1V10A

Structure of rigidoporus lignosus laccase from hemihedrally twinned crystals
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
494
structure length
487
Chain Sequence
ATVALDLHILNANLDPDGTGARSAVTAEGTTIAPLITGNIDDRFQINVIDQLTDANMRRATSIHWHGFFQAGTTEMDGPAFVNQCPIIPNESFVYDFVVPGQAGTYWYHSHLSTQYCDGLRGAFVVYDPNDPHLSLYDVDDASTVITIADWYHSLSTKAPPAPDTTLINGLGRNSANPSAGQLAVVSVQSGKRYRFRIVSTSCFPNYAFSIDGHRMTVIEVDGVSHQPLTVDSLTIFAGQRYSVVVEANQAVGNYWIRANPSNGRNGFTGGINSAIFRYQGAAVAEPTTSQNSGTALNEANLIPLINPGAPGNPVPGGADINLNLRIGRNATTADFTINGAPFIPPTVPVLLQILSGVTNPNDLLPGGAVISLPANQVIEISIPGGGNHPFHLHGHNFDVVRTPGSSVYNYVNPVRRDVVSIGGGGDNVTFRFVTDNPGPWFLHCHIDWHLEAGLAVVFAEDIPNIPIANAISPAWDDLCPKYNANN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure of Rigidoporus Lignosus Laccase Containing a Full Complement of Copper Ions, Reveals an Asymmetrical Arrangement for the T3 Copper Pair
pubmed doi rcsb
molecule tags Oxidase
molecule keywords LACCASE
total genus 130
structure length 487
sequence length 494
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2004-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v10A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v10A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v10A03
1ZIBA 5LDUA 2PP7A 2VSMB 5I5MA 2PPDA 2BWIA 1N68A 4HIPA 1GY2A 5B1AB 4G70B 1GR7A 1N70A 2YAOA 3AY2A 3TA4D 4HALA 2OJ1A 3T9WA 1WA0X 4AZUA 4YSRA 3PAVA 2IDSA 4YVUA 1V54B 2PPEA 4L0PB 1J9TA 5IY5B 1RZQA 1CUOA 3NT0A 2FQEA 5I5JA 5E9NA 1BQKA 1BXVA 1SJMA 3T6WA 1A65A 1GY1A 2YAPA 3PXLA 1AZCA 1V10A 1KGYE 1XB8A 2WO3B 1URIA 2ZONA 3OMIB 2GIMA 4YSEA 1OOWA 3NSFA 1JZEA 1MG2C 1SF5A 4P5RA 2YXWA 4BWUA 2XWZA 2H3XC 2DWTA 1AOZA 1YLBB 4NERA 2J5WA 2DYRB 3IEAA 1HAWA 3S3DB 1AQ8A 4G71B 1IUZA 2FJSA 3H56A 4DP9X 4KO7A 3NP3A 3T71A 1ET7A 1TEGA 4GP4B 1IBYA 3IE9A 1ET8A 2YAEA 2BWDA 1ILUA 1EZLA 1AZRA 1HAUA 2IDTA 3JT2A 4PCYA 4DPAX 1NWOA 2XV2A 4KO6A 5PCYA 4A2DA 1JZJA 2GHZA 1WA2X 4AX3A 1OV8A 5I6KA 2CJ3A 3CDZA 4GYBA 