1V10A

Structure of rigidoporus lignosus laccase from hemihedrally twinned crystals
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
494
structure length
487
Chain Sequence
ATVALDLHILNANLDPDGTGARSAVTAEGTTIAPLITGNIDDRFQINVIDQLTDANMRRATSIHWHGFFQAGTTEMDGPAFVNQCPIIPNESFVYDFVVPGQAGTYWYHSHLSTQYCDGLRGAFVVYDPNDPHLSLYDVDDASTVITIADWYHSLSTKAPPAPDTTLINGLGRNSANPSAGQLAVVSVQSGKRYRFRIVSTSCFPNYAFSIDGHRMTVIEVDGVSHQPLTVDSLTIFAGQRYSVVVEANQAVGNYWIRANPSNGRNGFTGGINSAIFRYQGAAVAEPTTSQNSGTALNEANLIPLINPGAPGNPVPGGADINLNLRIGRNATTADFTINGAPFIPPTVPVLLQILSGVTNPNDLLPGGAVISLPANQVIEISIPGGGNHPFHLHGHNFDVVRTPGSSVYNYVNPVRRDVVSIGGGGDNVTFRFVTDNPGPWFLHCHIDWHLEAGLAVVFAEDIPNIPIANAISPAWDDLCPKYNANN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure of Rigidoporus Lignosus Laccase Containing a Full Complement of Copper Ions, Reveals an Asymmetrical Arrangement for the T3 Copper Pair
pubmed doi rcsb
molecule keywords LACCASE
molecule tags Oxidase
total genus 130
structure length 487
sequence length 494
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2004-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v10A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v10A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v10A03
1CC3A 4DP7X 1E5YA 1ETJA 1E5ZA 4E9WA 1WAEA 1N68A 1QHQA 2B3IA 3T71A 1AZUA 1NWOA 3KW7A 4N8UA 3DKHA 2GBAA 2PPFA 2FT6A 1WA2X 3CVCA 4DPAX 4KO9A 2OV0A 3AZUA 1BXAA 4KOCA 3QJVB 2PP7A 4FAAB 4YSOA 3NP3A 1SNRA 3ASOB 4GY4A 3PCYA 1SF5A 1BYOA 3NSFA 3X1BA 1NIEA 3D12B 1EZLA 2IWEA 4GP4B 1OOWA 4BWUA 2EIKB 3FSWA 5I6PA 1TKWA 2HRGA 1RCYA 1NWPA 2GB2A 1WA0X 2HX9A 2PCFA 3JT2A 3NT0A 4E9TA 3FPYA 1NZRA 3JTBA 4G7QB 3ZX1A 1J9TA 1E65A 2XXGA 4DP9X 1QLEB 2QPEB 3FYEB 5B1JC 4A2DA 4HIPA 1PLBA 4L0PB 5B7FA 4A2FA 1DYZA 1KDJA 2XWZA 4KOBA 4YSRA 3RYMA 2YAEA 2AVFA 2BZ7A 1PCSA 3AW5A 1JZIA 1PAZA 1W6LA 2EINB 2PPDA 3T9WA 5PAZA 1TU2A 5F7AA 1IBYA 1AIZA 1BEXA 1AZCA 1CYXA 2I7SA 4AKOA 2BW4A 4BDVA 1PLAA 5FC9A 4YSTA 1MDAA 4YVNA 1JOIA 4A68A 2H5UA 6PAZA 1HAWA 5B1AB 3OMNB 4AX3A 3WIAA 1F56A 1WS7A 5TK2A 4G71B 2XLLA 1BAWA 3KW8A 1OCOB 3NJJA 1ET8A 5A7EA 2PP9A 4E9XA 1L9RA 3UAAA 3IEAA 4ENZA 3AG2B 2J55A 4UF7C 1JXDA 1M57B 3UGEA 4W9ZA 5B3SB 2CALA 4HCGA 2VMJA 3OMAB 2VSMB 9PCYA 3NJNA 2IDUA 2FT8A 2JFCA 2ZOOA 4Q89A 2DYSB 1BQRA 3EH5B 1XB6A 1JERA 1OE2A 2YAFA 2DYRB 2IDSA 3FQYA 4E9VA 3IN0A 4AI7A 3NJHA 2BWDA 5B1BB 4DPCX 1NINA 5AKRA 1L9PA 4M4RB 4W1TA 1PZAA 2BHFA 2VM3A 5B7EA 3NJIA 1A4BA 7PCYA 1AG0A 1JZFA 1DZ0A 2BWIA 3U25A 4BWWA 3BQVA 1AR1B 2PP8A 2XV0A 1KYAA 1MG3C 4DP0X 2XUWA 3BVDB 1CUOA 4BK5C 1L9OA 5B1JA 1CURA 3ABGA 1PNCA 1NDTA 3N55A 2VM4A 4KNTA 1ZPUA 1ASOA 1NTDA 4WKXA 2YAOA 4PAZA 2IH8A 1JXGA 3ABKB 1GS7A 3QPKA 3DIVA 3TU6A 3X1GA 1B3IA 2PPEA 3H4HA 3ZDWA 2YXWA 1A8ZA 4MFHA 1T5KA 4YSDA 4YSQA 4A66A 1ET7A 2FQFA 1A3ZA 1ZV2A 4AKPA 4F2FA 1NIBA 3SBRA 1ILUA 3TA4D 4YSSA 1MZZA 3HEIB 1NPNA 4Q8BA 3WNIA 1PZBA 1JXFA 3UAEA 3L45A 3PXLA 1GSKA 4DP4X 4GP5B 3FS9A 3NJMA 1J9RA 1SJMA 2EIMB 2RACA 2LLNA 3FSVA 2IH9A 2GC4C 2XX1A 3WI9A 4GP8B 4YSUA 3ABMB 1YLBB 2J57A 1AS7A 1A4CA 4PCYA 4DP6X 3TASA 1ILSA 3QJSB 1BQKA 1OCRB 1MZYA 1ASPA 3FSZA 3CVBA 4HHGA 2TSBA 1NIDA 2IAAC 4P5SA 5I6LA 1W8EA 4F2EA 2QDWA 1JVOA 1E30A 1N70A 1TEFA 2Q9OA 1AAJA 1PY0A 4G72B 2P80A 2DWSA 4BDVB 1GY2A 3S3DB 4EF3A 2HX8A 1JZGA 2J56A 3ABLB 5I28A 1XB3A 2OCCB 3TBCA 2UXVA 4HCIA 1ADWA 3OM3B 6PCYA 2GSMB 1UATA 1W6WA 2W88A 1GR7A 5TK4A 4NERA 3WKQA 4A67A 4F7KA 4YSEA 4GYBA 2YXVA 3X2QB 4A2EA 4YSCA 5I5JA 4NAJA 2XV2A 1XB8A 4KO7A 1AS8A 5PCYA 2AANA 1NIFA 1M56B 3QJQB 3T6ZA 1KV7A 2UXGA 4KNUA 3CZUB 3UADA 3GXUB 5ANHA 1BYPA 2H3XC 2Y69B 1BXVA 3FU7A 3FU8A 4P5RA 5D4IA 5AZUA 3EHBB 2MTAA 1SFDA 3S3CB 2PPCA 1GS6X 2Q5BA 1J9QA 3N2JA 3MX0B 3NSYA 3PAVA 3NJGA 1ET5A 5B1KA 1RZPA 7PAZA 2BP0A 2CJ3A 2IDTA 3FU9A 2VSKB 4HALA 4RH4A 1L9QA 4E9QA 4KO5A 3SBQA 1JZEA 2CCWA 3OMIB 3V9EA 1NICA 2UXTA 1E67A 4CSPA 1J5CA 4UAHA 1L9SA 2VW4A 3FT0A 2YAQA 3CDZA 3PAZA 2VW6A 2NRDA 3CG8A 2JXMA 2FQGA 1MG2C 1NIAA 3MBWB 2EIJB 1R1CA 2GHZA 2ZWNA 1AZRA 1ID2A 2PPAA 2ZONA 3UACA 3SBPA 1KGYE 5F7BA 2VN3A 1FA4A 2BP8A 3H56A 2R7EA 1BQ5A 3CVDA 2FQDA 4HZ1A 3OD3A 3TBBA 1SHWA 4BWTA 1AOZA 3X1EA 1TEGA 3H4FA 3WG7B 2H47C 2XYBA 4A2HA 1GY1A 1AS6A 2FTAA 1J5DA 4YVUA 1PMYA 2AZAA 2GIMA 2HZHA 2XVBA 3EH3B 2WSDA 2I7OA 4E9RA 4M3HA 2AZUA 1ZIAA 2IWFA 3ZBMA 4YSAA 2QDVA 4HCFA 1GYCA 2FWLB 2BW5A 1A4AA 1XMEB 2BO0A 3S8GB 1WS8A 2B08A 5D4JA 2YARA 4GXFA 5I6MA 1VLXA 2FJSA 1SDDA 1OF0A 3HB3B 3ERXA 1SHXA 5B7MA 1ZDQA 4JHVA 4HAKA 4CSZA 2BZCA 2N0MA 2FNWA 1L9TA 2XXFA 5I5MA 2HLEB 3NSCA 2WO3B 3GYRA 3IE9A 1URIA 1KCBA 4YSPA 2TSAA 4FA7B 4AKQA 2YAPA 3DTUB 1X9UA 4JHUA 1AZBA 4NB7A 5LDUA 2J5WA 3S3BB 3G5WA 3FYIB 4N4YB 2YQBA 1V54B 4JKNA 1OV8A 5I6KA 2XV3A 3AG4B 1OCCB 3NJKA 1WA1X 1X9RA 5I26A 2I85A 1SF3A 2DWTA 2XU9A 1GS8A 4BXVA 2ZXWB 1IBZA 4E9YA 1IC0A 5IY5B 3ASNB 1AQ8A 3FQ1A 4G70B 4G7RB 3X1FA 5I6NA 2QPDB 4ZK8A 4DP8X 2PCYA 3X1NA 2HX7A 5I5IA 3PPSA 1RKRA 3NSDA 4G7SB 5E9NA 3FU7B 1RZQA 1KDIA 3QJTB 3QQXA 2DY2A 3AG3B 2UX7A 1PZCA 5D4HA 2IDQA 3IBOA 3V9CA 2PLTA 4X4KA 2W8CA 2BP0B 1PF3A 2A3TA 1AANA 2AFNA 2Y1AA 3FSAA 4KNSA 3AG1B 4WTQA 8PAZA 1SFHA 2OJ1A 1JVLA 2IWKA 3FQ2A 2X88A 4QLWA 1CYWA 1NPJA 1IKOP 3PAUA 2E86A 5I6OA 3NYKA 2EILB 2HXAA 3AY2A 2FQEA 3CDZB 3PLYA 4DP5X 1OCZB 2UXFA 3UABA 1JZJA 2P80D 4DP2X 2CAKA 1KBVA 1HFUA 2JKWA 3NJLA 4TXVB 1FWXA 1KCWA 1QNIA 1ASQA 1JZHA 3GDCA 5EHFA 3FPXA 5AFAA 2BP8B 3EF4A 3T6WA 2R7EB 1J9SA 3ZIYA 4E9SA 4K9JA 4HHWA 3C75A 1GW0A 3NJFA 3WNJA 1PLCA 4DPBX 1ZIBA 1AG6A 3SQRA 3OQRA 2GC7C 2QT6A 1HAUA 1AACA 4BXSV 1EHKB 1A65A 2HRHA 2FT7A 1OE1A 2GI0A 1M9WA 2WO2B 2YAHA 1AZNA 1PNDA 1BXUA 3QJRB 4AZUA 1ZDSA 4UANA 1KBWA 4DP1X 2MRYA 2XX0A 2UX6A 2IDFA 1V10A 2DV6A 1OE3A 2CUAA 1FFTB 3S8FB 3T6VA 4A2GA 3EH4B 4KO6A 2VW7A 1SDDB 3WKPA 2X87A 4YL4A 1V55B 3NP4A 3QJUB 3T6XA 3IN2A 2CBPA 1IUZA 2YAMA 4QKTA 1I53A
