1V10A

Structure of rigidoporus lignosus laccase from hemihedrally twinned crystals
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
494
structure length
487
Chain Sequence
ATVALDLHILNANLDPDGTGARSAVTAEGTTIAPLITGNIDDRFQINVIDQLTDANMRRATSIHWHGFFQAGTTEMDGPAFVNQCPIIPNESFVYDFVVPGQAGTYWYHSHLSTQYCDGLRGAFVVYDPNDPHLSLYDVDDASTVITIADWYHSLSTKAPPAPDTTLINGLGRNSANPSAGQLAVVSVQSGKRYRFRIVSTSCFPNYAFSIDGHRMTVIEVDGVSHQPLTVDSLTIFAGQRYSVVVEANQAVGNYWIRANPSNGRNGFTGGINSAIFRYQGAAVAEPTTSQNSGTALNEANLIPLINPGAPGNPVPGGADINLNLRIGRNATTADFTINGAPFIPPTVPVLLQILSGVTNPNDLLPGGAVISLPANQVIEISIPGGGNHPFHLHGHNFDVVRTPGSSVYNYVNPVRRDVVSIGGGGDNVTFRFVTDNPGPWFLHCHIDWHLEAGLAVVFAEDIPNIPIANAISPAWDDLCPKYNANN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LACCASE
publication title The Structure of Rigidoporus Lignosus Laccase Containing a Full Complement of Copper Ions, Reveals an Asymmetrical Arrangement for the T3 Copper Pair
pubmed doi rcsb
molecule tags Oxidase
total genus 130
structure length 487
sequence length 494
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2004-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v10A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v10A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v10A03
2J57A 2MRYA 4F7KA 2LLNA 2W88A 1OOWA 4YSQA 2WO2B 1RCYA 2PLTA 8PAZA 2BW5A 2TSBA 3IBOA 3NJJA 1PZBA 2IDUA 4BDVB 3ASNB 5B1JA 3H4HA 2VN3A 2ZXWB 1AZNA 4HALA 5PCYA 4X4KA 1OCOB 5E9NA 1SDDA 1GR7A 1JZHA 2BWDA 4GYBA 1BXUA 1J5DA 4JHUA 1PZAA 5F7AA 2PP9A 4YSAA 1E5ZA 2UXGA 2FT8A 4QKTA 4YL4A 3FQYA 5D4HA 2EIJB 3FPYA 4A2DA 1JVOA 1SHXA 4DP5X 1NTDA 1IC0A 1SDDB 1ET8A 1AAJA 1NIFA 4L0PB 2YAFA 2QT6A 3JT2A 3KW8A 2PPEA 4G72B 1AG6A 2B3IA 1SFHA 2CAKA 4A67A 4YSUA 1GS8A 2VW4A 4YVNA 1JZJA 3FSZA 4N8UA 2YAMA 2Y1AA 4YSOA 2PCFA 1QNIA 1BXAA 1OCCB 3FSWA 4M3HA 4PAZA 1L9RA 3GXUB 5LDUA 2HX8A 1OE2A 3QJTB 3WG7B 2QDWA 2WO3B 4DPCX 1RZPA 2BP8A 1CYWA 1M57B 2PPDA 1NIAA 3WI9A 3PAZA 3WIAA 1ZIBA 2GI0A 4YSSA 5EHFA 4PCYA 1A3ZA 1IBYA 1M9WA 4CSZA 3FU7A 3EHBB 2IDFA 4E9RA 2DV6A 1W6LA 1EHKB 3WKPA 4BK5C 2W8CA 3X1NA 3CDZB 2GHZA 3UAAA 1WS8A 2CUAA 2FQFA 1V54B 3GYRA 2BWIA 5I6PA 1JOIA 3WNJA 3FU7B 7PAZA 2BHFA 4AI7A 2WSDA 5B1JC 3QJQB 3AG1B 1B3IA 4G70B 4HAKA 2OJ1A 3V9EA 1N68A 3NJGA 2UX6A 5D4JA 4YSDA 5B3SB 2PCYA 2XX0A 1A65A 2VM4A 4G71B 4UF7C 1ADWA 1TU2A 3OD3A 4HZ1A 2HX7A 2UXVA 4A2HA 5I5IA 2JKWA 4GY4A 4M4RB 4KNSA 1AR1B 3EF4A 1E30A 1BEXA 1TKWA 2QPEB 3UACA 1J9SA 4KO5A 3JTBA 4YSPA 3EH3B 1GYCA 4WTQA 1BQKA 2FT7A 3X1GA 1BQRA 2DYSB 2Q5BA 5IY5B 1PLCA 3AY2A 4N4YB 2DWSA 4KOCA 9PCYA 2X87A 3IN2A 2EINB 1WS7A 1MZYA 2P80D 4BDVA 3AG2B 3OQRA 1HAWA 1RZQA 2XYBA 1FA4A 2XVBA 3FQ2A 5I5JA 1AZBA 3PAUA 4DP2X 1SJMA 2YAOA 3X1BA 1JVLA 3OMAB 1L9TA 2BP0B 2XU9A 1W6WA 1GY2A 2GC7C 1BYPA 2VM3A 1R1CA 2VW7A 1OE1A 1BXVA 1CYXA 2YXVA 3FYEB 3MBWB 4BWUA 1SHWA 1XB3A 1BAWA 2HRHA 2BZCA 5TK2A 1ZIAA 3ZX1A 3L45A 5B1BB 1J5CA 1ET5A 1JZIA 3TBBA 1IUZA 4GP5B 3FSVA 2YARA 3AW5A 4Q89A 4JKNA 1KBVA 1GS6X 4E9XA 1OE3A 1SF3A 3T6VA 3FU9A 3H4FA 3QPKA 4YSCA 1ZDSA 2UXFA 3OMNB 1JXGA 3QQXA 4UAHA 3X1FA 1BYOA 2IWFA 1NPJA 1PCSA 1HFUA 4A68A 1MG2C 4Q8BA 1NDTA 3G5WA 2XUWA 1ILSA 1HAUA 1ZPUA 3UADA 1NPNA 1IKOP 2FQDA 3BVDB 3EH5B 1WAEA 4AKPA 3DIVA 4YVUA 4DP7X 4DP1X 4KOBA 4A66A 1NZRA 1ZV2A 3ABGA 3T6WA 4KO7A 2R7EB 1AG0A 7PCYA 3UABA 2EIMB 1OCZB 1BQ5A 3DTUB 4DP4X 2GIMA 2FQGA 2ZOOA 2AFNA 1AS6A 1JXDA 1I53A 1KBWA 2VW6A 2AZUA 3CDZA 1OF0A 3PXLA 5B7MA 2IWKA 1NIEA 4NAJA 1KV7A 4EF3A 5ANHA 2H47C 5A7EA 2H3XC 2CBPA 1A4AA 1A8ZA 4MFHA 2A3TA 5I26A 1J9TA 1AS8A 4K9JA 4E9YA 2GBAA 3WKQA 1NINA 4GP4B 3AZUA 3KW7A 2IWEA 3U25A 2P80A 3UAEA 2PP8A 4KNUA 3HEIB 2FWLB 3NSYA 3EH4B 2IDSA 1W8EA 4FAAB 2HXAA 3FPXA 2PPCA 2YAHA 2FQEA 2JXMA 2EIKB 1MDAA 3TASA 1L9OA 1E5YA 3IN0A 4G7SB 1MZZA 1PF3A 4DPAX 2IH8A 5AZUA 1GW0A 3CVDA 2AANA 5I28A 4HCFA 1GSKA 1URIA 3IE9A 3SQRA 3NJHA 5B1AB 4AX3A 1AZCA 2X88A 4JHVA 4ZK8A 3H56A 1DZ0A 3SBQA 1AS7A 1L9QA 3PPSA 3HB3B 2XV3A 4RH4A 2YQBA 1SFDA 2BZ7A 1OCRB 1T5KA 3NYKA 4AKOA 5I5MA 5PAZA 2BP0A 3NJFA 1PZCA 2IAAC 2CALA 1QHQA 1RKRA 5I6LA 3OMIB 3ZDWA 1SF5A 1PNCA 2XX1A 3D12B 3T6XA 1CURA 2XLLA 2BW4A 3SBPA 1J9QA 1TEGA 3NT0A 2HLEB 1PNDA 4KO6A 1A4CA 1JERA 2PPFA 1XB6A 3DKHA 1PLBA 4ENZA 2J5WA 1EZLA 2JFCA 2YAEA 3NSDA 2E86A 2PP7A 3X1EA 4A2FA 1XMEB 1NWPA 4P5RA 3CG8A 3ABLB 2FNWA 3UGEA 3ABKB 2Q9OA 5B7FA 2RACA 1PAZA 2OCCB 4YSEA 1ASPA 3RYMA 3T6ZA 1JZGA 2ZONA 3ASOB 4NB7A 3IEAA 5TK4A 4HHWA 2CJ3A 2I7SA 3N55A 4F2EA 3FYIB 1KGYE 3NJMA 1PY0A 1YLBB 3QJSB 4W1TA 6PCYA 3S8GB 2XXGA 1PLAA 2VMJA 3NP3A 4G7RB 2R7EA 3NJLA 3X2QB 2XWZA 1MG3C 4FA7B 2QPDB 6PAZA 4TXVB 1AZRA 4YSRA 4CSPA 4DP0X 2B08A 1AANA 2VSMB 2XV0A 1X9UA 1DYZA 2J56A 1KDIA 3PCYA 2HX9A 2ZWNA 1CUOA 3MX0B 4HIPA 3FSAA 2YAQA 2GB2A 2I85A 3QJVB 3FS9A 2OV0A 4DP8X 3NJNA 1NWOA 4QLWA 2DYRB 5B7EA 4YSTA 5AFAA 4HHGA 2HZHA 4BWTA 1JZFA 3V9CA 1TEFA 3NJIA 2IDQA 2DWTA 5F7BA 1WA1X 2Y69B 1SNRA 4G7QB 1AZUA 4GP8B 4DP9X 3N2JA 4AKQA 1UATA 2CCWA 3NSCA 1ASOA 3S3BB 4BWWA 5I6NA 3ERXA 2TSAA 3GDCA 3QJRB 1JZEA 3QJUB 1ZDQA 1KYAA 4E9WA 1V10A 1A4BA 3FT0A 4HCGA 1F56A 3ZIYA 4AZUA 3T71A 4A2EA 2J55A 3FQ1A 1KCBA 5AKRA 1M56B 4BXVA 3CVBA 1AIZA 2AZAA 1FFTB 2VSKB 3BQVA 3CZUB 3ABMB 3NJKA 3AG4B 1QLEB 3AG3B 3S3CB 1ASQA 4HCIA 1J9RA 2UXTA 4E9SA 3CVCA 4DPBX 5I6MA 4E9QA 1PMYA 3FU8A 3T9WA 1N70A 2BP8B 5FC9A 2PPAA 2I7OA 3TU6A 4NERA 2MTAA 3TBCA 3WNIA 1ILUA 3SBRA 2QDVA 3PAVA 1AOZA 1GY1A 1E67A 3PLYA 2H5UA 1E65A 4P5SA 3C75A 1CC3A 1L9SA 1L9PA 4KNTA 1AQ8A 2FJSA 4WKXA 2UX7A 5I6OA 2NRDA 2FTAA 5B1KA 2XXFA 4W9ZA 4E9VA 3ZBMA 1X9RA 2IH9A 1ID2A 1GS7A 4KO9A 2DY2A 4UANA 2BO0A 1IBZA 4A2GA 1WA0X 2N0MA 1AACA 2EILB 1FWXA 2YXWA 4BXSV 1OV8A 4DP6X 2XV2A 1WA2X 1JXFA 2GSMB 1ET7A 3NSFA 4E9TA 2GC4C 1NIDA 1ETJA 3TA4D 1KCWA 4F2FA 3S8FB 5D4IA 5I6KA 2HRGA 1VLXA 2YAPA 1XB8A 4GXFA 2FT6A 1NIBA 1NICA 3NP4A 1V55B 3S3DB 2AVFA 2IDTA 1KDJA 3OM3B