3S8FB 3WNJA 3WKQA 2FQGA 1A4AA 2PPCA 4QLWA 1OF0A 1PZAA 4HCFA 4BK5C 1L9TA 3FSWA 2IWFA 4F2EA 1ZV2A 2IDUA 1ZPUA 5D4IA 2FT7A 3EH4B 1AAJA 3X1GA 5AFAA 2FWLB 3QQXA 2AZAA 4UANA 4TXVB 4G72B 3OMAB 1UATA 1MDAA 1MZYA 3NYKA 3V9CA 5D4JA 1OE1A 5TK4A 2HX9A 1J9RA 1TU2A 2BP8A 2X87A 5A7EA 1AACA 4ZK8A 4KO5A 3UGEA 1M56B 3WG7B 2BZ7A 2Y1AA 1BAWA 2NRDA 2UX7A 4E9TA 4DP6X 3QJUB 5D4HA 4HCIA 2BHFA 1NWPA 1SFDA 3HEIB 5I6MA 3CVBA 1JOIA 1TKWA 3NJNA 4DP8X 1J5DA 2EIMB 1E30A 2VW7A 2YARA 3PLYA 4BXVA 5EHFA 3GYRA 2IWEA 2BP8B 2H5UA 4CSZA 4YSSA 3V9EA 2VM3A 2LLNA 3SBPA 2ZOOA 3T6ZA 4M3HA 1E5ZA 1E5YA 2HRHA 1NIAA 3FPYA 3ABLB 1ADWA 3UABA 3GDCA 3CZUB 1ILSA 1AG0A 3S3BB 1CURA 3NSDA 5TK2A 1ASPA 1NDTA 2FTAA 2GSMB 1JXDA 3UAAA 3WI9A 3QJTB 1JZFA 2BW4A 1L9OA 3X2QB 1ID2A 2VW4A 8PAZA 3FSAA 2VN3A 5I26A 1V55B 1M9WA 2J56A 1KCBA 3ABMB 3FQ1A 3OD3A 1RCYA 1AR1B 1XB6A 4A68A 3EF4A 3TASA 1JERA 3BQVA 1GS7A 2XX1A 2XUWA 3NJKA 1A4CA 2AANA 2XU9A 3T6XA 3FYIB 4GP8B 2FT8A 2GC4C 2MTAA 3NJJA 1NICA 1OE3A 4BWWA 3FU9A 2EILB 4YSOA 3L45A 1NTDA 4HHGA 1R1CA 2TSAA 2YAQA 1KDIA 1GSKA 2HZHA 3DIVA 1OE2A 2H47C 4YSQA 1NIFA 3WIAA 3EHBB 2PCYA 4QKTA 4N8UA 1JVLA 3IN0A 4WKXA 3H4FA 4ENZA 1FA4A 2AFNA 5I6PA 2XYBA 1L9RA 2XVBA 4A2EA 2DYSB 2W88A 1QLEB 4AI7A 2QPDB 2WSDA 3WKPA 1PF3A 3QJQB 3GXUB 3IBOA 1PAZA 1BQRA 2XV0A 1AS7A 2JXMA 4A67A 1B3IA 1PLBA 4G7QB 3RYMA 4A2HA 2IH9A 4WTQA 1EHKB 2QPEB 2QDVA 1I53A 4G7RB 1AZNA 5ANHA 1SNRA 3ZX1A 3OQRA 1PNCA 1PY0A 4E9YA 3MBWB 1JXGA 3NP4A 1RZPA 4BWTA 4KNSA 6PCYA 3CDZB 4BXSV 9PCYA 2DV6A 1MG3C 2B08A 5I6LA 4JHUA 1AS6A 4JHVA 3SQRA 4BDVA 4YSAA 2IDFA 4Q89A 1ET5A 4GP5B 4HZ1A 3ZBMA 4KOCA 3KW7A 4YSUA 1QNIA 4AKPA 1PZCA 1PCSA 4FA7B 2IDQA 2UX6A 4E9VA 3X1EA 2OV0A 1PNDA 2N0MA 2XX0A 4E9XA 2DWSA 1X9UA 1W6WA 3FQ2A 1CC3A 1GW0A 2UXTA 5AKRA 1WAEA 5B1JA 1AANA 4DP5X 2IAAC 3FU7A 2BP0A 4FAAB 3N2JA 1NIEA 5B7FA 1E65A 1SHWA 3EH3B 1AIZA 3FYEB 2PP9A 2HRGA 3OMNB 1BXAA 1OCOB 2Q5BA 5AZUA 3S8GB 2WO2B 4F2FA 1A4BA 1PMYA 3MX0B 3S3CB 1CYXA 3EH5B 1AS8A 3X1FA 4DPBX 