chains in the Genus database with same CATH superfamily
2WQVA 5JTWA 4MQ7B 2BS8A 2JI3A 5F96L 1G7MB 1MEXH 5IGXH 1E5ZA 3GC3A 5CGYD 5GRUL 3L3KB 3T71A 1SLVA 4NYLB 3V5HA 4C56D 3MKKA 1CU4H 3PWLA 3BUYB 3GIZL 5JUEL 5CEZE 4DPAX 2B1HL 2YZ1A 5E94A 1L7IH 1NPUA 1ZOXA 4G5ZL 4K5PA 4YBQC 2V2TB 3C60D 4PV9A 3RUGE 2JQAA 2UWEB 4Z1PA 1MJUH 1E9OA 4YDKL 2R0ZH 2EDQA 3BD4A 3O4OB 4BWUA 1TKWA 1X7QB 1F4AA 3SKMB 4EI5A 3OKLA 5F97E 1M1XB 3D25A 2A73A 5C0EA 1S9XA 4M4PA 2HX9A 3Q1EA 2XQYG 3J07A 3FPYA 5C09A 1UG9A 5ICYA 1HL4A 1YDPA 4DP9X 2G3ZA 4OJCA 5I73B 4QHNB 3CH1A 1YECH 4M7KH 4DQAA 2FZ3B 5F72S 1WWWX 1DVTA 4XN4A 5DJYA 4XPBL 4Y2DD 3QO1B 1NKRA 2YPKB 2BJMH 2LABA 3QXDA 4QF1A 5DUPH 2Q8AL 1JZIA 1BIHA 4L1LA 3T0WA 1GC1C 2NY4D 4TNWK 1FIGH 1J8HA 1VEPA 1CGTA 1MJ7L 3O6LL 1TJHL 4LRIA 1CICC 1Q9OB 1BFTA 5FKPA 4YVNA 2CPUA 1X5XA 1YN7B 4NO0D 4ETYA 4PJBE 4PS4L 4N87A 4JY6B 1M7XA 1S7UA 4KC3B 3GXIA 4J23A 5BW7A 4YHKH 3GSUA 4HXBL 1Z3GH 4FOMA 4GXVL 2EDBA 5DO2D 5AVSB 5KVFH 2NUPB 4GKSA 1QO3A 5K9OB 3O3DB 5EO9A 3AG2B 1NFDF 4FMKA 2J55A 5BVPH 3AS3A 1FCGA 4ODTH 3UGEA 1UD2A 4L8CB 3GS7A 3VXRE 3PHQA 3RVVC 1EFXB 2DWEA 4ADJA 2OTUA 2EXYC 4KRPC 3RWGA 2DIEA 2WMPA 4O2EB 2WLIB 3BGMB 3GK8L 4H1LG 3V8CA 4Z77A 3NJNA 3B9KA 4X6DA 1MFUA 1BVOA 1ONQA 4CVZB 2IDSA 4AWJC 3G5VA 5E0FA 4DERA 2V7NA 4ODBD 2ZUQB 1EGJL 3F7KA 1BF2A 3K4ZA 1NINA 3SOBH 4DVBA 1RURL 4DQOH 1PZAA 3FO0L 1DN0B 1QEWA 3NJIA 3QDGD 1A4BA 3O8XA 5T1KA 3O81A 3PG2A 5TH2A 3RVTC 4LLUA 2QHRH 3MFFB 3HBPA 2FJGB 4DO5A 2FO4B 1I9EA 3AMKA 1CUOA 1BLNB 3ABGA 3T4YB 1U8MB 4H1LB 2QEJA 4K9EL 3F6LA 1K3ZA 4NKOB 4NZUH 4B3VA 2CR0A 1ZSHA 2GG1A 3PUCA 3FT2B 1S7TB 3RX5A 4Z7NE 3B2DC 3MLYL 1FE8L 5H8DA 4UV4L 1T1YA 3FCTB 2QSCH 4HKZA 4MDJB 2VN5A 3L3HB 3HR5A 5KBDA 1TVBB 3RTQB 1RHHB 2E6QA 2EXWD 2VLRB 3D2UB 4IW4C 2R23B 2C34A 1T0MA 2WIMA 4WUUD 1NC4B 2AMUA 2ZX5A 4EKJA 4N25A 4Q7DA 4XNQA 5EOTB 3HE7D 4NZTL 1X7SA 1BW8A 2VZOA 1GSKA 4DP4X 4GP5B 3F5WA 1XHHA 3MA7B 2AGJL 5DVOA 4HMEA 4P5TA 1J9RA 1A4KB 1WIOA 4I9XA 4WU7B 4Y5VB 4LCWE 4X4YA 1HQ4B 5K69A 1KWKA 5GS1A 4NPKA 3VB9A 2OMUB 3GBDA 5D5MF 1P5VA 1UWYA 3QUKB 4J4PD 3U9UA 3V6BR 4U1SB 1QW8A 2XWEA 4FQ2L 2O6DA 4K94H 3O3EB 1ILSA 4HWBA 4NFCA 5D1ZD 1MRFH 3CDFA 3SDCB 1G7JA 4G6MH 5LLIC 3KLDA 4N3TA 2JE8A 4R7VA 3N1GC 3TO4A 3K6SB 1XGRA 2LU7A 3FO9B 5HYSA 3ARDC 2VDOH 3NUKA 1YUKB 2QBWA 2WWMD 3RGVA 1A3RH 1JHKH 2IPKB 3E6HA 4PYHA 3TPUA 7TAAA 4UT9L 3WFBH 2WXJA 3U46B 3VM5A 4Y5YA 3WJMA 4P46B 3I50H 1ZK5A 4ETQB 2OA9A 1QLRA 4AGMA 3CSYA 2NQDA 3UJTH 4IBTA 2OL3L 4GUPA 5AUMB 3QEGL 3EO1B 1HCYA 3QBTB 2Q7YA 1GGIL 4OV6F 4PLJC 4L8SC 2VTFA 1R6VA 2EVGA 1PZDA 1N64L 2EUWA 2X1XR 3ARWA 2ITCA 4LVEA 4GS7B 4KAQH 1A0QL 1C1EL 3X3GL 3ZLQC 4RDQF 4F24A 2BFVH 3G04A 5H2BA 5IMOA 2R8SH 3DSNB 3PP4H 1ZHNB 5E0QA 3K7UA 1KIPA 1AKJD 1NCAL 2NSMA 3APDA 2Y7QA 2VIRB 4JUSA 3DPBA 4J3OD 3HS0C 3QJQB 1CK0H 5I15H 4E0RA 4POYA 3ENEA 3U6XS 1I8KB 4O02H 3UADA 4U7SA 3UBGA 2CO4A 4TSCL 5FDWA 2Z92A 1JYVA 5KVGL 4YEEA 3O9WA 4MWFA 3WV0A 1SY6L 3FB7A 1NCDH 4Y2NA 4BFOA 2Q5BA 3VSTA 1AGDA 3GQFA 4XZUA 5CN3A 1T0NA 3CFKB 4L4TA 4FX5A 4QRAA 2GJZB 1BCIA 1YEDA 2CMRL 2HT3D 3HZKA 3O41A 4FQPA 4HKJA 4JE4B 4LASL 4D7BA 1Y6KR 3NCJL 1S5IH 4X6EA 1J0ZA 1RUAL 4MAYB 1LO0L 2LFGA 1N0XL 1F1AA 3BAWA 3KM1A 4WIQA 3WE6B 4CBPA 1KPVA 5DHYA 4YZFE 2N01B 4BSVB 1LEGB 3CG8A 4ZMVA 5F7EL 4WJ5B 3I6GB 3AU1A 1UWXK 2ZPKL 3TA3C 3LNHA 2FATH 1FH5H 3CU1A 2DQMA 2FWUA 3OXSA 1F3RB 1M53A 2XN9D 2VDQH 1CBVH 4PVNA 1CGSH 2FX8H 5T5FL 5C2BH 4J3OH 4JFED 1XH3A 3QIBD 1RHFA 3QUZD 5HJ3B 1H3PL 4YHZH 4AGOA 1DQKA 2C1PB 3GSVA 3KR3H 1NFDA 2WXFA 1NKGA 1AO7E 4XAWL 5AB9A 2HG5B 1FFPA 3HG1A 3RVXC 1OTTC 3QIUA 1P5UC 2H9GA 5FA4A 3ILQD 5EBMA 1GPOL 1ZIAA 1OM3L 3M45A 4AGPA 5DQJB 2ZZUT 3C87A 4QT5A 5I18L 4U3SA 2WLHA 4BFBD 5CP3H 5TPWH 4UZGA 2D2OA 2OMYB 3TNNA 5EZIH 1KENH 1R5WA 3S8GB 1HNGA 2B20A 3DTXB 4XN9A 5C9KA 1OIOA 3LNIA 1WS8A 3MGOB 4ZAKA 4HK0B 3O4LA 1KC5H 1QQDA 1VFBB 3QISA 5F88A 3BESR 4AT6B 5A1AA 2BM3A 4HWUA 5C0BA 3REWA 4PI0A 3VSQA 3LCYA 4UTBL 4G8GA 4F9PC 4Z3EA 4YK4B 4QRRE 3BEVA 1D5MA 3BZ5A 1S7WB 3RL2B 2AJYH 2HA1A 2WQSA 4HLJA 4P57B 2AC0A 4XNXL 4YE4L 3NIGB 5DSCA 5KZCB 5HI5D 1PFOA 4L2LA 4DN3L 4H2AA 3EYSL 4PSPA 5K59F 1IJ9A 4WWOA 5C0AA 2YAPA 4BINA 1G43A 2XWBB 4NB7A 5A2KH 5CR8A 4JGJA 1GYAA 4R97C 3IDMB 2JLPA 5JOPD 3OHXA 4R4FH 5DTFB 2KPWA 2C7UA 4JM4H 5GZOA 2YFOA 1WFUA 4FXTA 4L5FL 5IZ7A 2DQGL 5FGBC 1DUYB 2R2EB 2XU9A 4HDIA 1M2VA 2IG2H 1R3HA 2JELH 4B9ZA 1KBKA 4NM4H 2JF1A 2HTLD 4YO0B 4MHHI 4NLAA 4TUUA 3RFZB 2MOVA 5B38A 3X1NA 4UT6L 4D9LL 4R96B 5HGGS 4JFXA 1KIRB 2NW3B 4PS3A 5AOZA 1YEWA 5D5MA 3L4YA 1PDKA 4OJFH 