chains in the Genus database with same CATH superfamily
4LEOB 1JZ4A 3CH1B 2B20A 4JR9L 4O02A 1BLIA 1QSVA 4YSQA 3E6FB 4NN5C 3A6BL 1JF1A 2SEBB 2XICA 2DDQH 3LEVL 5IKCA 4APXA 1CR9H 1U4EA 1XVSA 4XN5A 3L5JA 3DSNA 3KDMB 2H45A 4NQDA 3DGGA 2EE9A 4IOFC 3A4AA 4HALA 4U1JB 5EOQL 2X4RB 4B7IA 4GMTL 3QCVL 3I6GB 5FYJH 1NOFA 4PS4L 5IMOB 3KLLA 3NRFA 2BWDA 4RWYH 4FOMA 2VXVL 4GYBA 5I9QB 1CJYA 2V2WA 1AGBA 3LIZL 4KDTC 4G83A 2YD0A 2QGEA 4X5WA 4NKMB 2JKLA 4CVXA 4HUMB 5D4HA 1O75A 3P4MB 1M71B 1IM9A 3N91A 1TQBC 3TT1H 4MJIA 4N2OA 1SQ2N 5FPIA 2OR9L 2CDGA 3FUNA 1WV7T 3GJEA 5C6TL 3QISA 2HFEB 4D9LL 4E42B 3VI3A 4F5CE 3D25A 1TLKA 5E2TL 2FGZA 5HHVL 3ALWA 5CN3A 3T0DA 3V4VL 1MW3A 5CSZA 3FRPB 1U2HA 4N8UA 3V10A 3MRLB 4CMHB 1LJMA 2Q8AH 4KX7A 3FQTA 1QNIA 2IOIA 5D1XB 2O61A 1WHPA 5F1SA 5F1IA 1BOGB 3VFTB 1RSYA 5L2KE 3L1OL 3FBKA 1QVOA 1XGRA 2QDWA 3BZEA 1FNAA 2GTZB 1CYWA 1ZXQA 1BZEA 2WK2A 2XPYA 5CR8A 3WO4C 1ZSDA 1PD1A 3HI5H 3SCMB 4BSVA 4KI5D 3ESOA 3KLAB 3L3OA 4N2LA 2H8PA 2YD3A 3W2DH 4F37F 1HSBA 4KROD 1UD3A 1E2WA 1PDKA 3IS1X 2YSSB 1UA6H 3EBIA 4Y16B 4JN2B 3L1GA 4OJAA 4XPFL 1MI5D 3QEGL 4NRZB 4WU5A 3QFJD 4X4MA 3M8OH 1OPOA 4OJDH 1G7LB 3FO2B 5ISZE 3ETBJ 1YAIA 2MKWA 1AD9B 3C08L 4KC3B 4NQEA 4PJBA 2VDRL 3ESMA 3MI6A 3QIBA 2VUKA 4YBLC 5JOEA 5KJ7E 3HAEB 3NFPB 4K7FB 3TBSA 5K9OA 1U91B 3REWB 4WEEA 1C16B 1ZT7B 3HPJB 1MWOA 3DROB 3G04B 5INCA 4JY6B 4PW4A 2DQJL 3HZVB 3Q8FA 5GS0L 1GMEA 5I1AB 1CXEA 2BSRA 1DE4B 5DHMC 2FSEA 1M6UA 4M62L 4Y4HD 2WWKO 5CJXC 5AW9B 4B9IA 5HY9B 4AIEA 1SDAB 3UZQB 2EIZB 1M2VB 2BIIA 3T2NH 1KXTB 5MHSD 4LCIH 3ULVD 4AEHH 5D7IF 5DD6A 5DZJA 2PW2A 4G6AD 2E7MA 2GSGA 4XCNA 5TE6L 4V2CB 2XC8A 3FUDA 3TEXA 4Z7QB 5IBUB 1BG9A 3QEQE 1DQDH 2EE3A 5LBGA 4PRDB 5KJ4A 1YY9D 3F7KA 4DP2X 1SXNA 1SJMA 4HD5A 4YDKH 1ZKAA 2XU9A 3UYRH 4Y9FA 4TM9A 3VFGL 4MXWH 1GXEA 3HRZB 1WBXB 3D3VB 4A04A 3WV0A 4HEMA 3FYEB 2N56A 3US0A 3NCYS 1TFHA 1P5VB 4QRQA 5IB3B 1B9ZA 1XGYL 5EU5A 2HWZL 5AW6B 1M7DB 5E6ID 5IOKA 3A67H 2QQNL 1RZJC 3LJ3A 2WV3A 2Y1VA 1DBBL 1JMZA 1DJXA 4LAQH 1DANU 2RH0A 4EDXB 3REVB 3FQRB 4YPJA 3DDFA 2EECA 4Z7VE 1DJIA 3CZFB 2FIKA 4NC2B 3FU9A 3BGMA 1MI5A 1NGPL 4NQCE 3QNYA 4AIOA 2G75B 3DJSA 3EJQA 3K4DA 3QFJA 1EDQA 5CBAB 5BZXA 1LO4H 2IWFA 3FN3A 4NOBA 2APWA 1LO0H 3FRUB 1KACB 5F0PB 3MAWA 4LBEA 4BZ2L 3RA7L 2OMVB 5EWIH 2R2HB 1CIUA 1O6SA 1TVHB 4BZ1H 3ARFD 1J8KA 1NPNA 5BW7A 4KZDL 2W0KA 5DMYA 3LD8B 1JGLH 1SLXA 2LTQB 4XWOD 4G9FB 3O9WB 5EC2B 3T6WA 1HTYA 4W68A 3G6JA 3R06A 1JDAA 1LO5B 3B37A 1A9VA 5GRVL 1QABA 4U6HA 4LP8A 5ICXB 1MAKA 1ORSB 4Y4HA 6TAAA 1I3GH 3AMLA 2P3YA 4QRRE 1RXLA 2YGOA 4EJ1C 5KVFE 2H0JA 2PABA 5KSUB 1CGTA 1YEHL 2CJSA 1QNZH 1JN6B 3H9YA 3ULUF 3EUUA 2MH4A 3U30C 3GGWA 5LVEA 2ZAGA 5JOFB 5K5YA 3WXVH 3BIKA 3MXVL 4MZ2A 1F02I 3CLFH 3HS0A 2V7HA 4PTUA 5HYEA 1WZMA 1JTOA 4QXUH 1S7WA 1T1YB 3QDJB 5MEOB 4U6XB 2APVA 3UBXG 4K2UH 4UBDC 1QBLL 1J5OL 4XHJC 3KJ6H 4NFDA 3B6SB 4JPWL 3GD1C 3UMTA 3P30L 4WHDA 4F3FA 5MEND 1YYLH 4HCRL 5IROD 1J9CT 4LNRB 4X98A 1NOLA 1TTRA 1EVUA 2COQA 1HEHC 5F1NA 3ROLB 4QKXB 5F96H 1I9JH 3OKMA 5E1GA 5FO2A 1TCMA 4X6EB 1NAMB 5I1KH 1U8QB 4M3JA 4NUQA 1EGJA 5E6IA 2B77A 4JHBA 1VEMA 3MODL 1R6VA 4JO1H 4YPGB 4PJ5B 2X12A 3K1KC 3TCLB 4Z3HA 4MB5A 1IC4L 3MA7A 4NAMA 2VR5A 1L9QA 3KPLB 3AGWA 2QZ5A 2J1KA 3L1EA 4XMZA 3GZOA 4AKOA 5I5MA 3QQNA 5KSBE 3QUMB 3FOMB 3HI6H 4EN3B 1LNUA 4ZAKC 4M8VA 4FQIH 2GT9B 3LNDA 5TE7H 3QC5X 4L5FH 5CIPA 5IBTL 4XXWA 3ARFA 5AVYB 3P4OA 1FHGA 1P4LA 2QKIC 3SBPA 2I60H 1PKQE 4BK4A 1TITA 5KVGH 3VA2C 1HSAA 4B0MM 1YECH 1YNKH 3KPNA 1KB9J 5ANMA 1XF1A 2ZOKA 4M03A 5ADOL 5D5MA 4IOFD 3PGCA 3FB7A 3MRIA 5K59F 1FL3B 1G7PB 3HNSH 3KJ4C 3X13A 2FX7H 5EU7C 2CUIA 2FNWA 1FLTX 2HJKB 1K9TA 4M6NH 3OB8A 3MUY1 5IJKA 1FVCB 1WJ3A 1L7TL 1P1VA 4OZHB 5DEJA 3TC9A 4NQSA 5CKGA 2IFFH 3SZ6A 2OMXB 1RK1B 2JV6A 3QUYC 1IQDB 3O3AB 4TVSa 1OTSC 1NDGB 3LZNA 5JYLA 1EXHA 4AYFB 4P9HC 3D39B 2QVFB 1QLEL 3ATDA 4ZX5A 2GY5A 2NX5B 3CNKA 2YUZA 4YHPA 4ALAL 5KZCD 1WBYB 4DAGH 4Z7OB 1PG7L 4X6DA 1M7UA 2VMJA 1DO6A 1J8SA 2WTPA 3B5GA 4L4VD 5AVVB 3SD5A 3MYJB 4PJAB 1IJNA 3ILDA 3CQPA 5JXEC 4U0RB 1UJ3C 2VQTA 2GY7B 4ZTPH 4V11A 5T5FA 5IROA 2DLFL 5KAQG 2BP3A 5MENA 3E6HA 1IGFL 2FBOJ 2CRIA 2VYRE 4ELMF 1IIIA 3E2HC 4HGWB 5FECA 4QR7A 4MHHG 4MD5A 4YHOH 3QRGL 2XG4A 5F8RC 3G6DL 4LMQE 2QV4A 5CD3A 3QUML 2E7HA 4LGSB 4YDIL 3QJHA 5T1KB 3VI4E 2EDHA 1NC2B 2ZKXA 4O51A 1UZGA 4R96A 4O2CA 1S9XA 5FA4B 3PWJB 3NJIA 4HAFA 5ERWA 1OAKL 4UM9B 4FI6A 3V55A 4XMUA 4HPOL 4LLVB 5FLUA 1XBRA 3ME0A 1UATA 1F4WL 1XX9C 5TQ0H 2CCWA 3D2UB 1QACA 1E43A 2ADJA 2P8MA 3QJUB 3MBEB 4FS0A 2JJUA 4WW2B 