1VLXA 3AW5A 3IN2A 4DP4X 2J55A 1PLAA 1HFUA 1A8ZA 1KDJA 1KV7A 4DP7X 4K9JA 3QJVB 3SBRA 4DP1X 1BYPA 2FNWA 5F7AA 3QPKA 3ABGA 2YAHA 2BP0B 4EF3A 2I85A 3FPXA 3PAUA 4KO9A 3TBBA 4GY4A 1OCRB 3ASOB 2P80A 1FWXA 1NZRA 1ASQA 2AZUA 4JKNA 1GS8A 1JZHA 2PPAA 1KBVA 1TEFA 4W1TA 2GI0A 1NPJA 2R7EA 2VMJA 1NPNA 3NJGA 3FU8A 3PPSA 3FSVA 3AG4B 1M57B 2XXGA 2IH8A 4M4RB 1AZBA 1IBZA 2XV3A 2P80D 4KOBA 1J9SA 2UXFA 4GXFA 4YSDA 4PAZA 3NSYA 4YSTA 2I7OA 5B7MA 5B7EA 1J5CA 1GS6X 2ZXWB 1L9SA 2FQDA 4YL4A 2VM4A 2FT6A 2CALA 3SBQA 3D12B 3FSZA 2X88A 3U25A 1L9QA 4BDVB 4UF7C 4RH4A 3FT0A 1AG6A 2YAMA 2BZCA 1SDDB 2CAKA 3TBCA 1KYAA 3ZDWA 5I28A 4YSCA 4AKQA 3CG8A 2HX8A 1NIBA 1ASOA 1F56A 1ZIAA 2YXVA 4HHWA 3G5WA 3FU7B 1ZDSA 4MFHA 1L9PA 3FS9A 2DY2A 2UXGA 5B1KA 2JKWA 1GYCA 1NINA 1SFHA 2PPFA 2PLTA 5B1BB 2PCFA 2EIJB 2YQBA 2HXAA 1BYOA 5FC9A 1KBWA 4AKOA 5I5IA 3AG3B 3CVCA 3N55A 3QJSB 2GBAA 1DYZA 3ABKB 1WS7A 1AZUA 4E9WA 3ASNB 2QT6A 3DTUB 2TSBA 1IKOP 2EINB 4G7SB 1FFTB 4KNUA 2J57A 3NJIA 2Y69B 2ZWNA 7PAZA 3JTBA 3PAZA 2BW5A 4A2GA 2RACA 2BO0A 2E86A 3QJRB 1DZ0A 1IC0A 1JZGA 2GC7C 1E67A 2VW6A 2R7EB 1J9QA 1A3ZA 3HB3B 3T6VA 3X1NA 1PLCA 3BVDB 4DPCX 7PCYA 2B3IA 1SHXA 2A3TA 3UADA 3WNIA 2IWKA 2W8CA 4HAKA 2CCWA 3AG1B 2VSKB 3ERXA 4Q8BA 3OM3B 2PP8A 2QDWA 3UACA 2AVFA 4NAJA 4W9ZA 4UAHA 3PCYA 4NB7A 1XB3A 2FQFA 2CBPA 1BXUA 5B3SB 2OCCB 4HCGA 2Q9OA 1JXFA 3NJLA 5I6OA 6PAZA 1WA1X 4P5SA 4X4KA 2YAFA 3NJFA 1QHQA 3AG2B 5B1JC 1BQ5A 1WS8A 2MRYA 3NJMA 4YSPA 1OCZB 4KNTA 4E9RA 1X9RA 1CYWA 1OCCB 3UAEA 3ZIYA 1PZBA 3NJHA 1SF3A 1NIDA 5F7BA 3FQYA 3TU6A 1T5KA 1W6LA 4E9QA 3X1BA 4DP0X 2XXFA 1W8EA 1MZZA 4DP2X 1ETJA 4F7KA 3CVDA 4N4YB 3AZUA 2I7SA 2UXVA 1JVOA 4A66A 4E9SA 2JFCA 4YVNA 3NSCA 1ZDQA 2GB2A 1JZIA 3C75A 4A2FA 2CUAA 2HX7A 4CSPA 5PAZA 1SDDA 2XLLA 3H4HA 1XMEB 5I6NA 1KCWA 2EIKB 1BEXA 3DKHA 3KW8A 2HLEB 1RKRA
chains in the Genus database with same CATH superfamily