2F8OA 1JG9A 1D6VH 4MJIB 3FNKA 5EULV 3CNKA 4JQIL 5EBWB 2RGSA 3GUFA 3OJDA 4JZJC 4DO4A 2WZ0A 2J4WH 3S9DB 3LS4L 1VZHA 3OPUA 4QRFA 3ZRSA 4CKQA 4X5XA 4DKTA 3NZHH 4WQOA 1LJMA 3S34L 3QUXD 4HGWB 4EI5D 4J5VA 4C56B 3COOA 1SOQA 2OCJA 3NYKA 1BBJB 4EOWL 5H94A 3HUJE 3QW9A 4P3CL 1OSYA 3OV6A 1ADQH 3QHFL 2EIEA 3S8WA 3LNFA 1OD7A 1WZ1L 3C60B 2P5PA 5CMAB 3FTVA 5TE7L 5BUAA 5JHDA 4QRQA 1MCQA 1IQWH 4RGNE 4FQLH 1FWXA 4PJ9A 1QSEA 3PPEA 4MNQD 1OHQA 2ADYA 3T3PE 3BUPA 2A9DA 4ZO9A 4HJ1A 3FFOA 4LCYB 4RFNC 5DUMH 5KN5A 4J6IA 2KLSA 1CD1A 2K1MA 3DOSB 4AGLA 2EEAA 4PLNC 1XCQA 4NIKB 1NLBH 3U2IA 1VPOH 3U0TA 4HD9A 3MOQA 2NYYD 4Y2DB 2ZUYA 3APNA 2NY4B 1VKXB 1ORQA 2JKTM 2QADC 3HLAA 2K8MA 4A63A 5E6YA 3HMXA 1CD0A 3MRFB 3A67H 1XO8A 3JYBA 4OLWL 1CR9H 5E1HB 2ZWZA 2K0RA 3P3UA 3PWVA 4IKKA 1FHGA 3IBEA 3VFTA 4NO0B 2BNRA 4KZEL 4HC1A 4QYOA 3UPCA 5HDLA 2RR3A 3LRMA 2B1AL 3LN5B 5E00B 3R19A 6TAAA 1H5BA 1Q38A 2G75B 3PJSB 5BOZG 2WB7A 5IW1B 1QEXA 1MW0A 1I53A 2VXQH 5DJXA 3L48A 1R75A 1JP5A 2Z1KA 3S35L 3TF7C 3T0BA 3WHE0 3O8XD 4KUZH 2F5AL 3S36X 4AW7A 2XWJB 2F2HA 1MLBB 3L5WA 1IAOB 5FYLH 5E4IA 1IB5A 2ED9A 5JPNB 1CBJA 1RULL 1ZGLA 4X6CB 1YJDC 2IOOA 1HSAA 1RU9H 5HHPA 1FYHB 3ZDZF 1YNLL 4MA1C 4B27A 4OZGE 3BKCH 4LK4A 2EVHA 4YHNA 3D39D 3W9EB 4I3RH 3CD4A 3CSGA 2GJ6D 4JREC 2EIKB 4L1TA 1VHPA 2IAMD 4EVNA 3QG6A 4NN7B 4P07A 4LOFA 3KYMA 2EKSA 1LP9B 2DLEA 4H13C 2COQA 5BOJA 3GSRA 1ZT1A 1HJBC 5I8OH 2ADGB 3HC4H 3LS5L 3OLEA 4PLKD 3QNYB 4BE5A 4F37F 4EZMA 1FYTD 4NRXB 2C9RA 3GMNB 3IFPB 4GQ9H 1DJHA 2VDOB 1TPXC 4HEME 15C8H 1H6FA 3T9WA 12E8L 2YQGA 1FFOA 5LXGH 2JKSA 2WW8A 3I3BA 3LHAA 3SYOA 2WXQA 3H6JA 4NSKA 3TH2T 2H5UA 4WUUB 3D0LB 1WFIA 4R0LA 3ZE0E 3HE7B 3MNVA 2Y1VA 4OT1H 2IF7A 1CGXA 2CIKB 3LD8C 3ZMNA 3HHSB 3GBEA 3P1VA 1PEZA 2BDNL 3EYOB 4PRPB 5FYKE 4QTIH 1SN5A 4Y19A 3TBVA 3F7RA 4IRJC 3OZLA 4JDEA 3OAYK 4LNVA 3RGVD 3P11L 3O6MH 1KWGA 1Z3RA 1Z7JA 3QUMA 5HI3D 4FL4B 2UZXA 5C0GB 4JR9H 3UZEC 2DQHL 2ALWA 4GJTB 5FS5A 5D1ZB 1A02N 6CGTA 4XC1L 1DR9A 5EU3B 4J6RL 1PKQE 4O02B 3IN0A 5I1HL 2WPGA 3QPQC 3NACL 1OSZB 1XTLA 3OB0K 2OJZH 1RJYB 4XVOA 5J1SC 2O6FA 1QVOA 5DD3H 2G5BB 5MEQA 3CLWA 3O2VL 5HYJE 3SPHA 5HD8C 1DZ0A 5D1QA 5E8DL 2C4XA 5L8JB 3GZQA 3FAWA 1JPTL 3MGTB 2D4FA 4AMKH 2E8YA 2Q3AA 3AS1A 1MCBA 4JFWA 5EUOE 1NCCL 1TQTA 2DLTA 3QRBA 1WWAX 2JLLA 1F02I 1MVYA 2PWFA 4JLRB 3HNVH 1E5UI 4ZTOL 4J3OG 1NCGA 3IXAB 3OMZA 3LRKA 5CKAA 3C5ZC 4IRSC 2FDBP 3HTLX 3H4HA 1E50A 4JFOA 3PABA 4MKTA 1U3NA 1KGCE 3ZE2F 2O6EA 3WIHH 1TR7A 1QSFE 1H9VA 4KKLC 1RL1A 3QQNA 1YMHB 4LVNC 3UEQA 2R1XB 5B1CA 3BVVA 5E2WH 3VFNB 4X98B 4AQ1B 1A9EA 5CKGA 3RVUD 3NDYE 2PTTA 3ATDA 2VDQB 4I3GA 1MZZA 4LSSH 5AAMA 2VDNH 3QJHA 2GTWB 1AKJB 1AXTH 5EU6A 2D7OA 2ENPA 2WKOF 4PVLA 3SDYL 4V1DE 2AK4E 4NKDA 3WXVL 1USZA 5DJ2B 3FCGA 3II2A 3ZDYF 4Q74A 2WJ5A 2X6VA 4AIZB 2NY5C 2F53E 5AB2A 4C4KT 5KBMA 4XMWA 2XX1A 4FZEH 4GP8B 2CPCA 4MVBC 4NQDA 5CZVH 3WI9A 2FB4H 4TF4A 5K9KB 1LE5A 1MW3A 3Q7JA 1U8HA 1FL3B 4DKFL 1PZ2A 3WD5H 5C0FA 4QXUH 5A2JH 2YUZA 2ZWKA 4U6XA 2YA0A 3FOLA 3SDXF 2NXZC 5LGJB 2MFNA 4CADA 3B3BA 2R9HC 4Z7WF 5C0RL 3AXLB 4Z23A 2X9YA 4F7CA 4UT7H 3RDTB 1E30A 1XIWC 3FZUC 4TVPL 1U3JA 1YUHA 3DX4A 5KJ7E 3DDFA 5HGHA 3S48A 1RPKA 3C08L 1O7DC 3VFOA 2N56A 2FHFA 2J56A 4RFEB 3QIUD 2XN9B 2YPVA 1YEGL 4XBPB 5D6DA 4ZTPH 4D0BB 3T1WA 2GSMB 1A25A 5JR1H 1YEEL 4OLVH 4JFEB 3QIBB 4PY8J 4RGOL 1OT1A 3QUZB 1DQTA 1CE6A 1FP5A 2L7EA 2APVA 2VXTH 5I66A 1AHWC 2CZNA 5K39A 5F7NC 2K8QA 1HC1A 1KCKA 4ZDHA 4ZUSA 3VXMD 4KTEL 2F5BH 3ARBA 2V9TA 1LO3H 3INUL 3RJOA 4ISVB 4NQEA 3B5TA 3CUPB 5I5JA 1KGIA 5FV2A 1JL8A 3KXFA 2VDML 4W6XB 1RPUA 1E2WA 1OPGL 1Z0MA 4G80B 1JPSL 3GZKA 3OR7A 2UXGA 4G6JH 4XMPL 3QQ9C 3HBQA 4JFDD 4IU2B 3CFNA 3GLDA 3QXAA 5C0AD 3SPCA 2H32A 5ADOL 2GYSA 3QRGL 3WLBA 1KELL 3DVIA 3F04A 3DX0A 2MCMA 5JIIA 5KSBB 4ZX5A 2VGLM 3MX0B 1CF8L 1NMCC 2BRRL 3LIUA 4NWTH 1EO7A 1ET5A 1FNGB 1SJEB 1RZPA 2ZCZA 3FQUA 2BP0A 2IDTA 4NHCL 4P23C 5BOPA 1RZFL 3FUNA 3KPPA 3UPRB 3D4ZA 3MJ8B 4OGXH 4DAGH 1BF8A 1AYOA 2ZUXA 3BDBA 5DS1A 2QQKH 4ZTEA 4GW1A 2CG9X 5F2FA 1TJMA 3HMWH 1ZD6A 1JDDA 2ZXEB 4WKZA 4K3HA 2OSXA 1NLDH 4JCWA 5AL0A 4RZCA 3MRHB 2QV2A 2XA8L 2ZUVA 3NZ8B 1CIDA 2GHZA 1ZANL 2CHWA 1A6WL 2X4NB 1ZLUK 2W0LA 3TNMB 3O6KL 2ICWA 4JGMA 4FQJH 1D6EB 3VQ2C 1N5AB 4B9PA 1BQ5A 3BSHA 3N41B 4BCZA 3OD3A 5ID1A 1KZQA 3RWCA 1KJ3H 1T20A 5T33H 1KLFB 5LCVA 3E6FB 1G9ML 1KB3A 1G6RL 1RJLA 4OIAA 2FHCA 3KHOA 4OZFA 4YVUA 2ICWI 3BPNB 3FAXA 3FBQA 3OWEA 1EJOH 3GJFH 2FGWL 4IBZA 2X4PB 2Y1YA 4APQA 2JI2A 4X9BA 1EK3A 2H2SC 5EN2A 2CUIA 4N8CL 4G8IA 1ORSB 4PJDE 2QDVA 4X8GA 1MCKA 3MCYA 2WANA 3MRDB 2CDFA 1QSED 4GRLA 4UB0H 4HJEA 2NY2D 2CBTA 2XBDA 1YY8A 1E9QA 2X6AA 2YARA 1LXMA 3QUXB 4L3CA 4OCLC 1VLXA 1KB9J 2C26A 1CFSA 4WNQA 2IBZY 3PREA 4KRNA 5E1GA 5HVHB 4Q9QL 1N10A 1U8LA 2PF6A 3H9SB 3QUYD 4X0NA 5B7MA 3GIZH 2EEBA 3APMA 5JUEH 5GQBA 2B1HH 3S37X 4CSZA 3CH1B 4ODSH 4Z7IA 5DZOA 1FBIL 4G5ZH 3P73B 3TJEL 2I26N 4Z7UE 3WCYA 2B0SL 3BKYL 1NSNH 3IJEB 3VFVA 3KH4A 4BQ6A 1JZ5A 4XHQA 1E4JA 4YHIB 3ARVA 3LTVA 4MNQB 4RQQA 1OW0C 4YDKH 3QZPA 1I7TA 3UJJL 2JTYA 3ASWA 3BQUC 3UTTE 5IJVB 2HN7A 1IM9A 2BNRD 2C9XA 2B2XH 4LAJH 1DEDA 4OF3A 1G4RA 1IBGH 3VMPA 3H42L 4XPBH 1IE4A 4F8LA 2Q8AH 2FJFA 1WA1X 3NG5A 1WC7A 4LSRL 3RG1C 