G7VH 4U1MB 1E4KC 5F9DC 3ZL4H 3W39A 2FEJA 3PHSA 1LMKA 1F3DH 2WJ5A 3F84A 1OARL 4MJ5B 1FFPA 3BAEH 5L4IA 1BPVA 2JF1A 2K9UA 1MHPL 3RWJA 5TDOB 4KKAC 4WFFE 2H2SD 1WAAE 1HKFA 3RP1A 3PCYA 3B2UC 1JD7A 1U3NA 1FAKT 4WJKB 2CHXA 3VFSB 4BA0A 5DHVB 4JPIA 3TO4B 3VXRA 2GEEA 1J1PH 4TSBL 3UROR 4I89A 5BNXD 4IOIB 4LVOB 1F4WH 3V0HA 4WKXA 1RJZA 2FGZA 4HHGA 1T1YA 4JFVA 3APFA 4MNQD 5FUCC 5FUZL 4O2CB 4YOKA 5LNEA 4NKIH 1GC1H 3C6SB 4MXVE 3SZ6A 2WIIB 5TF1H 1KLUB 4JPQA 5A7EA 2GK2A 4YNYA 2CJUL 3HR5B 5HYQB 2P8LA 2X4RA 2OMZA 4CSZA 1HOCB 4ZQKA 1F11A 4OU3A 1RLBA 3SDYH 3HAEH 4NRXA 1KSRA 3E8UH 4AIOA 1JPSL 2HKFH 5SWSE 3GMQB 3WIFB 2V2TB 3HRPA 1DQTA 1IUZA 5DHVH 3WELA 4V1DB 1S9VB 4A7GF 1MELA 5KBDA 2WNWA 3I74A 4UOW1 3IJEB 3L95B 5AAWC 3SDXF 1OAQL 4A6YA 1RP8A 3DV6B 3NGBB 4KDTA 2JIXD 5GSVB 4LOVA 4QF1B 2MTPA 5EHFA 2PTVA 3UTZB 4XHJC 4J8RB 3SCMB 1TZ8A 2JKTM 4GRMA 4N25A 4TNVF 4AEEA 3R8BB 2CUMA 3MODH 3MGOA 3K2UH 3GINA 4YXLH 5D5ME 3WLBB 4AQ1C 1F3DJ 2WYZA 5E2WL 2ZKHH 4NLHA 3E0GA 1DJWA 5D1QE 4YMPA 4AH2B 4HWBL 4JKWA 5GHWL 3TBVA 3CXHJ 3SGKC 4HWUA 4HEPA 4LFHD 3P9LA 4HOZA 1OIOA 3M86A 5BUAA 1YEIH 4NN7C 4QY8B 4S10A 4BRJA 3F7YA 1GA2A 3TVMD 5TTRA 3PRZA 5SX5H 1KCUL 1SXZA 5B39B 3INOA 3QQDA 3T4YA 2EDOA 2SEBA 4JREB 5CP7B 4MZRA 2Z7WA 1G1CA 3DHUA 4PLOB 4M61B 1NUDA 4JO4L 3A67L 4LZKA 1NGQL 3VGEA 1LEKB 3K2IA 2KH2B 3TIDA 2E9IA 1HOEA 2QLVB 3F85A 2VNCA 2DLHA 4GEIA 5A43C 2QTEA 3OKNB 1AMYA 1WCBB 3LEVL 2NCEA 1KY6A 4GMTH 1M2VB 3K72B 3ZE1E 4G8GA 2LGNA 3D9AH 1ZLWH 1EXUB 1MFBL 5DD1L 5D2NA 4D2NA 1MHCA 5HYJE 2NY1D 4AI7A 2Y36H 1QNZL 4S2SA 3BGFB 5HHOA 2B1HL 4YSOA 5EPMA 4K73A 3QUZA 4M1DL 3PWPE 3GD1C 4DPAX 3B2DC 2EO9A 3P4MB 3DURB 4MSWB 1HK6A 5T1MA 2NXZB 2CZNA 2HAZA 5IROD 2DLEA 2VR4A 3JWNC 5ANMA 2GJ6E 2DY2A 2EIZA 4XOCA 2X89A 2O30A 1OP3H 3VM7A 4M48H 4JFYA 1OB0A 4U1NB 3TZVD 3HJ0A 1LO5B 3WTVA 3LN4A 1UM5L 3FCGA 1YA5A 3CFTA 4L37A 4RFEB 4FI8A 1IGJB 4KOBA 1FYHB 3FC8A 5T5FH 3ETTA 3A3YB 4OCRH 1YNTB 1D6VH 4MHHI 1ID5I 4ZS6C 2HG5A 4D0CA 4Z3TA 1S78C 5DT1H 1FORH 5LBSA 5LG1A 1GL4B 3GKZA 4PGJA 1UXSA 2O6EA 4JPWH 3HZYA 3OKLA 4BJLA 2NQCA 4FQ1L 5KSAD 4KI5C 3NIGE 1N18A 5DHMC 1MH5A 3VW3H 2X2UA 3O2DA 1A8ZA 1RPQA 1IAII 3T5WA 3CCHA 5HYSA 3UZEC 3UTSB 2F61A 32C2A 3IFOA 1P69B 3Q7JA 1MRFH 4Z3GA 2CIIB 4BFFA 3LHPH 3T1FA 1HILB 2QKIB 1A7PH 1NQBA 1TZGL 2L3BA 3KYOA 2IAMB 2ZP9A 4PREB 5F7EL 3V9EA 2QR0A 4FFYH 3RNQB 2YAOA 1AFVL 2DI9A 1HH6A 2C3HA 4I18C 1R24A 5C6PB 2VDRB 2MPAL 3IJHB 2WWMD 2LVCA 3G08A 1CD1B 1RQ5A 1BAGA 3D51A 3ZQWA 5BVJA 3NJLA 1LO4L 2W80C 4EXPX 4ZI8A 1BZQK 1N8ZA 2HYMA 1GZHC 3PYCA 2E4TA 3OG6B 3CZFA 2ZKYA 3ALWA 1T4KB 2W9EL 3FQRA 3VFRB 