4E9WA 2GJZB 3EF7A 3V0VB 4AEIL 4Y1AB 4HCGA 1EJ8A 2IQ9L 1PZ2A 4PJ8D 4XVUC 1QOKA 4MNQB 3MLTA 1UA3A 3MR9B 4R2GD 1UWYA 4YHML 5I75B 4J3TA 1RI8A 4HEPG 4OZGF 4XN2A 3VGDA 1KSRA 4OGZA 4TUOA 4RA3A 1IAKA 2OL3H 2VDML 4QHNA 2KI6A 3G5ZB 4PJEE 2X9WA 4Q0XL 2KLSA 5AD0A 3TYFA 5CZVH 4XPGH 4WCYH 2X0UA 4OTXH 2AEOA 2O72A 1F3RB 1XF3A 1CXIA 1IGYB 1VESA 2APSA 2RALA 4JAMB 5IFHL 4XP9L 2IOOA 5F3FA 3ZL2A 5HYFA 1XH1A 1XF4A 3IDIB 4LEXH 3FFOA 4HSCX 4LVOC 3F7LA 2E7BA 2XZQL 4IBUA 2HN7B 3WJJC 2DPKA 1E67A 2CGZA 4PJ9D 5I8KH 3LMJH 5AYTA 1E65A 2X6UA 5BO1H 1I8KB 5ILTH 2D03H 4ZDHA 2DLGA 3O6LL 3UPRB 2E46A 3V8CA 1E2ZA 2OTWB 3HZYB 4L4VA 4CU7A 2F74B 5DVPA 3ZBMA 1MRDH 4BKLB 3KL3A 1UWGH 3INUH 2VMDA 3GZPA 2JCWA 3AY4C 2BO0A 4GAAA 4ZFFA 4RFEA 5IB4B 1DDHB 5CWSB 4BXSV 1KELL 1UURA 5DRNB 4AG4L 7FABH 1ZHKB 3O3EB 3BSGA 3PHAA 1R4XA 3T4AC 1OL0A 2A6KB 4NUMA 5I1IH 3BI9X 5EZPA 4XR8C 2ZOWA 1H3WM 4M7LL 1MHHB 3DHJA 3OAUL 3MGAA 2KDYA 2QELA 3QDAA 3TH2T 4BK8A 3UC0H 2BS8A 2N1KA 1O5DT 3BP4B 5K9JL 2FJGA 4F58H 3ARDB 3OPZH 1ETB1 2G9HA 3PE9A 5B38A 3FFCE 2W81C 3I84A 3LZPA 1AHWB 4P9MH 5SV3A 3VFPA 1OB1B 1SN2A 3C5ZB 3DX7A 3KWVA 1USQA 4QRSA 5DD1H 2WO2B 1L5GB 2BFVL 2DAVA 2TSBA 1NAKL 4Y5YC 3ARSA 1UKSA 4LOEA 4W9EC 5E56A 3BXNB 3T09A 4KX9A 2ZWKA 5CJOH 1KB9K 4ODXB 4PJ8A 3GSRA 1ZRUA 4D9RE 4F91B 3VXRB 2Y7QB 1BVOA 1SDDA 3FCUB 3GMPA 3OKOB 1W0WA 4L0ZA 4OFQA 1INQB 2N3JA 3BJ91 1DQML 1SBSH 1Q8MA 3PWVA 1MNUL 2Q86A 2WLZA 3MRFA 5ADPH 1CGXA 4YL4A 2YRZA 2RTTA 2XG5A 4OKVB 3C09C 3DARA 1ZVYA 5JQHC 4N8VB 1M7IA 4MLSA 2JK5A 4RSYA 1EXGA 3JWNE 2YPLB 4JFEB 2YD5A 3QDME 4PJ9A 4AH2B 3GXPA 1T04A 5AVSB 4YO0B 4ILDA 5KYXB 3CVHA 3ZDXF 1GS8A 1S9WA 3M45A 3UO1H 1JNNH 5ABZA 1S9YB 2Y1AA 5IJCC 4JG0L 4BE6A 1EGJL 4Z7UF 2H0PA 3D09A 2AABL 4BKSC 3D1MC 3V9FA 3PDOA 2ZJSH 4I77H 3FN0L 1A6UL 3SY0B 5E2WL 3TA3C 4BFJA 5C9JA 5C3TA 2JKIS 1Z9MA 5HHMB 4XHJD 4X8XA 4NZTL 3OJDA 4G8GB 5DSCA 3PJLA 1LWHA 4KJYB 4V1DB 1I7ZA 4X6BA 5E8DH 1KJ2H 2R4RH 3DDGA 2V4LA 1M9WA 5CP7B 5DT1H 1A6VL 4NO3B 3O8XB 3GSVB 3NG5A 3CC5A 1BIHA 1ROCA 4UT9A 3WYRA 4PJIE 2AQ3A 4X6CB 2GHZA 3WHXB 1NCCL 3ZJAA 1NM9A 1E8XA 3JTTA 5FYLL 2IGLA 4Y1TA 2APBA 5LXGL 5EN3A 3LZFL 4QYAA 1I3RB 2XNAB 2HTKC 1DBML 3GJFH 3X14A 4ZO9A 1WZ1L 1NL0L 1ROWA 1DQKA 3PWPE 2ZT9C 4PGDA 2NXYB 4GBXC 3NJGA 3MLYL 3IDXH 1Z3GH 2E0PA 4MGXA 4ZAKD 4I3GA 1EMTL 1FO0H 3PJSA 4JFXA 4UF7C 2DMGA 3CGTA 3AQDA 4U7KA 1XCTB 2ISDA 2G9KA 1A1MB 1MFUA 2JKWA 4N90D 1IGIL 3WKYA 5AVWB 3EF4A 2EDTA 3EXLA 2DQCL 3V7AG 1Q9WB 5D2LF 3DX9A 5I1JH 3CFJB 3IKCB 2QTEA 4PJ7F 3MFFA 4RA0C 1HXMB 3RHWK 1TU2B 3E38A 5FHAL 1KTLA 4GAJL 1BG1A 4XCYA 4TVPH 1GIGL 1VPOH 3E3QE 4LSRH 5T5FL 3LQAH 3ZTCC 4GSRA 5DJZA 5I1GL 4JFPA 4C56E 3MROA 3O11B 5I5JA 1BBJB 4GO8A 3PAUA 3WFCL 4NYLA 3DOSB 1LP9F 3H9SE 5DHVA 2NY3B 1A0QH 4LVNB 4LCYB 1YN7A 2WMPB 2F7QA 4MNGA 3HI1B 5H94B 4NUGH 2IG2L 3PDDA 1WITA 3GXMA 1BXVA 4W93A 2YXVA 3MZTA 5EEUA 1XB3A 3FJTA 5BZDA 1ZIAA 1I1FA 2PCPB 4Z95H 2XTLA 4C4UA 3OLDA 4FXKA 2P9RA 3KGTA 4FN0A 3RX7A 2DF3A 2R29A 5DQJA 2FWOB 2VE6B 4XBPA 5JW4Q 1OD7A 1P5UB 4CDGC 2NYZA 1IUZA 3EOTL 3EDKA 4X5XA 4PG2C 3ULAB 1KBVA 3MJ9H 4TUKL 5ACZB 2VKXA 4WI4A 3D51A 4C4BA 3ALPA 4AZ8A 3PS6A 4OFIA 4XH2B 3IVKA 4DN3L 2Y22A 5EIIA 5E2VH 4M1DL 2XV6B 2YPKA 3WFDH 4F8TA 4A37A 3G5WA 3FB6B 3ATBA 3SQBA 3VWJB 1QD0A 2XUWA 3WJLA 1D7BA 4J6RL 1IKOP 3IB4A 5DI8A 1QSFE 2IANB 3CZLA 4ZOCA 3H0TA 4PRPE 2EDXA 3EKCA 5E1AA 3CSTA 1QLRA 4HMDA 4ZAKA 1UH2A 4JLRB 4Q52A 1WFTA 5FGCE 3NACL 2Y0SA 5CHNB 5D7LB 3LN4B 5JW5B 4JJOA 1NUGA 3S2CA 3THML 3OAYK 2A9DA 2FUTA 4NO5A 2YD1A 1IFGA 3DTUB 4IMLA 4PYGA 2ZOOA 3M17B 3Q1EA 3KYMA 2Q6WA 3MV01 2UZYA 1TCRA 4BINA 3UXFA 3U46A 3KEHA 3CSFA 2H3XC 3LEYH 1OGAB 2VISA 3N6YA 2EDNA 3QDGE 1IGMH 4MDIB 3GBDA 2DM2A 3FXIC 1G87A 3K74B 5C9KA 3D8MA 3B3IA 5ID1A 2YSTA 4M5TA 2A0LC 2XPGB 2C9RA 3GQFA 1W72A 1JWUA 4XMPH 1HEZB 1ZHBB 5J11B 3AWEA 1SXSA 3LDBC 4PWFA 4ODTL 4Z3FA 3EH4B 2IGTA 3C5SA 3FUJA 3ENEA 1UZ8A 4D0CB 3COOA 3HBGA 3PL6C 4TSBL 3VU1A 3EGSB 2Y07L 2FR4A 1DBAH 1UJ3A 4L4TE 5F9OH 3RNKB 3LH9A 4Z9KB 2IH8A 1GW0A 4MWFB 2CKBL 1UADC 2HJFB 5BJTA 1URIA 4KBPA 4FKEA 3ZE2E 2C9SA 3BEWA 4ODHL 3VFRA 4Y4FB 3QR2A 4UV7L 5AYUL 2E6PA 3VXUB 2AKRA 5I18H 1N18A 1DZ0A 2Z4QA 3HG1B 4XCEA 1DLHB 4Z3TA 3RX9A 2J73A 3KLKA 4XNZC 5J13C 1E27B 3PWLA 3R4DA 2Y1ZA 1GRWA 2CALA 4AVJA 1OT1A 5EBGA 4S2SB 4XX5A 2GK2A 5TFSL 2A9ML 3BE1H 1SF5A 3QI9B 3D12B 4IK6A 2WXFA 2V3FA 1TSRA 4KGJA 3SDDB 4RIRB 2HLEB 1F6LL 5GJTH 4D0BB 4S1RL 4KQ0A 2QLVB 2G5BA 1RFDH 4XO4A 5H35B 1DVFC 3V5DB 2X05A 5DMIH 5C0FA 2P5PA 4OM1L 4FXGB 4P46B 1MRFH 3WD5L 4A2FA 5GIRB 3QHFL 1GGYA 4ZW5A 1HL5A 2EDMA 4JE4B 4LP5A 1QUNA 2Q76A 3GO1L 3J8F7 5JZ7D 1MAMH 4NIYE 5HGDA 3KWWA 1XCWA 3CVHL 3CDFA 3OAZK 4YZWA 2IFGA 4LCUB 4KY1H 4X99A 3K6SB 3ASOB 4HAGA 3GUTB 2ZG2A 3PG2A 4JDZB 2VDNL 4OH2A 2HLAB 1KN2H 2DQGL 1KIQA 3FCBA 3KPSE 5G4OA 4WV1C 3MRKB 4LLWA 2BY0A 2P4AB 1MFNA 5I5RA 3MRCA 4X8GA 1KB5B 5AG9A 1HWGB 1CLYL 2R83A 4JFFD 1KTDA 4UOZA 4NKOB 2PTTB 2MKLC 4DO5A 2C3XA 1DEEA 3Q3GB 5HDOA 3T3PF 2ZE0A 4UT9L 4TSAL 4X6FB 3S3PA 4PBXA 3SE8L 2GAZB 3BHBB 1WO2A 2EDDA 4YXLH 2DYPD 2IF7A 3AY4A 1TTBA 4BKTC 5EEWA 1NGYB 3T0XA 4HJ1A 3VXQB 3DNKA 4DTGL 3SDAB 4ADGA 1BLNB 1EAPA 1BQLL 3LN5B 2JIXB 5I8OH 3P4NA 4Z7NE 4JFDA 3SE9L 4HHGA 4DSYA 2HZHA 