1V10A

Structure of rigidoporus lignosus laccase from hemihedrally twinned crystals
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
494
structure length
487
Chain Sequence
ATVALDLHILNANLDPDGTGARSAVTAEGTTIAPLITGNIDDRFQINVIDQLTDANMRRATSIHWHGFFQAGTTEMDGPAFVNQCPIIPNESFVYDFVVPGQAGTYWYHSHLSTQYCDGLRGAFVVYDPNDPHLSLYDVDDASTVITIADWYHSLSTKAPPAPDTTLINGLGRNSANPSAGQLAVVSVQSGKRYRFRIVSTSCFPNYAFSIDGHRMTVIEVDGVSHQPLTVDSLTIFAGQRYSVVVEANQAVGNYWIRANPSNGRNGFTGGINSAIFRYQGAAVAEPTTSQNSGTALNEANLIPLINPGAPGNPVPGGADINLNLRIGRNATTADFTINGAPFIPPTVPVLLQILSGVTNPNDLLPGGAVISLPANQVIEISIPGGGNHPFHLHGHNFDVVRTPGSSVYNYVNPVRRDVVSIGGGGDNVTFRFVTDNPGPWFLHCHIDWHLEAGLAVVFAEDIPNIPIANAISPAWDDLCPKYNANN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LACCASE
publication title The Structure of Rigidoporus Lignosus Laccase Containing a Full Complement of Copper Ions, Reveals an Asymmetrical Arrangement for the T3 Copper Pair
pubmed doi rcsb
molecule tags Oxidase
total genus 130
structure length 487
sequence length 494
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2004-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v10A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v10A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v10A03
4DP4X 2OV0A 1BXVA 4DP2X 1J5CA 1IBZA 1A8ZA 1PZBA 3C75A 1ET5A 4RH4A 1AZNA 3T9WA 3FT0A 2XX1A 2XU9A 1AZBA 2ZWNA 1B3IA 3EH5B 1URIA 1TU2A 1KCWA 3NJIA 2YAFA 1JOIA 2GC7C 1JXDA 1R1CA 4A67A 1PAZA 1J9SA 2YAEA 4KOBA 2PPEA 4CSPA 3N2JA 4HCFA 4KO5A 2YARA 4A2FA 3ZX1A 4DP9X 2HX7A 3L45A 3NJFA 3QJRB 5B1BB 2W8CA 2EIJB 3S3BB 3UAEA 4AKPA 3NJMA 1W6LA 4YSEA 4YSRA 1SDDA 5PAZA 1AS6A 5A7EA 3RYMA 2AZAA 3AG4B 4A68A 2GIMA 1NZRA 1GW0A 4KNTA 1BQ5A 2BP8A 7PCYA 2CAKA 2XX0A 2YAHA 1JZFA 2MTAA 3ABLB 4E9QA 4G7QB 4A2GA 1QNIA 4GP5B 1GSKA 5B1JA 2PP8A 3FSVA 4M4RB 3NSCA 4AI7A 1T5KA 1JERA 2XWZA 3PAVA 2FTAA 3FS9A 3WNIA 2PPAA 1DYZA 3KW8A 4KNUA 3SBQA 5I6LA 1ILUA 1OOWA 4Q89A 3AY2A 1JZHA 1SHWA 3MBWB 3SQRA 3TU6A 3X1GA 1ASQA 1KDJA 3PAZA 2Y69B 3V9CA 5B1KA 2YAPA 6PAZA 2DYSB 1A65A 3BVDB 2TSBA 1X9RA 2HLEB 4UANA 4DP7X 2RACA 4YSTA 1BYOA 5I26A 5LDUA 2TSAA 1ASPA 2VW4A 4DP5X 1PLBA 2Q9OA 3OMNB 3T6XA 3WNJA 3ABMB 1ZDSA 5I6KA 1VLXA 1PNCA 3JT2A 2DWSA 2FQGA 4YSCA 2GSMB 5B1AB 4G7RB 2GBAA 2PPFA 3QJUB 1NWPA 1WA1X 3NT0A 3NYKA 3OQRA 1OCZB 4BWUA 4WKXA 1QHQA 2H3XC 5I6MA 2XLLA 4A66A 1HAWA 4E9SA 3GXUB 2DY2A 3S8FB 2VW6A 4JHUA 4AX3A 3BQVA 1JVLA 1E30A 1JVOA 1AZCA 1L9PA 2AFNA 2H5UA 2QDVA 4YSOA 3WG7B 4A2HA 4A2EA 1AQ8A 3ASOB 1XB8A 3IN0A 2VN3A 3X1FA 4FA7B 3CDZB 4DP0X 1A4AA 4GP8B 1AANA 3GYRA 2BP0A 2IH9A 2UXTA 1ASOA 1V55B 3OD3A 4BXVA 2UXGA 1AIZA 1TEGA 5I28A 4BXSV 1CYXA 2PP7A 2XV3A 3JTBA 1HFUA 2HXAA 3V9EA 1OE2A 2IDFA 2QPEB 3TBBA 3FPXA 3FU7B 1OE3A 2FWLB 3NSDA 4PAZA 1JZEA 1AG0A 2GI0A 2X88A 3FQYA 1DZ0A 1X9UA 3H4FA 2R7EB 2CCWA 5AZUA 1ZIBA 2X87A 2DWTA 1M57B 1ID2A 4G72B 4PCYA 1GY2A 5F7AA 4E9WA 1AR1B 1ILSA 1PLAA 1J9TA 3PAUA 1XB6A 3GDCA 1RZPA 1AACA 4NB7A 1PNDA 4P5RA 5B7FA 2AANA 2FQDA 3FU8A 1QLEB 3AW5A 2PLTA 1NIFA 1SJMA 4HCIA 3QPKA 2FJSA 1SF3A 2BZCA 1UATA 1CC3A 4AKQA 1NIBA 1KYAA 3S3DB 1ZDQA 2IDUA 4YSQA 2PCYA 3QQXA 2DYRB 3TA4D 4HZ1A 2BHFA 4NAJA 3NJHA 2GC4C 4DPBX 4GYBA 4BDVA 1AAJA 3X1BA 5ANHA 4A2DA 5B1JC 3FQ2A 1SHXA 2J56A 2EIMB 1JZIA 1FA4A 5I6NA 2UX7A 2YQBA 3HB3B 2IAAC 4G7SB 1SDDB 3FU9A 1CURA 1ADWA 2B3IA 2J57A 2BO0A 1HAUA 3PLYA 4M3HA 4JHVA 1M9WA 1NPNA 2N0MA 4E9RA 3UACA 1ET8A 1W8EA 2YAOA 3PCYA 4YSDA 5B7EA 2BP8B 4YSPA 1AZUA 1YLBB 4HIPA 2H47C 1TKWA 2YXVA 4G70B 3FQ1A 1FFTB 3IN2A 3U25A 4F2FA 2BWIA 3FPYA 1A3ZA 2WO2B 3X1EA 1MDAA 1NIDA 2HZHA 3NJGA 1PZAA 1BAWA 9PCYA 1F56A 4DP8X 2AZUA 2FQEA 3T6VA 5IY5B 5I5IA 1NDTA 1NTDA 3CVBA 1BQRA 2QDWA 3DKHA 1KBWA 3T6WA 4GP4B 4KO7A 4QLWA 2Q5BA 4HCGA 3IEAA 3WKPA 4FAAB 2FNWA 1GY1A 3TASA 3D12B 2CALA 2XV2A 2HX8A 4P5SA 2J55A 6PCYA 2YXWA 2OCCB 2IWKA 1PMYA 5AKRA 3NJLA 2UXFA 2BW5A 1PF3A 3MX0B 3SBRA 2BWDA 2JXMA 2P80A 1KCBA 1PLCA 1PY0A 2FT8A 1MZZA 4AKOA 4BWTA 4DPCX 2EINB 1CUOA 5I5JA 1BQKA 1ET7A 2JFCA 2LLNA 2VM3A 4YSUA 1XB3A 1PCSA 1SF5A 1ZPUA 2DV6A 1W6WA 2HRGA 5PCYA 3EF4A 1BXUA 2PPCA 3WKQA 4E9TA 5TK2A 4K9JA 3NSFA 3NP4A 1JXFA 4AZUA 4QKTA 3S3CB 4YSSA 3AG3B 2PPDA 1L9RA 2HX9A 4DPAX 3UADA 2YAQA 1A4CA 2BP0B 1L9OA 1ZV2A 1PZCA 3EHBB 3ZDWA 3SBPA 1WS8A 2NRDA 3H4HA 3PPSA 3PXLA 5E9NA 5B3SB 1E5ZA 2W88A 3CVDA 1GYCA 4KOCA 5EHFA 1CYWA 3NJKA 4E9VA 1BEXA 3HEIB 2CJ3A 2BW4A 1TEFA 4HHWA 3FYEB 3QJVB 3DIVA 4N8UA 3EH3B 5D4IA 2XVBA 3UABA 5D4JA 3CG8A 1MG3C 1GS7A 3AZUA 2IWEA 3AG2B 4DP6X 3ABGA 4TXVB 1KV7A 1GS6X 4ZK8A 5I5MA 2IDTA 1OE1A 1L9QA 1JXGA 3NJNA 4CSZA 1N70A 2I85A 3NJJA 1KBVA 3X2QB 1IUZA 4E9YA 4KNSA 2ZONA 1AZRA 1MZYA 2XXFA 5I6PA 1AG6A 2IH8A 4G71B 2I7SA 1E67A 2UXVA 3N55A 4HALA 4N4YB 3IBOA 4BK5C 1XMEB 1OCRB 1IKOP 3QJSB 1I53A 1GS8A 2VMJA 2A3TA 2WO3B 4YVNA 3DTUB 1JZJA 4YL4A 1KDIA 1AOZA 4BDVB 3H56A 2IDSA 3IE9A 2EIKB 1WAEA 3ZIYA 2E86A 3NP3A 3T71A 4MFHA 5I6OA 1GR7A 4WTQA 2IDQA 4HAKA 4HHGA 5AFAA 1NIAA 1OCOB 4BWWA 3EH4B 1SFDA 1FWXA 3ZBMA 5FC9A 1SNRA 5TK4A 5D4HA 5F7BA 1NPJA 4UF7C 1M56B 2VSMB 4W1TA 1J9QA 1EZLA 3OMAB 4JKNA 2YAMA 4L0PB 2CUAA 2VM4A 3T6ZA 2AVFA 1OV8A 2MRYA 1NWOA 2QT6A 4UAHA 4W9ZA 4ENZA 2IWFA 2ZXWB 1AS8A 1JZGA 1N68A 2I7OA 1ETJA 2WSDA 3WIAA 1KGYE 2OJ1A 2UX6A 2GB2A 2JKWA 2XYBA 3CVCA 4GXFA 4KO6A 1NIEA 1J9RA 1ZIAA 2VSKB 1J5DA 3WI9A 1OCCB 1BXAA 1NICA 3UAAA 3CZUB 3S8GB 2FT6A 4KO9A 5B7MA 3G5WA 2FT7A 3FYIB 1MG2C 1V54B 2XXGA 3X1NA 1RKRA 1L9SA 1E65A 3TBCA 2P80D 3FSWA 3KW7A 2GHZA 1RZQA 2VW7A 1WS7A 8PAZA 2PCFA 3CDZA 3QJTB 4NERA 1IBYA 2PP9A 1V10A 3AG1B 1AS7A 3ABKB 1IC0A 2XV0A 4F7KA 3ASNB 2QPDB 2HRHA 1OF0A 1BYPA 4GY4A 2J5WA 2BZ7A 2XUWA 3OMIB 1WA0X 4YSAA 1SFHA 3ERXA 4DP1X 2ZOOA 4E9XA 2CBPA 1RCYA 1E5YA 1NINA 1L9TA 4YVUA 1A4BA 4F2EA 2EILB 4Q8BA 4X4KA 2B08A 3QJQB 3FSAA 3FU7A 3FSZA 1WA2X 3UGEA 2FQFA 7PAZA 3NSYA 2R7EA 3OM3B 1EHKB 2Y1AA 4EF3A