1RVFH 1HHKA 1ODAA 2IOOA 5CSZB 5CF3A 2CNYA 4NO0B 1X5FA 1U8LA 1F58H 1XSKA 2RTTA 3PE9A 4CN6A 5F0LB 2L0DA 4PJFB 2D03L 2GJZA 1ZANH 5E6ID 2R7EB 3GJFK 3NFNA 3BWAB 1YUKB 3BVDB 4OFPA 2RFXA 1KYAA 4G1EB 4HS3B 5EBGA 2VL5A 2VITB 1WFTA 3T3MF 2W07B 4K3DH 4LHUD 4IK6A 2VDRH 1DBJL 2VXUL 2VQ1B 4FEIA 1QFWH 1P4LB 4ZFFA 5F9JB 3W3BA 5F7WC 2HTLC 2N0MA 1S7TB 2K7PA 1NKOA 3MLXH 1SXBA 5C08B 1CICB 4JFOB 5KVDL 4XBEL 3EDFA 3I9IA 4P46B 4ZZKA 3W5MA 3ZY7A 4OQ1A 3HC0B 5J8OA 3CPLA 5B1JA 3L3GB 3GIVA 4NQEB 1DANT 1FVCA 5D1XA 3MN8A 3HE6A 2W0LA 4JFDD 3ILEA 4IBVA 3BQUD 2RR3A 4MDIA 2Y07L 2VDPH 2WOBA 3L8QA 5D9SA 2UWEE 3V5DB 2AXJA 5IFJB 5EN2A 3T6QC 1Z3GH 5IESH 1SMAA 4J3OF 1R3JA 2BNRD 1NTDA 4L8SA 2P43B 3RWHA 1XQ4A 3KCPA 5DJZA 5ITBH 3Q2VA 3GS7A 3U9WA 5HHXH 3VYPA 4IRJC 1CBVL 3SY6A 1WLHA 2DIJA 3B3BA 4IQHA 4BELD 1T1WB 2Y72A 4AJYV 1GPOH 1MQ8A 3AXLB 2JTDA 3STZA 4QO1B 1JSYA 4AV4A 1F6AB 3K5SA 3MQIA 1A6ZA 3LCYA 4W9EC 5ES4B 5I1HL 2ATAA 5JYMA 2VLKA 3GJFA 4K9EC 4PWJA 5ICXA 2AXFB 1QAWA 2ZSVB 1U8QB 1NC2D 1AIFB 4PCSA 4JHWL 4UAHA 4BK8A 4R0LC 3VFGH 4NCC2 2DQIH 4EKJA 5TDPB 1A9VA 3RZCA 1BBJA 2HFFA 1QUNB 4UTBA 1XGTA 4OIBA 1U8MB 4EIUA 3MGAA 3O9WD 3GBML 5LGYA 1Q8MA 4X6DB 1PY9A 3OJDA 1MWOA 4RIRB 5H2BB 4OF6A 5ESVB 3SOTA 1TVBB 3ARZA 4M9PA 3A4EA 2AJUL 2YPKA 3QJQB 1DCEA 4XXDA 1IM3A 4YSQA 5F88A 1XXFC 3ZDXE 2X2JA 1P5UB 5CR8A 2VSKB 4GKZA 2W95A 4RAVB 35C8L 1DUYA 1NSNH 1P6AB 2Q7YA 2W38A 3X17A 4C4KO 4Y4KB 2CD0A 4ABWA 1UKQA 3HS0A 5DI8A 5DHYA 3V0EA 4OLWH 2NZIA 2VDNB 2F7RA 4H8PA 3VGAC 4GUQA 2V33A 5EOCL 3QPQC 3AB0B 3MYJA 3TASA 4F2MB 1IGCH 5F1IA 4RWYL 2DN7A 1FL6B 4JKPL 1MQKL 1M4KA 2OKMA 4OIFA 4PJHB 4R5TA 3RVTD 3UBHA 1XVSA 2XWTA 5ENWA 1HI6A 3ZVVA 4XCCH 3WFHA 2RQEA 2ZOKB 1ZEAH 2V8LA 1JMZA 4DAGH 3RDTA 1G7HB 4CU6A 3Q9QA 4UAOC 3KLQA 4C57C 1P5VB 4NM8L 3FO0H 1MN4A 3OB0H 3W37A 4LMQE 2HKAA 1D5ZA 1AZZC 4GBXD 1FJ1A 4GAGL 4I9XA 2OI9C 4QWWD 1HYSC 2BHUA 2WNKA 1H0DB 3NCXA 3DJRA 2OMWB 1GY2A 3H2WA 2HWZL 1QG3A 3IKCB 3NDZE 4P4RB 5JIKA 4XVTH 1QEXA 6FABL 3T0DA 1L5GB 1IEHA 4M7KL 1KT2B 1W80A 4WUUA 3N1FC 3D30A 3FB7A 3WFDL 5F7AA 4KKRA 4KKQA 1AI1L 2CHNA 2J8UA 2ADGA 3ARPA 4JO1H 1E5BA 5CUSH 4Z7OB 4J3BA 4IOSA 3CFJB 4KUZH 3VFUA 5CEZL 3KLHD 3TOPA 4LCYB 5E5MB 1JV2B 1JNJA 3BO8A 4B96A 4Z7NF 4PRDA 4GYBA 3LS5L 1SJHA 3HE7C 4KO6A 4HEME 5ALBH 1T20A 2YIHA 1JPFA 3G5ZB 3KDMB 4HG4J 3NZHL 2AERT 1NKGA 3DUUA 1FDLL 2WLIA 3BH4A 3X1EA 1J0YA 3LKPA 1WBZB 5EBWB 2ADFL 5IBTH 2WLNA 4XT1C 3NJIA 4K8RL 1YJDH 2XWJB 3SGJC 2CKBA 4X9BA 1UG9A 4XCEA 1BFTA 4YEEA 1QRND 4X6CF 3SIKA 5GS3A 3FUDA 3WIIH 4UNVA 4XCNA 2DM3A 3BXNA 1JFQH 1T0NA 3MFFB 4F7EA 1HC1A 1TF4A 1IGIL 