1BPVA 3JTTB 2BY2A 4Q6IA 5KSUA 1C5CL 3FTZA 1TCRB 5HJGA 3UTQA 3WTXA 1EXGA 1MJ7H 3H9HA 1TJHH 3KPSE 2WKOA 3O6LH 4GQZA 1CWVA 3V0WL 4HWNA 2HFFB 2LFEA 1F6AA 3PHQB 4CSSA 1I1FA 3U1SL 1BZOA 2WXRA 2Z93B 4WWPA 4PS4H 4C83A 3MN8A 3T4AB 3BZ4A 1JBJA 3DV6B 4NQCA 2UX7A 4LCVA 3PFQA 1ONQB 5FX3A 4RX4D 4ENEC 5GRWA 4HXBH 5DDHA 4GXVH 4G83A 3TS8A 2ZOKB 1GA2A 4FI8A 4P2CG 1AGEA 4GRWH 1G7PA 4LCIL 3TT3L 1SFHA 1YC7A 5EF0A 5IWLC 3SDXA 4PGJA 3FQ2A 4TL5A 2X88A 3HMXH 5CEYB 4BH7A 2J1WA 3BEWB 4PN6A 5HDBE 3PAUA 4HK3J 4Z7WA 3A6BL 5DUBA 1MH5B 3VWKD 1U8OA 3GK8H 5AVQB 4YXHL 1OWRM 1NEZG 3P2TA 5DD5L 4MS8C 1QFWI 2XOTA 3ZR6A 5KYUA 2GKIA 2P80D 4FNQA 3RPIA 2JKWA 1KCRL 4NUGL 3D39B 2I9TA 3PJNA 2CHXA 1EGJH 2GJ6B 4KMTL 1JZHA 4LMQE 5EHFA 1RURH 2IAMB 1K5NA 3FO0H 3TTYA 1W72L 4F33B 2DJ4A 5D7IE 1IIKA 1DJGA 2LLGA 5IF0A 3BP7A 1WCQA 3FB5A 5EBGA 4NPJA 1CDYA 4Z7AA 3HB3C 4L4VE 1IL1B 3LRSA 3WNJA 3TIEA 3QFDA 4JFSA 3TO2A 2YC1A 4ELME 3GXMA 4QRBA 1FYTB 3PL6C 4GKZB 1JPFB 4OJEH 3SE8L 2VN4A 2BVQA 2ZG1A 1UZ6F 1D7BA 2WXPA 1AQMA 2JKNA 3EOBA 3F5WB 2EDEA 1UOLA 5HDWA 1XD0A 4O9HL 4Y19D 1AZNA 1B4TA 1PNDA 3MLYH 2VLKE 1FE8H 1KGUA 3OKNA 4L9DA 3UX9B 4UV4H 4X4YB 1N67A 2XX0A 3IS0X 5A16A 3AS2A 3KGSA 5TDNA 3GNML 2K6WA 5ANME 5E5MA 5D2NC 3S8FB 3NH7H 3ZT5A 1VZIA 4AQAB 4CJ0A 5T3XL 1U2CA 2BERA 4FNRA 5E51A 1MIEL 3T6XA 4NZTH 4Z76B 2WCPA 3II1A 1USQA 2Y24A 3MROB 3IMWA 4JRYA 3D69B 3E2HC 2AGJH 1KCLA 3RGVB 3EYVA 3AC0A 2Q2LA 5D7JC 3E6HB 4QHUA 1PFCA 4FTVE 4ZMPA 2BXYA 1QHQA 4JPIA 1DJZA 4W9HC 5J12B 5D55A 1EX0A 1BGXH 1WA2X 2VDNB 1FNSL 1MY5A 3K6DA 4FQ2H 3Q05A 1CLYL 1N0LB 3APFA 3R06A 4MB1A 3BJ91 3CFDA 3QDHA 4YSOA 3FO1B 3ZYOA 5T3ZD 2AXWA 2FD6L 4KK6C 4PBVC 1U3YA 1XF5A 3EBGA 5ISZE 5HGDB 3PAYA 2VDLH 1SUHA 1GMIA 5E9DE 5EC1B 4GSRA 3ZDXB 5T1LA 4E5XG 1H3XA 3UXFA 3KGRA 2E56A 5L0QC 2DLHA 5EPMA 1FO0A 3RWHB 3TCLA 5IQ7L 4G8FA 2CUHA 2ITCB 1VADB 2PKDA 3KLAA 4UT9H 3JT2A 1I1AC 3JTBA 1SJVA 2I9LB 2BS9A 3QS2A 4A2DA 2P8LA 2XQYK 3OPZL 4K3JL 3RWIB 4MD4B 5I1CL 3Q2LA 5JXAL 3WHXA 1KIPB 2OL3H 4PB0H 5H4ZA 4DGIL 4LNRA 3QEGH 4NBYB 3RBSA 5I1AA 1GGIH 3QEQA 1PAZA 4HEPG 5DHVH 5E03A 5KYWA 4NLHA 4OB5L 5D9SB 2W0FB 2YUXA 1MWAA 4HT1L 5T1MB 5I1GL 1N64H 4S10A 1XF2B 4BBWA 5DRZB 4N20A 1G1YA 4JGNA 3FB7B 5KSVA 3B9VA 1KB5A 4NQDD 4TV3A 2QMKA 5SWQB 1XBRA 1A0QH 4XX1E 1MQ8A 3PHOA 5B4MC 3X3GH 3WY2A 5E56A 1WS7A 3MJ9A 2CDEA 1ZVSA 4HKJB 5T3ZH 3O41B 2DQFB 1UURA 3BRDA 5JZ7D 1L3NA 4E42B 2E7LC 4MXVF 1UYWL 5D93C 4NQVA 3SKUD 1G1OA 1T6VN 1N4XL 1RSYA 3I9PA 4TSCH 4XRCB 5C08A 1JXDA 4TLSA 5KVGH 1KPVB 5DHYB 1GC1L 4RMUA 5I0YA 1SDAB 3L7FB 4NCC1 3PP3K 3OXSB 2FT8A 1LYQA 4N0UE 1T7YA 2YGQA 3VGEA 2OYPA 2YAFA 4WWNA 4PJXE 1GKEA 5G5DB 3II3A 2CMRH 4LASH 5EZLA 3VFPB 2V17L 4NQUA 4NRYB 3UBXB 4QHPA 3NCJH 1RUAH 4CU7A 3RWDB 4JDZA 2WINB 7PCYA 1LO0H 2Q86A 1F86A 1N0XH 4O4YL 4QWWD 5FIEA 3RIFK 4JK0D 5DJDA 2P5WE 4N86A 2CKBL 5E4EC 2ZKHH 5CGBA 2ICEC 3MYJB 3ZGHA 3CFQA 5CEZL 3S96A 3T8XB 3QIUB 4OLZL 1CXKA 3KXFD 2OMWB 4NJ9L 3WS6A 1EXHA 4BGLA 1GS7A 2P9RA 5T5FH 3X1GA 3L7EA 5EO0A 3O4OC 2PW1B 2JJTC 4MA3A 4OW6A 5FCUL 4UIMB 1Z5LA 2Z6FA 3VXMB 4C57C 1NBZA 4YSDA 2MNJB 4YSQA 4YJZL 3VQLA 1TTRA 2YEVB 1F6FB 1OB0A 3SPGA 2QPUA 4NHUA 4UWQB 2ZOLA 3HPJA 2GIYA 4XAWH 3U2JA 5I73C 4G6KL 1TYRA 4NWUL 4FJYA 4PJCF 1UWGL 4A6YA 3K2IA 1KEGL 1OM3H 1JXFA 1BJ8A 2FX9L 3GSNA 1N8ZA 3LB6D 4WSGA 5AL8A 1NDMB 4KQ0A 1R5VA 3QXVA 4XN1A 4BE6A 2VITB 3BAKA 1H6UA 2NY6C 4JKLA 4JFDB 4XWGH 2ZSVB 4BV1A 1I4FA 3OBAA 1U8QA 1F3DJ 3FUMA 3B2UC 4IU3A 1TFHA 3GJFB 1JNNL 3EH2A 3L4XA 3TFKC 2X7LB 3LKOB 2IH3A 1VF5C 5D6CA 5ACZA 2AW2A 2AQ3A 3IDIB 4TNVF 1Q94B 4GBXA 3WNMA 1PY4A 4JFUA 4U1LA 4ONOA 2TSBA 2XBTA 3VI4F 4L3FA 5HVWA 2PW2B 4GW4B 1DVFC 2WYIA 4D0CA 3ROOB 4YE4H 2X53A 2Q0ZX 5AVVB 4XO8A 4DN3H 5EBLA 4JM2C 1TETL 2VAAA 3EYSH 3CQFA 4TSBH 3L6FB 3EJYD 1AD0A 3DK0A 1U4EA 3HC3L 3K74B 2E27L 2HX8A 1A9VA 1AMXA 1Q9LB 5I71C 2NX5E 4XZ4A 2NR6A 2UXVA 5TGBA 1MF2L 4L5FH 2CBMA 2DQGH 3OM3B 5SV3A 4J1UA 1X5IA 4AEHL 4H0HB 3CGTA 1MCPL 5MEOA 3QO0A 1MELA 1XR9A 2DM4A 4M7JL 4Z7OB 2OSLB 1A7BA 4UT6H 3GHEL 4D9LH 1FDLL 3KPRA 2KS0A 1BQLH 4GIPD 4JQXA 1T04A 1CLVA 5AW3B 1AS8A 4U3HA 1TIUA 4QRQB 3NN8A 1GCFA 4KROD 1QSEB 2W9LA 3WKYA 2NY2B 3RHWK 4HSCX 3LS4H 1QP1A 2DICA 3FH5A 5E1QA 1E8WA 1JHTB 3BVWA 4Y9GA 1CL7L 3S34H 3UDWC 5KN5B 4P5RA 1BXVA 1CXHA 1HKLL 1CD1B 3QUYB 4GAGL 1IM9D 1TOXA 3EJJX 4KKCD 2B4CL 3DUUA 5F9AC 4EOWH 2FCBA 2AVGA 1OD9A 2L0DA 4YR6B 7FABL 3B43A 2Z4TA 3BSGA 4BIKA 2BSCA 1L9QA 2DH2A 4GRWB 4UU9A 4AEFA 4XO5A 3FQWB 2YPLD 5EF1A 1KEGH 1E9PB 3Q8AA 2OR7A 4F8OA 4ZMTA 1MSPA 1JRHI 4PJAE 1XZ0B 4NZJA 5JIHA 1T7VA 1BFVH 2WXOA 5D7SL 3UC2A 5FHBL 2BNRB 2PO6A 5ITBL 1UM6L 3ZE1B 4YLQT 3G5YB 1MAKA 2OMBA 4Q52A 2WXMA 3QFJE 3MQIA 4H0IA 3O3AA 4D8PA 3OAUH 3F8UB 4JRXE 2CDGB 4GO6B 2YIHA 4FF9A 3LVTA 5DC4B 1RY7B 5F1NB 2NYZA 3UACA 3DX8B 4P5KA 1OB1B 2XXCB 3OB8A 1S7RA 4PRHB 3NMEA 3EGXB 2ZXDA 3US9A 3EUDA 5FB8B 2XYBA 4BHUA 2BSRA 4HULB 4CMMB 3FH8A 1N19A 5BJTA 1FG9C 3FU3A 3LPWA 4P4KA 1M3IA 4P46C 5CIPH 2LVEA 4OGAC 1LGVA 5FF6B 1A7PL 1FLRL 3JWNG 1DANU 2Z7UA 3KBFA 3PV6A 1X6NA 3HJEA 5KBPA 3CCHA 4YXKH 4PRID 4HUNB 1EJ8A 3U7YL 4JDTL 4HCFA 1WTGT 2XZZA 1GYCA 1ZLVH 5A3IC 4H8QA 4BHUI 1T4KB 4WWKD 2G4EA 2J8UF 2JIXA 5CCKH 4JJOA 2F5AH 4LLQA 4ALAC 5AW9B 