chains in the Genus database with same CATH superfamily
4W9FC 2DS4A 4JZNB 1FL5B 5ESVB 5JHLL 4AJWA 1A8ZA 1BECA 3MLXH 4TTDD 1K8IA 5GGUB 4OIFA 2APTA 4HLZG 5IT2L 1QRKA 5KSBA 5FYKD 4L0ZA 2BJML 2XX1A 3REWA 15C8H 1E4WL 5AYQA 4JY4B 4GXUN 3MBEA 5HVFB 3DARA 2J6EH 5DD1L 2HLAB 4KRPD 5DJ2A 1FYTA 2O4EA 1KXVC 3K6SB 3IB4A 4JMNA 4RWYH 1WIOA 3N2JA 4HV8B 4HX1B 3DPBB 3PWLA 3HB3C 3VWKD 3C09B 3L9YA 4A2FA 4FQ2H 4DNLA 3QHFL 4AKPA 4X8XA 3NJMA 5GS2D 2YXMA 1KJ2A 2VC2L 4ZW3A 5KVGL 2E76C 3BAEH 1DBKH 5PAZA 5EDSA 5A7EA 5I15L 1T3FA 1SMAA 1ZV9A 3MROB 3O2DA 4IS6A 3QUXB 4KX8A 3VG9C 2VLMD 3MRJA 3D07A 1BVKB 4A7VA 4MNQA 1LP9A 1TSRA 3ARXA 5DD6A 2MTAA 4CVZA 3HI6H 3QXDA 4G7QB 2D31A 3SDDB 5DQDL 4OZHF 4CW1A 4D0BB 4PFEA 3ULUE 1N8ZB 5LGHL 5E2WL 4Y5YB 3PNWA 3M86A 5D55A 4HOWA 2ENJA 1T1YA 1IGIL 3QJOA 4POYA 3VG0H 4Q89A 5AYTA 2Z8VC 1MJJA 1B6UA 3HMXL 3K72A 3RI5F 2O5XL 1SJHB 3MCYA 1S7UA 5LQBH 1ZS8B 5DMGD 3V9CA 4QJ5B 3H7LA 1IVTA 2WB1A 1FVDB 5L2KE 2JLLA 4LLUB 2KBGA 4JK0D 2JCWA 3JBG7 1EK3A 3UTPD 3LQAH 5DLLA 1R3IL 4XPGL 5DK0B 4UNTA 1PLBA 4JG9A 2F53D 3SE3A 5C09E 2QMKA 3DHPA 4JDEA 4YE4L 4X5WA 2FE0A 1VA9A 3U6RA 5CJBA 4RNRA 1RJZA 2CIIA 4PTTA 5D5ME 2GSMB 1X5XA 3ZTEA 2Z8SA 1ITBB 5LG1A 4J5VA 3HC3H 4EI6B 2QJDA 4PJXF 4OV6F 1CFVL 3T1FA 4HEME 2BIOA 2XZCL 1XMWA 3CMOH 2P42B 3R4RA 4LQFL 1ZA3A 4UYPA 4Y2DD 3VH8A 4E9SA 3H6AA 1NAKL 5HI3C 4KZCA 3K71A 2Z8WC 1N5AB 3BQVA 4AGNA 1JS4A 3SKUD 4XCEB 3WDJA 1AQ8A 5E6RB 4OB5L 1XBRA 3PHOB 5K9OA 1AO7D 1N4XL 3FRPA 3GSUA 5I18L 5IEKB 4U6TA 5KN5A 3V4VA 4FHBD 1CGSL 3EHBC 4GG8A 4DP0X 2XN1A 1M7XA 2CKNA 1IGFL 3BSZH 5F7FA 3BEWB 1CVRA 1QX1A 4Y1AB 3GYRA 1MCCA 1GH7A 3E7JA 5F7YC 4BFIA 4BV1A 2P24B 1O5DT 3SKNB 1K5WA 2NW2A 2UXGA 1QLEH 2ZOKB 2FL5A 2YOAA 4OUUA 1T0MB 3OL2A 2I27N 2O5NA 3TWCH 1MFVA 2BY3A 2IO5A 4MD0A 2IAMD 4FQIL 5HY9A 3MN8A 3DVFA 5KVFL 2B5IB 4JPVL 3T3MB 1PW3A 4APQB 2Z91B 4PAZA 5T5NF 5GISL 1DVFB 4P4KD 5CSGA 2W95A 4HUWB 2R4RL 4XPAL 3CFCH 5GZOA 4H8WH 3PGDA 3HA0A 4FP8L 3IFOA 4HIJA 4PJEF 1IM9D 4P23A 4BEIA 1PY4A 1T2QH 1UWEH 1UM6H 1YYLL 5AW4B 3ZY7A 5KSBB 5T33L 1ACYL 2E6JA 2Z1KA 3REWB 1KIQA 4OLUL 1CDHA 5L9DH 3TO2A 4WY7H 4IOSA 2MKWA 4TULH 2MPVA 3MBEB 3OAYK 1CC3A 1MFCH 3JTSA 5DVLA 5CJXC 5DJ2B 4XP9L 1NLDL 4OLWL 5IREA 4HLEA 3C5XA 4DKDC 4YHPA 5ANME 1QFUH 1FE8L 5KVEH 2XTLA 2YA2A 4IBWA 2BSEA 4ATWA 4MD4A 4NNPH 1BLNA 1ZHBA 5FCUL 1SHXA 4ELMF 4WI3A 2YQBA 1KJ2B 1JI2A 1VGEL 1ADWA 1KXTA 3VMPA 3W0WE 1T3FB 1DLFH 4PIRF 4IS6B 3BH8A 1MFEH 1EMTL 3D69A 3MRJB 3QCUH 3H0TB 2OSXA 4A6YA 1ET8A 4XO4A 4MNQB 1LP9B 4KV5F 3CVHL 1PD6A 5DD6B 4FA6A 5EEZA 4B53A 5KBDA 5GSRA 4U1NA 5IMKA 3QXDB 4XVJH 4CVZB 4K71B 2D31B 5H94A 1ZRUA 2EE0A 4CW1B 5C6TL 4HKZA 4TNEA 1DJYA 2L7EA 2WAHA 5JZ7D 3PNWB 4PJXE 4PV9A 3DK2A 4WI5A 3WNKA 4YXHH 4U3CA 1NCDH 3U6XA 2JK5A 1PPIA 2FO4A 1DJSA 1MJJB 2BWQA 3K72B 1BQRA 3FQWB 4G43A 1S7UB 1TVDA 3T0EE 4RA0C 4WW1A 1IFHL 4ZYKA 2VWEE 4K07A 4LE8A 1OWWA 1AP2A 2CALA 1L0YA 2EDKA 4OGYH 4GMSH 1SXSA 4AL8L 1FLRL 3GEWB 4X5WB 1CFNA 2XBZA 3U6RB 4RNRB 1RJZB 2CIIB 4PTTB 3RTQD 5HGGS 4Z3EA 1VEOA 2E74C 2XG4A 3MUGA 3SDAB 1TR7A 4HSAC 3CFDA 3QC5X 4ZUVA 3O6ML 1UB6A 4CMHB 4J3OF 2Y7LA 2DLIA 4TLSA 3A5VA 3T1FB 4G9DA 2CU9A 2WCSA 1TZOA 2WZ6A 3PS6A 3S35L 3ECUA 4YHZL 4D94A 2P47B 5C0DA 1NFDF 1ZA3B 5ICXA 3VH8B 1NAMH 4YSUA 2X89D 3MV8D 1IGYA 4XOCA 4IKJA 5DD0H 3K71B 1ZANH 4X5XA 4Y4KC 1GCYA 3NSFA 2O6DA 4PJEE 3B3BA 4FLSA 3NP4A 3FRPB 5F0LB 3GSUB 4F8TA 2ZCLH 4B9JA 5K9OB 2AI0H 1CGTA 3IFLH 3V4VB 2UY7A 3LRHA 4GG8B 3VNYA 4P9HC 4JN1H 4HLJA 5F7LB 2IPUK 1A1OA 2UVEA 3FTUA 1WISA 4O02H 4BFIB 3RDTC 3WN5A 1QSEE 2ZT9C 2NW2B 4FYTA 5C08B 3CXHJ 4KZ0A 5JPNC 2FL5B 2OP4H 3C2AH 4OUUB 1FGVL 1G0YR 1IAIM 5TE7H 3ZDZB 4NN7B 4HFUL 1GYCA 1BGXL 1HOEA 2XVGA 4MD0B 5BV7L 5HY9B 1OAXL 1B4LA 3TOPA 2ZNWA 2NR6C 5JLZB 4CC0A 1JPEA 3BSZL 3ULSA 4ELME 5D4JA 4N22A 5DC4B 1MG3C 2W38A 3ABGA 3BCFA 3Q1SL 3JUZA 4XNBA 4IBUA 5I74B 1ZEAL 3PGDB 1LM8V 1IAOB 5JIKA 3IFOB 2IDTA 1Z9LA 4P23B 2VAAA 5F70A 1BZQK 5ACMA 1SM3L 4FKEA 4KV5E 3LEVL 5D7EA 3APDA 1H3PL 5I30L 2AP2A 2WK2A 1KIQB 1PYWA 2ZWYA 4KNSA 4JREC 1MZYA 4JHAH 3D4GA 3TO2B 5MEPA 1MRDH 5BQDA 2O5ZL 1KOAA 3JTSB 1A6ZA 4FQXD 4HS8H 1Z1WA 4NZUH 3A6OA 1ITCA 1SLVA 2A3TA 4KJQD 4HUXB 4YHPB 3IMBA 1MFDH 1JZJA 4NIKB 3ETBF 5HHOE 3B83A 3GUFA 1XXFC 3DX4A 4MD4B 4HK3N 1BLNB 1ZHBB 3PNRB 1WWCA 4LOUC 4XTRC 3GGWA 5FS5A 1BQLL 4X9GA 1LDPL 3NIDB 1UJTA 5BPPA 3ECQA 4MKMA 3B7UX 3T71A 3BH8B 4N2MA 2QR0A 5EN3A 2R69H 3D69B 3D4CA 2BSSA 4A6YB 2CO3A 4WJG3 2MQ0A 1NANH 2NTFA 3BHBA 4PCSA 2G0KA 5F88A 5T3ZH 1FWXA 2DD8H 2XQBH 3LH8A 4D8PB 1SNRA 2XTSA 1GGUA 2HMID 