1ZA6B 4P23D 4MMXC 1JDAA 2R2EB 1I53A 1L9NA 3EYVB 2JMRA 4KZDL 4JFDE 4QYOA 3ARUA 1G43A 4Q52A 5I1AA 4BFIB 4TNWK 3QAZB 2NX5A 1EZSA 2NY7H 3UBXA 1NLBL 1U0QA 2ICEC 1EVTC 1MCNA 5LGJA 4CILA 3BKJH 1X7SA 2CM6A 3CVHA 4OD1L 1S9YA 1UM6L 2BNRE 1U8JA 3ZTJG 1QWUA 3B56A 3TWCL 3ARYA 2VW7A 2CDGB 4XWGL 5PCYA 2OSLB 1J1OH 4W9GC 1O9ZA 5JOPD 5LGKA 3D39E 4NKOB 1DL7H 4YZFF 4A2DA 2DQFB 3DXAB 1XR8A 5I17B 4YHPB 5CR1A 1A1OA 1ECYA 4P3WA 4UBDC 2IDQA 1ZT7B 1AZNA 4UDUA 4WFGD 1CLZL 2VN6A 2GFBA 2VM3A 5CMAA 4W68A 1E4KA 3LKNB 4P2RA 4BCYA 4ZMZA 3ARFB 5HI5C 1F4XL 3TO4D 3ERXA 4ADJA 4I48A 3SYOA 4N2AA 1SUHA 4AT6B 4ONFH 2CR0A 3AU1A 1HDMB 4G71B 3RTQB 2YBRA 1DQMH 3DDFA 2QEJA 3HG2A 1BMGA 5A6MA 2E8YA 2R4RH 3EJRA 3LN5A 3WO4C 3ZYJA 2FIRT 1WICA 4NQDE 1KGUA 1KJ2A 1XAUA 4AVJA 3QJHB 3BVTA 1UWYA 4PJ9C 1U8HA 5I18L 4YLBA 3QR0A 1NCCL 4NS0A 5B1CA 3RWIB 1XH3A 1IAIH 1S7VB 3SDCA 1KZYA 4G7RB 3GXNA 2DMHA 2KZBA 2FQDA 3VAEA 4C8XA 3C8KB 4FXGB 4X8CA 2X4UA 3S34H 5K9QG 1RSFA 4NO3A 3VWJB 4O00A 4UMGA 4NEHB 3TN0C 1KPUA 1E4WH 2WBJB 3BVNA 1ZSDB 4HV8B 2J5LB 3O0LA 4U6YB 5KVEL 5KW9L 2ZWLT 2DQDH 4WCYH 1E9OB 2ISDA 4FA7B 2BS8A 2OBGA 2H1XA 3JYCA 4QXTA 3UJTH 1BLNA 2XYBA 1BD2A 2UY7B 1MFUA 3HZKA 3OR7A 3QIUC 4PJ7E 4QD2E 1SOXA 2CGZA 1XCTA 3C5ZC 3QDGA 4Q9QH 3EGSB 1AHKA 1ZHKA 4DCQB 3VNYA 2FSEB 5D1ZB 2PXYC 1D2OA 4NHUB 2IBGA 3EKCA 3IXTA 4QGTA 5GS0L 1A22B 1G9NL 1Q0XL 5D6CB 5J56B 2WO3B 4N8UA 2V4LA 3H9HA 1JWSB 4N6RB 3BAXA 2Q9OA 3DGDA 3FO1A 3BH8A 2YXWA 4P5RA 2VR5A 4X98B 5A2LH 1TNNA 1KZQA 3O3BB 3MRLA 1FVEB 4NJ9H 5I26A 1TQVA 2OZNA 4AMWA 4PP2A 3WN6A 4Z23A 2VW4A 1A9EA 3B8YA 4HC1H 3QIWA 1JK8B 4GRWB 3VQMA 3T08A 1R19A 1JWMB 1RU9L 3PNWA 5I8KH 2VDKH 3AMKA 1OZTG 2D0GA 4ODVH 1JNLH 4ZMPA 2BJML 3AQDA 1ED3A 1UM4H 4N3TA 1RUKL 1JXDA 3WKQA 2BOCB 1X5IA 2CA3A 3RWCB 3S3PA 3HZVB 4NZFA 1KGJA 5F0MB 1I1AB 2B1AH 2M83A 1DBMH 3N5AA 2RQ8A 1ZGLM 3ULVH 4P3CL 2A83A 5H37A 5CLWA 3FSZA 2NXZD 3N40P 5IVXF 4PRIA 1E7UA 2VO5A 1HHHB 1M6OA 3A24A 1AYRA 5DWUL 1G6RB 1B9KA 4NPJA 2YMXH 3CLFH 3QZPA 4LNRA 1ZVSB 5GGRB 1G0YR 1H5BC 3H3BC 3OHMB 3TFKC 5KTEL 4Y1AA 5ILTL 5I1GH 4Y9FA 4OTXH 4BIKA 5CJ8A 3ZSSA 2FLMA 4GRWH 4BUQA 1IGFH 2WQSA 3HHSB 2DIAA 3LH8A 2APTA 5FX3A 3SE6A 1KCSL 2XY1A 2E4FA 1RPKA 3MREB 3LB6C 5F9OH 1M7DA 2BSRA 4XPHL 5L4MA 2VR7A 4UT9H 1SZNA 1OB1A 2CJTA 2Z0UA 3OKKA 4Y5XB 3TBYB 4LEEA 1RIVL 1ZXQA 3QUHA 3LZLA 5DMKB 3DARA 1T2JA 4P59L 1X5KA 5FM5M 3VRIA 1NDMA 3ATAA 3JZYA 3NIFB 2VDQH 3UG4A 3ZTDC 5C70A 2D3JA 3PGDB 2NW2B 1OF2B 1J8HB 4KMTL 1HCVA 2V5MA 4YHKH 3DJTA 2P24A 1G6RH 4U6XA 1A2YA 4IRSA 4M43H 1JRHL 2YLKA 1JERA 4TTGA 2DWDB 4JFXA 1Z9SB 1A5FH 3PLYA 3UTSD 4A6YL 2Y69B 