1DO6A 4M5TA 3I75B 1RFDL 3VWKB 4G9DB 1F90L 5GS2D 4N5ED 1RULH 1QA9A 4G6AD 4UQEA 4U1HB 2A9CA 1KNOB 4LSUL 2K4AA 1BZDA 1RAMA 1MCWW 1YNLH 3SGDI 4A7TA 3FUJA 1WAAE 4LPXA 5AZEL 2C4FT 3Q06A 3CMGA 3QDME 5J11B 4PJ5D 2OXHA 3WIFB 3DMMA 4UOZA 2FEJA 2IH1B 1Q0EA 3ZHLA 1ZT7B 3WKNA 5LDUA 4WY7H 4Y4HC 2Z31B 1CXIA 3LS5H 5D2LF 1ZTXL 2VDLB 1GJUA 4LGRB 4V2CB 3G5XA 2ZOTA 5CHNA 4F7PB 3MRQB 5KBNC 4HIJA 1OCCB 4P05A 3MR9A 1OAZL 3PGFL 2YD3A 3DVFA 4JRYD 5IQ9A 5CZRA 3DRQB 3DXAD 2VLMD 4WFFE 5LAXA 1MCDA 12E8H 4FHJA 1DLFL 3C6LC 3SGKA 1NUGA 5DD6A 3K81A 2OX5A 4DGVL 5DRWA 3VI3F 1IGFL 4BKLB 1RZQA 1DZBA 2OL3B 5E5LA 3QDJA 3S98A 3ULVE 5DQ9A 1TVHB 4OZIE 4OFYA 4AE0A 3V0IA 4AEIL 2MNUA 4MD0A 5DHVB 2XA3A 5GS2H 2BDNH 3IF1A 3GMRB 4BQCA 2PLTA 2WNKA 2IBZX 2CE6A 5GXBB 2AI0L 2F54E 3GLAA 5DYOB 3CV5A 3CC5A 4ICXA 4KNSA 3R8BB 2XTSA 5I1LB 1LEIB 2ZX7A 2O72A 3IPFA 5FUZL 5FUOL 5GGRB 3P11H 3VI4A 3MCKB 3RNQA 5TE4L 2L7QA 3FKUS 1S7VA 3K72A 1G7LA 1XBDA 3B7TA 2DQHH 1X5FA 4NENB 1T2XA 5AD0A 1UKQA 4NT6B 1C08B 3HZYB 3HLKA 5BXFA 3TYFB 3Q3GA 3W11C 1EEZA 4N22A 2X9XA 2JXMB 5C0NC 4DP2X 1F11B 2WO4A 2YBRB 5I1HH 1HFUA 4OQTA 3NJLA 4G7VL 5L4MA 3NACH 4YGAB 4BK8A 1QNIA 3G5ZB 1E4HA 3NJVA 2WBJC 4H2CA 1G84A 3FTWA 2EVJA 4KK9C 2R7EB 2CLZB 2BNUB 4E9SA 3CMOL 1FZOA 2QLYA 5E8DH 5L9DH 2XV6B 3C09B 3TV3L 4PPTA 5F7MC 4Q2ZA 3MUY1 4YAQA 1HAUA 2PTTB 4XE5B 4XN7A 5IVOA 1P7QA 3D08A 3NQIA 5GS3A 4YK4C 4ZTOH 3HS9A 4XMTA 3ATAA 2BVPA 2VRAA 2VB5A 3RKDC 3WLWC 4NKDB 2GY7B 3AADB 4FQXC 4HIEB 4OV5B 3JV4B 3OC5A 2YS4A 4JDVB 4YFLF 4KJQC 4ZSOB 3HZVA 4TVPD 4AYBA 1BQHA 2IDFA 3ULVC 1U3HA 3MYZA 3V4VA 5IKCA 4Y16C 2YHGA 4NQDB 4XH2A 1E5CA 1JGVL 2XT1B 4JFHD 1Z9NA 4NCDA 2HH0H 4J27A 4GB9A 3MNWB 5GSRB 5TQ2L 1QRNA 3D06A 4UINL 4OCYL 4YL4A 1KTJA 3JT0A 2E7DA 3NP4A 3QJUB 4YDNA 5JORB 4B9FA 4OZHB 1LE9B 3MRPA 1OVZA 2YAMA 2FIKA 3SDYH 4KKBC 1MHHB 2V7HB 4LKCA 3WXVH 4DP7X 4MCNA 2TRYA 1ZA6B 3ARYA 2JJUA 4F7CB 1DJWA 5AOKA 4XBEL 1P1ZB 32C2B 3RFZC 2JKJA 1ETZA 1CT8A 2DWDA 4KWUA 1JGDB 4C47A 2BHZA 1E4KA 4JFQB 1D7FA 1MHEB 2I5YL 3I3DA 1U8KA 2OV0A 1D2PA 3LSOB 4DKFH 4TULL 4HJSA 4U1GC 4R6UA 1KMGA 3BPLB 1BVKB 1X5JA 3PCYA 1E2ZA 4W4OA 2F1AA 4ODVL 1NDGA 3B9EA 4A55A 2WUBH 3H3KA 1VERA 3SCMD 2AQRA 1EZLA 3RY5A 3OXRA 5E8EA 2DEXX 3NCEB 3EJUA 1OY3B 5K39B 4EN3B 5CGYC 1XF3A 2IEPA 3V0EA 3OZKA 4TVPH 4HX1B 4WFGD 3U2SB 4LKXA 1DUZA 1KFAL 3C08H 1MKFA 2L8AA 4HIPA 5J0BA 2A2QT 3QARA 4CC4C 1ID5I 1C5DA 4M7LT 3N1FC 3NIFF 1YEGH 4OD2B 3RB7A 2X1PA 2XY2A 3KPMB 3BIKB 1SLUA 1YEEH 1MCLA 2E3VA 2H1XA 3IU3B 4RGOH 5E2JA 4PJHE 5ADPL 1YJDL 3G6JF 3N91A 4GT0A 2K78A 2QVFB 1T5XB 4KTEH 4GI9A 4RLDA 2EIZA 3INUH 4HLZH 2OQJB 1EAJA 2J8UA 5F7LB 4E5XA 4HIXL 3T77B 2YXFA 3UTPE 1XDTT 1JZ2A 3A6CH 2VDMH 5GS0D 3DA0A 1MFEL 2XLLA 4G71B 4OSUL 4Y2DC 4DFHA 3JV6B 5F0JB 4Y5XA 4PY8I 5HVGB 1JPSH 1OLZA 4XMPH 4PREA 5FGSA 1ZLWH 1M71A 4PMFA 4WTWA 2EC9U 4GW1B 1UB5B 3CX2A 5BMFL 3CJJA 2EEFA 5ADOH 4WI4A 2OW6A 4YDVB 3QRGH 5JDSB 2EUXA 1KELH 2H6OA 5A6LA 4HEPA 3GMLB 3RX8A 1CF8H 2BRRH 3OR6B 3KVDD 4Q9BA 4NHCH 4WI0A 1MW1A 1BQRA 4L48A 1D5ZB 2DMBA 1ZLSL 3KPOB 3C8HA 2GK2A 2IOMA 5B1BB 5D2LA 2NT0A 2K70A 3W2DL 4BFIB 5IVNA 4OFKA 2VM3A 3EYFB 3B37A 3ZTJG 2Y2TA 3L9RB 4I3SL 4XGZA 1VAHA 4DKAA 4OGYH 2XKNA 1PJ9A 1HL5A 1K8IA 3DI3B 3CDYA 1IM3A 4K5MA 3BVDB 4PP2B 5BZXA 1A14L 2XA8H 3QQDA 3U4EB 1UXMA 4ZQKB 4AENB 1B0IA 1X4XA 4LLMB 5F3BA 4GLRI 3ET9F 3VI3A 3O6KH 3W0WE 3T0EE 2OK0H 2WLYA 2CDFB 3TU6A 2PTVA 1TJIL 4G1EB 4ZPTA 1Y18B 4F7EA 1YY8B 5JW5B 4HFWA 4S0SD 5EDXA 1CFSB 5EEWA 5EU4B 5J4MA 2FUTA 1IGML 1D9KA 1FL6B 1G9MH 1G6RH 1U8LB 3FRPA 3EDDA 4KFMA 1NIBA 3IWVA 2GSIA 3DUHA 3ZQWA 2CD0A 4B5ZA 2XKUA 5D7LE 4HD5A 2HVJB 4QHKJ 1BVLB 2FGWH 4AYFB 3RPBA 2PYEE 4S1DD 3IFNL 3CZSA 4N8CH 3IMRA 4KROB 3ULUF 3PWPE 3ECWA 3QNXB 2DD8L 3MRLA 5JXED 3IDGA 1YEIL 2K3TA 1QR1A 1PYWA 5CIPB 2CLRB 4FEMA 4XNAA 4NKMB 1P7HL 3P30L 4Q9QH 2W9DH 8CGTA 4U6HB 3INOA 3NIDF 3AQDA 1YEFH 1NC2D 1HT6A 4PD4K 1U8IA 3QJSB 4Q0XH 1FBIH 4TUOB 4L1BA 4KI5E 5I74B 1NA8A 3TJEH 4POZD 5HGBB 2KBGA 2B0SH 2P5EA 2X4SB 2E46A 2YPLB 1LWHA 3TBWA 3ZL2A 2FJFB 5F8QC 4PY7B 3WMQA 2KQMA 4KKPA 4HHAB 2IO5A 4M5ZL 3UJJH 3HI1B 1Q0YL 3P4MA 1XSOA 2QGEA 2X70B 1AGFA 3CFJA 4X8CA 3RNKB 3ZZSA 4X7DC 2IXQA 1JIBA 5BRZE 5C0CE 2A9ML 4IJ3B 3ELAT 2CRZA 5D1ZC 4R83A 4EF3A 1MLCA 1IQDB 1HQRB 2Y22A 4PJ8D 5EIIG 1KPUB 4B9KC 2NY5L 3ABLB 3H42H 3T3PF 2OCCB 1HU8A 1WDAA 3RJDA 5CNHA 6PCYA 3GBMH 4NUQA 1C5CH 1NANH 3BUDA 2WWMC 4XP1L 4YFLI 3UP6A 2JIXD 2CBQA 3V0WH 4NERA 5BZDA 4PTTB 3F64A 3B2VL 3F62A 1NFAA 3H54A 3DUSB 5MENE 5IB4A 3H7LA 1JWMB 2BY3A 2FYVA 1WUZA 2DQEL 2E9GA 1NCOA 2W92A 4NO2B 4PRIB 4NZ8A 5EIIB 5PCYA 1FZMB 4OI7A 4K23L 1X4YA 1NIFA 4AIXA 1I7RA 3T6ZA 5DMKA 4WWKB 4N9OB 5ENWA 4GSQA 5KAQF 3FF8A 4LCIH 3TT3H 4OF5A 4MAZA 1I3UA 4ONFL 2M1KA 5E2TL 1IGJA 1FAIH 1UH2A 2NZIA 3EGDB 1B9KA 3L9EA 3MRKB 3UAFA 3FF7A 4KI5C 3FU5A 3S3CB 5T3XD 5K9QI 1RK0B 4RSYA 3A6BH 3MTXA 3D8MA 5DK0A 4AQ1C 5M94B 2XKSA 4YXHH 3VD0A 5DD5H 4CL7A 1RZ8B 3AVEA 4HALA 1IX2A 4GAFB 4LLYA 3GTVA 4BZ2A 1HL9A 3SE3A 3V5DA 1KCRH 4NUGH 2F74A 5D70H 5DS8B 4KMTH 2R1WA 4PJ5B 2XPGA 1AP2B 2IALB 1W72H 4KI1A 1M05A 5D96C 4L9LB 5HYIA 4W81A 2ZYHA 4HIHA 4F27A 1UCBL 3WEXB 1UJ3A 2D31A 3GXDA 2QPSA 1AXSB 4FQHA 5FAAA 2BOBB 4UDUA 4LL4A 4IIZA 4UCFA 