3OKKB 1R19A 2FHBA 4PIBA 5EIVA 3T04D 4APQB 3MUUA 5ENWB 4R26L 1RZ8B 1UH2A 4ODUA 3SKNA 4OSUL 4RQQB 2I27N 4AZUA 1VKXA 1IFHL 2W65A 3PAVA 3ZKQD 4DVRL 2P8PA 4IU2A 1TTCA 2VNCA 5ERWB 1JK9A 3VTAA 4POZC 2VLKE 1HE7A 5B3JF 4BUHA 3D05A 4UI2A 2WO3B 3UTQB 5DHYB 1T20B 4IHBA 2EVFA 4A1RA 3TL5A 3AT9A 4G8GD 4JRYA 2YXWA 3FT3A 2B1HH 3GK8L 1SUHA 2ARJB 3T65B 4H8VA 4FNQA 2VLKB 3W9EB 1DBAL 2BCKB 4XVSH 2BNQD 4Y1AA 1FGVH 2VXVH 3FU6A 4XMKH 3VJ6A 5E24E 1DVFD 2DWXA 3AUVA 3L5XH 5A3IC 2ODIA 1OPOA 2R4SH 4K94H 3K74B 4MCNA 3RWEA 5ISZB 1IILE 3BRGC 2OZ4A 2AKRB 1NC2D 1WISA 4GO6B 4V2CB 3WL9B 1AFVL 1Z2KA 3HMXH 4DK3A 3I6LE 1ZA3B 2XI9A 1PW3A 1WGOA 3ME0A 4HUWA 4AK2A 4WCYL 1IM9A 1SY6L 1WA2X 3KXFA 3LQAH 4MDRA 3MFFB 1U0QA 4EZLA 4I77L 4QXTA 1S5IH 4JZJB 1OTSC 1HYSC 3FCTB 2ZCHL 4LCCB 2FQGA 2OR8A 4MVBC 4QLWA 2E9BA 1MWAH 3BIBX 2BPBA 2HG0A 3DX6A 2CKBL 2PWEA 3P3UA 4OKVB 4KGLA 3C9NA 3DPDA 2DRUA 4A6YL 4J4PC 1DQKA 5G4OA 3T8XB 1R0AH 4HLJA 2WXHA 5H37A 5J1AA 3ZE0F 1B6UA 1BVLA 2HTKD 4JFFD 5E8DH 4IRSD 2KZBA 3ARFC 1FQ9C 4YHMH 4RRPM 3V9CA 2RJMA 2AAVA 3AWFA 5DRWA 3UO1L 1X5ZA 1JHKH 4HSQA 3APDA 4JW3A 4R4BA 4EIZC 3LIZA 2V5RA 1EXUB 1XCTB 2WVSA 1TEYA 4DEUA 2CA4A 2V9RA 3DO4A 2QQLH 4ZO6A 3VFVB 5MEPA 1GA2A 2VDKH 4FDWA 5C0BE 3RDJA 1H8LA 1U95A 1T66C 4K4KA 3PGFL 3Q5YA 4X6CF 2KPNA 3BDYL 5C6PB 2KZ1B 1MI5E 5EZOL 2H7WA 2ZOKA 1OP5K 4CNIB 3FCUB 2L04A 2J2ZB 2OK0L 4FQXD 3QNFA 4M7KL 3D4CA 1BMWA 2QHRH 1ACYH 5F9JA 3P3TA 4XVTH 1RK1B 3N91A 1NGPH 3N41F 5HYSA 1S8DA 1NSNH 3E9TA 4Y1AB 3LXAA 1VIWA 3V9EA 4IMLB 3MRGA 3LNHA 1WD9A 3KBHE 3LKQB 4PJFE 3SE8L 4PI0A 1BIIB 1VDGA 3RL1B 1NIAA 4WJ5A 3DO7A 4X98A 2R69L 2A6JB 1EJOH 4WEBL 1QEWA 4JPWL 3WKNA 2UVFA 3QIUA 1EFQA 2AQSA 1EO5A 3HCVA 1NGXA 2YBRA 3HBQA 2CHXA 1KTRL 4WFEE 5T3XE 3O3DB 1J5OL 5EUOE 5IBUG 3L3DB 1L9OA 1QASA 3OGOE 1I1YB 4P05A 4X6DA 3FAWA 5IB3A 5JXEA 3FSAA 1IT9H 5SV4A 3BJLA 4QNPE 3SKMB 3QUXD 4KK9C 2UZIH 1MAMH 5D2LE 2CKBB 3IMUA 2PKDA 5E1IA 1AQDA 5CS7A 5JW5A 2NT0A 1L0QA 2E27H 3JV0A 2ZXBA 1J0KA 4JN2B 3BQVA 1GS7A 3NIFB 2EUXA 4RFNC 1CI3M 3F65A 4IBVA 3NDZE 4YDKH 2EILB 3FB8B 4K5PA 2HTLC 3DECA 2WSPA 3JUZA 4PEEA 