4R2GB 3MV11 5GSRB 4U1NB 5TE6L 2VLJA 2VSMB 5H94B 4YK4C 1XR9A 4MAUL 3P4MA 4YFEA 1KY7A 4HKZB 1NFKA 2KMWA 1DQQA 4QO1A 1G87A 2JQZA 3U79A 4Q6YA 1OV8A 3LRGA 4TRPH 2I9TA 4PV9B 4EDXA 4XMWA 2NY2D 3ZPDA 3NA9H 5FW7A 2K7QA 2A9NH 2FO4B 1NFDE 1TITA 3WHE0 1V7MH 5CUSL 2VDKB 4XN8A 1KG0B 1X6NA 5I1LA 4FZEH 2P5ED 5IJCC 1M53A 2IVFC 2GB2A 2WIMA 4G43B 4QRRE 4QUOA 1YEKL 2WXPA 3VGFA 4QXGH 4FG6D 4FQHA 4WW1B 2BNQD 3U1SL 4ZYKB 1BOGB 4X7SH 5ILTH 3UJJH 2WBJC 4U1SA 1E9QA 1XSJA 2AJUH 4PTUA 4PVNA 1AP2B 4TN9A 4WGWB 4Z76A 5AD0A 2A4CA 1MVUA 2AJSH 5AQ0A 1GYUA 3PV6A 1X5GA 5A2CA 2J1XA 3GRWA 4JUSA 5J6SA 3ZYOA 4ODVH 2FEJA 3ARUA 3OX8A 2XG4B 3MUGB 5HDOA 2XZZA 4R9HA 1Z6JT 3CFDB 4PJAF 1MFMA 4ZUVB 1UB6B 2MPAL 4N0RA 1YNLH 4PRBA 4BZ2A 4JFWA 4NERA 4G9DB 1PIGA 1VFOA 2PP9A 4A38A 4B95C 4XCCH 4AQOA 1V10A 5C8JA 1S5HA 3QEQD 2FJGA 5C0DB 5ICXB 3ASNB 1UD8A 5C0JA 4LPTA 2OTWA 3TP4A 4LPCA 4QNPF 4HOMA 1OF0A 1IGYB 4CL7A 1A5FL 3INUL 4GY4A 4R83A 1XBDA 4OT1L 1U8IA 4X5XB 3CN4A 3JV6A 3A0OA 4HU2A 1F13A 5JQ6H 1E5YA 4X7TA 2IAND 3D18A 1RIHL 2UY7B 5EBMA 3OAZH 3QUYD 3QJQB 3WY4A 3V6ZA 4JRYD 3TL5A 3UGEA 1NCBL 2X3AA 4YC2B 4TLTA 1FH5H 3WN5B 1DQDL 1C5DA 4UT6H 5DD3H 3PYCA 1A7QH 4K7PH 3AY4A 2GEQA 1MHPH 4YHYB 4IRJA 1UOKA 2HN7A 2OMUA 1HIMH 3EYQD 2G5BA 4JRXA 3U7WL 1YQVH 1AZBA 2ORBL 4FQPA 5F0JB 3RL1A 2L8AA 2ESVA 3ULSB 4EDWH 2ZJSL 1AHKA 1CTNA 3NPSB 3GFUA 4JFZH 4LCCC 2YAFA 4HIIA 4B9IA 1Z7JA 1MH5A 3BRGC 2WGXA 2ZPKL 3PL6D 1IRAY 1B3JA 1ERNA 2VAAB 3EJQA 3HUJA 4M8RA 4OIIL 2XACC 4QEGA 1QNZL 4TUOA 1NEPA 2B1HH 5C97A 2CPUA 2NPLX 2WTOA 2NTSP 2DOCA 3DIFA 5MEPB 4YSRA 1F4XL 1OW0A 2WXIA 1A6ZB 4Q9BA 1VJSA 3N43F 4A2MA 4HF5L 4F2MA 1I3RA 4YHOH 1JP5A 4DN3H 4ODBD 4JFEB 4S1QL 4NUPA 4M61A 2FJHA 3ML8A 3V95A 3KYAA 1I8KA 3FTYA 3TN0C 3UTSE 4Z8FL 4KH2A 5C07D 1B2YA 3GGWB 4FQ1H 3OKKA 4I2XA 1MLBA 4PG2A 1SLWA 2J25A 3M88A 2NDFA 4Z7VF 4OGAC 3U30C 5IROD 1EVUA 4PSPA 2XBTA 2QR0B 3RWIA 1P5UA 1FNAA 4N1HB 4C58B 2BSSB 3HZMA 2NTFB 5F88B 3BHBB 2JVUA 4RFOL 5D1QD 2BFGA 4F8PA 3CHRA 1AZVA 1XCTA 2NY1C 3APMA 5DQ9A 1YEFH 2ZWKA 2VLJB 3MACH 2XWRA 6PAZA 2D7MA 2JB5H 1KGCE 1XR9B 3SE8H 1ZVNA 2TSBA 4Y9EA 3B3IA 1DN2A 1DQQB 4QO1B 5DEZA 4CSTA 1NFAA 4OGXH 2I9TB 4OQTH 2I24N 5IZ7A 3MRHA 4EDXB 2IG2H 1LVEA 3D3VE 1KB5A 2A4ZA 1A9VA 5C0ND 2BOBA 5I1LB 2ARJA 1QWUA 3WXWH 4QNPE 4LSTL 5AVSB 3SE4A 4BELD 2E9WA 4FQHB 3BZ5A 5CLZA 2YD9A 1X5AA 1I4FA 3RWCA 1XL6A 4TUJA 3JTTA 2IGFH 5TDPA 3FT2B 4U1SB 2DQJL 3CTTA 3I3EA 4MLSA 4PTUB 2A7BA 3ILQD 5CCKL 2QVTA 1RZ8B 4Z76B 5AD0B 3WU1A 1AGDA 4A66A 4PSRA 4QRPA 1E6JH 5CILH 1MVUB 2EDHA 4R4FH 4XP5H 3V6OC 3WFEH 4JHUA 4LEOA 4PJIF 4AX3A 3PV6B 5FAAA 1NGYA 2CKBL 2H5UA 2W59A 3IN0A 3OX8B 1ZK9A 1DQJA 2PXYC 2FVNA 2CR6A 4RIRA 1LHZA 1NCAH 4PRBB 3RJOA 5BQ7A 1GHFL 4WTZG 3GSRA 4NCC1 4EIZC 2ETWA 5C8JB 5E7FA 1S5HB 2Q7NA 2FJGB 3G6JE 5JYMA 2G3XA 2GY5A 5C0JB 2OTWB 4F27A 4KQ3L 4NWUH 2Y3NA 5E4EC 3WSQH 1U8IB 3KJ6L 3PP3H 3JV6B 3OBAA 3SIKA 1YC7A 2OMWB 2VUOA 1ACXA 1JJUA 3D51A 4J1UB 4XPHL 4LCYA 4LOVA 2QQNL 3L3OA 4DKEL 4X7TB 5E70A 5KSAC 4TTGA 3D18B 1UKSA 5AEAA 3UBFA 2AK4A 2QPEB 5EBMB 1NKGA 2Q6WA 4DVRH 4G5AA 4KDTA 4R4ND 3V6ZB 3ZRCC 3FQYA 1OANA 3GXTA 4OFPA 5AZUA 5T1MA 1C5DB 5TDOA 4AYFA 2HRPH 1HL5A 4G72B 4UTBL 5HDBF 4EI5C 5LNDA 1HXYA 4ZAKA 5KYYA 2EH8H 2IOMA 2ATKA 4IRJB 4AUJA 2HN7B 1E8YA 3HCVA 5T5FL 2G5BB 4JRXB 1XGTA 1UACH 5EORH 2FQDA 2OMNA 2WKLA 4KFZC 5TGBA 3MSPA 4PRID 3P77A 4N9OB 2QLVB 1E0OB 1SJMA 3RL1B 1FQ9C 2ESVB 3ARQA 2QSQA 3QRGH 1UATA 2UWEE 3DGCR 1CDGA 1PD1A 1OP9A 2CD0A 4NUMA 3TIEA 2NT0A 5AB9A 3HLAA 1FFRA 3KYMA 4L1TA 3WE6A 5IB3A 1D5BA 1G94A 4HIIB 1QEWB 3CHSA 3QQXA 4DGYH 1MH5B 4O9HL 4BE5A 1UEYA 4KKRA 3HUJB 1DO5A 2WWKO 3ZE0B 2GC4C 4TUOB 1SPDA 4Z3IA 3PG2A 4K3HA 3CZFA 5AAWC 1TTGA 3K2UH 3DIFB 2NZ1A 4HG4J 4Q9QL 3GNMH 5FHAL 5LB1A 3RIKA 4V1DE 3LZFL 1SN2A 4F2MB 1I3RB 2JLPA 3CH8A 5A2JH 1NPNA 1U3HD 1WK0A 1BFTA 3IDMA 4M61B 2FJHB 4N0UA 1LO4L 2RD0A 4DQOL 3UYRL 4PBDA 1I8KB 2MOVA 2D7TL 1KFGA 3JV5A 4H88L 4POUB 4AGOA 2FATL 4G70B 4JFFA 2RIKA 1O6TA 3DRTA 3OKKB 4I2XB 1MLBB 4OSUL 3KPMA 2IXQA 2AEWA 1BJMA 4P2QD 3V7AE 1EVTC 3RWIB 3FTVA 1P5UB 2F5BH 3KJ4B 1ZVHA 4NLHA 7CGTA 3EYUL 4PJIE 1U91A 4LAQH 25C8H 5I6XC 1XCTB 5DQ9B 3OKOA 3BWZA 4XOAA 5CU9A 1E8XA 2IQAA 3FB7A 3B3IB 4YLCA 4FXKA 4P2OD 5F71A 2YGPA 3S36L 5GGVH 1QZ1A 3MRHB 1FIGH 1FLTX 3MQIA 3ESNA 4P5SA 1CTOA 1S7WA 4LHUG 1KB5B 1HYRC 1Z0MA 2MNWA 3TJPA 2BOBB 2IADB 4KMQA 5DMIH 2DEYX 1UXSA 4NSKA 2Q3AA 4CRPA 4QRTA 2KL6A 3GZQA 2WXMA 4LEXL 3A6CH 3MRMB 4EKJA 3CHXA 1I4FB 4ZTOH 3D52A 3MX0B 3R8BB 1DEDA 4TUJB 1EHLL 3JTTB 5TDPB 3PWUA 5CN2A 1KCBA 4JY5L 2J5LC 3RZWA 3ULUC 5CBEA 1NOLA 5A2LH 2COVD 1BQKA 4Y2NA 5J7CC 4X6DE 4UUJA 1B4RA 3MUHL 1AGDB 5ITBH 1MCBA 4QRPB 1B0WA 1G9ML 3LKRA 1W9XA 2DV6A 4LEOB 3ZGHA 1W6WA 5PCYA 1NGYB 1T0OA 2OS7A 5HDBE 3WKQA 3UCQA 1DQJB 3B2UD 1TZ8A 5HI4C 3A21A 4OW6A 4XP4L 1CFSA 4HQQL 3TBWA 5BQ7B 3P3UA 3GSRB 2WIIA 4IRSC 3QYMA 2VUYA 2NQCA 3CXDL 1EBPA 4F8QA 4KHXH 4EIBA 4LCYB 4KOCA 2VDMB 3L3OB 5IW3A 5JW4R 3DV6A 4FTVE 2AK4B 2XOTA 4OTXL 3N0PB 2OZ4H 1F90H 2BW4A 2Q6WB 2FX8H 1V7NL 4R7DB 5D7LD 2LFEA 1WH0A 2ZG3A 2EEBA 5T1MB 4AYFB 1UCBL 4HSCX 5TDOB 4BKSC 2H3KA 3I3DA 4NJ9L 4DP6X 4PH8A 1HXYB 4ZAKB 3RVUC 4WI4A 2ATKB 2Y7SA 1D9KD 2KPWA 3HCVB 1XGTB 2ZAHA 1WITA 2B0SL 