3G6JA 5CBEA 1U91A 3GB7B 3SPVB 1E8XA 1V7NL 4W9FC 2ZONA 5DJCB 3U1PA 1AGBA 2DQJL 3SO5A 4IOIA 3DXAB 4O9HH 2HWZL 1RD6A 2ZYRA 2B3RA 4YDJA 5DFTA 1ZA3A 4X6BA 3P4LA 4LBEB 1TEGA 1Q72L 1IGYA 1OAYH 2KYIA 3GI9L 4X99A 5KJRL 1Q0XL 2QVTA 3GNMH 4Y1AE 3KJ6L 3H6AA 4QRSA 2FTAA 1AO7A 3L3JA 2GIMA 1D5RA 2QKIB 1PY9A 1CGVA 2P43B 2VDKL 4JB9H 5T3XH 4R3SB 2WNGA 1DSFH 2F7QA 3BOVA 2JCCE 3LVEA 4PV8B 1E90A 4FYQA 3BLPX 4I0PC 3LQAC 3TX4A 3NCWA 3G08A 3O3UN 4N6RB 3OSVA 1RZGB 1IC7L 4JFTA 4YBQD 4HOMA 3KPNB 1OAJA 3RDJA 2WUCH 4R9HA 5ECJE 1V8HA 4W9GC 4X4XB 2OMZB 4GOSA 3GSOA 2OMVB 1TZ8A 1WAPA 1FNSH 4S1RL 2XTJE 4LVHC 3VRIB 3VTAA 4AUJA 3LEYH 1K2DB 4F57L 1KPRA 2FD6H 4W9LC 5KVDE 4RAUB 1UFUA 3MRNA 4N8PA 1UGNA 4XR8C 2VRKA 4ZFZB 2LHAA 4LCCB 4Z7QB 1Y6MR 4KTDL 1W8OA 2MOGA 2Q20A 4HJTA 3CFIC 2UZPA 4A1RA 2Q1EA 3TBYB 2X4QA 1OZUA 1TZOA 2G60L 4LU5L 3RWEA 3SDAA 1CICD 2WCGA 4K3JH 2VUOA 5I1CH 2CDEB 2A6IA 4YXLL 4MQXD 5C09E 5I6KA 4DGIH 3IJHA 4WF7A 3K91A 4R26L 5IQOA 5J3HD 2I85A 5E4OA 4XMZA 4E9YA 1A4JB 1IBZA 3EUUA 1F4WL 2Z35A 3EDFA 5CJ5A 4OB5H 5F89B 3SKJL 1MUJA 1T1WA 5I1GH 2QFRA 1QUNA 2PCYA 1W0YT 4CN6A 1J8HE 3S3PA 4I4WA 5C9JB 5CEZD 2FEDC 4G7SB 5KYXA 4CMHB 5HHOA 1F8TL 4YIQB 3CFEA 4Z5RB 3RVVD 2HPOA 3FC8A 2EXYD 4OUUB 3KLSA 4Q4IA 3FB8A 5EZLB 4X4KA 2W8CA 3ZU8A 3V7AG 1KXVA 2Q6WB 3FSAA 4AW4A 2CXKA 1UYWH 2Y1AA 4EBQH 4LARL 4N2EA 5IQLA 3WU1A 1HH6A 1S9YB 2HTLC 5MERA 3V0HA 3O6FA 3KWVA 2MJWA 2OTPA 2XTJC 3MRMB 3U7AA 1CYWA 3BT2L 3IVKA 1SVZA 3EBHA 2QZ5A 3LN9A 3P9LA 4YPGA 3MV7A 3HUJA 4BUQA 2VDMB 4C4KO 3F7LA 1MAMH 4ZMWA 4WI5A 5JQIB 1ZWIA 3X12A 2SEBA 1MFNA 3IFLL 3K4AA 1FI8C 3SCMB 1DFXA 1NGYA 1TMCB 2V17H 4N0CC 4KVNL 5F9JA 1UZGA 4CBZA 1HILA 1J5HA 2VE6A 5LO7A 4O4YH 4EI5C 1FJ1B 4P2YA 1GZQA 2GY5A 4NNYA 1GW0A 5DZ9A 1YY9C 2CKBH 5D7EA 4TL4A 1AG6A 1SY6A 2FO8A 2AJXL 3MTRA 4JFVA 5CEZH 4UIKL 4NNPL 4OLZH 1EHKB 1UZ8A 2D7TL 4EO5A 2WO2B 4OGQC 1CTOA 4K7PL 2HCZX 2UYLB 1U4FA 2MSPA 3OZ9L 1N6QH 3BDXA 4M5YL 3P9MA 4KV5E 4LRIC 2UX6A 1CXLA 2Y07H 4IU3B 1Z9SA 3VXRD 3IXTA 4I48B 2CUAA 3KS0H 1FFTB 3DOHA 2VO8A 5ACZB 5HHNB 1NJ9A 4TUJA 3FOMA 3L3OB 1A6UL 4G6KH 4R4ND 3GLZA 3UAJA 4M1CC 1UWGH 3AY4A 1LNUA 3BP4B 3O11B 3V52L 5BW7C 1E3XA 4JVWA 4NM8L 2FX9H 5KYNA 1A6VL 4KZ0A 4HU2A 2J8HA 2YUVA 2ZF8A 3MCLH 3QFGA 4HCRA 4X5WB 4P3DA 5LGYA 4ELKA 3DJ9A 4ZOEA 1G6RB 3D87B 4YHYB 2NDFA 3BWAB 1IKFL 1IIIA 4OCWH 3ARDD 2GBAA 4ABWA 1KCUL 4R7NB 2GK0B 1ZEAH 3AZUA 4DK5A 5JIPA 1FNAA 3UYOD 3B9KC 3NFSL 4ODHL 3MRJB 4Y4FA 1E4XL 3IDXL 4DJMA 2OBGA 3JV5A 5L2KA 3PDGA 4GP4B 3ZN6A 1MNNA 1CJYA 4PUBL 5GHWL 3MMEB 3O8XC 1NWPA 4QO1A 4FA6A 4LFHD 4PLJD 4E9TA 2Y7OA 1NZRA 4NPYB 3HC3H 5E6UB 4X7SL 1OALA 4KDTA 4MJ4A 1XR8B 3M1CA 2QPEB 2E4TA 4U1NA 2E27H 3E7JA 3EO9L 4XN2A 2YN3A 4WO4D 5B7FA 4JFFB 4LHUD 1KJ2A 2XYCA 4M6OL 1UTDA 5C86A 3H0TB 3H1ZA 7CGTA 4CN1A 4AEHH 3I2CL 1M7DB 4CJ1A 4WHCA 4AY0A 2RQEA 2PPDA 3IJSA 2RH0A 3L81A 4LCWD 4PVBA 4M93B 4X5LA 4BDVA 4M7JH 4AKOA 4P5MB 4IK7A 1GW6A 3GHEH 4TQIA 1FDLH 1BQUA 2H6PA 2BIPA 4N2GA 3LV3A 2DJSA 4PLKC 2WHVA 2RB8A 4AX3A 2IBBA 3L8QA 3LIZL 2O6CA 3US1A 3LKNB 3BHBB 2MPVA 1ITBB 2Z4QA 3H7BA 4P5TC 4U1MA 3LYRA 1DO5A 2QSVA 1HHHB 3LZQA 5F9DC 5B3JF 1F18A 3TBTB 1HKLH 2E0PA 3CPLB 1FNLA 4GAGH 5B3SB 4GG6F 1JE6A 2B4CH 4PJDF 1A2YA 5IHHA 1NC2B 3O3AB 5IFJA 1HX0A 2VSMB 2UY7B 3PQYA 3QRLA 4JANA 1HK6A 5BCAA 4MJHA 2FGZA 7FABH 1EANA 1KJVB 3Q8CA 2Z8WC 2N7SA 4F8TA 5EU7E 4DKEL 2ZT9C 2BWDA 3TA3D 1Z2KA 4DCQA 4ATTA 8FABA 3MKGA 4JQIA 1H8OA 4L4TE 3ESVF 4RFOL 3LKSB 4E68A 5I75B 2EDWA 3RGVC 2HAZA 1JZFA 5D7SH 4YEFA 3AMLA 5IJKA 2BSRB 4XNBA 2JKIS 1TQBC 1UM6H 4R4BA 3JTSB 3SD5A 4Y5YC 1YNTF 2NTSP 4LPWA 5B1JA 4R84A 4PJ8B 2M8XA 3EJCA 5JLZA 3PV6B 2F7RA 3C6SA 5IFHL 3QJFA 3KLHD 2AXFA 2ZE0A 3P77A 4JRFA 1W72B 2GJPA 4PJEF 3GI8L 4P9HL 3RVXD 1F4XL 4RWHA 4TQEL 3ZDWA 2HB0A 3ZMRA 3IK2A 4N1EA 3MV8A 1QSFA 2Z91A 2JIXB 1IAII 2YMXH 1OKEA 3QXUA 5DJ0B 1NGWB 1Y1UA 1MOEA 2WK2A 5IBTL 4WJKB 1QTYT 4HUVA 4G8AC 1BBDL 3GJFK 1RERA 2X4RA 1ILUA 3VD4A 1A7PH 2ICCA 4NFBA 5FO8A 3E80A 1OGTB 2IVFC 1E28A 1G0DA 2OZ4L 3L45A 3U7YH 2ZX6A 3FS9A 3NJMA 4KY1L 3EIFA 5MEPA 3HG1E 3U9WA 3PGCB 2ZG2A 2CCVA 1PAMA 2DM2A 2EYRA 2F53A 3D18B 4Z3IA 3V79C 3DVNB 2JB6A 1KLUA 3O9WC 2GC4C 3S7GA 3MUZ1 5IHZA 4PCSA 3BH8A 3RVUC 5J06A 1KUMA 1F90H 3SODB 1OO2A 2VR8A 2A6JB 2PCFB 3O4LE 2W65B 3QCVL 4OF6A 1ASPA 2ADJB 2HTKD 3JVGA 4P49A 3BWSA 4LSUH 5CHNB 5J56B 3S5ZA 4CGUB 5T1DL 1CZ8H 4O51B 2AXGB 4NQSB 5GZNA 3V6FA 5C0BE 2WQXA 5AZEH 1QLFA 4ATWA 3TEYA 3QYMA 2J21A 5ETUB 4G8GE 5J13B 1J7VR 3KLLA 3TF4A 2QDWA 1QOKA 1AY1H 5FHAL 1BM7A 2Y25A 2ZOWA 3B3IB 5INDB 4JZNA 3D3VD 3CFBA 1SOSA 5F6HJ 1AO7D 2JK5B 3PDOA 4D94A 3BGFB 3OKKA 3OKDA 1KY6A 4G43A 2F58H 5DQ9B 2APBA 4U6YB 5J57B 1C7TA 4WK4B 5CZXD 3SKNA 1OAZH 2D73A 2SODB 4YGVA 4IEFB 2H8PB 3WL9A 4YHPA 3K72B 4AVJA 1F6LL 2ZCLL 3CLEL 3RI5F 3DX9A 2YXVA 4DGVH 1P4IL 5CCJA 3WJJA 1IGFH 3ESPA 1N3NA 2AXJA 2MPAL 1XB8A 4C55A 4JY5L 4JHWL 4AEIH 3QIUC 4QRRD 3Q2VA 2R0WL 2WAQA 4GG8B 4Z0XB 4NFDA 3V0JA 1TZIB 2AI0H 3MNZB 3VJ6B 2GSGB 5D5ME 2AERT 3Q48A 4ZAKC 5D4IA 5TE4H 4X6FA 4HUKB 3LEXA 1HVXA 1URZA 4YAQB 5DA4A 1XGYL 4IBVA 3QQ3A 4GI6A 4AQEA 4UAOB 4L8BA 2DM3A 2FUQA 2BSTB 3BT0A 2WBKA 3BP6B 1ZK9A 4G7VH 1MY7A 4NRZA 4YZWA 2YEZA 4JAMB 3GM8A 4Y4KA 4CSPA 4UM8A 