3SYQA 1NBQA 5D72H 5AW3B 3VRJA 5JXAH 1YPZA 3ETSA 1WVZA 2MQ3A 2COVD 2ENYA 4F8OA 1U8PB 4M1GH 2B16A 3CFKA 4OZFA 3O3DA 4N8CL 5D7KD 1FH2A 1BZOA 3ERXA 2E7LC 4MTMA 3NIGF 1NC4D 1E4XI 5HVWA 4NUJB 1ZDQA 3R7QA 3CDGB 4Q6IB 1NANI 4WF7A 5JLZB 3L48A 4HT1H 2VR3A 1W9XA 2A2QT 2XQYG 3OKEA 2EICA 1JBJA 4MQXD 4PTTB 2YMXL 3WXWL 4Y5YA 1FFTB 5GRUL 3MV8B 4ABVA 3CBJB 3NK4A 1MFAH 3EOYG 4M7KL 2K78A 3AG3B 1N5YL 3ZQ9A 4E0RA 2B1OA 2EKSB 2VZ3A 4UQAA 3QZWA 4L8SB 5E6SB 3AQXA 4GRLC 1PMYA 3FU8A 5BV7B 3L3DB 1I4FB 1NBCA 4J8RA 3BSZH 1X6NA 3U0WH 3ZGIA 1KT2B 2AK4B 4YDJB 3BKJL 2F0CA 4MMYA 3FU5A 3IAQA 2P5EE 3GIZH 4MNHB 4NCC1 1AP2A 5BOJA 4C58B 1KENH 1NJ9A 2KKQA 4QJ3B 3HPLA 1KGIA 4YE4L 3IMVA 3QE5A 4Z8FL 1GY1A 1PZ5A 2NY5L 3RTQB 2ZX6A 3DO7A 3U4BL 4DOHB 2OX5A 3N1FC 2J8UB 2IBBA 2ZCLL 4BHUA 1TQCB 4LSDA 1N2RA 2EYTB 1QMUA 5BVJA 3JVFC 5I6OA 3OAYH 3V4PA 1YHPA 4NBZB 5FCUH 2ZUQB 4MX7A 4XOAA 3UGUA 2O5ZL 2WUCH 3M6DA 4JFFA 2EVJA 3DTXB 2VLKE 4X7EC 4UU9B 4WDIB 4A2GA 3K2MC 5FHBL 3NDYE 8FABA 4G8EA 3VCLA 2XV2A 4XBEH 1E3ZA 4PJGA 1ZWIB 4FADA 2Z35B 5DJ6B 1NCOA 2DYPA 1NKRA 4X7TB 4WI3A 4Q9BA 2CLZA 3F5WA 4LL9A 3D06A 2G4GA 1YRKA 4ZNCD 1FPTL 5ITFB 2LR4A 1CS6A 4UQ2A 4I2XA 4NRXB 1ZLWK 4JQXC 1AH1A 3GZKA 4DEPB 4IBVA 5DK3A 1YEDA 4LCCC 4ZUVA 3EBGA 2R1WA 2UY6A 2ZG3A 3GKWL 3DWTA 3IDNA 4POUB 1OP3K 3GLZA 3W9EA 2J1XA 3KPPA 1CFNA 2WYZA 5D7IB 3RDTC 3DV4B 1NC4A 4OGAC 5EUOF 1X5MA 1PZBA 2E76C 2UWEB 3WIIH 3EFOA 1A5FH 4FCHA 4XCCH 3QXUA 3NCMA 4UMGA 2NY2C 3HE6B 2XZCH 4Z76A 2IALA 1TUPA 3ATFA 1CDIA 4AVIA 4FYQA 4R26L 1MFDH 35C8H 4HF5H 4TS6A 4JHUA 4UAOB 1CICB 2IH1A 3N1PC 2PP9A 3RVTC 3MYZA 1E5ZA 2OYKA 4RDQG 4ODVH 3G08A 4QKTA 3MSPA 2OSWA 4G80B 1MELA 3MV9D 2DQTL 3FU3A 4LT7A 4MXVF 1RVFL 3T8XB 1AAJA 1Z66A 2XWXA 5KVMC 5KYUA 4NGHH 2PPEA 5IF0B 4P2OB 5IQLA 3QCTL 3RFZB 5D93B 4FQXB 4LSPH 5FKPB 4CADB 1MCSA 5B8CA 2OBGA 4WNQA 2JJTC 3O6MH 2EDJA 4FQ1L 2IH3A 3QGVA 4N85A 2A0LD 5BOPA 3U4AA 2C3WA 2CGRH 2IQAA 4PRAB 1Q4NX 3A4DA 2KZWA 4F1ZA 3RBGA 5G5DB 4ZFZA 3P2TA 3RUGE 2BVPA 2WO3B 4GKNB 3OAZH 1F42A 1QRNE 2NY0C 4W9JC 4WK0B 1H8SA 1S5IL 2C9XA 2X1PA 5IM7A 3RWFB 2H4EA 3QJZA 4GSUA 2D31A 4P99A 4XC1H 1AYRA 4GMSL 2R0ZH 2V7NA 1XGZA 2DV6A 4NXSA 3LKPB 1TQTA 5JDSB 1W6LA 3QEHA 1WIOA 1CFTB 4LSTH 3T1FB 4HC1H 1PYWB 3QNFA 3L9EA 4FFYH 5I6PA 3F00A 3GHPA 4WU7B 3IJ9A 1J12A 1XZ0A 2WLLA 4K3EH 2XTJC 3RY4A 1YEIL 2AI0H 2X4OB 3JXAA 5EG6C 1MAJA 1XFPA 3EJJX 3WE6A 4NQQA 5JW4N 2OSLB 1BWWA 1HH6A 3B8YA 2ZKYA 2VM4A 4HPYL 1AXIB 1BVLB 5GJSH 3X12B 2FJHA 4QRTA 1MCWW 1T1WB 5I5IA 3TM6A 1JTPA 3G9AB 2G5UA 1F4HA 1RZ7H 1QWNA 2NUPA 3EJRA 4OZIB 2O1AA 4E41B 4F20A 1MRCH 2QPEB 3MJ8A 1HH9B 1DVFD 4PN6A 4YSPA 3SJVE 4BZ1A 1XR9B 1WWCA 4ABWA 4N86A 4LSSL 4OI9A 3ARYA 1BQKA 4F92B 3MV9A 3X1GA 3VXMD 4PRNA 4PWGA 1KBKA 2J88L 3MRHA 3S36H 5K33A 3VG9B 4UB0H 4GRWB 3VD1A 1FGNL 3LXUX 3T04D 1KTBA 2YPVH 3RVUD 1X5HA 2VDOB 2XPZA 1RIUL 4MS8C 5B4MC 3EDFA 1ETZA 3BPCA 4JY5L 3UAJD 5SWQB 1HAWA 2XVBA 3J27A 1XH0A 2NQDA 4PP2A 2ADFH 3CFQA 2B0SH 3EO1B 5FUOH 2ESVD 3W0WB 1I9IH 1B6DA 3O2WH 2BP0B 1CFVH 3BH4A 3CC1A 3F83A 1ACYL 1MCJA 3LQAC 1R1CA 1NOAA 3BLBA 1JNLL 3IGAA 4NBXB 3BEVB 1GGBL 5FYKU 2HRHA 5HYJE 2C4FU 3VTTA 1NLBH 2R0LL 1J8HB 4JO5A 1KTRL 5FDWA 4ZS7L 5FFGA 1MEXL 1F3JA 2CBQA 3CMGA 1BBDH 3MC0A 3C2SA 2CHDA 2LLGA 5D9SA 4YLQT 3ULUL 4ZPVA 3M46A 3W5NA 3H4FA 5D1XE 2G2NA 5C0AE 5HDQH 3OMNB 5GGSB 2BRQA 2FYYB 4GFTB 1TJXA 4JFOB 2F7IA 5FK9A 3E8VA 5I1EH 1ZJBA 3DJZA 4IOIA 3QO0B 2EVHA 1IAOB 4F7EA 2EDEA 4M61A 2A6DB 4OJFL 4NZJA 1MFBH 1N12A 2FQDA 3EH2A 4EIZC 3FONA 1BQHA 3DIVA 5KSAC 1WAAE 4LKXA 4LIQH 2O6CA 4A66A 4FNSA 1T03L 5F3HA 2ZWSA 4F2MA 1HK6A 1HHJB 4OCLC 4WRLA 3DX6A 1KPVA 3I6KB 1T83C 3LKNA 1TF4A 4IRZL 3JV4A 4BFGA 4F9LC 2W9DL 3FW6A 1ZLWH 1H6FA 3H2PA 1DVFA 2C1OA 1KGXA 4YIQA 1OP3H 2ARJQ 1K4CA 2NY4B 3F2LA 1J1XH 2GG1A 3VXMA 2H47C 1ECYA 5CGMA 1I8AA 1K5NB 3V4PL 4B9GA 2Z92B 3ZL4H 4ELMB 2DM7A 2PR9A 5CD5C 2NNAB 4AIZB 2IO5A 1M1XB 4QDGA 4KKBC 5IR1B 1HU8A 1MJJA 1A7RH 5I76A 4JPSA 3UAJA 2FYVA 3LZRA 1RQ5A 3IK2A 2ICEB 4OFKA 2D4FA 2NSQA 3QQ9C 3HN5A 4PIRF 2BDNL 3GSWA 3V0AC 5IW6B 4KZEH 5DWUL 4B5ZA 2ESVA 5C92A 2H6OA 3Q9QA 4PS8A 1SY6H 5EF1A 4PUBL 1ZGLB 3QFDA 1R33A 4IGBC 2DQDL 1KUMA 4PVMA 3BQUB 4L23A 2GEEA 2L04A 5INDB 4IRSB 1UYWH 2EIKB 1SEQH 3IDMB 4N0FB 3BKCH 2OK0H 4Z7QE 2WINA 3VM7A 2R69L 5CZKA 3IPFA 1RP9A 3IJSA 5MP6H 2WTOA 3RKPA 2ZP9A 2NLJB 4NZ8A 4UZSA 3N41F 2X2YA 3DHMA 5IMKA 5FR3A 2X0WA 3D34A 3HCVA 3Q0HA 4OIIH 3VG0L 2R1YA 1HX0A 3KGUA 1BZ8A 4P3WA 4X2UA 1JHKH 2HVJB 3LKRA 5C0DB 4X4YA 3DXAD 3MUJA 4XAWL 1QA9B 3STLB 3QPXL 4I0CC 1FV1B 5F88B 3GBMH 2I07A 2YC1B 5D2LA 3MGTB 2VKWA 4TUUA 5DK2A 1G7HB 1IAMA 4U7SA 4BFNA 4AL8C 4XBGB 4BHUI 1GGIL 3T3MB 1W80A 3FO1A 1QFOA 2FO1A 1Z9PA 2XX1A 2R9HC 1A6TA 1VIWA 1CURA 4JKMA 3II2A 1AIFB 3RDTD 2R56L 2Z7UA 5T3ZH 4OGAD 2NSXA 2QVTA 5GRXG 2NW2B 5IG7A 3F3HA 1JGEA 3KWTA 2V9QA 3WTTA 3PHQB 4ENZA 2FGWH 3RU8H 1EZLA 4F7TA 3DI2B 3SQOH 1HXYA 3U2SA 3HNTL 1GTFA 4LVEA 1QSEB 1T1XB 2ITFA 5B7FA 4DN4L 2R27A 5JUEL 1EZVY 3S6CA 3RVTD 1TTGA 3FB8A 2TRYA 4KITB 5IOPA 3SKOA 3ZE1F 1D9KC 3FCSA 5TGBB 4G9FE 1NEPA 1T2JA 1G1YA 3RGHA 5I8CB 2W60B 1SYSA 1JFQL 2X38A 2B4CH 2W95A 4P06A 1E5UI 2ZD0A 3VQ1C 4LDOB 1AGFA 3ULSA 1KFGA 3ZPDA 4UQ9A 3L9BA 1QFPA 1Z9LA 4J23A 