4J6RH 5TGBB 3BP4A 3H3KA 1TZIB 3P77B 1YJDH 5C0CA 4G6MH 1LL1A 2XY2A 2QZ5A 3F85A 4JKPL 3HG1D 3TIEB 3O3DA 5HDLA 5I1CH 3HLAB 3KYMB 3QNXA 5CZRA 3WE6B 5I0WA 5IB3B 4Z7OF 5D72L 4XXDA 3FAXA 2IWGA 4JM4L 4U2YA 4J3TA 1J8RA 3KCWA 1CLVA 35C8L 1WG3A 2BM3A 4DOHE 4WGVB 3FO2A 2CJTA 5SWQA 2VDNH 1UEMA 3CZFB 2H1PL 4D3CH 2GK2A 1EX0A 4KK5D 3ZKXC 5B21A 3D08A 3V5KA 4OCYL 1SXZA 3BKJH 3KPSA 3I50L 5D1ZC 5HYJD 1EANA 2E7DA 4WLCA 1HCYA 2YPLE 4JFYA 1AMYA 4XN7A 4HAKA 3IDMB 4BWWA 2PABA 4C56D 4N0UB 1DVXA 3HC4H 2FX7L 1MAJA 1FSKB 1TQUA 2D3NA 4BSJA 1CPUA 3C5ZD 4I3RL 2FSDA 2NXYD 1LTXA 4N90D 4JFFB 2WVVA 3OMAB 1I8LC 1MIML 2Z31D 1UFGA 3DRTB 3DIDA 3KPMB 3DPDA 3KL5A 1WEJL 2IXQB 3IWVA 4P5TD 3M17B 1N68A 4CILA 3UZQA 4P46C 1LO0H 4OZIA 3K6NA 5CBAA 1U91B 3L3GA 1LO3H 3OKOB 5CEZH 1J9RA 1FGNL 5CP7A 1URZA 2IQAB 3FB7B 2P4AB 5I0XA 2BVYA 1TTUA 3VW3H 4FXKB 4GAGL 3VAEA 3ZR5A 3S97C 2XPGA 1DFBL 4ZPTA 5T1LD 4RAVA 3DYPA 3CZUB 3LPFA 1T2XA 3FTWA 1XSKA 4Z7UA 3X13A 2NDGA 3NH7L 5SWZD 1UXSB 4NSKB 3GBNL 4QRTB 2CBMA 2WYZA 3DX3A 2WXKA 2E47A 3M7OA 4OJEH 5EULV 1YEDA 3Q9QA 4EN3C 5C7XH 5ICYA 4Y19A 5EZOH 5A43C 1J48A 2DEWX 5E08H 3PWUB 1JNLL 5CBEB 4XB8A 4A37A 2JJTA 2XQYG 4UUJB 5CJ8A 1IBFA 1MJ7L 4F7KA 4Z23A 1XF2A 1JGEA 3LKRB 4OFYD 3NN8A 2NQ3A 4UQCA 4EEEA 2J4WL 2LU4A 4GO9A 4W4NA 1AD9B 2CBPA 2H26A 4G5ZL 3T0EC 4IRZA 1CFSB 1OK8A 3TBWB 5I76A 2VWEC 3R8QA 4GMTL 4JFUA 1FFOB 2ERJC 2WIIB 4MHHI 3TYFA 5D1QE 1NGPH 2FQFA 3K6DA 7PAZA 1UG9A 2VXUL 2Z93B 5E51A 3S37L 3II2A 4IKIA 2J1WA 4U3XA 2AK1L 3D2UA 1A3LH 4DN4H 4XVTL 2OV0A 3HE7B 2M1KA 4Z7OE 1IGJB 1QSFB 1IBZA 1CFQA 2IH1A 4M1CD 4X6CA 3DV6B 3NCMA 4G6FB 2CE6A 4NOBA 4AQ8C 2AABH 2AEOA 3SGDI 4L3EA 3K8KA 5JPMA 2GQHA 4JPWL 1YEJL 3PHSA 1BFSA 3CX5K 3VX0A 2M26A 4QHNA 3V6FA 2G5UA 1KIPB 4J4PD 5T8IA 3WFCH 1A7OH 2J72A 2GIXA 4ZUUA 2O5YH 2H3NA 1QI3A 1GKOA 2PWFA 1IQWL 4XP6H 4RGNE 3B2VL 3PPEA 3BP4B 3QEGL 4OD3L 3SJVD 4Z1PA 4X98A 3F58H 3L45A 3QAZC 2WWKT 5E99H 5C0CB 4IIQA 1B0RA 3B1UA 3MNVA 4UCFA 2EDRA 3O3DB 1Z2KA 3NESA 1MFBH 3QNXB 3NCFB 5CJXA 1GPOL 4MASA 2OL3A 4XXDB 3KS0J 1KBGL 4KNQA 2HJKA 4CBPA 3MTXA 1NEZG 2HPOA 4KKQA 2PW2A 1BQ5A 4N2HA 1ZKAA 4C4KO 3P0YH 3ULVL 3FO2B 4JQIH 5SWQB 2V0AA 2CRMA 3CZLA 4K7PY 4ONGL 2FB4L 1DQML 1MCKA 3FMGL 3CLWA 4J23A 1IFGA 4ERSH 4Z77A 3PAVA 3V5KB 5J06A 3KPSB 4N0YH 4AV4A 4GRWH 1AJ7H 2RA1A 4FQQA 4J12A 4EVNA 1JRHI 3PHAA 2ZP9A 3RZCA 2J7LA 4JFYB 3A3YB 4AMKH 1GW6A 2HG0A 4WGKA 3Q9PA 3JV4A 4WHTA 5DK3A 3VXUA 4H8HA 1NKOA 3D09A 2R2CA 3DUHA 2Y69B 5FM4A 2A9BA 4LU5H 4ZW8A 5EWIH 3WEAA 4WKZA 2ZCZA 4AVKA 2WVVB 3P4NB 2VDOL 2Q2EB 2LV4A 1MAMH 2WWOA 3UTTE 4DP7X 3CPUA 2B3RA 3RUGF 3RFZA 4OBSA 2OJZL 1LO2H 4HPOL 3L4TA 1YY9D 4NZDA 3WNJA 3ABMB 5ACLA 5CBAB 3L3GB 3INOA 4LIQH 4I9WD 1NMAL 1M7IA 5CP7B 2EDTA 3R0NA 3DJ9A 3QJUB 5DZPA 4XNXL 1QLRA 4NWTH 2WP3O 1JWUA 5EZPA 1QHQA 1FBIL 5C0BE 3O81A 4XVOA 2XPGB 4W70A 4ZPTB 4RAVB 4L2LA 1E4JA 3GXUB 3X13B 4Z7UB 2EDYA 3BAJA 4NRZA 3VXRD 4C4UA 3WEXA 3QJXA 3KPPA 1PAMA 1YEDB 4RFEA 3A6BH 1OD9A 5ICYB 4Y19B 2ATPA 3S48A 2ZNXA 3HLKA 4NI3A 1DDHB 5DYOB 3U4AA 1MFAL 3V4LA 3JT0A 4J3OC 4WFGD 1K2DB 5AZEH 1HILA 3TYGH 1JGEB 1XF2B 3SE9H 1QASA 2HG5A 3AS3A 4TNVK 1P7QD 4M9OA 1EFXA 1NKRA 5K1VA 4RDBA 1JPFA 4Y4KA 1DLHA 5GZNA 4E41E 1IT9L 1AGEA 3BVTA 1N12A 6CGTA 5I76B 2JI2A 4K3JH 1TTBA 2Y36L 3BUBA 3BCDA 3TYFB 1OAKL 1UD4A 5L6YH 1J1PL 4P3CL 5DVKA 1DZ0A 5D8JH 1DQLH 2IDCA 2XFXA 1VACA 1A6TA 3F6IA 3RDTA 5AB2A 3D2UB 2DWTA 3ZTCC 3ALWA 5JPNA 4Y7MA 5GRXG 3MV7A 3NIFB 3OJVC 3UMTA 2IH1B 3D39A 4X6CB 5EC1A 2WQVA 2R29L 5FEBA 4GQ9L 1J5IA 1OP5H 4M5ZL 4WTXA 2SEBA 4L3EB 4R90H 3MYJA 4ABWA 5JPMB 1H3UA 1TF4A 1Z5LA 2EECA 2WC7A 4ZW5A 4QHNB 4UV7L 3RVVD 1F1AA 2JJWA 3O2WH 1KYAA 3V6FB 3ULVF 5BMFL 4NQCD 1MJ8H 2EKJA 2NY5C 1CBVH 1UA3A 3WXVH 5F3FA 5E9DE 2C3GA 2H3NB 5AALA 2NY3C 4N1CA 4QOKD 1T7ZA 4DPBX 3BGMA 4WWKC 5DGRA 3W5NA 3ZL4L 4S11A 4G11A 4Z18A 1O9VA 4A2DA 5F1SA 4X98B 1BZEA 4IIQB 1UA6L 5D7JA 1B0RB 3QIWD 3MNVB 4G8GE 5AOLA 1KELL 4HDIB 5EU6D 3TEYA 3CC1A 4ZMPA 4LSQH 1MXDA 4FNPA 2OL3B 5TF1H 1A6VH 1I31A 4BJLA 3V0JA 4HEPA 5JXAH 4WEMB 2HJKB 3RUGE 3LMJL 3QK0A 2YAOA 5D93C 1PY9A 2PW2B 4TL5A 2EH7L 1YHPA 2YOCA 5IB5A 1HKLL 4G8EA 5DR5H 4TUUA 5HJGA 5G4OA 5HPMA 1MI5E 4IJ3C 4O00A 3FB8A 4QMEA 3RA7H 4Z77B 4G8FA 3RX5A 3LHPH 3OXSA 4FQQB 2NT1A 4HC1A 5F7KC 4OCSH 3RZCB 4JZJC 4L8BA 5AVXB 4JFSA 1CE1L 2Z8RA 3U9UB 3JV4B 2VN6A 3J27A 4TVPL 2QDWA 4WHTB 3VXUB 5BUPA 1KBWA 4XMTA 1YPZF 2YZ1A 4AENA 3DETD 5ID1A 3QRFM 2ZOUA 4QLWA 2C34A 1NJ9A 2IOIA 1G7HA 2EO9A 3EGDA 3JWDH 2WUBH 2W0LA 4BZ1H 2XRAL 4YHIA 4OKVA 4WVRA 4AEHH 4AL8C 5J3HD 5H2BA 3VUAA 4QDGA 1CDBA 3RFZB 2VLRA 4OCLC 4LHUD 2VE6A 1KXQE 3TBYA 5AVYB 4DQAA 1CLCA 1QFWM 3ARWA 3U36A 4ZBJA 2Y06H 5K9QG 1AZZC 1M7IB 4HYTB 5FUZH 5TPWL 4TOYH 4GSDL 3O2VL 4KTGA 4M3KB 1QLRB 3R19A 4IDJH 2Q8AL 1J1OH 1JWUB 1Q90A 1WV7T 2WBJA 3V0DA 1V3JA 1OTTD 5EV7A 3PGCA 3S3JA 1ET7A 3V0WL 4ALAH 3AS0A 2CHXA 2GSIB 4C59B 2IAMC 4URTB 5TQ0H 1J5OH 3WEXB 2I9LA 4GBXD 4N8VG 3KPPB 3RBSA 1WZ1L 3CSFA 4E9TA 2LTQC 3C5SA 3VXNB 2ROXA 4RFEB 2OYKA 4JM2F 4AZUA 2VDLH 3SZ6A 2ATPB 4YQXL 5B8CA 1D5ZA 5MEND 2AJYH 1QYGH 3KWVA 1JHTA 2GVYA 5JHAA 1U2HA 2ZF8A 1HILB 3LEYH 1VESA 4YEFA 2J3SA 2NY7H 2HG5B 4NZJA 5CJOH 3RAJH 3ULVE 1EFXB 5GGVY 1Q1PA 2X3CA 4FYSA 