2F7OA 5JHDE 1BQHB 4N2CA 4NN5C 2QADD 2QVKA 3CMOH 2CH8A 2LT9A 2CU9A 3FT4B 3ILPA 2ARJA 3AWFA 2VABB 3R4DA 4G5AA 3VD3A 3PUUA 1CICB 5H37G 1KXQA 3KWWB 3FONA 3OHXC 4HKBA 2ZICA 3WN5A 4N1HB 5IOPA 1G7HA 1AI1L 3LH2L 1NGXB 3PHSA 5GZOC 1FNEB 1YAZA 2FIKB 5F7BA 3H2PA 2ZUWA 1XAKA 1B0RB 1FC1A 2X2JA 2FQDA 1QRKA 4LPTA 4XXWC 1QFUH 2NY1C 2CKBB 2YD7A 3K5RA 4HJUA 1HTYA 4TPRL 1AD9A 4GSDL 3M1BB 5IM7B 1S9VB 5DJZB 4B9CA 5DD1L 1JGVH 1KLGA 4A2HA 3QORD 1QR4A 1ZHBA 3DETC 3MRGA 4UNTA 3GHBL 4HWEL 2E7CA 4L4JA 4XCYA 2HZHA 3HKZA 1MNUL 5TQ2H 4ANWA 1CE1L 4UINH 5I8KL 4OCYH 3RUGB 3EFFB 3FQNB 4GG6A 4PJDA 5E5UB 4RGND 2WVVB 4JPKL 4U0RB 2BFGA 4FMVA 5DRXA 1ESOA 1XMEB 2IC2A 3SJVA 2J2ZB 4WDIB 5DO8A 4MMZB 4YBLC 4XBEH 1Q1JL 2Q87A 3TOPA 3EHBD 5CJ8A 4IM8A 2OK0L 1IC4L 1ZCRA 4IK6A 2I5YH 1T66D 1KBGL 2YRPA 3K2MC 2VXVL 3IDNB 2EC8A 1L9TA 2WVUA 1YNTA 2WO3B 1HCVA 1SRDA 1TCMA 2H2PD 2NY2C 3UOAB 3TZVA 1OAQL 4YSPA 1DDHB 5KS9F 3UTTA 3OSKA 4PJEA 4WCYH 2WXGA 3HRZA 1LVEA 4H40A 1U92B 5LN4A 4ZFOL 4H5SB 4PJBB 1DVZA 1DDTA 1DLHA 4LP4A 2D2CC 5ID0B 1FLTX 1KFAH 2F7IA 4NQXA 4KXAA 4B6ZA 5EEVA 3OLIA 4Y2OB 4NP9A 1JV5B 2R29H 4JKNA 4ALAL 5I1DB 4NUPA 1QWNA 3B5HA 1YEJL 4WW1B 3ZYJA 3PNRB 3OKMA 2JKXA 1DVYA 2G0KA 3KPSA 5ADPH 1AR1C 1DN2A 2R4RL 3VXRB 1F5WA 5E8NA 1T03L 3LH8A 5CP7A 4IRJD 5DRNB 4N8VG 4UI2A 5I5IA 1YA5A 1QMUA 3CK0L 4YWGL 1JZ3A 3FU7B 4HIXH 2OYLA 3JZYA 4WI0B 1P84J 2P4AB 2ZNXA 3FRUB 4ZO7A 2O26U 1I85C 2KZWA 1MFEH 3FHEA 3L5XL 1H5BC 3W81A 3UYRL 2I07B 5TJWK 3QEUB 4N0FB 1LK2A 2F08A 8PAZA 4XPFL 2DI8A 1NGPH 4OH2A 3QPQD 5BMFH 1YPZF 4J3XA 4GXUM 3QUGA 3ARDB 2VDRL 4F2MB 2E86A 3ETTA 4N8VB 4RIRB 3K80A 4WHTB 4WLCA 4ZOBA 4AK1A 3DBXA 3WKML 3GINA 2ZP9A 4LHUG 4YHLH 3VO0A 3CZLA 3AUVA 3R8QA 3ES6B 1ZLSH 1PZ5B 5K59E 4Z7NB 2ED8A 2P52A 5DA0B 3DHUA 5HY9A 3W2DH 5AG9A 1YEHL 3C5ZD 2CLVB 1GZPB 4IRSD 4PRNA 4XCCH 3V0AC 3GSWB 1JNLL 3VQMA 3NJFA 2GJRA 2GSIB 4ELMA 1YYLL 2MKLC 5ICUA 1A14H 3OQRA 2AQ1A 3AREA 4LSVL 1E40A 3QS3A 2GJJA 2FYYA 3DGGB 4WO4B 4FXKA 5D1QE 3VRJB 4LHUB 5FYKD 2CQVA 2P45B 3DX3A 3TT1L 3MLZH 2A9BA 5JW4M 1OARL 5BQ7B 4L3AA 2BIOA 1A6PA 1TJIH 1P4LA 4HJGA 4LCWB 3MRLB 1R33A 2A4ZA 3F7YB 1JV2B 3HS0B 3S4SG 1PYWB 5JIMA 2YSSA 3KPLB 4A7VA 1IGMH 2VL5A 4ORGA 2DRUA 1R3JA 4MMYA 4TM9A 1XGPA 4K3EH 2NNAA 2X87A 3L2NA 4MVBD 1JFQL 3DURB 4A37A 3IFNH 3FCBA 2HRPL 4I9WE 1SM3L 2DKMA 5LB1A 5ICXB 3ULAB 2A83B 1VACB 1L6XA 5EU6E 5HYJD 4FTVA 1YEIH 5EZOL 3M8OL 3S4SB 2ORBH 2RCSL 3HBZA 3FQRB 2C3WA 1UUSA 2O30A 2R9HD 5AVXB 1MXDA 1MEXL 5DWPA 4UNUA 5JIDA 4QHKI 1UXSA 1MLCB 3CHOA 4AOFA 1BXAA 3N85L 1H15B 1XIWD 3FZUD 3O3BA 2E47A 4WEMB 1JN6A 3NRPA 4FERA 5ISZA 3ULVL 5F7HA 2CGZA 3GMOA 4FLHA 4P9ML 5FYKH 4MJ6A 3TA3B 3IPEA 4FI7A 1ROWA 3ESOA 4BCXA 1KGCD 3GJEA 1N18A 1QSFD 1Q0YH 1GSMA 5D1QC 2GB2A 4PJGF 1JDAA 2A9MH 4OFQA 4G7QB 3ZKXC 3ROLA 3V6ZB 2EYSA 3QA3B 3QI9D 5JPMB 2NY5H 4A2FA 5KEZA 2Y6SD 2YAEA 2MOQA 1PCSA 3VFGL 4V1DD 3WEBA 2AK4D 3DX6A 3UO1H 1A6AA 2WKGA 3QZNA 1SN2A 2VAJA 1BIIB 4AL8C 1PZUB 4C54A 1U8CB 1IT9L 1GGBL 1NBVH 4P3WA 1IBYA 2F53D 4XP1H 1CYXA 1FIGL 4Y9FA 4K07A 1KG0B 3EGSB 4NGHL 4AQZA 3QQ9D 3B2VH 2B77A 3MRIB 3VCLB 2VH5H 1BZ8A 3S88L 2Z7WA 3LKPB 3GXNA 2DQEH 4M48L 5AAMC 4ZD3L 3NJJA 4NQEE 2H3NB 4W9CC 2IV9A 4P23D 4ZUUA 3UAAA 3MUUA 4YHKL 5L2JB 3C9NA 1Z3GL 3W9DA 4AVHA 2XY1A 2JJSA 2EVIA 5E2TH 1DEEA 2DH3A 4KK8D 4ZUVA 5GSVA 4P0DA 3UEZA 3OKEB 4FQHB 5BVPL 4BQ8A 4RNRA 3ZDZE 4XB8A 5KS9A 1A64A 3MJ6A 1IV8A 1SEBA 5IVXB 2HLFD 2YD0A 3MGAA 5IK3A 1SLXA 3FB6A 2AKRB 5F6IB 4E9VA 5IB3B 2FECI 3IKCA 3RILA 1CPUA 1DQJB 3M88A 3L3DA 2V8MA 3BZEB 3EDJA 1WCBA 3QCTL 1J8SA 4BQ9A 1IGYB 1JTOA 2J6EL 2WLMA 3D3VB 1UCBH 2GHWB 2P5WA 4QHLA 3VVWA 1PU0A 3OLGA 4B60A 3L3JB 5CWSA 1WAAF 2H3KA 1KACB 2V5RA 1HS6A 5B22A 1EUTA 4NOFA 1ZPUA 4MMXA 1V7NH 5BO1L 4OCRL 1LD9B 2DQJH 4JBSA 4J3VA 1FG2B 5GRXG 4ACPA 4S1QL 1TLMA 2HWZH 2HKHH 4Q9CA 2ADIB 4LCUB 3LKRA 1J18A 1UD4A 2Y7NA 3T2LA 1BHGA 2WZ6A 4LEBA 1Q72H 3GI9H 5KJRH 3UBFA 5EORL 1TQSA 2BVOA 3ARBC 4PR5B 1NUFA 3KJ6H 4QXGL 1X5HA 1LWJA 1EEQA 5IVZB 2EJ1A 2M83A 2B9BA 4RA3A 4F3FB 4N9GB 1YPZA 3CBRA 4WENB 5IB1A 2VDKH 3I9IA 1R3KB 5BRQA 1LHZA 3GXFA 4QRRB 2FSEA 1NPNA 2YGOA 1S9WB 3E3QE 3QEHB 2ISDA 1SJXA 1Y0LA 4WU5B 5F3HA 3FCSB 3BAXA 4FFZL 2W80C 1ZLVK 4KUCD 4BFKA 2DLFL 1U8JA 1SJHA 3FK3A 4UM9A 4A2MA 2BMKA 2EDHA 2BCKB 2DQUL 4TOYL 4AIEA 4GKNB 3QHZL 3S6CA 2R1YB 3QH3B 3KWTA 1BAFL 2P3YA 4X4ZA 4RFNB 2XZAL 3ARRA 3AXIA 4S1RH 1MZYA 3ILEA 1ZJAA 2GAZB 2R2BA 3NFNA 3VWJD 4U05A 3CVHA 4FHKA 3BFOA 4QRTA 1SOKA 4H8PA 5ABZA 4N68A 4YNYB 3WENA 3DLQR 4G6ML 1MUJB 4KXDA 4XTRD 4KTDH 1SXBA 4TNWF 4IHOA 3V0VA 3MPCA 1IU1A 2QADB 3GPSA 1XGQB 1P6FA 3GS0A 5EZJA 4FG6C 4I4WB 4IGBA 1JYNA 4HETA 1HXKA 2G60H 5KYXB 4LU5H 1JHKL 1F45A 3SO3B 2RFXA 5I8EB 3V0FA 1AMYA 4X9FA 3WFBL 4UDTA 2NX5A 5I28A 1NM4A 5J1TC 3FB8B 4KVPA 4F5CA 3ZE2E 1ADWA 2BRQA 3BX7C 4HYTB 3WXWL 1GL4B 4KITB 3LPFA 3OQ3B 1AR2A 3C5JB 4JZOA 1DJIA 1TQWA 4F1SA 2IANA 4X9YA 4TQ8A 3EJYC 3MO1A 4LIQE 4NNXB 2AK1H 4QGTA 3QORB 1QI3A 4AJVA 2HVKA 5C6PB 4HZLA 1UH4A 2WTOA 3E3QC 5FWQA 5GRVL 1Z6JT 5GISL 4WNSA 1F8TH 5SWZA 3DYPA 5KYYA 4KY2A 3N43B 3FHQA 3R0MA 3OF6A 5CSBA 4QAMB 1HI6B 1RJZB 2YK1L 3I6SA 4APQC 4EXPX 1KIQB 5FOBA 3FUIA 4FQIH 1M56B 5EF3A 1KV7A 4NQCE 3ZHFA 3TESA 3VD1A 4KNUA 