1VPOL 1CT8A 2YQ2A 2ZXQA 4XCYA 3ZL4L 3FQWB 3FB8A 4PGBA 3WJLA 5DZPA 5J13B 3IU4H 3S8FB 3EJYD 4QRRE 3QULA 3BSZA 5CIPA 3WEBA 1XWVA 3NIDF 5KVGH 4JFEB 1QO3A 2IFFH 3PWVA 2RHEA 3KYNB 3OC5A 4DH2A 1XGRA 2Q7AA 1HYRC 4OVUA 5JDSB 3O45A 3TEZA 5TGBA 2YAMA 1UEMA 3EJZD 3P73A 4P48A 3J2PA 2MCPH 2YGVA 1I8MA 1IILE 1B0GA 3FXIC 4X42A 4CRPA 3QP3A 4CGUB 3F62A 4H8VA 1WT5C 3FQNA 1SYSB 2YAQA 3CUPB 4GKNA 1JZ5A 3QCUL 2DWSA 1ZY9A 4MA1B 4I18A 3FO9A 3VXTA 1YN6A 1I4FA 2DTSA 4LSPH 4AMXA 3KLAB 1GC1L 3HN8A 3WJJA 5FGRA 1MG3C 2AXGA 1G7QA 1BHGA 5TF1L 2FWUA 2OSWA 3BEWB 4WK0B 1CFNB 1NL0H 5E8EA 1OM3H 5T8IA 2V7HA 1IBFA 3WYRA 1GZHA 5DQJA 4XAKD 3FSVA 3KJ4C 4KH2A 2JCCB 1E8WA 1YUHA 4YSEA 4KY2A 4QLRA 4L5FH 5HDRA 2HKFL 3WEOA 4U49A 5IHZB 4PRPE 1RUPL 3VGHA 4WW1A 2GKIA 1XGQA 2KZWA 1NCWL 4PD4K 5C08D 1CICD 1O6TA 2YFOA 4XI5C 1IFRA 4P46D 5G5DB 3KZ8A 1CYGA 3FHEA 3X3FH 4P2QA 4ZUVA 5J57B 5EIIB 3DJZA 2NCMA 2ZOTA 5IFAH 1DEEA 3GM0A 3GMLB 4MCZB 3MODL 4LU5H 5D55A 4YXLL 8CGTA 4JRFA 2ZKHL 1WFIA 3MUHL 3Q6FB 4BFRA 3K6DA 3O4OB 4Z7QF 3ZT7A 3DX6B 5IHWA 2OPCA 2P26A 4W9LC 1A3QA 4FZEH 2KERA 4TQIA 2XICA 4X8GA 2JLLA 2E9JA 1YEIL 1N70A 2UY6A 3FULA 4GEJA 2Q2EB 5BQDA 3O11B 3CC5B 4WO4B 2I7OA 3ZRSA 4PW4A 3MRRB 2C4FT 4IJ3B 1S46A 3EGDB 3H1ZA 1T7XA 4LCCA 2OJEB 1T6BX 2GC7C 5FGBC 2YK1L 2MOGA 4UDTB 4M4RB 5AVSB 3FZUD 2EKSA 3HN5A 2OLDA 2V3DA 2FBOJ 4GIAA 4EI6A 2DQCL 1Z5LB 5HGGS 4OJEH 4GMTL 3O41A 4HIIA 2AJ3B 4JDVB 4KQ0A 2CM5A 1AGDA 2VQUA 1B6DA 3DUHA 1HX0A 4TVPH 3SE3A 2WLKA 3HVNA 2PW2B 4TUJA 4WW2C 2NLJA 5IEKA 5JHDA 1NAKH 2Y36L 3II1A 5HGAB 5JTWA 1U6AH 1PSKL 2UYLA 4L23A 4XMKL 2APSA 2BVUA 3DRQB 3ZU8A 3I6KA 4WY7H 2VSMB 2VKWA 1D5XB 2XLLA 2JB5L 3ZE2F 4BZ1H 4BD4A 2FWOB 1U8CB 1U8PB 5D7HA 5HHME 3GZKA 2XKUA 3X2QB 4Q14A 1KJMA 3U30B 5IVZA 4GAAA 2OZ4H 4M48L 4CN1A 4HJ0C 3WLWD 3MLTB 2DF3A 4Y4KD 5EF0A 1L7IL 3N42B 3O2WL 3C60A 1PLCA 3DV4A 4RFNC 3U0TA 1XIWC 5E95B 3ROLB 5E9DE 4FP8H 4LSTH 1K85A 2B14A 4OCRL 1M7IB 1RZPA 2YD8A 1BAFL 2XA3A 1F2XK 3JYBA 4IKJA 5A6LA 5D96B 2ZOUA 4G7QB 3MOBL 3CE1A 5F6IB 3T8XB 1JXKA 1D7DA 1FORL 3MRJA 4DQOL 1WZLA 4KTDL 3P4LA 4LIQH 5J12C 3SPHA 1II4E 4NQCA 1EVUA 4ENED 1FZMB 5IJVA 3T4AB 1GIGL 1DQJA 1SJXA 4F37F 2ZYSA 3UMTA 3DX9B 1E5YA 1EHAA 4N85A 5GZNC 4FG0A 4TRPH 3U2SA 3DKHA 3DX7A 3RL2A 1MY7A 1GSMA 3I50L 4ODXB 5BV7C 2ENQA 1MRFL 2LAAA 1FN4B 1TJIH 5EIVA 3LHPL 1AE6H 2R1YB 2X87A 4H2AA 2DLFL 2HVJA 3HUJE 3SBQA 2D31B 4FFYL 3RU8H 1KNOB 1A6VH 5JIQA 1A4JA 1XZ0A 1X3DA 4KNQA 2DIEA 3QFDA 2IO5A 5FO9B 1DBKH 1MCKA 2QPEB 3VI3B 5LXGL 4IBTA 4M3HA 1BBDH 3NCJH 2XOTA 5MP6L 3TF4A 5IG7A 3UOAB 3WKYA 4B9PA 3BZEA 4NRZA 4ZMYA 2CJSA 3LNHA 