3T08A 4PGBA 4MS8C 4LAJH 3TCXA 4Y4KB 1JPFB 3VQ2C 1DLHB 2KYIA 1AGEB 1FRGL 1KJ2H 2BH0A 4UQAA 2XZQL 2WVUA 3MNZA 2H1LM 1Y07A 3MRLA 2WKGA 4HHWA 2WM0A 1ZTXH 4B0MM 4RVBA 4DK5A 2QADB 2XFXB 3TF4A 4PRPE 1VACB 1A6TB 2Y2WA 3RDTB 5JQIB 5T1KB 3O9WA 5JPNB 3R1GH 2IPTH 2EJ1A 3MV7B 2LR4A 1KFAL 1SHMA 3D39B 2TAAA 2JELL 5EC1B 5DD5H 3NJNA 2V37A 5GGTL 3AWGA 1ZV5A 1LEGA 3MYJB 1S9KC 4UBDC 1Z5LB 3ARTA 3ZKSD 4EIUA 3LZNA 4P2YA 3C6LD 2VKXA 2LQRA 3L3KA 1MRCH 1KEGL 5C0AB 1CR9L 2CG9X 4R0LA 3WEMA 2C9VA 5CR8A 4IGBA 3PRZA 2WO3B 4PJ5D 3RHWF 3M07A 1MQ8A 2VRAA 1QACA 3BGMB 1CLZL 1CXEA 5K39A 1A3QA 2C8NA 1YPZE 1HCZA 4KROD 5T1DH 3LKNA 2IDSA 2F1EA 2YWYA 3K4DA 2VDQB 2W0PA 3IE9A 3O6KH 5D7JB 4EI0A 3TBVA 2QTEA 1INEL 3ECVA 4TPRL 1M05A 4MAYA 3BOVA 4JKMA 1QZNA 3B9KC 3B7YA 4HD5A 3B4NA 1OCOB 3US0A 1MJ8L 2R1WA 2D3JA 3VFVA 4LSVL 2AEQH 2JCCF 3TN0A 4G8EB 2KLRA 5HPMB 1GL4B 4AIXA 2YD0A 3TXAA 3FB8B 3OF6A 4L0PB 3L4UA 2E9BA 4HG4K 4K5MA 4KC3B 2VUKA 1A4KB 2XCMC 3OXSB 4R8WH 2ZOTA 4WUKL 2HLFD 4Y16C 4L8BB 2ICWJ 4WFED 1H5BC 1UZ8A 2BVQB 4DHLA 1ECYA 4YUEH 3C60A 3V4VH 3U7YH 4DGIH 3QQ9C 4AENB 5ID1B 2EEFA 2F18A 3CHPA 2R51A 1NJ9B 2NXZD 1G7HB 1PKQE 3H9HA 3GTNA 3EGDB 1RULH 4YK4B 5IHUH 4A39A 1F97A 1HESA 2WNGA 3P3SA 4YHIB 4GSUA 3QFJE 4AW7A 2OBGA 3QUMH 4OKVB 3RNQA 2QL1A 3PJNA 2VLRB 2XWXA 4U6YA 2VE6B 4BQ6A 1PL3A 3O6LH 1I7TB 4UZGA 3O6FA 3I2CH 3X1NA 1RKRA 2W9EH 5AVZB 2XWDA 4DEPC 2KH2B 3QP3A 2HFGL 1FAIL 2JQAA 1CWVA 1MFUA 2RBLA 4MMZA 5E6SB 2X9WA 1DVUA 2D7QA 3ARED 3PGCB 4ZUWA 1CXHA 4J3XA 5SX4H 1CZ8L 4CADA 5LGKA 1NM9A 4CVUA 3QR1A 3U4EA 3MR9A 3V6OA 4LPVA 2V5SA 2I9LB 3BESR 3OMIB 5EFIA 5JHDE 4XH2A 2B9AA 3HFML 3G9AB 2C1OA 2XN9D 2BLFA 3C5SB 4P2CG 4Z9KB 2PXYA 1OARL 2F8OA 3X3FL 5B8CB 1D5ZB 3N41B 5FUZL 1MW3A 3L81A 5IM7A 2E8ZA 1JHTB 1SJEA 3O4OC 4I1PA 1CIUA 4XWGH 3N1GC 3WO4B 5DZNA 4LRIC 3HS9A 1BFVL 2VGLM 2C9UA 1AHWC 4RDQF 1H6FA 3FN0L 1IEHA 1XGYH 2FAUA 4PGBB 4ACTA 4JQVA 3VVWA 5KSAA 3HE6D 2EDBA 4PJGF 3MNZB 3BE1L 3MRLB 5IB1A 1S3RA 2DIAA 2WPGA 3LPWA 1CE6A 4TVPE 1KCWA 1CO1A 4YDZA 3O9WB 1A7NH 1UH4A 5AL8A 3OGCB 1KGUA 4AYEC 3QDJA 1WWBX 1U8NA 4ANXA 1LQBC 2QGEA 4I3SH 3V2AR 3QULA 3ETBJ 3JXAA 1JMXA 2CUHA 4UNUA 5FUCE 2YARA 1YAZA 2JCCE 2VZUA 3T65A 3TPKA 5CWSA 3AJ7A 1BZOA 1MCPL 3IMSA 4WV1C 3T8XA 1SDDA 2AQTA 2Y6SC 3O2DL 1DQTA 2HMIC 5A3ID 4IHOA 1JRHL 3L3KB 4N87A 1N67A 2IALB 3S5YA 4R0LB 3HIZA 4IGBB 4GIAA 1BZ9A 5J6GB 2LU7A 5KAQG 5E5LA 3LKNB 4G8AC 1D5IL 4GP5B 1BCIA 1KB9K 3TBVB 1PX8A 1HNYA 4QRAA 1RSYA 2DQCL 1M05B 2XYCA 3B7RL 1GC1H 3KXFE 4MAYB 3S88H 3HBQA 1EDYA 3TX4A 4N8PA 1W0WA 4AG4H 2G9KA 2R1WB 4XPTH 5HHME 5T3XH 3VFVB 3FBKA 2EXYD 3ALPA 3PAZA 2VXSH 2X2UA 1AIFA 1JL8A 5D1XE 3TN0B 3PWPD 1RZFL 5AAMA 4U3SA 2JH2A 1ZSDA 1F6AA 2YZ8A 3OPZL 1Q0EA 1EIBA 2E9GA 5LDUA 3ISWA 4OZFH 1ASPA 3TO4A 1U8JA 1AQDA 2QVKA 4XC3H 1UZ8B 4UM9D 5JYLA 3QIUD 2YFOA 3TURA 3C60B 2RCSH 5LG6A 1C9SA 3OPUA 4YSCA 3B34A 5DLMH 2F6AA 2DQGH 3HAEB 2JKXA 3H9HB 4HWEL 3EOBA 4HXBH 2D03H 5SWSD 3ZGIA 5EUOA 4NFCA 4W9DC 5GJSH 3RNQB 4U6VH 2E27L 3WBDA 1JZ8A 2CO4A 3AQXA 3JSSA 4U6YB 3Q0HA 1U92B 4GKNB 2VW6A 1ZT4A 2ZX7A 3T3MF 3O6FB 2EO7A 3GMPA 2ADJA 3VXSE 1ADQA 1KTCA 5J13C 2DL2A 4PLKC 1E42A 4TYUA 2WNKA 4NKQB 4DUWA 3FCBA 1QPKA 1V27A 1YEIH 4AWJC 1A4AA 1ES0A 4MMZB 4O2FA 3S4SG 3VD7A 4PJGE 5IJBC 1KTLA 3NOIA 3BVNA 4EOWH 3TPUA 4CADB 5KSBF 4NLAA 3WS3A 3US9A 5GS0L 3MR9B 4LGPB 5MP6H 5EFIB 4XH2B 5HHVH 2FHFA 2AAAA 2C1OB 3K46A 4I1NB 5EU5A 2H6OA 4WTWA 2PXYB 3T0AA 5HVHB 4NNYA 4UQ2A 4ZOBA 3FO9B 1WTLA 4P5MA 5IM7B 4OAWA 3FPXA 3VA2C 5I23A 1SJEB 3QZBA 3PL6C 4IRSA 5ABDE 4ADIA 7FABL 4FNTA 5LCVL 2B7DT 1ZIBA 4HJ0D 1Q0XL 2GIYA 4KTEL 1M57B 5DC9B 1GY2A 5GGQH 5C09A 3TJHD 4PS4L 1OT2A 1X9LA 2EZ0C 2FLRT 2AC0A 5A16A 3UPRA 4ANWA 4R7NA 1C16A 4IBYA 4XR8C 3LRSA 4G6AD 2NNXA 1LMKA 5IB1B 1LP9F 1YEEH 5JO5A 3V79C 1CE6B 3UROR 1IBGL 2XG5A 3SYCA 2JV6A 4NJAL 5CKAA 3DSFH 3OMZA 4MDIA 3N9GH 3MJGX 2EO1A 4MWFA 4H20H 1I9IH 1UUSA 2ZWLT 3QDJB 1U8NB 5CZVH 3P02A 4N2NA 3FB5A 3QULB 3ASWA 4GYBA 4CU7A 3ATAA 1CK0H 1R17A 1ZXKA 3X1BA 5ANHA 4XN1A 3T65B 5C86A 1NSNH 1S6NA 1GGYA 2HT3D 5CWSB 5JQHC 1CJYA 1CLOH 2J8UF 3L7FA 3QBTB 5D1QC 1GZHC 1SDDB 1XGQA 2YPKA 3U0WL 4ZOEA 4IHOB 1HAUA 2OW7A 1Q1JH 4M7JH 2ZCKL 4A6YL 1M9WA 3BJ91 2BK8A 1XIWC 2VXTH 1BZ9B 4NO0A 4XZ4A 2CLRA 3NZHH 1AZUA 5CP3H 2YPVH 4Y1AE 3O0LA 1TKWA 3OG4B 1Q0YH 1OGAD 3QHZL 1A0QH 1I7ZB 3TH4T 1J1XH 1MDAA 3KLKA 4DGVH 1HHIA 3P2DA 3JWOL 1SOXA 5K5YA 2X4PA 4MZRA 2W60B 2VDKL 1IU1A 2ZX9A 1P2CA 4V11A 3CVBA 4KAQH 4UT9H 3MJWA 5FKPB 3T3ME 3VXOA 1AIFB 5F8QC 1T6BX 1W0VA 4X4ME 2WB7A 4U3SB 4GSRA 4XCNA 1F6AB 3RX9A 4M02A 4Y2OA 1Q9LA 1I8LA 5DSCB 2R0WL 1VZIA 2AJXH 2EIEA 3TO4B 4NZRH 1A6AA 1U8JB 1AQDB 3NFPA 1G6RA 4WEUD 5KSBE 4JX0A 2X1PA 4H4NA 6PCYA 5CEYA 1KCSH 1KC5H 2AQQA 3AXIA 3FCSA 5T3ZD 2GABA 3P4LA 1BIIA 1E9OA 2GY7B 4QI3A 2SODB 3SY6A 4Q9CA 1LQSR 4YDVA 2EUVA 1KJMA 4I1RA 2FT8A 5EUOB 1G9MC 3ZDZF 3ARPA 4XN9A 2BC4A 1NMCC 1MXGA 2WLYA 5DJ6A 2B4CL 3W0WA 3KPOA 3WS6C 5DQJA 1ZT4B 5FA4A 5D4QA 3RY6A 4P2RA 5FYJL 3MNDA 5TK2A 5I1HL 1HX0A 5DI8B 5IKCA 5HYSG 1PSKH 4S1RL 1MCIA 3THMH 2GTQA 2LVCA 4O2FB 4XXCC 5FGCB 2PR4L 5I1JL 5DVPA 1KTLB 4H1LH 2YAQA 4PUBL 1A4CA 5KYNA 3BVNB 5GHWL 4KHTH 1LP9E 3TPUB 3UPAA 2ZXGA 2W0KA 5GS1C 5EOCH 4PJXA 3WS3B 2H32H 