2JWYA 5J9PA 4XWGL 3MJ7A 1KCUL 1MG3C 5GGUA 4F7MA 3T2OA 1J1PL 4YDLC 1UM5L 3Q6GH 4P3DA 5CJ8A 5A16B 3VRIB 4JKKA 4WJ5A 5CP3H 1K6QH 2HT4D 4JL2A 1DDTA 3DSFL 1OSPL 2HJLB 3S34H 3GMQB 2QGBA 3QCUL 4N5EC 3EG9B 2DLIA 3M7FB 4ZRGA 3UTSB 2QPFA 3QDJE 1H3PL 1J88A 1CXFA 1JWMA 1ODAA 5DQ9B 3B9KB 2W0LA 1IGCL 4U1MB 5DA0B 2K6WA 4PRIB 1DQVA 1J18A 2PF6A 3HR6A 1U8IB 2PTVA 5I23A 1Q9KB 4DKEL 3DXAA 3EYVB 3SPVA 1U8HB 3ZRSA 1D2OA 3CFEA 3FTGA 4PBDA 5F7WC 5BMFH 4BWWA 3F84A 1D5IL 4JQXA 3VXOA 4KUZH 1ONQB 4LCCA 3W1ZA 32C2B 1SYVB 2AJYH 2QR0B 1PW3A 1SN5A 3OX8A 2H32B 4FC3E 3WS3B 4AZUA 3RDTA 4ZNEE 5CJQH 3FRPG 2YA0A 2XJKA 1H0DA 2PCFB 3ABMB 3BQVA 4RFNB 5FM8A 4I18B 4QRPE 4APQB 5DJ2B 3VRLE 2UXTA 4HLZH 4LK4A 4TV3A 3VSVA 5F9JA 4MMZB 4FNPA 3V6OC 1UCBH 2DQUL 4PJFF 4Z7UB 2FUQA 2BNQB 3FH7A 3O3BA 3RJDA 1N6UA 1YUHB 4OIAA 5AAWC 1B88A 2V5SA 3WFZA 4B97A 3O4OC 4MA7L 2VLMD 1AO7B 3NN8A 1JK8B 1ES0B 2YKKA 3A22A 1AYOA 3MBXH 4LDCA 5JIHA 4BFBD 5EPMA 4ZUSB 1KPRA 4HU2A 3VNYA 1MY5A 2VRKA 1L0QA 4UOJA 1RH8A 3TVMB 4MS8D 5HYSG 4Y5XC 1WK0A 2UX7A 3VXTA 5L8KB 1LD9A 5CLZA 1I7TB 3GK8H 2XXFA 1KG0B 1UWXK 4PY7A 1EXUA 2OJEA 3QNXB 4NCDA 5GS1A 5M7QA 1FP5A 4OZHE 4Q9QL 4PLJD 2A77H 4FJ6A 2CJUH 1GS7A 4GXVH 4UUJA 1I9RL 2BOCA 3HAEG 1IM3D 4TVPD 5F9AC 1J0KA 5K39B 4Z7IA 1VFOA 4V2BA 3SDXA 2Y5EA 3Q13A 4XPBH 1MF2H 1S7UA 4K9EH 1BAFL 1PY4A 2GSMB 2O93L 2FECI 3D08A 2NX5E 2WOBA 4WJG3 3VDAA 1OT2A 4G7VL 1I1AD 1SM3L 1FL5B 4R0LC 5KAQF 4Z7OE 3S8FB 5D4IA 4HXAL 2EYRA 3QG7H 1BFVL 3V0WH 4FMVA 3VXNA 1VADB 2QVKA 5JOPE 2H3NA 1EJOH 1RHHA 3VQ2C 5EDXA 1H3UA 5FO7B 5DVOA 5F7UA 1RJLA 3QA3B 1GKEA 2Q2LA 1KJ2A 1ZA3B 2VR8A 2G4EA 4B9ZA 1T0MB 2VLLB 4LVHC 4YXKL 3UH8A 3UTPD 5IBUG 4N2HA 3UYPA 1HQ4B 5JHAA 1Z9OA 5JW3L 2IDUA 5J1AB 1AFVL 3SOBL 1DUYB 3BD4A 4YWGH 2KZBA 4LLDA 4CBPA 2W65B 4WI5A 2D2CC 1K85A 3B2MA 4FEIA 1JF1B 1C5BH 2FWUA 1TYEB 1ZHLA 1IILE 1LP9B 2UUDK 4APXB 5CEZD 1T22A 3HLKA 4NJAL 2YK1L 3DSNB 1JGIA 3DGGB 4MA1B 1KGCD 2ARWA 2CUHA 2K7PA 4NQDB 4R6UA 4Z7VF 5IVNA 4LKCB 3RWGB 3MA9H 2JF1A 3ASWA 4HYTB 1FYTD 3MLRL 2Q20A 4OBRA 1FIEA 1HC1A 1BECA 2V2WB 1HZHH 2CR3A 4YQXL 1JZ6A 1XH3A 4YE0A 2WUBL 3TCXA 5T1JA 2K0RA 2NNXA 3BAWA 5GGVL 3V5KA 3SY6A 1AG6A 1CGVA 3FQNB 4CVXB 5C0AD 4HLJA 1LQSR 3MCLL 2AITA 1JGDA 1XT5A 4X7SL 1QR1A 1WZLA 5L2JA 1HCFX 4AYEC 2MNJB 4M7ZB 3NQIA 3DMMB 5D7HA 2IPTH 2WZPD 4KTDH 1JYNA 4KHXL 5AB2A 1H8NA 3C2AL 3QQ9D 3D25B 2NXZD 4RZCB 4FHBD 3RY6C 1IM3A 1OARL 1QHOA 4FFVC 5LDUA 2HX8A 5TF1H 1C12A 1GW6A 3D69B 1OD9A 2OCFD 2OYPA 1XV8A 4GAGH 4O5LL 4IGBD 5EO0A 3WI9A 1LMIA 5B22A 5TE4H 2J6EL 4JPVH 2JVUA 3QYNA 3FQTB 1I1AA 4PB0H 3VFUA 5F97E 2VR6A 3U9PH 5CUSH 1MWAH 1EHKB 4Q6KA 3WN6A 2CDFB 4Z7WB 3ZR6A 2W8CA 1T3FB 1QVOB 4DKFH 3K5RA 3L7EA 3BZEB 4B9KC 4AK1A 4ORGA 4K3JL 4GG6E 3IFLL 4JZJC 3P3UA 1TZGL 2YBGA 2B2XL 3FAWA 3BH8A 5CZRA 4ZBJA 1NBVL 5SX4I 3VNZA 1AGCA 2W0FB 4BSVB 3BCFA 5KBNC 3OR7B 3GS0A 5D7JD 5D6DA 4LARL 1RZGA 4FNTA 3ESPA 1HSBB 4PG9B 4AI7A 3BUBA 3TBYB 2XY1A 3ZDYE 1B3IA 3FBQA 1N68A 4OZ4B 1KYDA 5D4JA 2MQGA 4Y88A 2HT2D 3MJ9A 1CGSL 1JJUA 1XSIA 4ZO8A 3AQYA 3TEWA 3B56A 2R9HD 1QFUL 3ZYZA 2VZUA 2FATL 2IDCA 3QIBB 5I1HH 2UXVA 2VDKB 1S8DB 2NCMA 2NTSP 3QH3B 2OKMA 4GY4A 5D1QD 5E9DD 3HTLX 5IREA 1F90H 2V33A 3GM8A 4HIIA 2XT1B 1BEXA 4JFWA 3TT3H 3FQ4A 4PHXA 3D48R 2DD8L 1ACZA 1T83A 4X9IA 2JI1A 3X11A 1QZNA 4XTRC 4ONFL 3U7WL 4CC4A 4F9LA 3T6QC 5G2NA 3C60C 1FYTA 4OCMC 2X2JA 5DHYB 5FYLE 5TQ2H 2DH3A 2OMZB 1FLRL 4U1KA 1D9KD 1S7TA 1SMDA 3PV6A 2E9JA 1AY1L 5C0AA 5K9KB 1E4HA 3T0VA 1AZBA 4NXKA 2GSGB 5EZJB 3X1BA 3K1DA 2JB6B 2QQLH 3O0RL 4G6FD 4P5KA 4KTGA 5C0RL 4IS6A 5FB8B 2WZPA 4CA4A 1XR8A 4JY4A 5GGTH 4YK4C 2VDPH 4H7VA 3PWUA 2DMKA 4HBQA 2OFQA 5EU6B 2Z91B 2GIYA 2X41A 2IPKA 2Z8SA 4IGBA 5SWZD 3OKNA 2HMIC 4N5ED 5DMGD 1U58B 1KIPA 4Q4IA 5I2IA 2MPVA 4WFEE 4FG6C 2AJUH 4EOWL 5ENWA 4OQTH 1K4DA 2UY7A 3I9AA 2FB4L 1HHIB 4QRQB 4AYID 4F33B 3MXWH 3GSUA 1UWXH 4N6RB 1IVTA 4K15A 3QQXA 4DH2A 3VXSE 2EIBA 1JIBA 3V6BR 5D7JA 1BJ1J 3OKLB 2C1PA 2XIDA 2X40A 1RMFL 4DFIA 4KROB 2KYIA 4Y4KD 5E5MA 1OWRM 4MCZA 3P2DA 3UADA 3MGOB 5IMLB 1J0ZA 2J5LB 3KG5A 4L1LA 1FBIH 1YEJH 5DUJA 1NZRA 3VFWA 1EO8H 1HCVA 4Q58C 1IL1A 7PCYA 2O5XL 4LBEB 1X9LA 1E5BA 3IGFA 3UABA 1BGXH 1L3NA 1HL9A 5D1QA 5E9DA 1DJHA 4DESA 4FLHA 2YLKA 1ZOXA 3MOBL 5L6YH 4FNQA 1KBWA 5A2JH 5HDBB 2N0KA 4HKXA 1U8MA 3HFFA 4X8CA 1RU9L 3VJ6A 3H9HA 3O45A 5BUGA 1GTNA 1P4BH 5HHOE 2Y3AA 3T3PB 5C09A 4HXBL 5L9DL 4LRIA 4RGOL 4Q56A 1MLCA 5A7EA 2FEDC 3GF8A 1FFPA 3FZUC 1EEQA 4EI6B 1KNOA 3J7HA 4ZMNA 3GNMH 2V5YA 4Y5VC 4HU8A 1D9KA 1YEKH 4QOKD 3EFDH 4KQ4L 4XT1C 1QLFA 1OPGL 1U8KA 2HH0H 3S5ZA 1KB5H 2MCG1 2WPGA 3LQZA 4AGLA 4B9PA 2ZSVB 3VH8B 4JUTA 2UUDH 4G6JL 5HYQB 5JHBA 3OF6D 1TYJA 1PFCA 4XMKH 3HS0B 5CBEA 3UJJH 4ZQTA 4PTUB 2PPCA 2D3VA 3TWCL 4OUUB 1E40A 1S7WB 3KWXA 3QAQA 1YYMH 5DCCA 5KBMA 6FABL 1E5YA 3DOHA 4U1HA 3GI8H 5E00A 3H3PH 4WUUE 4DPAX 4OCRH 3VWKD 5SWZA 4B3VA 5L7XH 2P49B 1NGXA 3P0VH 5CN1A 1TJHL 2CH8A 1CTNA 3W5MA 3RVVD 1CLZL 2VC2L 3NTCL 3QZLA 5F1NB 2Y72A 4NJ9L 2Q3XA 1ZGLM 4JPKL 2CLVA 2D7OA 1N8ZB 4TPRH 4J3OG 4CU6A 5BS0D 3D50A 3KCPB 4J39A 5FKAA 4XZ4A 4MYWB 2UZXB 5FOBA 2IIJA 1RK0A 1I8IA 2ALAA 4Y4KA 5DRWA 4K3HA 5CXPA 2GHWB 3HIZA 2XRAL 3TJPA 4FLSA 3U2JA 2AJXL 2DQIL 3MRRB 5ALCH 1B4RA 2ZKHL 