3R4DA 4PWHA 4EQ2A 4EXKA 1D5RA 2VLME 3IGAB 3CLEH 2C1PB 4G9FB 3U1SL 2WTRB 4EN3B 4PVBA 2X88A 5FKPB 4JQIH 2YC1B 3VX1A 4PJFE 4IBSA 5H4YA 4HUVA 1RVFL 3KPOA 4PV9B 4WENB 2DLTA 5C1MB 2RGSA 1YYCA 4N5UA 1WIPA 3GLZA 5LXGH 1S9XA 3GJEB 2DYPA 2Z8VC 1ZANL 2BOBA 5EC2A 3M45A 3W9DB 2EADA 4M4PA 4LARL 1KXQA 4RGMB 4L4VE 5T1JA 2NNXA 2B1OA 3CNKA 1W6LA 2FJGA 2D3NA 4H20H 3I75B 3HTLX 4K3DL 3LQZA 2F68X 3QARA 2J71A 2OMVA 1KG0A 1ZK5A 4LKXA 4ZUUA 2F5AH 3EOAA 5C08E 1Q0YL 4U3SB 3UGUA 1D2PA 1U3HC 4ONOA 4CSPA 5I30H 1MHEA 4ZPVB 2XNAB 2OP4L 1MPAH 2XZZA 4EOWH 3ECUA 4L1DA 3X3GH 3KPRA 1JPEA 2HT3D 2H7WA 4Q97A 3TYFB 1VF5C 5J3HC 4WNSA 3HBPA 1G7PB 4UTAL 1QA9B 5IJDC 5EF2A 3UTPE 4MRCA 1L9PA 3RZWA 2COVD 4LQFH 4QXVA 3VSVA 4MMXA 1KCVL 3FT3A 3S96B 2JXMB 1SDDB 3DX0A 4N2NA 5ETUA 3ILPA 3QUGA 4JUTA 5I6OA 1AG0A 5E9AA 4TL5A 3ZL1A 3IETB 4G2AA 1OTSC 1ZLVH 3ZIYA 1KTBA 3A6BL 1N6QH 3PL6B 4M8UA 5ITBL 1E9PA 2PYFB 3IKKA 5DJYB 2EDWA 1P1ZA 3LDBC 4KQ4H 3SDXE 1GOGA 5GS2H 3OPUA 1GPOL 4KJPC 3OKYA 4K5OA 3ARFD 2Z93A 5ECJE 3PWUA 4JJ5A 3QUYD 3DMMC 3RI5F 4X2UA 3BPLB 4LFHG 2WVVA 4XN1A 3RTQD 4MMYA 2WLYA 3BN9C 4XPTL 3ES6A 1ZTMA 4ZFOL 2FYYB 3L9RB 4X6DE 1J5OL 4KTYA 4X7TB 5AOIA 1QYGH 2MMXA 1SVBA 4WF7A 3GI8H 2UXVA 1HIMH 2M1KA 3LIZA 2R9HD 2EDRA 3BVXA 4X0KB 3EO1B 1Z0MA 4JDZB 4TS6A 4WSGA 1OK8A 4HK3J 4HGKC 2R29H 2X2IA 3CQQA 4NSKA 4AGMA 1QBBA 5GSRA 1G9EA 4Q6IA 2XPZA 3MAWA 1HHIA 3OAUL 4J7RA 1L0YA 5JHBA 5I24A 3ARGB 2X4OB 3VWJD 2TAAA 4FDWA 1NSNL 5DRZA 1VEOA 1SRDA 2WBJD 4F2ME 5IBUG 1JGDA 1S7RB 4MB3A 4OLWL 5TQ2L 3BP6B 1JVOA 3IJYB 1UFUA 3JV6A 1HXMB 1KYOJ 5EORH 4W6YB 1CGXA 1EPFA 1IGCL 2G30A 4ZMOA 3SQBB 4ZW7A 4P9HC 2VJXA 4PTTB 3MOAH 3UTTA 3KXFE 3TN0A 3UEQA 4MD0B 4D7BA 3H3PH 4IEFB 4XCCL 3BQVA 1CGWA 1ZEAL 2DJSA 5H35A 4DAGL 5D1ZD 5DYOA 2CRZA 5DC9B 3TNMB 3FO0L 4CL7A 4H7VA 4F91B 2AW2A 4P4KC 1BVLA 3BVVA 5K9KB 5HPMB 5ISZB 5LVEA 1QACA 3QIUA 5IIEA 3QEHB 1NBYA 4LCIL 3C5ZA 4I0PC 3ABGA 2DQHH 3NJFA 1Y0LA 4PB0L 3TA4D 2CO7A 2PABA 4P5MA 2H47C 1VACB 2AGJL 3BH9A 4YHIA 5GGSA 1BOYA 5M7QA 5FOBA 2QQNL 3HLAB 3BPCA 5CSGA 4XVTL 2CBMA 4GXVH 1PKQA 3CFEB 4WAFA 4MAYA 3MV8E 2JJTA 5EO0B 1IQWH 3QORC 3CVHL 5EEUA 2JB6B 5HDOA 1L0XA 4F9LC 5IT2H 1P7QA 4G80B 5I73B 4LEXH 4EUPG 2Y06H 1FZKB 1YEKH 1ZXKA 3W11D 1SVCP 5ALBL 2IWKA 2DJ4A 3QDAA 1I1AD 3MGTA 4M9OA 2FHFA 4KXZI 1VESA 2H8PB 4LRNH 1TLMA 4J39A 2VSDA 3L13A 3RVUD 5DO8A 2O5YH 1AAJA 2J3SA 2H2SC 3GI9H 3S5LA 2E0PA 4FABH 4PRHB 5I0ZA 2Q86B 1WZ1H 4LXFA 4WNQA 5IBTL 5JORA 3QGVA 1ZT4B 5C0ND 1JF1B 1YJDL 3V7AG 3ZQXA 3UABA 2FBJL 4UANA 4YSSA 5JPNC 1F13A 1P4BH 2VISB 3LZFH 2LT9A 1T03H 1EEYB 1WFUA 4Z0BH 5C0IB 1S7UB 3WEXA 