2X1XR 1YEWA 4HGWA 1A6WL 1ROCA 1TQBC 4XCYA 4ZOAA 4OJDH 4M9PA 5B3SB 2HKFH 5EU5B 1HZKA 5HDWA 4LSDA 3KGTA 3SOTA 1FNLA 1YA5A 4NNYB 4UQ2B 4WFEE 4P5MB 3EBIA 1MCLA 4NHCH 1KPRA 2D4FA 4JFHE 4UM8A 2DDQH 2EABA 3B9DA 4N8UA 2E7MA 4IRSB 2FBJL 2J8UE 4M43L 5I1AA 2BX5A 3LRLA 1E3ZA 1L7TH 3QGVA 2KLTA 3AG2B 5JHLA 2XPZA 1AKJA 3WKMH 5JIPA 4YXKL 1JNJA 4ETYA 3FAWA 3IM1A 1RZJL 3NIDF 1TEYA 1EAPA 3KR3H 4MBOA 3MLPA 1QW9A 3GS4A 3IAQA 5AWNH 2ZF9A 4JHWH 4R7NB 1C16B 5A16B 1Y6NR 3LRSB 1MSPA 1LJMA 3NJJA 3X2QB 2BP5M 5JXED 2OR9H 4P3DA 4RX4D 3H3PH 4I0KA 3WFDH 4PLNC 2XG5B 2CO7A 3NA4A 3E6FA 2NNFA 5JOPD 4KZDL 2YA0A 2XETA 3L1EA 3O45A 4TSBL 4MDIB 4FYRA 5KJRH 3P69A 4MWFB 2WLHA 4XPBL 4OI7A 5INCA 3AT8A 4YVNA 2EP6A 3FB5B 1KDIA 2Y22A 5IK3A 2RH0A 1OCWH 1QHOA 2Q86B 1WZMA 3ZDYF 1JZ2A 1U8PB 2XVKA 4HISA 4RMBA 1F4HA 4U33A 3L7FB 4LP5A 4WNSA 1XGQB 2YPKB 3IMTA 4K3DL 5A2BA 3UG4A 4AEIL 1ID5I 2H8PA 3AAZA 2WXFA 1QSEA 2YMXH 3P4OA 3WE1A 5IB4A 4PREA 1ZE3H 4NN5C 1ND0A 1BLIA 1MREH 5FWQA 2CLRB 1IKFL 2XI9A 5D4HA 1XFPA 4RFNB 1I9RH 3K6OA 4UF7C 1M56B 1LMIA 1TKWB 1BAFL 1EZLA 5C08E 1EO5A 4PVMA 3RIAK 3T6ZA 2CHNA 4CC4C 1KTRL 1HHIB 3DGDA 3VSVA 3OAUL 4Z3HA 3V52L 3ZDZE 1CLYH 2X4PB 4ZO6A 5DUBA 3IBEA 2IH3A 3MA9L 4NGHH 2JE8A 2KKQA 5EOQL 3K1KC 4UV4H 2HT4D 4WWID 3BI9X 2VLLA 4PBVC 1W0VB 1DR9A 2VSKB 4PLJC 1J5DA 2X9XA 4DZ8A 2WXQA 2XA3A 2P52A 4XGZA 4Y2OB 1Q9LB 3NTCL 1PD0A 4FXLA 3B2UC 3NFPB 3JZ7A 1G6RB 3S34L 1DZBA 3EYOA 5CEYB 4AM0Q 2PW1A 2VDMH 3DXAE 3GRWL 3IGAA 3FCSB 5E8EA 1KPVA 1ETB1 2ZYRA 1SOQA 1E9OB 5I75B 4UOW0 2WKOF 3A24A 3FSWA 1K3IA 2VW7A 4BZ2L 3FQRA 4R4BA 4IJTA 1KJMB 4NBZB 1MDTA 3IE4A 1IIIA 5FB8A 2OR7A 3MBXL 5EEWA 2BC4B 5DJ6B 3RGHA 3MA7A 2XV0A 2VR6A 1VDGA 5JMRA 3KPOB 5DQJB 2ZCHL 3LHAA 5FA4B 5I9QC 2FBRA 2ZKHH 4R97B 2ICWA 4P2RB 1RUKH 5CM1A 1UH3A 1CGUA 3NIDE 5IKCB 1Q4NX 3HG4A 1K6QH 1A4BA 3AB0C 3QR2A 3L5WA 3FQTA 5FECA 2OI9B 3SYQA 4QXWA 5I8EA 3OB0K 3TZVC 4JPKL 4PJXB 5F1IA 5LNEA 2UZYA 1CYGA 2EDMA 2Y1AA 3W2DL 2F7PA 1BXVA 2W07A 1NFDA 4HGWB 4XCYB 3UYPA 1HHKA 2VDRH 1XH3B 2WLIA 1GSMA 1ET5A 1RVFL 4OLVL 4F7MA 5GIRA 3WO3B 2WLZA 4BUGA 3U0TA 3ELAT 4JE0A 4L48A 4B27A 1KPRB 1OLZA 1WIPA 3II3A 3ZDYE 2L04A 3OV6A 1OAZH 2CUIA 4PBWD 1IGCL 4KJWC 1BG1A 5I1AB 3P0VH 1NCNA 1EPFA 4YDIH 1AKJB 2OXGA 3MOAL 1SUHA 3GMQA 1R5IA 1SJVA 4K55A 1BDYA 4KOBA 3KWWA 2VZTA 1ZLSL 2GFBA 4RDQG 1EJ8A 5FX3A 3WFBL 4P05A 4P3DB 4K9EL 3VM5A 3N06B 4LLAA 3SD5A 4C55A 4S0TD 3AG4B 4A68A 3O45B 1UM4H 1A7BA 4I77H 2J8HA 3FUKA 3LJ3A 3ULVC 4J8QA 5INCB 2AJVL 5EU7E 4LP8A 1BBDL 5TF0A 4DVBA 1RJLA 4JVUA 5IK3B 2CAKA 4BKLA 1ZLVH 4KXCA 4WWKA 1WFOA 3ZSTA 1FORH 3MRKA 3CFJA 2CMRH 3CZNA 4G8IA 5E5MA 1ZSHA 4A2GA 4F8NA 3FSVA 5LXGL 4JPIA 4KKLD 4PP2A 4PV8B 3TBSA 4MSWB 1T5KA 5JHMA 1KEML 4KU1A 1YMMD 1TIUA 4KNUA 2H8PB 5FYJE 3AAZB 2VZ1A 1QSEB 3CVHA 3EDFA 3P4OB 1QPXA 2VXQL 3QQDA 1TLMA 5IB4B 4PREB 2YIHA 4JFPB 3M6DA 5L0QC 2G60H 1YYCA 4ODHH 4QYAA 2JSFA 1IM3D 3GI8L 3NFSH 3WLBA 2F5AH 3UZVA 1J0YA 2DYSB 4KKNA 5DJZA 4I48A 2F53A 3O0RH 1JXJA 3DJRA 1DBBL 3NZ8A 2XC8A 5MI0C 1KB5L 5ACZA 5BUGA 2OTPA 4N2GA 5DUBB 3SDCC 3DX0A 2AXJA 2RQEA 4P48A 2IH3B 1B0GA 3GO1L 5JW5A 3JT2A 2WGNB 2DWSA 3K2MC 2VLLB 1J8HD 3UAJD 4DZ8B 4XWOC 4Y2DA 5E23A 4XGZB 4ZMZA 3SEPA 5AB0A 2YK1H 3NT0A 4GFXA 4OVVA 4KQ0A 3F5WA 1AYRA 4S1DC 2H3XC 3GTVA 2IGTA 1UT9A 5DHVB 1HH6A 4YXLL 4O58H 3T0WA 1AO7A 3F64A 3IJSA 3EYOB 1YEGL 1DCLA 3KPLA 2PW1B 3GHBH 4G3YL 5B38A 3TS8A 4X80L 1UOVA 2DTSA 5ECJE 1AZCA 1KPVB 5E8EB 4A2EA 1AYOA 4Q74A 4MMYA 2VN3A 4PWFA 1QLFA 2ED8A 3FQRB 4MHHG 4KUZL 1QR4A 5D70L 2OTUA 4QTIH 1SBSH 4OVUA 3NSXA 5FB8B 4JFEE 4X0KA 4XBEH 2GJ6D 3WNNA 5HVWA 2ZSWA 3MA7B 4WJKB 2UXTA 1ASOA 3M8OH 2GBTA 1A14H 4E5XA 3GM8A 4WNJA 4Z0BL 1KMGA 3H54A 3M1CA 1JGLL 2IAMA 4Q7DA 4X99A 1DQKA 1T1XA 2ICWB 5DMKA 5ALBH 5DJCA 2IPKA 4BFKA 2WXHA 1UYWH 2Y7MA 3UC2A 3UO1H 1S3KH 1RXLA 4WO4D 3L5WB 2YHGA 3FQTB 4FI7A 4JM2C 3OC5A 4UAOC 2A1WL 3S98A 5FECB 2AJZA 1WCQA 4CGTA 3HUJF 4MX7A 4X7CC 3ZE0F 1KWKA 5I8EB 1ZJAA 3RGVD 1IM9A 5E8DH 4ONFL 2ZE0A 3LD8C 4FXGC 5F1IB 1V3LA 2X87A 1NCWH 2AGJH 2VLJE 1LEKA 1KN2H 2BS9A 2W07B 4NO2A 4W9CC 2X6BA 3UYPB 1HHKB 3T2NL 2WLIB 5LHDA 5KW9L 3IRCA 3LKQA 4F7MB 5GIRB 2N56A 3OJDA 4PQXA 3VGEA 3DDFA 3MXWL 4GXVL 1H6TA 2KT6A 3IMWA 3FU8A 2P7TA 4K3EL 3V4UL 1C1EL 2A9ML 1X9QA 1IBDA 2P49B 1EH9A 4LCVA 5T3ZE 2AV7A 3ARGC 1RMFL 1KWGA 3B9EA 4JO2L 4PRDA 3P9MA 3R4DA 2KDGA 2OXGB 4QF1A 3GMQB 1R5IB 2DWEA 3QA3A 4ZSOE 4W93A 3KWWB 3QFDB 2CDFA 2GFBB 5LBSH 2B1AL 3BIAX 1F42A 1NL0L 1IKNC 3VYPA 1H3TA 3FFCD 4OJFL 1TZGL 4G6JL 1INDH 2NNCA 5B1JC 4F5CA 5IQMA 3IGLA 2EIMB 1JZIA 1P4BL 4D9RE 1WBXA 2D73A 3NAAL 3RJQB 3RFRA 3QWNA 3MV9D 4Q9RH 3G6JA 4LSSL 4N8CL 4M3HA 3WY2A 2MCPL 5CF3A 4OLXH 3NFNA 1H8SA 1BQSA 2CLVA 3D0LA 4FZ8L 4YSDA 5J11C 2A83A 2X41A 4DVBB 1RJLB 4BKLB 5AW7B 2ODIA 3CFJB 3E1ZA 4LLWA 5E5MB 3TV3H 4HHAA 4PJFF 1JPSH 2Y1ZA 4JPIB 3TBSB 3NVQA 5CCGE 5HDQL 1KXHA 2CNZA 1L5GA 4KPHH 4PWHA 3B7TA 4DP8X 2WXOA 4EJ1C 1GGTA 2CRIA 3QQDB 3H2PA 1NDTA 5E0FA 1Q38A 5AW6B 5E6IC 2P5WD 4HT1H 3T6WA 4GP4B 5FUCC 2Q5BA 4OCRH 4ODTH 3KLHC 2MQGA 3QXAB 5DJZB 3WKPA 4I48B 2TRYA 4NOFA 2F53B 4OR1A 3SQBA 2XKUA 4H44C 4HOXA 5C0EA 4JS7A 4FL4B 3CSGA 3GJFH 1NGQL 1OALA 2FECL 4DIXA 5ACZB 3RTQA 2UWEA 3GKWL 2VABA 4JRXE 4Y16A 2UZIH 