3MMEA 4TQ8A 2NZ9D 4EPSA 5FO8B 3D08A 2YAQA 2KUTA 3SZKC 2AJ3B 2OP4H 2XN9A 4YDMA 1IC4L 1SEQL 2X4SB 1W15A 1UH4A 2YGVA 1NIFA 1RURL 4L5FL 4X0KB 4Z9KB 5I82A 4YSQA 1QEWB 1VPOH 5AAMA 5EZIL 5CN3A 3K7UA 4MAZA 3EYUH 2WYTA 1NCWL 1T80A 3KPRD 3QUYA 2A0LD 1NUNB 2XYBA 1GZPA 5D1XB 3F12B 4Q9RH 4HJTA 3MRNA 1TT6A 1E4WL 2QPDB 5JLZA 4DERA 1BAGA 1QWHA 4XNXH 1JPST 4S1QL 4A2LA 1G0YR 3G6AB 5B3JE 1WHPA 3RYMA 2GEQA 5DJZA 1HHGB 1F2QA 1VFAA 4OM0L 1CR9H 1MHCA 2F9BT 4YR6B 5C2BH 3HRZC 2YD7A 1WK0A 3O8XA 1CPUA 5GHWH 4ZYKB 3S7GA 1BWWA 3N85H 2QJDA 3NQIA 5DLLA 1E40A 2OXGA 1TQBC 3HNTL 3P54A 5J12B 4F8TA 5C09D 3A67L 1I9IL 5HDOA 3Q43A 1UJTA 2CGRH 1MDTA 1MXDA 3WJLC 2D7OA 4S2SA 1M4KA 3RQ3A 5CD5C 4OQTL 2R69A 4JDVB 4JKKA 2QGCA 4RWYH 3E0GA 1JWMA 2YKLL 3BLKA 4OD3H 5DEGA 3ZGIA 1IIKA 2V7HB 1KIQB 5E6ID 1FL6B 3FB6A 4P3WA 2HP4A 1AANA 4Y19D 3CSTA 3DVFA 1MVUA 1T2XA 2PO6A 3ARGA 1JUFB 5ECJE 2LU7A 5KSAC 5CIPH 1NIEA 3D85B 4L8DB 3S5ZA 2EDNA 1L9MA 4D9QD 1SHWA 2DQ6A 4MNHA 3SN6N 4K3DL 5GRVK 4HLZH 4M7JL 4NZUH 5D7IF 2Q5BA 1YC7A 1QABA 3L5HA 4QTIL 5DUML 3BP6B 1IM9B 3KXFB 5EV7A 1A4BA 3WJMB 3M86A 4JM2C 4P9MH 5K1VA 1CYXA 4G7YH 4D0DB 5DRNA 3WO3B 2YSSA 1F42A 3VYPA 3QZBA 1P4LB 2J1ZA 1NANI 4J3TA 3CC1A 4BKTC 1VJSA 1V7MH 4PJXF 3CX2A 4B9CA 1DDTA 1BPLB 1Z9SA 3QJVB 4JFSA 5E6IB 4N8VA 1Q94B 4HEME 1CE6A 3D48R 5DJCA 4PRDA 4AGPA 5F7UA 1SMOA 3E9UA 5IOPB 1THAA 4QF1B 4ZPVB 4NRZB 4LAQL 2DIAA 2BIHA 3IKCA 5JOFB 5T3ZH 1YZZA 1JZHA 4GSXA 3ZTNH 4YHYC 1LO5B 3VDAA 4WUUB 5IJBC 3K72B 3TH3T 2JWYA 1FSKB 5ES4B 4BH8B 3REWA 5FECB 1KIRB 1IGCH 2L7EA 4IU3A 4WDIB 1BZQK 4ATTA 1CL7L 4XN2A 1YMME 1F45A 2JB6B 3NIFF 4HUUA 4F15B 2YGNA 4UWQB 5IHZA 1RZKH 3KCPA 1RIUL 3MLXH 4N2EA 4YFLI 4GXVL 3DX9B 5T1KB 3FFDB 5INDA 1U8MA 2XTLA 5IOKA 4ZW5A 1B2WL 2GJRA 2FT6A 3WFHA 4Z8FL 3D12B 4JZOB 3QAZC 3L3OC 4MAYA 5HDBE 1RZFL 2YN5A 5FO7B 1AQMA 2LTQC 1WP6A 3FT0A 3W0WA 4J6RH 4O02L 2CAKA 4M3JA 5D55A 3ZDYE 4M61A 1L5GB 4J23A 1R5VB 1WC7B 4WI4A 1NANH 3BD5A 2ZKXA 2A9NH 2HA1A 2UY7B 4PRPE 1URZA 1L9PA 