3WIIL 5BZDB 1JPTL 1X4ZA 1M3JA 2KLTA 1G9ML 2WN3A 2VTFA 1XF4A 4DGUA 3QH3A 4H4NA 2Y3NA 1IC0A 1OSZA 3MBXL 1GW0A 1H5BA 1TR7A 1NEZB 3QNYA 1WDAA 4P9MH 1DLHB 4DNLA 1DHKA 2BFVL 5AVUB 4YDLB 3DHPA 3S8GB 4MAUH 1J8HD 1F5WA 3VE0A 1DN0A 4LHUG 2VDLL 3HS9A 3C12A 1RY7B 4NNXB 5DLLA 5D4QA 1DQIA 5HGHB 1I1YA 2BY2A 1FP5A 1U8KB 4EZKA 1VRSA 1RI8A 3IDJB 2A9ML 1N19A 2OSYA 1ACCA 4QRPA 4XX5A 5AG9A 3T3ME 2HFTA 1QEWB 1TQBB 4Q9BA 4ZYKB 1EZVX 1T1XA 1PIGA 1UH4A 2DKSA 3NA9L 4KK9D 5CP3A 4JFED 3B2XA 4DVBA 3QFGA 4GAYA 3W39B 4AYBA 1GAFL 4WHYG 4GNKB 5F7FA 2G9KA 3WMQA 1FFPB 5L7XH 5DS1A 3GXTA 3RWJB 4XNUH 1HE8A 2HFEA 4OZFH 3ASNB 2Q3ZA 2Q1EA 4U2ZA 1SUJA 1JAEA 2BP8A 4ONFL 1OT2A 2F7OA 5DSCA 3RX5A 3K0YA 2FNWA 2VR8A 5HGBA 1VZHA 4OJCA 2K9FB 3V9CA 3P9WB 4JPIB 3VXRB 2J1WA 3N06B 1FIGH 3TVMC 4IIZA 4F27A 3T0BA 2Q3AA 3MRMA 1BQKA 1BQHA 2AEOA 1RJZB 3EBAA 4S1RH 1YMMB 3ELAT 1M9SA 1T1YB 4LOFA 3GRWH 3PV6A 1U3YA 2R15A 4G3YH 4OQTA 1E9QA 1KLGA 3ZR6A 3FBKA 1HHGA 1AQMA 1HL9A 3RIAF 4PBXA 4YNYB 4AQEA 4R4FH 2FQEA 2EICA 3VXSE 2X4RB 4G7YH 1JV5A 2OMZB 3KVDD 4YBQD 4ZQKB 1F11B 4AL8C 4NRXB 3WY2A 5BQ7A 1NDTA 1YEWA 5FYJH 1XMWA 2CLZA 3JTSA 1L0PA 2O5XH 4CBPA 5C0DA 43CAA 5CU9A 4ZOCA 3QO1A 1A7OH 2PTUA 3KPSA 4A6YB 3A4FA 3BAWA 5D6DC 1QLEH 1E90A 4JB9L 5IROC 1BXAA 1V54B 2HRGA 4UNIA 4Q9QL 4GRMB 1AO7A 4J28A 3STBA 1BFVL 3NG5A 4DWHA 4TVPD 5T3XH 4P05A 4YWGH 3FTXA 3TZVC 3PJLA 4ZX6A 3MX0A 4CDHA 5GRWA 1MAMH 2OYKA 1MIMH 3ATDA 4WO4D 4FE9A 1I9JH 3TBVB 3KR3L 3TS8A 1SOKA 1CFBA 4KAQL 3P9LB 4UNTA 3VU2A 3ZGHA 3F7YB 1T7YA 3AS2A 3QQDB 3T4YB 2C26A 2SEBB 3VJ6A 3DVNA 3WTUA 1V8HA 3A47A 4HC1L 5KSAC 5DK3A 5EF3A 5I8KL 3VQ1C 2F8VA 3TIDB 1JNLL 1DVUA 2YAPA 3TM6A 4APXA 3RGVC 1UM4L 3DX1A 5LDSA 4ZMVA 4RZCA 3K2MC 3PU7A 4G8GB 4OJFL 4K3GA 2B1AL 4OLZH 2YXMA 5AWNH 1DBML 1E42A 2DQUL 5D2NB 3ULVL 2X1PA 3APNA 5CN2A 1P53A 4S2SB 4XMXA 1DUZA 5HHOB 5CCGE 1TYJA 5EPMB 1YVLA 3NRQA 3QUZB 3CLFL 4DPRA 3BN3B 2WWMC 5T1MB 4NWTL 4QKTA 5ANMB 3T04D 4UT7H 1DO5A 2EIZB 3IDUA 2IGTA 2WWKO 1IGFL 4EI5D 4JFYB 4M7ZC 4NXSA 5EDSA 5DO2D 2IXQA 3L1OH 4KKPA 2JKXA 1W16A 3ARXA 5F9OL 4Z7NE 3LN4B 4OCYL 2NW3A 5IF0A 1DCLA 4L37B 4ZO6A 2WKLA 5C8JA 3IJ9A 1J0ZA 5LO7A 4LP5A 1T04A 1MZYA 3DWTA 1U58A 3UBXI 1XAKA 1BREA 2IDUA 1CE1H 3MPCA 2LABA 4HUXA 5C0BA 3BDXA 2HG5B 2VDQL 4D0CB 1I9RL 2VN7A 2W8CA 4YHKL 1CR9H 5EEWA 2A9CA 1RIHH 1UXSB 4M43L 4L1BA 4OJAA 4HHWA 4KHXH 2TRYA 3OKLB 4NZUL 2OL3L 2C4XA 2ZYIA 4R7NA 2P7TB 1GXEA 3N6YA 1MH5B 4YSDA 3O6FA 4GT0A 2DWEA 2A99A 4CNIA 3UDWA 3CCHB 5HYSB 5EH1A 32C2B 3IFOB 3BAIA 4QHKI 4YDKL 4UV7H 4GINA 3T1FB 4TLKA 1KGYE 2I5YH 3ETBJ 2J44A 3RPIB 4HIEA 2XN1A 3KYOB 3QHTC 