3ESPA 3JWNH 3PDOA 1B0GB 1H5BA 1P6AB 3RY5A 5JW5B 5C3TA 3DURA 2ESVE 3KVQA 1OTSD 3IPFA 1QVOA 4Y2DB 3RVWD 3QAQA 2X89A 1TTFA 3MV8A 3VH8G 1T22B 3F5WB 4AKOA 5DYFA 3X12A 3Q06A 5DWUH 1HH6B 5L4JA 3HUJE 3MLWH 3ZE0E 2NY0D 5I17A 1QQDA 1AO7B 3IJSB 3KPLB 1MCRA 4WI0B 1IGMH 4F91B 1SMDA 1TLKA 5B38B 1DEEA 3EF4A 3MXVH 1BXUA 5KVMC 4MMYB 4WFHE 1NQBA 5H37A 3QDMD 4RMWA 1RFDL 5DZAA 5D1XC 5CEZD 4UDTA 5IFHH 1QLFB 2Y1YA 1NOFA 2GHWB 4H0HB 4PI2A 4B9KC 3QDHA 2OTUB 5F7MC 1T7WA 3HI1A 2EC9T 4UINL 2YQ2A 4XC1L 3D33A 2ZSWB 1CF8L 1DUYB 1JHLL 3EIFA 5I8CA 4F1SA 4E5XB 2DBLL 2IAMB 4X99B 3TEXA 1J18A 1OQXA 1T1XB 2AAVA 3BP5B 3I3BA 5DMKB 5DJCB 2IPKB 4ZS7H 4I2XE 1DSFL 3CVDA 5ADPL 3GSQA 3BRFA 5A7BA 2KERA 4P59L 3BMWA 2Z7WA 3RKPA 5IFAL 1SEQL 2AJZB 5DO8A 4MX7B 3IDUA 3LS5L 3QJVB 3OLIA 1IM9B 4F9LC 5LKNA 4PM1A 3U0PA 2PO6D 1PVHA 4LRIA 1XH1A 2OYMA 1LEKB 4NO2B 4GAAA 4U4IA 5KBLA 3HC0A 3U48A 1MELA 1XD1A 2K1MA 3LB6C 1IC5H 3LKQB 5HHXH 4M5YH 4DAGL 3OJDB 1PEZA 5DWPA 4G42A 4FQXA 5GRVL 1OSPL 1IAII 2P7TB 1IUZA 1UWGL 3KBHE 5BZWA 3QUXC 2XXFA 3MAWA 5KTEH 3FXIC 2AV7B 4JG1H 4PJFE 4K5OA 5AL0A 4WJ5A 3VE0B 4PRDB 3MLVH 3P9MB 4U2ZA 3SBWC 4X6DA 2RMNA 4PB0H 4QF1B 5LGJB 3U9PH 1I53A 2DWEB 2Z35A 3QA3B 5CIPH 1GOFA 4ENEC 4Y0GA 3SDDC 3V6BR 4D9LH 5EIIA 1HNGA 2CDFB 3DX9A 1KACB 4XMZA 5IHBA 5IIEA 1R5VA 3D7PA 1SZNA 3DBSA 4Y5YC 3CFKA 2X42A 5HI5D 1DJZA 1HJBC 1N7ML 4QRPE 3K2IA 1A6PA 1ZHLA 1WBXB 3MLTA 4MVBC 5G55A 5TJWK 1G9EA 1U2CA 2VXVH 3P30L 3G6JB 5IQOA 4UOZA 1OKEA 4ZD3H 3NFNB 3MBWA 3D0LB 3DHJA 4K8RL 2A83B 3AGWA 1OAUL 2V3FA 3GTTA 3TFBA 5J3HC 4OJAA 2WUCH 3VFUA 2Q87A 3NG5A 4HHAB 2YRZA 3EFDL 1F2XK 2CDEB 5CZXC 5DUPL 3Q8EA 5AW9B 1L5GB 4XB3A 5IF0A 4ODSH 3HS8A 2ZXWB 4YHLH 3KBFA 4OF6A 4ZQKA 1QG3A 3IPBA 3UBXA 3ZT6A 2BNQA 2AK4E 2R56L 2K4WA 1S78C 5GRJL 4AM0B 2XWBA 2XYBA 1U3YA 4JKKA 4KO6A 4MCYA 4NZ8A 1P5VA 3QCTH 1BSIA 3VI3A 2WYHA 4FYQA 2L4OA 2XA8H 2CLZA 4XX1G 3SQBB 3V0EA 5C0EB 4GBXC 3KYNB 3NCJH 2VRKA 3M7FB 1F02I 2FEEL 3RTQB 3UMNA 2UWEB 4E42A 2VABB 1VPOH 2H6UA 2FT6A 4FFTA 3A4AA 3ARFD 3N1PC 4KO9A 4MB5A 4Y16B 3X3GL 5FV2A 1H5BB 1DQIA 3L1GA 2V2WA 3DV4A 5AG9A 1HEZA 3TVMD 4P9HH 4JO3L 1IC4L 4P8QA 3QEQA 1A7RH 1QVOB 5DZ9A 5KEZA 3A23A 3MV8B 1XAUA 3X12B 1FN4B 3AG1B 1EGJA 4OZFG 1HQ4A 3FCUB 4H0GA 5I17B 3O3EA 3GK8H 1MWAA 4OH2A 1DEEB 2OX5A 3CIQA 3LIZA 1XCQA 3QUYA 1X4XA 2LGNA 4TNFA 2B5IC 4Y9GA 2MEJB 3OWRA 4DP1X 4JRYA 4YL9A 4IRZL 2VRQA 4APQC 4DEPB 4UDTB 2X4OB 3G6DL 3UP1A 3UDWC 1DVFC 3HI1B 5EU3A 5L4FA 2V5RA 3D6GA 3ZE2E 1JSYA 1L9NA 4FQLH 3H3BC 4CDGC 5I8CB 1KENH 1ODUA 3GBMH 4DP4X 3SDYL 1ZOXA 1RP9A 1RU9L 3KH3A 4UB0L 1ZCRA 3GSQB 2VDQH 3MBEC 3IMVA 5B22A 3BQUC 3NABL 1BIHA 1N3NA 4JR9L 1UXWB 2PYED 4ZMQA 1HS6A 4XMPH 3B37A 2DQEL 3PL6A 3GZPA 3K74B 2R8SL 3U0PB 1RUPH 4QAWA 2CPCA 1UOWA 1TJMA 1XL4A 3SOBH 5IVXA 1U8KB 3GD1C 3SD2A 4B0MB 4D8OA 4RZKA 2C4FU 2WYTA 1J9SA 3RKDC 4GIPD 1HYSD 3LZPA 4G42B 4FQXB 2EXWD 5DVNA 3UJIH 3NRPA 1B4TA 4LSRL 5BZWB 3ZX1A 1B2WH 1W91A 4Q0XH 4K2UL 4PJCA 4WJ5B 2MTPA 3IJEA 1AS6A 2OL3L 2DIBA 3BDYL 4X6DB 3CU7A 4EZMA 3HZVA 5C07A 2Z35B 4K71C 4DT2A 2APFA 2C3VA 4GO8A 4X8JA 5EIIB 5IIEB 1M4KA 1R5VB 4E0RB 2VH5H 3CFKB 2PWGA 2XICA 5TDNA 4E9QA 4DETA 2XBDA 4MJID 3ZHKA 4HH9A 2B59A 1XHHA 1ZHLB 3OZKA 3MLTB 3QS3A 5D1QA 1GZHA 3NUKA 2YFNA 1JNNL 3BMVA 3EJJX 1R46A 2NYZA 3MBWB 5JR1H 4YDKL 2DMBA 1XH0A 3PIQA 2MFNA 3WJLA 4CU8A 1FC1A 4DGUA 1DBML 4Z7UF 2NY2B 2G2NA 4I5BA 3VFUB 1TNNA 1PG7H 4JPQA 4Z6AT 1U95A 2JB6A 4HSQA 3T3PB 1VCBC 1B6DA 4AYSA 1X9RA 3GPEA 5AZ2H 4UANA 4W9HC 1CIDA 3KYKH 4XBPB 3I9AA 1BYOA 1G7QA 1QSFE 4G1MA 4GNKB 4ZQKB 2Q9OA 4U6HA 3PQYD 2BNQB 3SDAC 1L6PA 5AOKA 3D9AL 2XWBB 5DHYA 5I6KA 4KI5D 4CMHC 3VX1A 3SE6A 1BEYH 4NQTA 2BCMA 1NA8A 4MCYB 1R6VA 1P5VB 4L4TD 3VI3B 3M1BA 4HW6A 2CLZB 1NWPA 1OCZB 1W72H 2DWXA 2FBOJ 3IFNL 4BWUA 1C5BL 5BOJA 3QUHA 5FA3A 4X9BA 3NQIA 4E42B 4F7TA 2X6UA 2O6FA 3FFCE 4V2CB 5CMAB 3UIYA 2CGZA 2V2WB 3QEHA 5C0CE 3IKKA 3DV4B 4BFRA 1RLBA 4MA8H 1HEZB 3U4KA 2APWA 3CPLA 2VR9A 3REVA 3QEQB 2NMSA 1YVLA 3X1FA 4JFOB 4TNWF 3MGTA 1ZGLA 1MCQA 4XNAA 1TETL 3NIFF 1YG9A 1HOCB 5GS0C 2FO8A 3V8CA 5K9JH 4YHNA 1HQ4B 3QXUA 3DX7A 3O3EB 3BZ4B 4NN7C 5C0RL 1MWAB 4KJPD 1Q94A 2HFTA 3WS6A 2OX5B 1T80A 1XCQB 1CYXA 2H7WA 3QUYB 1Z9OA 2PP7A 4AK1A 4JRYB 4MKTA 5J13B 3IGKA 1VFAA 3IDGA 5I5RA 1H19A 1FVCA 4QRQA 5IW1A 2Z34A 3GXNA 4IKKA 4KK8C 1F58L 1PJ9A 3EOYG 1IIKA 2YXFA 5EU3B 2JF1A 1DVTA 3NSDA 4PB9L 1EZUA 1ULVA 1WGVA 4M29A 3UTTA 5EB9A 2HYMA 4OFKA 2J88H 3D0VA 3E9TA 2EE9A 4N2FA 4PCYA 3VB8A 4E9WA 3NJVA 5I66A 1ILSA 2XKNA 3AU0A 3IVKA 2V2XA 4RRPG 1XZ0A 4UWQB 4XNUH 3NCEB 4LOEA 1TZHA 5A3IC 4LLYA 4A7SA 1N3NB 1Y18A 4H8WC 3ZTNH 5I8OL 2H2PD 2GJRA 5LXVA 3D1MC 4H1LG 5FO2A 2FJSA 3VD5A 2CIKA 3PL6B 1Z3GH 4DEUA 2DQDL 2Z65C 1FYTD 1I8IA 5C0BA 2RB8A 3NCYS 4OF8A 4RQQA 5ALCL 1U33A 5FCSH 2Y23A 2PCYA 5IVXB 1ORQB 4Y4FD 3WENA 3TA4D 5D96B 2BHFA 2YUVA 4KQ4L 4NAJA 1BVZA 1NCGA 5E2UL 3CBRA 3EOTH 4JMXA 3AT9A 5KS9A 3K8MA 4QTHA 4F24A 3LDBC 2BOCA 1S9YA 2Q20A 2MKLC 4YWGL 2JKJA 1IEAA 4RESB 4Z7UE 4PP1C 4ADJA 2ICES 4YBQD 1WWAX 1I9JH 2EIDA 4N0CD 4PJCB 3IJEB 1B4JL 1EEYA 3NACH 2XIBA 4MA7L 2BO0A 1CL7I 3HZVB 4MNQD 4R2GC 5C07B 2QHRH 3QYCA 2ZUYA 4Y19E 1E40A 4G9FD 3BPNC 1DANT 2C3VB 3IXTA 1BD2D 4X8JB 1AI1H 2WY3B 2ROYA 