4XHJC 2M8XA 5EEUA 3CK0L 3HJEA 3EBAA 1GYCA 5C09E 4AL8C 2HT2D 4YHLL 2JI3A 5DUPH 1XXDC 2IGFL 2OMNA 4FE9A 4HD5A 5J6GA 2I60H 2C3XA 1YNLH 1XR9A 2WQRA 2XA3A 3LQAC 4YDVA 5I5IA 4JMXA 1A25A 1TITA 3BEWA 3BWAB 4YGVB 4XC1L 4PG2A 4D3CL 3PL6A 4W4OA 1AQDB 5DHDA 5JW5B 1TJGL 1YMMD 2QV4A 4Z7QB 4IBLT 1P7QD 3PWJA 1RZ7L 2ADFH 1BVKA 5BXFA 1E9QB 5KVDE 2ZWKA 3BP4B 4UV4L 2FEJA 5F1IA 1H3XA 2J57A 3F83A 3QDMA 1DANT 2O5XH 5MHSE 3EGXA 5LWYH 2VL5B 1DZ0A 2GEEA 4HSAC 3ECQA 4HKBA 1AGFB 4X5WB 1E5UI 1G7LB 1NL0L 5DA4A 1QFPA 2XA8L 5JMOC 1CTMA 1IJNA 1YQVH 1SQMA 2NTFB 4JFFB 4JHWH 2N0KA 4UM9D 4CA4A 1X44A 3SJVB 3RIAF 4FXGB 2VDMH 3CZKA 3FCSA 1GC1C 3ERXA 4WFHE 1DBJH 2QDWA 4Z5RB 2AVFA 2Z7YA 2F08A 4D7PA 2EDRA 2ZT9C 3ULAB 2XFXB 1E4KC 5K69A 1SLXA 2CBPA 3BCFA 1O9ZA 1YEEH 3V6ZA 5HYEA 1WWWX 2F68X 1PSKH 3E80A 5KW9H 4QRRA 1S7WA 4JMNA 2WVUA 1I8MA 4KTDL 3GJEA 2Z64C 2MNUA 3L4XA 1N64L 3O2DL 1EVUA 1YEKL 3SOBL 1JNHA 3RX8A 5GGVH 3RWFA 2JIXD 5I19L 4XH2B 3MRFB 1Y0LA 1T0OA 2NZ9C 2IPTL 3TURA 5GGRB 1SF3A 4PMEA 3MROA 2HVKA 4LF3B 4X6EA 5BUPA 5CBAB 1WWBX 2OMVA 2YWYA 2R56H 3VE0B 1FVEB 1W6LA 3RNQB 4HX1B 4TKWA 5MEPB 2G3NA 4HPOL 3VFVA 3WEXB 2G9KA 3MKKA 1KCUL 4H8HA 2OTWB 1T03H 5C09A 2I5YL 1MFDH 1R17A 3GBML 4AM0B 1L7IH 3TA3A 5FF6A 4UM9A 1U8QA 3VXRD 1MWOA 1AH1A 4PUBH 1SJVA 4WFED 2V8LA 2YRLA 5DC9B 1ZHLB 5D7HA 4OFKA 5E2TL 5J6HB 4XP4L 5IKCA 2XWDA 3D69A 4IRZL 3UDWC 1GGUA 1IBGL 4Q56A 3V4UH 5AD0A 5CD3B 2X12A 1ZJBA 3OXSB 4JG0L 1KCWA 3DKHA 1NAML 4GEJA 1WT5C 2JKLA 3V4PH 4OI8A 2IG2L 2CMRL 5LDUA 4PY7B 2V6HA 2WLMA 2UY6B 2PPDA 2A5UA 3CSBA 4ORGB 4X9IA 2HKHH 1HK6A 4M43L 3N9GL 4CAGA 4TQEH 3GZQA 1P7QA 3KDPB 2J8UE 1AI1L 3IDNA 1QZ1A 4P4KC 5JIIA 2AAAA 3KPQA 1YPZF 1C5BL 5IY5B 3BUBA 1I7TB 4XNUH 2FQEA 2V0AA 2I25N 1NBYB 3FQRA 3Q2LA 3TN0B 5KTEH 5KN5B 4OW6A 3WUWB 4Q6IC 5F8RC 1IB5A 1KIPB 4LNRB 1A5FH 5F0PB 5IIEB 1CGSL 1KULA 1QAWA 1C7SA 4J3UA 2BOCB 4KI1A 2AEIT 1EQWA 2X6MA 4PJAB 1E5CA 4ELME 1V5JA 1XH2A 2A74C 3CSPA 3GKWH 1QNZL 2LT9A 2HJKB 3NPSC 5IVOA 2KZKA 1ZT1A 