4V33A 1FI8C 2WAQA 2QR0B 3BQUC 5ICYA 2OR9L 2BNUA 4RMRA 2BS71 4NM4H 2MCPL 4TQPA 2ZWSA 5DF0A 4ZFZA 1FO0A 4CW1A 1T6WA 5GRJH 1HH6B 2V9TA 4IJTA 4JVPA 4POZD 2BY0A 2K8MA 5LBSH 1X6LA 3G08B 3MNDA 4XMPL 5BVJB 5C2UB 4H88L 5BZZA 1RMFH 4G9FD 4EN3D 2H45A 5KANI 5A16A 4FI7A 1FGVH 2BY3A 3V95A 1N8ZB 2P80A 3ARVA 3DX4A 4LSPL 5G4NA 4AYDC 5JW5A 5CM1A 3O2DH 5FYKH 3HAEG 3CZFB 3NESA 3UL4A 2EDKA 1CGUA 5DC2A 3FQRB 1NL0L 2O72A 4C54A 1HHKB 3LRHA 4YZFE 4PJHF 4JGNA 3V8CA 5FKAA 5FA3A 4F8TA 3JWOH 1AXSA 2A6JA 1U8LB 4FYSA 1KEML 4JFTA 4Z76A 2PWGA 3BC9A 2JKLA 5LWYH 4UZSA 4AK1A 2GJZB 3LMJL 2HX9A 2AJVL 5KBMA 3NFNB 3SD2A 2XIIA 2RFXB 2KT6A 5HHNA 3S4SG 4YHOH 2VL5B 2ERJB 4Y8DC 3WNLA 1WAAA 1LO0H 4KGLA 2EE6A 4ZFFB 4M29A 2FUQA 1GJUA 5FYLH 3X3FL 4ZNCD 3ZE0F 2G3MA 1UUNA 1CGSH 4QAMB 3ZO0A 5JR1H 1MCCA 5KSUA 1PLAA 1MDAA 4J4PD 2CIKA 4CC0A 4Z5RA 3CPLB 3VXNA 3OV6A 2Z8WC 3QUMH 3GIVB 1ETZA 1FVCB 3GMMA 4HPYH 4KNTA 3DIFA 3TEWA 4QRBA 5C0CE 5D1XB 3S37X 3HE6B 2B9BA 4OCLC 3BCFA 2IQAA 3RFZA 1YECL 4MDIB 4KMLB 3LS4H 3PXLA 5D9SB 4NZRH 1ZVYA 2R2HA 5EN2B 4DTGH 3GSWA 2ZUSA 2W88A 3OZ9L 4XXWC 3PL6D 5AW4B 4OH2A 3GKWH 5EA0H 5CEZD 5L0QB 2OYMA 1R3JB 3ZZSA 1TJHL 2WV3A 2XVGA 3RVTC 4L8SB 4R5VA 3RWHB 3KCPB 3I9AA 5DJZB 1CXIA 3P4OA 3E80A 5DR5L 3US1A 4TUKH 2L7JA 1URZA 3MXVH 3STZB 2NY4B 1WHPA 2Z8SA 1A6ZB 2BK8A 4O02A 4OT1H 2VLKB 3GJFB 2WXQA 3HMXA 3OGCA 3QRGH 4GBXC 5ESAA 5ICXB 5IEHA 2WZAA 3QO0A 1X9RA 4K8RD 2DQGH 4QWWC 1NAKL 2Y23A 5KJ7E 4RGOH 1U6AL 2C4FU 3RAJH 2A2QT 2ADYA 3L08A 4AJ0A 4BZ2H 4OLYH 5D5MA 5KVDE 5EO1A 2O6CA 2AP2A 3RZCB 4BZ1L 1BBJB 2HFFB 4NFBA 1XGTB 4OLVL 4YHZH 3EG9A 3CHQA 3G6AA 5T1DH 3W2DH 5D1QA 1EXHA 1EAPA 2D4FA 1N2RA 1OT1A 3OJDB 2VT0A 2OZ4L 2X1QA 3ARGD 1PG7H 3KLHC 4LSSH 2YPKB 1LM8V 1QX1A 1ET7A 3EJSA 3QA3A 1IM3B 4XXDB 5E2VH 4BQBA 5F88B 3REVA 4EDXA 4TM9A 3V4PL 4O51A 3AVEA 4G6KH 4GKZB 4NAMA 4FP8L 3L5JA 2Q7YB 1WUNT 2OYLA 1URIA 4NN6B 3HS0B 1NMBH 4PTUA 5DI8B 3IFLH 5DHYB 1UWEH 2YXVA 4MA8L 4ESKA 1J8SA 4HS8L 3MYJB 4Z7OF 1QWHA 5F1IB 2AVGA 5D2LF 1UD2A 3GS0A 3ZPDA 2VCOA 3CX5J 2XWTB 2LVEA 4AOFA 3UEZA 5ENWB 1HI6B 4UTBH 1TPXB 5IVXE 4Q9CA 1DQLH 4OJDH 5E6YA 3WFHB 3S37L 4GXUM 5GISH 5ISZD 2B3RA 3PPSA 4F20A 5HYJA 1ZV5A 3RDTB 4KKCD 5SWQA 3BRDA 5CINH 2YPVL 5IQ7L 3PFUA 4H1LH 1KC5L 3KE0A 1JXFA 4AX3A 3NTCH 3PWPA 1AE6L 4P23C 4ALAC 1ANUA 1D5ZB 1FJ1B 1DSWA 3SKNA 4MGXA 1GS7A 1K5WA 2GJ6A 3NJMA 1VB9A 4R26H 2HB0A 2IFGA 5AL0A 1RZGA 4MMZC 1LDPH 3DI2B 1KMGA 1DBKL 2F58L 1J18A 4PJ6A 4X9YA 5IHUH 3WMSA 1BBDL 3SJVB 5EU6E 1NJ9A 3TURA 3MLVH 3FB7B 5AAMC 4MDRA 4A2FA 3MUUA 3LZOA 2J8UB 2R0KH 2YEQA 2ADGB 2IQ9H 4HJ1A 2RMNA 3CLEL 4N0YH 