1PLGH 4TV3A 4D9QE 4P2QA 1EZVY 3ZT5A 3RVXD 2DWYA 1NMBH 1USQA 1Z9NA 2B59B 3JWOC 3KVDD 4HH9B 3QIUC 4F37F 5GGRA 5ADOL 5D1QB 4HC1L 3HZYA 4WWOA 3H6JA 2AZUA 4JDVA 4GB9A 5E95B 1A66A 1IE5A 1JN6A 1MCOL 1V3KA 1JMZA 3NZUA 3PIQB 4TVSa 4MXQC 2YSSA 4I5BB 4FTDA 4HCGA 3KWUA 3BKCL 1U95B 3ARDD 3AC0A 4ZX4A 1DBJH 2WZPD 4XNMA 2MWCA 1G7QB 3NIFE 4G1MB 4UQIM 2QQKL 3ZO9A 4U6HB 4M1GL 2HTKC 1U36A 4Q56A 2GK0A 4JG0L 4JG5A 4Q14A 5DHYB 5EU7C 3TJEL 5F9AC 1RIUL 4O5LL 3KGRA 4JEGB 1AXTH 2R2BA 2YD1A 4XPFL 4IOFD 4AJYV 1E8ZA 3M1BB 1UA7A 2ZX6A 5E8PA 2JXMA 2B4CC 1MZZA 2OXHB 2C7FA 3DVIA 4QHKJ 3MLZL 3AMKA 5F9OH 3VWJD 4F7TB 4N2OA 3TESA 2DKMA 4JCLA 3AM8A 2HRGA 1RURL 1S7SB 3QEHB 1HL9A 3RUGA 3FSOA 4I89A 2PPCA 4AYDC 4KY1L 1EBAA 1GJWA 3VFPA 3REVB 4KKCD 4ZX3A 5LWYH 4YC2C 4HJ0C 5F6IB 1YNKL 3MGTB 3N40P 3WN5C 1ZGLB 1L9RA 5I1IL 2APXA 1JCKA 3IGUA 2ADYA 2CO2A 1HHJA 3RRQA 4YHNB 3R18A 3WOVA 4WK4B 3DX7B 2NZ9C 2VB5A 2ITFA 5A6MA 1RQ5A 4AXWA 4ELKA 3S8WA 1T66D 2RAMA 5KYUA 2FHBA 3SBPA 3GSNA 3PY9A 1CXLA 2XDHA 3QIBC 5D7LA 5TQ2L 1VFAB 3IDGB 3O8XD 5LAXA 1FVCB 4QRQB 1P0SE 4PN6A 5IW1B 1JZ4A 2HVJA 1CICD 1IAIL 3NPSC 3MLYH 4ZTPL 5F7DA 4XP1H 4GS7C 5GZOD 1AQKH 4GXUM 3HNVH 3UABA 3VXUE 3UTTB 5KVDH 1MCDA 1D9KA 1RZJC 4BH8A 3D0VB 3MRNA 4P23D 4TXVB 1BHGA 5TE4H 5HYEA 5I66B 4PRIB 5FFGA 4EE2A 4ZK8A 4JGJA 5BVJA 1BW8A 1XZ0B 2DQUL 3BD5A 3DLQR 3Q05A 1TZHB 3HG1A 1XTMA 3K5SA 4XVUC 4BCYA 3S7GA 4LLYB 4JJ5A 5FYLH 1Y18B 4YDJA 1XF1A 1YECL 3VM7A 4DESA 1UB5B 3HFFA 1AZRA 4RAUA 5DGQA 1CFMA 2CIKB 4DKFL 2J12B 2EEAA 3QPXH 1I8IB 2IH8A 3KDPB 4K5LA 4QXUH 4HALA 4RQQB 1KJ3H 4UQBA 3I9GL 2WXLA 3L95B 4M7KH 1GAFH 3KLQA 3A4DA 4L9DA 2WQAA 5KS9B 5HYJA 4QTHB 3EO1A 4KXZI 2BOCB 1S9YB 1IEAB 4TS6A 1D5XA 4BFOA 3OSKA 3RU8H 1IC7L 4R96A 1ZLWK 3VFTA 1EEYB 1F4YH 3LZRA 4M62L 5BZDA 3KS0H 3C5ZA 1EXGA 4FFYH 3KPRD 4NM8L 3IXTB 4TF4A 3VRJA 1RZKL 3VXMD 2Z31A 1E2WA 1J05A 1K72A 1OP4A 3I74A 4P2QB 4G7YL 1EEUA 4JKNA 2AS5M 1BOYA 2QT6A 1RIVH 2MRYA 1NWOA 2PTVA 5GGRB 3HZYB 3KDMA 2R9HC 1V8HA 5F1KC 2EDXA 3ZW3A 5ABZA 2BCKA 4JDVB 3P3TA 5DEGA 5GSVA 2E7HA 5CINH 1JN6B 5IVOA 3W39A 4BSWB 3ZHLA 4S2SB 1G1OA 1S5IH 3W82A 2YSSB 2EQDA 5T1LA 1MCWW 3ULUH 3GRGA 3KAAA 1OCCB 3C8DA 1U9KA 1WHPA 5AAPA 4PJ9D 2APSA 5SWZA 4XNMB 4NFBA 2XZAH 5CN1A 1UH2A 2XTJD 4KITB 3D39E 5K1NA 4UDUA 5C2BH 1DL7H 3SDCA 3KNBA 2GK0B 3DTDA 4X7DC 5T3XD 3GI9H 4CN6A 1OO2A 2VERN 3BJLA 3WIHA 5EEVA 1TO4A 4IOIA 2R2BB 3OTTA 5HYFA 5IQ7H 1DJXA 2JIXA 1YPZA 2JXMB 2PUQT 4OFYA 5C0AE 2K6YA 2YA1A 4PJDA 1XCXA 2BY0A 3I6GA 4S1SL 2ATAA 1UQSA 4AUYA 2Y5EA 2VQ4A 3PHQB 1FO0B 3DX2A 4YSAA 3DTXA 4KJYA 2BP3A 3ERXA 3VFPB 1RCYA 4KGJA 1SQMA 5CLWA 4EBQL 2K78A 4LKCA 3N50A 2A2QT 2WSPA 3L1OH 3L5XH 5JW3H 1JYXA 4UILL 4KVCL 1JGIA 1HHJB 1KCRL 1CL7H 3F7QA 4FXTA 3AY4C 4WHDA 5FOBB 4X4ZA 4IRJC 4AXWB 2ICWI 4ELKB 5KYUB 4DP2X 5I9QB 3GSNB 4L3CA 1P53A 5AVUB 4DW2L 5DA4A 5H4ZA 5D7LB 1ZMYA 4RETB 1YYMH 5LAXB 1BQHG 2MOQA 4OF0A 2HVJB 1TQCB 4DTGH 5J0BA 1MEXL 2IMMA 2Z7UA 4J4PA 3AB0B 1PKQA 1CG9A 5F7DB 4JM2A 3RIFK 1AHMA 2GBUA 3QFJA 1D9KB 3A67H 3P11H 3VNZA 3PGFL 4BH8B 3MRNB 2CA4A 1JGDB 5BVJB 2BDNH 3BX7C 4A67A 1OAYL 2R29A 1QBML 3JV0A 2FGWL 4FMVA 3HG1B 3X14A 3QUZD 4K9EC 1NLBH 2DQIL 4JJ5B 1BM7A 1KCVL 2HX7A 2VLRE 1MNNA 4BCXA 3L5IA 4RAUB 5TFSL 3FUJA 2FUTA 4O4YL 2WANA 5HGBA 4CC1A 2ODHA 4N2IA 1S7TA 4DH2A 1BFOA 2KHAA 1IILE 2YBRA 2WZAA 3QB7C 2C9PA 2YRBA 2I60L 5JTWA 2X1WL 3S3SA 3B8SA 5HYJB 1KCUL 4ZFGL 3EO1B 3L4VA 3QG7L 1D5XB 3V4PH 4TUKL 5B1JA 2I26N 2OCJA 5DUJA 4R96B 1G6RH 1S9XB 3KJ4C 1OSEA 4AI7A 3VFTB 3FS9A 2PPAA 2YD8A 4AJ0A 5BZDB 4OGQC 3C5ZB 1ILUA 1Q9WA 2FGZA 3UOAB 4ZMOA 4HCRA 3GLZA 4Y7OC 1OP3K 3VRJB 3HKFA 2Z31B 4X4XA 4ZMVA 1NCCL 1UD3A 1J05B 4WEBH 4AYID 2ADGA 4TSAH 4BINA 5DO2D 4P5TB 5B1KA 1E3FA 3V0AC 4MXWH 2EYSA 3FN9A 1A7PH 3RVTC 1LD9A 2FD6L 1KULA 3KDMB 1SHSA 1UM5H 3SE4C 5CJQH 1G1KA 1XD0A 2BCKB 3LS4L 5MHSD 3RWFA 5DEGB 3ILPA 2FX9H 4Z78B 5D71L 5GSVB 4ADGA 3W39B 4I0PD 5I19H 1FP5A 3VGBA 3GMLA 3T77A 4FULA 4R26L 5EIQA 3IPEA 3PP4L 5AVWB 5T1LB 1DQVA 3LH2H 4PGDB 4G7RB 1E4XL 1WA1X 3BH9A 4OM0H 4UIKH 5SWZB 4NCC2 3VXRA 4AT6B 4M1DH 4WKXA 5JW4N 4F1ZA 2QQLH 3QZPA 2QSCL 4V33A 4F9PC 1TJHH 3SDCB 2CHZA 3KNBB 3D50A 4IMLA 4HXAH 1ADQL 1E30A 1JVOA 1UOLA 2E9JA 2UUDH 4ZXBC 4G59C 3NRFA 4WTZA 3U4BL 3E8UH 4IOIB 4KMTL 3Q2NA 4HK0A 4XRCB 4GUQA 1AXIB 1MVFA 3ZQWA 2JIXB 3FZUD 2IJ0C 3ZKMD 3I6SA 3PXJA 1P7QA 5FLUA 4PJDB 5JHLH 3I6GB 3FJTA 4L4VE 4RMRA 3KPTA 5HYQB 1UQSB 5IT2H 2OCFD 1OAQL 3LEXA 3KXFA 1KLUA 2EVFA 2BJMH 1AR1C 3L3OC 3Q6GL 4M7LL 2P9RA 3DTXB 2PWHA 4KJYB 1E4WH 5G2NA 3Q6FA 4YMPA 2UZPA 4KDTC 2XV3A 4JJHA 5DD1H 5JA9A 2HWZL 3MHZA 5JDSA 3GHPA 4ONHA 5IEHA 4ZAKC 1EJFA 2QHLA 2X4SA 1BM3L 4AITA 3VRIA 3U2IA 3KMDA 4K5PA 2XIDA 1ID2A 1T1WA 3HBZA 4BK8A 3QHFH 4L3CB 2WZ5A 2W9DL 3GDCA 3FUIA 2VC2H 2W81C 1PNDA 3QCVL 3RNKA 5I15H 2WCGA 4JY4A 4P99A 3T6QC 1WCBB 5CGMA 3KLSA 1CG9B 4OIAA 4JM2B 4WK0B 3QSKB 5DJ8A 5FWRA 4AKQA 3BUDA 4QOKA 3GZKA 5DS8A 4LLQA 3SSGA 1CXKA 3KG5A 5DQDH 3BUYA 3FULA 3CN3A 2A6KA 3F6LA 3PUUA 3KM2A 1C8PA 5LGHH 3IF1A 5E2WH 3QDGE 2GI7A 1CN4A 2IQ9L 3VXSA 1M7DA 1I75A 2NNAA 4ODUA 3ZKNC 1IGIH 1IQDA 3B9VA 3HMXH 4NPJA 3ZHNA 3K2KA 2O5XH 5HGBB 5FHBL 4PJGA 3QUKA 4H8VA 4LGRB 1FSKC 4GH7B 3FQXA 1S7TB 3ESVF 3Q5YA 2YBRB 4Y5XA