1SXNA 3BKJL 2ZF8A 1F11A 5H4ZA 1GVIA 3B83A 1I1AB 2GFBB 2CQVA 1GGCL 1G1KA 5DUBB 1C5CL 2NTSP 3EOBA 4YFLF 3BT2L 2WCGA 2OTPA 2PCPA 5AAWC 1X4YA 1GGBL 2G0LA 5TPWL 1LDPL 2ODHA 4N90D 4Z95L 6CGTA 1LP9F 4PJEA 4OVVA 1SN2A 4AX3A 3I6LD 4XE5B 3VH8B 1BQHA 2A73B 4IBZA 4BH7B 5E5MA 5CCGE 3D4ZA 2P8LA 3AT0A 3QEGH 1PZAA 3F3HA 4HCFA 4TVUA 1Z9NA 5FGSA 4C4KO 1IJ9A 1YCSA 2H6UA 3ATAA 2NY3B 2DL9A 1ZPUA 4JY4B 3TIEA 2C4XA 3DX9A 3PP4L 3WEOA 2C5DC 4XI5C 5EEZA 1JBJA 4KK8C 3QPQD 5F0MB 1RJYA 4E9LA 5IV2A 3KR3L 1ACCA 4ZMVA 1UEYA 3TEYA 1JNNH 3EGDB 3G3LA 4FKEA 3DXAD 5F3HB 1V3JA 4LZKA 4KROD 4NQCB 3FUDA 4EN3A 5F1OB 4YQXL 4ZK8A 2W07A 4I8DA 2MOGA 2DKUA 2FVNA 4JO4H 2XQYA 2NRDA 3QWOA 4JFWA 1I9JL 2PYFB 5D4HA 4L1BA 3D25B 3RUGB 3V4PB 4AW4A 4LIQH 4L1LA 4OCWH 4UU9B 2RTTA 2WLZA 4PJGE 4WI6A 2NY3D 5CGMA 4FHBD 1RY7B 1UD3A 1OSZB 2FBJH 4GMSL 3V79C 1Q90A 5I1JH 4MA8L 4WY7H 4PVBA 3U7WH 1T1YB 2E4TA 2H32A 2W9EL 3UBFA 1OCWL 3O6LH 1FYTD 5DJYB 3ZT6A 3AQYA 3MODH 2AQ2A 4FZ8L 4JM2F 2X4OB 5EU5A 1UACL 2AJSL 4YBLC 3A21A 1KEML 1U8PA 5GJTL 4ILDA 3X17A 4L4JA 4BSWB 5IB2B 4F2MB 1H0DA 4JFPA 3MBEC 2O93L 4F33A 1J1XL 4IRZA 4JREB 1FG2A 1FVDA 1B0RB 4DAGL 3VGFA 2OMWB 1OTTD 3PGCA 4LRNH 4KV5F 4DEPC 4GW4A 4LSUH 1A3RH 4B53A 1HIMH 3BSZL 1NBVL 2EP6A 4J3OC 3MLWL 4A38A 5D1QA 3D0AA 5FYKU 1IM3D 3T3MB 2EYSA 2YPVH 4UQDA 4ZFGL 1JRHH 5F70A 3NK3A 1KCKA 1CICC 4NBXB 3SO5A 5K5YA 3HE6C 2ED7A 2ETWA 1R3IH 2VQ1B 5EWIL 1KNOA 5J8OA 2XX1A 4FA8A 1ES0B 4I9WE 3IDNB 3BXNA 4FG6C 1LO2L 1QW8A 4LLMA 4UBDD 4JZNA 2FE0A 5EUOA 3F6IA 4DESA 3GMLA 4DK5A 2YMXH 3RL2B 4JN1H 1B6DA 1QPXA 5JHBA 4KX9A 4W6WB 4PJDB 1T5XB 4R84A 1P5VB 3QO0A 4AEIL 4L18A 1INQB 3S88H 2NZ1A 1K8DA 4FXTA 2ZUQB 3IN0A 4PWGA 3LIZH 3QE5A 5IW1B 3S37H 1ZHLA 2Y7MA 4K3EL 1KGCD 1WITA 3MV7E 4U1LB 4CDGC 1LMIA 3T65A 4Z7UF 4EDXB 1CK0H 2BVUA 3GUTB 2K45A 3PQYE 1PAZA 3RWCB 3QHTC 3L4VA 1BQRA 1Q72L 2VO5A 1MNUL 4ZUUA 3D2UB 3BT0A 3V52L 4A67A 4KI5F 4IDLA 3IPEA 3T6QC 1VEMA 1XGYH 1XF5A 1WZ1L 5LCVH 3HUJF 2VZTA 4KZEL 2A9MH 1SNRA 3HC2A 4LCWB 