4AUUA 3VFUB 3IBEA 2AAAA 3IMTA 3MC0A 3BWUC 4JQIL 5LXVA 3BO8B 5C0JA 3QORA 4HSAC 1AANA 4PRDB 1G9HA 4K9JA 3L9YA 5LCVA 2YARA 3OAZH 2EH7H 2XV2A 4YXHL 3TA3C 3U83A 1SJHB 3CAFA 1E5AA 1T20B 3C5JA 1JPFB 4PIRF 4PRHD 1BQLL 2L7EA 1TETH 1RZFH 2C8NA 3Q5OA 4XNQA 3V7MA 4HF5H 3NIDE 3DUUB 2XZQH 1DJXA 4FHKA 4X9GA 3TPKA 2XBZA 3B5GA 1MCPL 4GLRI 2WLIB 4D9QD 2WZ5A 4GSXA 2IV9A 4PJXF 3LKPB 2K4WA 2AZAA 4ADIA 4H20L 3BCDA 3TO4C 2R59A 2Y4SA 4ZMTA 2OMBA 3W81A 4LVOC 2F5AL 3K6SA 4HJUA 4N20A 2CSPA 4JM2D 5T33H 2CKBB 2OJZL 5CLXA 5FHBH 5I30L 1EHLH 4XCEB 1HINH 2E9WA 4J2QA 4AUYA 3T8MA 1MPAL 3QS3A 1ORSA 2YQ3A 3QHFH 3BXNB 4PJBF 4XCNB 4DETA 1T0NB 1IFHL 1IAOA 3X3GL 1RHHA 4F7EB 5GS0D 1U41A 5ALCH 3ULVF 1JTTA 2GBUA 3BIBX 4RH4A 2CBPA 1Q9LA 1VZIA 2C3GA 2WY3B 4NKQB 1MEXL 4FYRA 4QYOB 4RRPG 3B2VH 1EDQA 5BZWA 1F86A 5I1AB 5KYYA 1PCXA 1KDJA 1MUJA 2NX5B 1QSFA 4PWKA 2E7HA 4A66A 2BIHA 3BYTA 2XV0A 3VX0A 5BXFA 2HH0L 2P48B 2ED6A 3WDHA 5CEZE 4HXBL 4ZS7H 5LGJB 3CVHB 2I9TA 1S9YB 1M6UA 1U8JB 3WE6A 3NGBC 2CKBH 4KXDA 1OSEA 3WO3B 1MHHA 3OJVC 4TPRL 4WTZG 1XF2A 4QGYA 2ORBH 4KXBA 1XR8B 1ZAGA 2WUCL 3CHXA 3D0VA 3DJSA 5IUCA 4UDUB 3KHQA 1A3RL 2GFBB 3CG8A 5CMAB 3VGFA 5FYJD 2XA8L 1GTNA 4P2RB 3G9AB 4M02A 1FA4A 1X5HA 4R7VA 4ZFGL 3VXRD 4I48B 3ARBA 3IJSA 2WGNB 2GTZA 2NDGA 2CPUA 4XBGA 3AU1B 2ETWA 3MRHA 2YBRB 1QYGL 5D7KD 4NZ8A 4B9CA 3GI8L 1YMMD 1HIML 3LN5B 3KJ6H 4JREC 1KJ2B 1UURA 4RMBA 1C08A 4FNSA 1U8HB 1E0OB 3TYGH 4Y8AA 2R29L 2GCYA 2ADJA 3M6DA 4ZAKA 3WUWA 4LDOB 3I3EA 4AG4L 1XH3B 3TVMA 3SDCB 2GBVA 2J6WA 4EQ3A 1NDGB 4BK5A 4YSUA 3HC3H 3RJQB 2X4UB 1GS6X 4P2CG 3EOTH 4NO3B 5IWLC 1VFUA 3NPZB 4AGPA 4MQ7A 1KPUB 4HK3N 5I74C 3BGFC 3BVNB 1UCTA 4PUBH 1KXVC 1ITBB 3EYOA 2WW8A 4JQXA 2QMKA 2Z9TA 2X6VA 5IW3A 2NXZC 3MOAL 1BYOA 3JWDL 2NUPA 3BWSA 4JRXE 4XMUA 4ADGA 1MDTA 4QXTB 1KJ2H 3A5VA 1BLNB 3TNNA 4FULA 4JHZA 2E6PA 1BD2B 2ED8A 3HZKB 1SF5A 3EIFA 3BZFA 3OR7B 4U4IA 3WS6A 2VXVL 1XCTB 4MLSA 4FNUA 3EOYG 3QDGB 4RA0C 1ZHKB 2K6YA 2Q7NA 5D6DA 2LE9A 4UOJA 4M1CD 2CWRA 5E8NA 4KVCH 2DQHL 2ZWNA 3IXTB 5AALA 5DS2A 3X14A 3A22A 3SY0A 4KK6C 4X5XA 4OCSH 2A9DA 3FQTA 3H9HB 1KULA 4Z9KB 3CZGA 2NNAA 5IMOA 3A0OA 3OXSA 4N2FA 3TZVA 3FO1B 3BH8B 4GXVL 1OALA 3T3PF 1QZNA 2NYYC 4UINL 1EDHA 3MRNA 3MRLB 2H41A 1GGBH 4L3AA 3UP1A 1PAMA 3ZXAC 5KVFL 2F15A 3KPLA 4PY8I 4ZMNA 1UCBH 3V55A 2P28B 4PP2B 5TDNA 2IEPA 4TXVB 1A9EB 4ZNEE 4X9HA 2A1WH 3QIWB 3O6KL 4FQLH 2ZYHA 4PJAF 4WHCA 3WNIA 5HYEA 3PNWB 4ZXBA 5I8EA 3KEHA 4G72B 5DXWA 3EJYC 2WNXA 2QKIC 4X7FC 4PRHE 3LXCA 1Z9LA 2X2HA 1ED3B 3UPRA 3P0VH 2D2CC 3DETD 1KBBA 4QHKJ 5KVEE 4D9QE 5FYJU 5HHOD 1Q4NX 3QNFA 2HZHA 1WZ1L 3RGVA