1A4CA 4M48H 3H1ZA 3V4UL 1LNUB 1XGTA 1W91A 4IU2B 5EBLB 5CIPB 4S0TD 4G11A 5MEQB 1N3NA 1JXKA 1QX1A 3P4OB 4KH9A 4ZS6C 1P4LB 2ZPKL 3V95A 1KWKA 1A6AA 3DPBA 4KJPC 3DK2A 5IW1B 3OBAA 3KPNB 5ANMB 2IANE 2ZOKB 3RYMA 3B2XA 3RB7A 1WH0A 3PGCB 4H13C 4QF1B 1EHNA 3MRIB 1RIHH 3EJSA 3LNFA 4OSUH 5D7LE 3ARWA 3DC0A 4NENA 3X13B 4MXQC 2CJ3A 2V8LA 5CILL 3RVWD 5AAWA 3FYIB 3UBFA 2YJLA 3NJMA 1AKPA 1F4YH 3LVEA 1DQIA 4NQSB 5ES4B 1XEDA 3QWRD 4QOKA 1JCKA 2W07B 2D9CA 1U3NA 4NFCA 2BXZA 2XN9D 3QAZB 1PIGA 2VMEA 1G7MB 2B4CC 5C2BH 3GLEA 1Q0XH 1OSEA 3OF6A 3HN8A 1Z5HA 4N0CC 1A9EA 3UMNA 2EEBA 3GI9H 1DTUA 4YHPB 4OLUH 1QBML 1OZTG 3WIHL 2WN3A 4OGXL 3UJTH 5DD5L 4FFVD 1CZ8H 5EUOB 3VWKA 2Y06H 3MPCA 3P3YA 5AVUB 4WLCA 5B7EA 2DJ4A 3DUSB 2XQBH 3EGXB 4IIQB 5EV7A 4BRJA 1UQSA 3FCTB 1F4AA 3BVWA 4H20L 3S35H 4RETB 3VFSA 3QRFM 5FCSH 5FECB 4ZFGH 1G7IB 1Q1JL 3JUYA 4WGKA 1OM3H 2XG4B 4LLQB 3SE3A 5F7NC 4N8VG 1AZUA 2Y7SA 2R1XA 43C9B 4AKQA 5BS0A 5GZOC 1Q9LA 3ISYA 4U31A 4O51B 1U4FA 5DRZA 4R96B 2H1PH 4HWZB 4MRCA 2VQ1A 3PV7A 1S9XB 1TNMA 3ARVA 1OGTA 5CEZL 1UM6H 5ERWB 3SKJL 2GFBA 4A2EA 4OLEA 4D94A 2VUYA 1H3GA 3TTYA 2ADJB 3HG1E 4L18A 2I69A 5D2NA 3V0IA 4ZD3H 3S3CB 4ONGL 5FYKH 1J9RA 1A4KA 2MCPH 4O58L 1WF5A 4H1LA 4R7DB 5FO9A 3P2BA 1N70A 2BP8B 4YXHL 4NN5B 4I88A 3MLTB 4QHLA 5KS9A 2O6FA 5DA4A 2A83A 4FG4A 3TTSA 3KR3L 4AMKH 4QHNB 4QTIL 2LAGB 1VGEL 4XTRD 4D7PA 4N24A 5CGBA 3X3GL 5C6WH 4OCSL 2H5UA 1CFQA 1EEYA 4L1BA 2EE6A 1KC5L 3BAXA 1XF3B 3C75A 3DX3A 1U3YA 1MJ8H 1L9PA 4ODBD 5DMKA 3QWRA 5HHXL 4UTAH 1HHKA 3QRLA 4ELDA 2NRDA 1FC1A 2XN9A 1R5IB 1RJZA 1TQBB 3FOLA 4W9LC 3QFGA 3IJHA 5E23A 4MS6A 4JVPA 4YHIB 3TO4C 4HKZA 4AUYA 5C0BE 1UB5A 2ERJC 3NSFA 1S7XB 4L4VB 1AXSA 4PJXA 1CT8A 1ZSHA 5L2KD 4J2QA 2QADC 2TRHA 5TTRA 4F2FA 2K7QA 2LU4A 2HMID 1RIVL 4K9EC 4LEEA 4FQJH 2X1XR 4QD2E 3SIKA 1BZ7A 1N0LB 2RBLA 3S37X 2Q8BL 1U95A 4KFMA 1QTPA 3BUPA 4FG6D 5ICZA 2XFXA 1FDLH 4NP4H 5JPNC 3BP7B 2QEJA 1CXKA 4HWEL 2MQ0A 2BNUA 3U7AA 3TESA 2MRYA 4AGOA 2CHXA 2NPLX 4JZJA 2GITA 5HGHA 5EEZA 3WO4B 4BEIA 1QRKA 3MLVH 2FWSA 2VH5L 5ISZD 1R5VA 8PAZA 1OAYL 4E2OA 1X3DA 3IFPB 4BDVB 2QHRH 4AVHA 1UH4A 4W9KC 4FZ8L 3DRQB 4CW1B 1XD1A 1JHLL 2IAMD 4MA8L 4K73A 4MA3A 3MLUH 3DX7B 1QO3A 2G3ZA 3ESUF 3IGKA 3BUTA 1BXUA 5AL0A 1WTLA 5DHEA 1HQRB 2FX9H 2DL9A 2WCGA 3ELQA 1V7NL 3VFOA 3T4YA 1NMBH 1UXSB 3JVGC 4HUXA 3TH3T 5EO1A 2A6IB 1SDDB 3GMPB 1NIFA 4ZSOB 1TZHB 4AYBA 3RHWF 5EORH 2QLYA 2B1HH 3ECUA 3I3BA 4G72B 3BAKA 4K5MA 2Q86B 5DD0L 1I3VA 4WW1B 1EH9A 4PY8J 1CMOA 2XG5B 4BM7A 1N4XH 5JHDB 1S7QA 2AGJL 4CKVX 1X5IA 1OHZA 2JK5B 3QEQD 4YHKH 4F5CA 5I16A 2AXWA 3DVNA 3RFZC 2AXJA 3NAAH 4HJSA 2AK4E 1BXAA 3MCYA 4QYOB 2MJWA 2CO7A 1JFHA 5IHBA 3GBEA 1RY7B 1NCWH 1T04B 2VCOA 1KEGH 2BVUA 4ZMAT 4OCYH 2DS4A 3W9DA 2A9NH 1CF8H 1D5BB 3N1QC 3BPLB 3QQ4B 4ZUUB 5LAXA 5AW4B 2J8UE 5L2KA 2X4TB 3H54A 3EJTA 4ETQA 2VXQA 3E8UL 2VXSL 1OF2A 2XWRA 1LK2A 3S88L 3ZDZB 4PBVC 2F1EA 3UZVA 5DSCB 5I17B 4Y9GA 4TL5A 5C7ZA 3UAAA 1DANT 3CU1A 4X6BB 1A3RL 1MCBA 4G1EB 3IXAA 1IKFH 3D4CA 1VACA 2AV1A 4R7XA 5E2UH 4AQAB 4WWNA 2BHFA 1FH5H 4X7CC 4HJJH 4NQCD 2WSDA 3CC5B 5JDJA 3V0HA 4KZ0A 3V9EA 1B0WA 2DEYX 2XXCB 2DMBA 4FYSA 3S36X 3UZEA 2PCYA 3JTTB 1K3IA 2BSED 3BISA 1EIBA 4G71B 1ADWA 2DLTA 2IAMA 3T77A 3MUGA 4Y89A 3UOAB 5GRVK 3ARQA 1FRGL 4JB9L 4X80H 4PGDB 3RGVC 1E30A 2K8QA 4Y0GA 1DBJH 3CXDL 3QR1A 3FT9A 1BJ1H 1KYOJ 4N2CA 3AU1A 1R9FA 5D7IE 4ELKB 1U3ZA 3MACH 4K23L 2ZIDA 2ZYRA 4JR9H 4QRRD 5GHWL 5IY5B 3E80A 3BPNB 1XMWA 3L3IA 3A6BH 4RDQF 2DWSA 3LEVH 3QJXA 3JWNC 4AQ1C 5JHLL 3D9AL 2PYFA 1FHNA 5ACLA 1F2QA 2IBZY 3CMOL 3L6FA 5CMAA 3L9RA 3MFFB 3MRGA 4H8UA 4MXQD 3QCVH 4XGZA 5DYFA 1F8TL 4PS4H 1KTLB 1EBAA 3DBXB 3H55A 1QPXA 1TJGH 2VXVH 3EBHA 4XCYB 2X4QB 3MREA 4Y5VA 4M9OA 1KCSL 3O41A 4JZNA 5SV4A 3LIZH 4GUCA 4FQ2L 3U30B 2P8PA 5DJZB 4JFPB 1R46A 2ZUVA 3MROB 4JFZL 5B39A 2EVIA 4N0CD 4Q2ZA 3WBDA 1UXWA 1XGPA 2EADA 3O2VL 4OGQC 1J11A 1YN7B 4WEBL 1XF5A 2MNUA 1EA9C 4M6OL 2W92A 3KVDD 1LO3L 5E2TH 1ND0A 4HUVB 3TO2A 3R18A 5BZDB 5IP4A 5HHVH 3OHXC 4K3GA 3V4VH 1F18A 2NCEA 3OC8A 5AENA 5I1DA 3HZMA 4MB1A 4RCAA 4OD3H 1Q94B 1GCYA 3SGJC 2BSSA 5IIEA 3LB6C 4Z7VA 4HEPA 4X5XB 1T6WA 1BEYL 3X17A 3L1OH 1OT4A 4NQCA 1ILSA 2FL5A 3GSQA 4CNIB 5GS2D 4BIKA 2BVYA 3ZE1B 1GOHA 3MV7E 2ETWA 4LOFA 1FZMA 3GLDA 4Z77A 1HILB 4DZBA 1T0NA 4YZFF 3T65A 2P5WB 3QSKB 2BSEA 2Z34A 1VFMA 4JFDE 5GGRA 4NKIL 1CCZA 4XAKE 1EFXD 2L7UA 4FTVE 3CN1A 1RJCA 4XPFH 2WZAA 2WWKT 3QEGH 5EB9A 3DA0A 4F7PB 4DP4X 1PLGL 1BMWA 3KHQA 4N6QA 1OHQA 1CVRA 4ZAKB 4Z6AT 4W9FC 2YEQA 1EZSA 2K6YA 3C08H 4K94L 3ULUE 2VDRH 1KV7A 3IAGC 3MFGB 2QKIB 4QRRA 3TNMA 1A8ZA 2ZWZA 3UBXB 4NO5B 2ZXCA 4BCXA 4U4IA 3F58H 2AAAA 1I8LA 1Q0YL 1DJZA 1BQSA 2E8YA 3TEZA 2L7JA 3E3QC 1J1OH 3N40P 4HK0A 3BIBX 2A9CA 5GS0H 4OZIE 2PP8A 3KJ4B 5EUKB 4E41E 1N9PA 1UB6B 4HJEA 4M62H 1DJWA 1BZ9B 4BFRA 2VISB 4Z78A 4UIMB 1L7IL 2YGVA 1SHSA 3B2VL 4MQ7B 3QUYB 3GTVA 2WM0A 4O2FA 3P3SA 2BJMH 2V6HA 2DH2A 2JXMA 4BZYA 5F7DA 3K72A 3QS3A 1L9OA 1W72B 1JWUB 2VDQB 3WTVA 5TE6H 3TO4D 2AANA 4FD0A 3C5SB 2AQTA 1GSMA 1UZ8B 5DEFA 5I73C 3W0WE 1Q1PA 4F8QA 2QADD 3UEZA 1EERB 1P84K 3ZY7A 5KBPA 1UJ3B 2O6EA 5AKVA 5CP3A 3PNWA 2QTVA 1OCRB 3VFGH 3F12B 4HH9A 3G5YA 1T2XA 3ZKQD 3E2HB 1J8HE 3BVNB 4XMVA 3VFRB 1GYAA 