4GRLC 4MA1B 4LARH 1HILB 1KGWA 1AGCA 1DBML 1BYPA 4FQ1H 3UTTD 3VXUA 1LEKA 3A22A 3BT2H 3EHBB 4JREB 4NNYB 1I7ZA 1HEZA 1XXDC 1PD6A 3N2JA 1EWHA 3SDXE 3HS8A 4MJIE 2BLFA 5DQDL 3LPOA 3FT3B 1CFQA 1E4WL 1OT4A 2VMFA 4PJGA 3V5KB 4Z7WE 3IFLH 2WQ8A 4UZUA 2EH7L 2Y06L 4UTCA 2K3HA 4KROC 5DS2A 2UXTA 4KVNH 4NUJB 4GUOA 1IKNC 1JK9A 4PRBA 1J5CA 3KPSD 1FORL 1TPXB 1GOGA 2YA1A 4X0KB 4CW1B 3UTZA 3KDMA 2EDFA 3CDZA 4MJ2A 3ISYA 5IMMB 4X7TA 1I9JL 2X38A 3TVMD 3QFJA 2G9HA 2F18A 3QZOA 2CHZA 4GW5A 4Z7VF 3GTTA 1MG2C 2AJXH 3A6OA 5FLVA 1CFNB 3UPAA 4NNPH 1JI2A 1HHGB 1AZRA 5I74C 2D7TH 4AH2B 4URKA 2JSFA 4DEWA 4Z6AT 2FATL 1FH5L 3FT1A 5MP6L 1KT2A 4Q6IC 1HXMA 2MKWA 4O2CB 3DVGA 3OZ9H 3GUTB 4M5YH 5F0PB 4BWTA 4GUQA 4W68A 4IRJB 3BSZA 2GUOA 1HZLA 5DC0A 3GTNA 3U0WL 1PMYA 4ZPVB 3HNTL 2VLLB 1T1ZB 2P8MB 1TO5A 4M3HA 2AXHA 1G1CA 3FO2A 4OZGB 3V52H 4NM8H 1A6VH 1OK8A 2YWZA 2EEDA 2FWLB 4MNGA 5H37A 1S5HA 1WBZA 2BHUA 2X4TA 1PVHA 1RK1B 4PRAB 3TBSB 2OMNA 2ADFL 3TV8A 3QJZA 2IOIA 2IQAA 3BI9X 1IKFH 1O7SA 2PWDA 2OULB 3GMMB 1KENL 2E7BA 4HJ0D 4L4VD 5JIKA 1BA9A 2XG4A 1SYSA 1DCEA 4LL1A 3UBHA 1KC5L 2B8OT 1SXCA 3VFUB 3HG5A 5DJAB 3CDGB 3NFSH 4HH9B 4JFYB 3REVA 2F8XC 1GVIA 2HLAB 1E4XH 1WAAA 1G0YR 1SLWA 3IDXH 1J1OL 2XFXB 3GRBA 3ZKQD 4NAQA 4NO5B 2C9AA 4HAGA 2VLKD 4K3GA 3ETSA 4XXCA 5CBAA 5GHWH 3C5ZB 1K4CB 2A6KB 5IMKA 3SHSA 2N0KA 4IRSB 1DHKA 2AJYL 3KPQA 3LQAL 1H3TA 1AZBA 1MCSA 4WEEA 4RESB 3GMPB 4JFPB 3ZE0B 1OP3H 5I8CB 5AKTA 4LVNB 1T1XA 3EO9H 3L4CA 1WK0A 4G6AC 4N4YB 3KNBA 2XWTB 2O6PA 3AQYA 4GEIA 4M6OH 4L8DA 4R4FL 2F7PA 1BX2A 3H2QA 1BG1A 2X9ZA 2WN2A 1GS8A 3I2CH 1IFHL 5IY5B 5CSGA 3H3BC 4PWJA 1SQMA 1S7XA 4W9KC 1HHJA 5IREA 1R24B 3LQZA 4FTVD 4H8UA 2Q3XA 2EDJA 4A7QA 2IG2L 3QEQE 3L3IB 1UCTA 3VDCA 2HX7A 3MRCA 3MLUL 4H8WC 5FO9A 5MI0C 3B56A 4LP5A 1PKQB 2X28A 3LIZH 4FLSA 5ISZD 4BZ1A 2YOAA 3OGCA 3GRWA 3DHPA 1J0JA 5E9DD 1SVCP 3AQZA 2Q76B 1CQYA 1ZLWK 2KERA 1D6VL 1JUFA 5FECB 3ME0B 5HYJB 1SBSL 2B7DT 2Y6TE 4K8RD 3TN0D 1NH6A 5BZWB 4B0MM 5HYQB 5EUOB 1IEHA 1RUML 1T3FB 1P7BA 4LSDA 2EXSA 2XRAL 4PRPE 5C08E 1XIWB 3Q8FA 1WFMA 5F1KC 1MCRA 3PLYA 2K9UA 1CLCA 3MUGB 2PCPA 3JWOH 4K5LA 2BP5M 2E76C 1LMKA 1XD1A 3X14B 4DKEH 3HE6A 4QKXB 4ANVA 2CO7B 1ASQA 2XZCL 1J0HA 5DR5L 1QSFB 4JS7A 5AW2B 4FQLL 5IT2L 1FZKB 3DIFA 2OJEA 3VFSB 4XMKL 4HHWA 3FJTA 5ESQA 5AW0B 3L9BA 2AQ2A 4P2RD 2GC7C 2AV1A 3QI9B 3ARGA 4Y8DC 2F8VA 2O5ZL 5BUGA 4L8SA 2VUKA 4Q58C 5IFHH 2V9UA 4V1DB 1DANT 2AK4B 1VPOL 2X1WL 4IDLA 4U3XA 4XVUC 3OG4B 5KVDL 3GI8H 4P9HH 1F4XH 5MEPB 4M1GL 3NPZB 2ZKWA 2BPBA 1CL7I 3F84A 2GPZA 1RZJC 2E7HA 4PYGA 4Z18A 4AV5A 3Q6FB 2NY6D 2V33A 4WEUD 5IBTH 4K8RH 1THCA 3EH4B 1B88A 3SYAA 1JS4A 2VW7A 3EZJB 3VE0B 43C9A 3PE9A 4G8EB 4K4KA 3FFDA 5CSZB 1NMCB 3QT2A 2NNCA 3AABA 5E8PA 4RCAA 3RJQB 1ZHKB 1EDQA 1JPEA 1TSRA 4P23B 4M61A 4KY1H 2G2NA 4LPUA 3NGBB 4RRPM 3N44F 3KBEA 4ZZKA 3IDUA 1NAMA 1WH0A 2ZUUA 5IMLA 3N0PB 3KYOA 2JCWA 1DVFD 4JZNB 2P5WD 4N8UA 2VDKB 4CC0A 4JM2D 1UXWA 4PWKA 4DHLA 2K4WA 3QCVH 2X42A 1T7XA 5AB0A 4LB8A 1ZY9A 3FTGA 3SQBA 4F7MB 1TTAA 5T1DH 4Z7VA 1KY7A 3I3EA 3VXSE 4X7FC 1M2OA 3ZKND 4P2OD 1RLWA 3BPCA 3CH8A 1WBYA 5ITFA 1M4KA 2LU3A 1RZIA 4W9JC 4OIBA 5C07E 2XWDA 1UKTA 3GGWA 5F44A 3FQTA 1UZ6E 3SGEI 2KZ1B 5E8OB 3ZZLA 1A1OA 2DB8A 4YSRA 4DGWC 3J8F7 2JKLA 3WS6C 3HC4L 3BXNA 3SCMC 5AYTA 4N2IA 3UTSA 2WGXA 3B83A 4ABQA 3JXAA 5PAZA 1TU2A 1OQXA 4GQ9L 4RAVB 3CHRA 5F7AA 5AB1A 4BSWB 1FVEA 5EH1A 4DZBA 5DEFB 3RQ3A 1UASA 2ZCLH 1P5UA 5F6HI 3CLEH 4K5NA 3CZEA 1P4IH 3T1FA 2NCEA 4PJ7F 5SWSA 1ZV9A 5B1AB 2MPAH 1ZSDB 3MJ7A 4JY5H 1F56A 1UEMA 3AGWA 4JHWH 4JKKA 3LJ3A 5EF2A 2B59B 1HSBB 2WYTA 5C0IB 3KPRE 3K8LA 3DJTA 4HWZB 2X2IA 4YH6A 3B8YA 4FCAA 3DX7A 2I32A 1I3GL 5JOFA 4UM8B 4ZUWA 3WUWG 2WIIA 4ZRGA 2WWKT 4LLDA 5EU5A 5B39G 3QWNA 5FYKU 3QDAA 4F9PA 4OTXL 5EUKB 1SYVB 3OX8A 1NGZA 1V3LA 2VMJA 3VW3L 3GKWL 2FR4B 3MV11 3O6ML 4MAUL 4ZFQA 3R7RA 1XGYH 2XN2A 3VWJB 2K7QA 2VOTA 4MX7A 4AV4A 4HAFA 2VC2L 2NX5D 4GBXC 5GS0C 1JERA 2W07A 3TGXA 2QKSA 3MV9A 3K71A 2GEEA 1Q1PA 4QHMB 4MJ5A 4P4RB 3VH8G 2OXGA 5GGSB 1QHOA 1KLGB 5DD3L 3MRGB 2XV0A 4EI6A 4U33A 4PJIF 4NXKA 3PXJA 1CURA 3TURA 1PNCA 4U6TA 1ZXQA 1AI1H 2BWQA 2EIDA 4KNTA 1U9KA 2ZG3A 1VESA 3T0EA 4OGAD 1OGAA 2FL5A 3RRQA 4ANKA 3B2PA 2GEQA 4HWBL 3B6SB 1UB6B 5IIEB 4L3EA 3GSXB 1D5BA 4R2GD 3ARFA 4TPRH 2CIIB 3E0GA 4GSDH 2WBWB 4ODWA 1J0YA 3RZCD 5DD1H 2AAVA 4GT7A 4JHBA 4YLBA 3GHBH 4HWEH 2EABA 4JQXC 5CILL 4G1MB 4HS6A 4KVCL 4Z7UB 3NBNA 1CE1H 2HUHA 2W91A 5I8KH 1KV3A 2ERJB 1UQSB 3UAEA 3PWPA 4JPKH 1B0GA 1BZ7B 1TZHA 5DVMA 1SXNA 4NC1E 4A04A 1UWFA 1JPGB 2OTWA 1UVQA 3DK2A 2ZXGA 4IYKA 1ND0A 3UTTB 3Q2NA 1Z9LA 4HJIA 5GGVY 4YLCA 2LLNA 4LLWB 1FF5A 3D85A 1WHPA 4NC0B 2H26A 2ROXA 4PCTA 2X4UA 1C16A 3CZJA 1AS7A 1IC4H 3IMTA 3QFJD 3RKPA 4DP6X 3TASA 4JRXD 5DJ6A 2EECA 2VXVH 4FZEL 1R5IA 3N1QC 4S1DC 2ITDB 2MTPA 3K6NA 4Y4HD 4W9DC 2F6AA 4Z0BH 3WD5L 3PL6B 4P5SA 1G7IB 5DHEA 3DHMA 5DU7A 3KYNA 1MHCB 2BVYA 2GCYA 3KPSB 3STLB 5IV2B 1MRDL 3HCVA 5JXEC 4H20L 3H9SE 2JQMA 2VKXA 5CP7B 5BRZA 2Q9OA 2Y2WA 3TVMB 3SE9L 5AVRB 1HDMA 3FQXA 3G6AA 3QJOA 4N2OA 4S2SB 3CBJB 3WFHB 3C6LD 4BK5A 3FL7A 4NC2B 1UOKA 2R27A 1MXGA 5D2NB 3NEOA 2HP4A 2HJLB 1JZGA 2HFEA 1WT5C 4XNMA 4POZC 5M7QA 4ALAH 2GTZB 1YEJH 2DTML 4JO4H 1UATA 3D0VB