1NCDL 5IHUH 4JHWL 3L4ZA 4TOYL 4JCWA 2KH2B 3LHPL 4WTZG 1XGYH 3BVXA 2Z8VC 4QJ4B 1C5DA 2G2PA 5KSBA 2J8OA 3NUKA 1C5CL 1UZ6E 3GMLA 2QQNH 1F4XL 4NQUA 4AV0A 1N59B 4X5QA 4AM0B 1EFXA 4MD4A 5E7FA 1MNNA 5K59E 3NSDA 4JRXB 1KYOK 3N43F 1PKQA 4AJ0A 3FCGA 1ZT4B 2EO9A 2RR3A 4Z18A 3KL5A 3ZZSA 1G6RA 5ITBL 3ABKB 1MXDA 2RACA 3LKQA 4ICWA 4MAYC 1JD7A 5AKTA 2A4ZA 4BZ2H 4ZFOA 1ASPA 2PWEA 4NN6B 5I15H 2HSIA 4NSKA 1JGVL 4G59C 4KZDH 1DR9A 4HHWA 3SGKC 1UGNA 5DUMH 3NIDF 2LGNA 3WS6C 2XFGB 1W0YT 3KWWB 6PCYA 4WSGA 1EDYA 3MRBB 3MX0A 1P2CB 5AAPA 1JWSA 1TLMA 3TIEA 3UAFA 5JIKA 3NEXA 1E8ZA 3NP3A 5HTSA 5D7EA 4UWQB 4B96A 5C0JA 5AVRB 2B08A 3AWFA 2Z0BA 2VXQL 1OGSA 4LLWB 4AMWA 4LVOB 1TETL 2XN0A 2YBRA 4ELME 2NTFA 4Q9CA 2CO6B 2ZOLB 4B53A 3SPJA 2NY7L 5AKSA 3LS5L 1T20B 4MKMA 5CLTA 3WIFA 1KTDB 4GUQA 3TO4A 1YNLL 3MXVH 2FEEL 2BCKA 2AXFB 4YSTA 5IVOA 3BWSA 2W1NA 5CJBA 3BP6A 1X5YA 2FJFA 1G9EA 1OWWA 2G3XA 4BFEA 5DURD 3VI4A 1QBLH 4RQQB 3G5XA 4JPWH 3S3BB 3CCHA 4HCRH 3P4NB 1IC1A 2FHBA 3AU0A 1JZEA 4L3AA 3T4AB 43CAA 3FFCD 1U6AL 3HVDA 3I85A 5GGRY 1YPZB 2A4CA 2WSPA 4JFYA 5DVMA 1JK9A 2H2SC 3RUGF 3ZIYA 4PWKA 5GSRB 5LG1A 5E03A 3CVBA 3MODH 4OZGE 3BUDA 2A74A 4QXVA 4O02H 1FSKC 1DN2A 4LPUA 3ZMRA 1ASQA 4MVBD 5IVXF 2VLJB 1IC4H 3N50A 5I24A 1ACCA 2BSCA 3KM2A 4D9RD 3FTVA 3D4ZA 4PJHF 1LDPL 4Y5YB 4PJEA 2CXKA 1YMME 2NR6C 4CVWA 1UM4L 4HKBA 1GJIA 5CCGE 4NIKB 4E0RB 5IB5A 3JVGA 4FQCL 1QFWL 2RD0A 1KULA 1KBBA 5BRPA 5LHDA 3WEBA 3V8OA 4JDVA 1L9SA 2FEEI 4XXDB 2ICWA 1MY7A 4ZMWA 1TNNA 2FJSA 4WKXA 5ADOH 4JM2D 3QDMD 4NZFA 3A23A 2FNBA 4LESA 1QSEE 3C09B 2KHAA 4GKLA 2JTYA 2WC7A 5IT2L 5IJVB 3DO7B 4GW4A 2OTPA 5E6UB 1L7TH 3AS1A 2AMGA 2NT0A 1N2RB 5BVJB 1Y0LB 4P5MB 2VO8A 1M3JA 3TGXA 3D6GA 4LLYB 3SHSA 4G8FB 3ZR5A 3RI5F 1QLEH 1NCTA 3TA4D 4NQVB 3VFVA 4N9GA 3UTQA 4DZ8B 3GMRA 4ALAH 1IC7L 2AJ3A 5AZ2L 3SKMB 2V2XA 4W9DC 3FF7A 4G1MB 2DYPB 3TA3B 3DHUA 1OKEA 1S2EA 3F6IA 5B1CA 4GIAA 2KDGA 3AUVA 3WIAA 3GSNL 2CLZB 3QORC 2OMTB 3F5WB 5E8EB 2DLFH 3GXIA 4L29B 1IGFH 2MOQA 3FULA 1MREL 3IBOA 3UTSE 2F08A 1A7QL 4UQ2B 4AQOA 1R3IL 3FFCA 4I2XB 4TQHA 4Z0XB 4M7JL 3QRGH 1QFWI 4PRIE 2L7EA 3G6DH 2YWYA 2ZXWB 3PWPD 4Z3GA 4YDIH 2C3VB 3IDNB 3RPIB 1CFNB 2Z31C 3NZ8A 3HN3A 1VAHA 1KFAL 1NC4B 3W39B 5KVFL 2WJ5A 5JNYA 3TJHC 4YSAA 4IJTA 4X8JA 2UXGA 2BMKA 1OAKH 1WICA 1CR9L 4HPOH 1NCGA 3PJNA 2IALB 1MQ8A 1V3KA 2WBJC 4GBXB 4WKZA 1F4WH 3BVTA 3MMEA 2K6ZA 2E27H 4N87A 5AOKA 1ET8A 4XNUH 1WFIA 3TCTA 3KW8A 2R0WL 2IH1B 3PWNA 4RWYL 4AEIH 2CXGA 2IQ9H 3APCA 4KMTL 1JI2A 1XGQA 1RZ8A 2WIIA 3RG1C 1UACH 3MRMA 3ZDXE 2FO4A 2PWFA 4YHMH 3GS7A 4F93B 4AQ1A 2BVOA 2F58L 2NY6C 2MQCA 1JNHB 2DQFA 3ES6A 3R19A 2VDMH 4R90L 4JM2A 3QDMA 1E7UA 1GVIA 4Q0XH 2BNQE 4KKAC 4Z7UE 4C56D 1AQHA 4XVJL 4X7DC 1JTTA 3H9SD 3VTAA 1S4IA 5H37A 3WG7B 5IFHH 4NO2B 4W9CC 4XP9H 3EFFA 4LSVL 1I7UB 3KDPB 3C6EA 2FDBP 2IH3B 2XZQH 5JQ6L 3ORJA 5I0VA 2JJWA 2APFA 2IDFA 1NFDB 2IQAB 3L5HA 1QHPA 1Y6KR 2MOGA 2PNDA 3BD5A 3LXBA 2JKXA 3BSHA 1CN4A 5LBSL 2BVPB 4WWKC 2ZYIA 2XWTA 3WFHA 5IM7B 2DEWX 4LB8A 5HHPB 4L2LA 3TBVB 1DQJA 2WLNA 4EPSA 2D31B 1P6AB 3VB8A 3HC0A 3HE7C 2V7NB 3JYBA 3OHXA 4PJIA 5B1JC 5EZLA 3QJQB 3QEHB 4G43A 5JQIB 2B59A 3SGDI 5AAMC 4EVNA 4N8PA 1INDH 3Q6FA 5DDHB 1LGVA 1KELH 4PCTA 2XI9A 1P69B 4AG4H 5GSVA 2HFFA 4OQTA 4IDLA 4GT7A 2CHZA 3PWPA 4JS7A 4L3FA 4HZ1A 1OW0C 4M7LH 1QSFD 2WLLB 3BZFA 1FZOA 4HX1B 2NSMA 4PRPD 4P2RB 3FU6A 2V9TA 4PGBA 2I9TA 4G6KL 3RIAK 4UNIA 5DJXA 5D2LE 5FEBA 1JPFA 5K9JH 3JWDL 5FF6A 4PJ7E 2ADGA 4JZOA 1VERA 3II1A 3QRBA 3EH3B 4PJCB 4QRTB 2DYSB 2Q5BA 4KPHH 4O9HH 4R4BA 3CSPA 1RERA 1E5AA 3MO1A 5KOVC 2F2HA 3TJEL 1T5XA 2BFVH 1ZVHA 4OVVA 1NAKH 4L1TA 4MAYD 3MJ8B 2F54E 3VYPA 1A2YA 4AT6A 5LN4A 1HYRC 2P80D 4NNXA 1AQKL 4CVZB 3OVUB 3MV9B 3EHBC 4FQHB 3T2NL 3QDGD 1B3JA 1H5BC 1LP9E 5CZXD 4WTXA 1JVLA 1L9TA 1PCXA 3EOBA 1DQMH 4C56A 5J3HC 1MNUH 1QG3A 1YEEL 1ETZB 3IJEA 4P49A 4HIHB 3H9SA 2WZ0A 5HJ3A 1CQKA 4F27A 4PP2B 2YUXA 3MNDA 2JQAA 5DC0A 4CN4A 2BHZA 3ECWA 4LSQL 5AOMA 1JZIA 3CLEL 4S10A 2AK1L 2IXQA 2J21A 4YDKL 3FSVA 2N01B 1KXVC 3IGAB 4MXWL 4ABUA 2XWJA 3AW5A 4L4TD 3LDBB 3PGDB 3GMMB 2WKOF 1KXHA 1OE3A 3GTTA 4HULB 4I48B 2GIXA 5FDWB 4AEEA 1U3JA 2XQYA 3GSOB 3PP4L 3LS4L 1AR1C 2PCXA 3PL6B 4JG0H 4R5XA 1EGJH 2ZUTA 2V2TA 4WHYH 4DUVA 2C5DC 4B5EA 5E4OA 4GT0A 3RZWA 3FN0H 3HBPA 1A6UH 1NLDL 4OCNC 5E2WH 2QFRA 1I8UA 5ABAA 3GM0A 3MOAH 4QHMA 4ATWA 1VGKA 2AP2A 4GW5A 4NZTH 4YBHA 5JA8B 5ESAB 4PS7A 2P45B 3MCG1 3VU2A 3U4KA 3LVTA 4WO4D 4Z7WE 1A6VH 4KO7A 2BXYA 4IOIB 4U6VL 3F01A 4F7EB 3QUXC 1QSFA 4WENB 1XAKA 1OCWL 4PRPA 2F1BA 3SYOA 4CAGA 4WEUD 5J13B 4K7PX 4XNZB 1QFHA 3FONB 1NCCH 2BVQB 4OJEH 2HKHH 4LKXB 5FYLH 1EHXA 2B39A 3CDZA 4HWBA 5LXGH 2ZUSA 4D0DB 3LZFH 4F2MB 5IJDC 1WBZA 1WZ1H 2VWEC 3K71B 1NL0H 1KPVB 2H9GB 3G3LA 2ZF9A 4XNQA 2X6VA 4YAQB 4B27A 1JV2B 3ARGC 5I1LB 3MLYH 4FYTA 4LMQI 2NR6D 1CDJA 1I3GL 1EMTH 2C1OB 3IU3B 2P80A 2XIIA 3JZYA 3U25A 2XIBA 3MCKA 1K4CB 2HCZX 4JEGB 2EAEA 1UH3A 3KPSD 1QNZL 3QDGA 3SGKA 2WXOA 1IGIH 4UNTA 4FEMA 4S1DC 3WS6A 3ZZLA 2DQCH 3WN5C 3BFOA 3RPKA 1W8EA 3WL9B 5GS0C 2AJVH 2HFGH 2FQEA 5I76B 1R3JA 3TASA 2EQDA 4UT6A 1WSST 4FFZL 4ZMOA 4WV1B 3GSWB 4GAJH 4NM4L 2CK0L 3A0OA 5DJDB 3CVDA 4MBRA 3ZKMC 4GKZA 4HBCL 1E4KC 4HDIA 4HCFA 1GIGH 2OMWA 1GGUA 3QFDB 4GIPD 5T5FH 5DJCB 5DS8A 2IEPA 3D33A 4L4TA 1CDYA 1AGEB 2OI9C 1I7RA 3LTVA 1YYLL 1DCEA 3PFQA 2WINB 3WFCH 1BF5A 4OCXH 2XV3A 4Z23A 2QQKH 4HUCA 4YX2H 4LRNH 4L1DA 4KXDA 4R8WL 2X4PB 2NQCA 2XVGA 3P02A 2IG2H 4NPJA 4W9HC 5EU6E 5JO5A 3NJFA 4AMXA 2IAAC 2ZX9A 3CZNA 2ICWI 3ARRA 4OZHF 3LKRB 5TF0A 4PGCB 3QORD 1MCCA 1T5WA 4ZT1A 5HDLA 4LF3A 3FU0A 4ZUWA 2BW4A 3TWYA 5HD8C 3RWIB 5J6GA 2I07B 4TTDC 3E9UA 1EJ6A 1PJWA 2KMWA 4WO4A 5DK2B 5LKNA 2ZWLT 1U3HC 3EOTH 2C7UA 1JP5A 4BYHA 5T1MB 4TUKH 1IC5H 4KFZC 1TTAA 3D0VA 1A6TB 3EJZD 3MRJB 1CB4A 3BJLA 1D5XB 4HMCA 4PJAF 4DN3H 4M1DH 3TJHD 4S1SH 1PAZA 4M5YL 1SN0A 5F7YC 2X9YA 3H2WA 2BP5M 4P57A 3IRZA 5F9DC 3DX1A 1JZGA 4E5XB 3L4YA 3IMWA 2WANA 3QULA 4NHUA 5TK4A 2EEXA 4F7TB 1E2VA 1YG9A 3U2SB 1KPUA 2P5ED 2NR6A 3NESA 3N55A 3Q5YA 4ZUTB 3RY5A 1FAIL 4P4KC 4CMMA 4OLWL 1BZQK 1NCBL 1HT6A 3THMH 5HGBB 4GRLB 4QO1B 3APMA 2IWGA 3KPSA 4KKPA 5HDBE 5CEXA 4NRYA 4FLQA 1U30A 4IKIA 1T21B 1SYSB 4K5LA 2OL3B 1X9UA 1FE8L 3T3PE 1KDIA 1RUML 4OLXL 2RCSL 4N25A 1AGFB 4KKAD 4FJYA 4ZJ9A 5F7LB 1EEUA 5T3XE 1Y18B 4HIPA 2Y7OA 3B7RL 2VLKD 3E9TA 3QJVB 4G5ZL 2KS0A 5GGUB 3B7UX 3OKDA 4OIBA 4UTAA 4WW2F 4F7MB 1I1YA 1D6VL 1JZ7A 4CN6A 2HPTA 1G9HA 4UDUA 5AFAA 4J5VA 5I8EA 4OV5B 3K6FA 2V5TA 2R2CA 1QFWM 3ZT6A 1QEWB 2C3GA 4KHTL 1TTCA 4XO3A 5EOCL 4ODTH 2ILLA 4WWKD 4G7QB 4D8PB 2H0FA 5TDNA 4HFWA 3NIGE 1B6UA 5AVZB 4F7CA 1O6VA 3GDCA 3LKSA 2ZKWA 5F89A 4TSBH 5E6RB 1TVBB 3TONA 2Y07H 4Q97A 1X5AA 4J3OF 3QORA 4GAFB 1T89C 3FMGL 3FT3A 4KV5F 2CKBH 5H2BA 2FX8L 1JF5A 4KJWC 1HDMA 4UDTA 3SE4A 5LGJA 4UV7H 5AYUH 4G8AC 2F15A 2PR4L 1MPAH 1FNSL 4LCCB 3RWDB 4UQ3B 5I6MA 1E4WL 4FG2A 5M94B 3IYLW 3FUHA 1XBDA 2I25N 5FC9A 2DWDA 1WC7B 2ZXDA 3IM1A 4F37K 5ALBL 1VFAA 3NDZE 2L3BA 1BFOA 2D4DA 2MFNA 3FB5A 1H0DB 1UUNA 3JV6A 2OR8A 4QRUA 4PGEA 4QXTA 3LD8C 2NY2B 5TFSH 2A9MH 5E5RB 4QIRA 3LXAA 3KPMB 5F9JB 4PV9A 4AQEA 2WBXA 2P5EA 1U8JB 1G7QA 4OTXL 4WSKA 5IHHA 3O3BB 1NGWB 1PD0A 4S1RH 4OF5A 4JN1L 3BIAX 4OM1H 2PO6C 3STZB 3EHBD 3WD5H 3NN8B 2OTUA 4GKOA 4I0PC 1IO4C 3QHFH 4M6AA 1RAMA 1UD6A 3QBTB 4UANA 1IBZA 4HK3N 4ZYKA 5CEYA 3GO1H 1IGJA 5EPMB 5I8KL 1KPRB 5BO1L 1E4XH 3WUZA 4CGUB 3CVHH 1J0IA 5J3HD 3D05A 1NANH 1WA2X 2LABA 1LD9B 1HINH 1ADQA 4PY7B 3VUAA 1EXUB 3KPOA 2R4SL 2VDNH 1C08B 2DQGH 5FGBC 1YNTA 1HWWA 1N5AA 1N6QL 1KZQA 5I66A 1QRND 2HRGA 1INEL 3INUL 3CX5J 5C71A 4GXFA 4Z0BL 2GUYA 5E2JA 4JUSA 4QTHA 1S7UB 4Y2OB 5DJ0B 1CLYH 1KXQE 3FQWA 1B0IA 1MKFA 2VB5A 2YMTA 3FHQA 4WWKA 1WEJL 4C47A 4N1CA 2H26B 2GUOB 2EYRB 2H1LM 2NY0B 2P26A 3DIDA 3WEAA 4ALAC 2LLNA 1L0PA 3CN4A 1AR1D 4UT9H 5CAYB 4ZXBD 1M6OA 5EUOE 3IT8D 3VXNB 4TSAH 5FUZL 2H3NB 1RHHB 4G2AA 3SE8H 4Y7MA 3BKYH 1J87A 2VXTL 4ISVA 3UC0L 3L3OC 5F44A 5B1JA 4NQXA 4HWBL 4EUPH 2IV8A 1KLFB 1TFPA 1G4RA 4DTGH 3VFNA 4CRPA 3R4RA 1BQLH 1RLWA 3N42B 4X4KA 1KJ2B 3MNVA 4JFTA 4P9ML 2CPUA 1JZHA 1ZTXE 5D7SL 3ZOAA 3DBSA 4GG8A 4QGYA 4K5OA 3DYMA 3GXDA 1OW0A 2XTJB 1BF8A 3B83A 2BNRE 3QT2A 4G42A 2CD0A 3GRWA 3B1TA 3L7FA 4MXVE 5ID0B 25C8H 4JM4L 3AT0A 2ZOTA 1MIEL 3SJVD 3GSXB 2R8SL 1ZHLB 2XETA 3CUPA 1N7ML 3VD4A 1T22B 2VDLL 3QUZB 2F5BL 3RL1A 5CM1A 4M8QB 2B5IC 3NZUA 5DVNA 5DRXA 4EZJA 4H5SA 1SFHA 2YMXH 5T33L 2CAKA 5GRUH 5ADPL 4UT6L 4HS6B 5FX3A 1FO0B 3SOTA 1TT6A 5K9QI 4M7KH 1N5YH 3US1A 3HZ3A 1XH3B 4X6CF 5G55A 3V5KB 1T2QL 4PAZA 1HE8A 1L9RA 5C09E 3F7YB 3C5JB 2X5PA 1KJ3L 3BKJH 1N10A 3I3DA 4UIKL 2EH7H 1M42A 2DW5A 3ZT5A 4ICXA 5GS0D 5DHVH 1ZIBA 3DURA 3RDJA 4A6YA 5HYJD 4YE4H 3FU7A 3UO1L 4Z8FH 1PQZA 2JTDA 1F6AB 1JV5A 2NY5H 5F7KC 3RUGA 3U4BH 1F11B 4PD4K 1IM3B 1QRNA 2ZCLH 3ZKMD 2GW5A 1VFUA 1C12B 2CG9X 3NPSC 4N0UB 4B60A 4LSUL 1JD9A 2Y2WA 5EO0B 1KXVA 3WJMB 1NPUA 1PJ9A 2O5ZH 1NMAL 3R0MA 4J1UB 3L3KB 1UASA 5E8DL 3VFUB 1YEFL 2WKLA 3SDCB 3ZHLA 4NPYA 5D1XD 2M26A 3PF2A 3DVGB 2JCCF 1T4KB 4TUJA 2CA3A 3L7EB 5C7XL 2OJ1A 4ZXBA 2Y6SD 4ADIA 4ORGB 3R0NA 1CYGA 1R3KA 2WVUA 3B9DA 1RPKA 2A73A 3BH8B 2XX0A 4FZEL 4KI5C 2HRLA 2C9VA 3SCMD 2A99A 2VAAB 5FW6A 1RZGB 4S11A 3VH8G 3VYNA 5HD8D 2X3AA 2ZICA 3C8KA 5SWSB 4TTDD 3SPHA 1WZKA 1NKOA 4NWUL 2ARJA 2NYYC 5I1CL 1FPTH 1U3HD 3T0BA 2B14A 1TKWA 1GOGA 5KANI 4DQAA 5CJ5A 2I24N 3TFBA 1LEIA 4L05A 4BV1A 1U92A 2GK0A 5KSAB 1MVUA 3CSYB 2XWDA 4LEOA 3CH1A 1KYFA 2VN7A 5BW7C 3QIWC 3SJVA 5LGHL 1BX2B 1MHCB 4TNWF 4CC1A 3E6FA 2P46B 3F04A 3U9UA 5F6IC 3LPFA 1KJMB 3CJJA 4U7MA 3KYNB 1Z0NA 2Q7NA 4Y4HC 2VJXA 2X4RA 4R26H 4P4KD 1FYTB 1FVDB 1XQ4A 5IMOA 4GUPB 4RAVA 1W6WA 4U1KB 2ZCKL 2VM3A 2QGDA 4YNYA 2BOLA 2YKLL 4H8WL 2EZ0D 4ZSOE 3R1GL 2DQTH 3B9EA 5C0AB 3ZX1A 5KYNA 1OK0A 3WN5A 1RVFH 1NKGA 4XZUA 1M71A 3WCYA 2WSKA 5IB2A 5HYJA 1SEBA 1XR8B 3CX5K 2OSXA 5JHDE 3HC3L 4JHAL 4KRNA 3W11C 2HFEA 3C8HA 4IW4C 4E42A 1WE5A 3PWUB 1YY9C 2WLKA 3QCTH 2YEVB 2CM6A 5DGQA 1PL3A 4GQRA 1RULH 4HJ0C 2IPUG 1PVHA 4YN3A 3OKNB 4FQ1H 4CU8A 5LAPA 4A7GA 5A6IA 4DKTA 1BREA 1M53A 1PCSA 5ESVB 1KIPB 5D1XA 1WGVA 3T0EB 1BOGA 1E0OB 2UY7B 3VFTA 1LL1A 3QIUC 1FI8C 1S5IH 3CPLB 3GSUB 1I31A 1NFAA 2R0KL 2GTZA 4PRBB 5DJAB 5E6IC 1EFQA 3L4XA 5DJ8B 4GMSH 4IDJH 3EH1A 3MLXL 5C97A 1X7TA 7TAAA 3SCMA 5JW4R 3NOIA 2WCPA 3KLAA 4XI5C 4WGVB 5E5MB 1BSIA 3CZEA 1IE5A 3N40F 2R2BB 1WAAA 4G6ML 3UBHA 2YJQA 1WCBB 2HLFD 2FQGA 1U3HA 1JXDA 3PXLA 4HHAA 4DWHA 4NRZA 5B7MA 4FDWA 3BYYA 1X44A