4WU5A 2GTZA 4TTDD 4WTXA 3TGXA 1UASA 3WXVH 1MHPH 1PZUB 4HOXA 1CN4A 2Z31A 1J12A 1PCXA 1KYUA 2GBUA 3J8F7 3DX2A 5D7SL 4Q6IA 1UM5H 2NOYA 2V33A 4H88H 4KFMA 5C2UB 2EIZB 1UM6H 3GXDA 3DUUA 4OB5H 3L5WB 4JJ5A 1VFUA 4ONFH 2GTZB 2DJMA 5HGAA 1WYJA 4X4YA 1NEUA 5FKAB 3GLAA 3MRKB 4V33A 1IGYB 3V6ZB 3NUKA 5GRUL 1E5BA 2AW2A 3QHZL 4JFHE 2J6WA 5C07E 4ANKA 2C9SA 5IFHL 2OMZA 2YZ8A 3T0DA 5DYOA 1CICA 4TSAH 5EFIB 2EUZA 1E3XA 4MD4B 2JIXA 3CN1A 3NZSA 2V3DA 1D5MA 3MLUL 5DZPA 2MFNA 4F8OA 2X42A 4P4KD 3UDWA 1NBCA 1ZV9A 3SDAA 1ZV5A 5D93C 5GRWA 5J13C 2QSQA 5IUCA 2DQGH 3WNPA 4ODBD 1IC7L 4HOMA 3TO4B 2OCFD 3BD3A 1NUGA 4J3OG 1VA9A 4PRNB 5HHOA 1AGCA 3I75B 3WIHH 2XZAH 5DD1L 1BQSA 4I9XA 2FJHB 4NRYA 1DJWA 2IQ9H 4R4NC 2VN5A 2Y2TA 3FO2B 2Y4SA 4L3EE 5C8JA 2ZCLL 2OSWA 4HCRL 5F96L 2EEBA 1SOSA 5ICUA 5BO1H 1UWEH 2YSTA 4OF5A 1YDPA 1KNOB 3V0GA 4CSTA 1PD1A 2PW2B 3GIZH 3DXAE 5KSBB 2M1KA 4ETQB 4JKNA 4ZO9A 3K2UH 4MNQB 4YH6A 2MCG1 4P0DA 1EAPA 3GJFK 3WFDH 3P3SA 4KZCA 1B4JH 3DV6B 3U30C 1XCTA 1NPNA 2Z7WA 4D8OA 4Z0XB 3OKMB 1OVZA 2XIIA 4AL8H 4N5ED 2MOQA 2XXGA 5EU6A 1LE5B 3MOAH 1I8AA 2OMXB 1SOQA 3TVMA 4JKPH 4OLXH 2GK0A 5EIIB 1JZDC 3BAYA 3IWVA 3QUHA 4LSPL 4PAZA 4NC1C 3V5HA 4YSTA 3SCMC 5JQ6L 3GMPA 1GS6X 3WCYA 1GH7A 1L9SA 1NBZA 4Y4KD 1RIVL 3CVHH 4HGMA 1U8PB 1Q9KB 3NAAL 3OKEB 5DR5H 3PV6A 3FC8A 1HILA 4G8GB 4UOZA 1RUAH 1S9YB 2DBLL 1LEKB 3K2MC 1FVDB 1O9WA 4U1GB 3MGAA 1TO4A 4J6IA 4PJ5A 1MFBH 1KB5B 1UD5A 4Y5YA 3JYCA 4J3BA 1DP0A 4C56E 5KG9B 3PRZA 1D3CA 4PS4L 3EHBD 3IGLA 3ROOA 3I9IA 1DTUA 1F90H 4N20A 4XPHL 1QSEA 4F7PA 2F58L 1D2OA 2O1AA 3BZ4A 5KYUA 2FRGP 1ZVSA 5E0FA 5FYKE 1WEJL 1IGFH 4QJ3B 3VH8G 4R7LA 4XVJH 1KB5L 2JKRM 4KQ4H 1CXHA 5ID1A 4HPYH 5DO2D 5E2WH 4JNXA 3W57A 2DIBA 4M62H 3SDDD 3BZ4B 1UGNA 3K6IA 1XZWA 4A7UA 3ZJAA 3IVKB 3CV5A 1A7PL 2A6DA 1TUPA 4HK3J 3FO9A 4RAVA 3TEUA 3P11L 5GISH 1HWWA 1M6OA 2H8PA 4G8EB 3ORJA 4X8XA 4MCMA 5AYTA 5BRZA 3TIEB 3C2AL 2RACA 4R0LA 4XRCA 5E4AA 3ULUC 5DD0L 1QKZH 1I9RH 1V27A 4LU5L 2HFGL 5F21B 4QXVA 2YGQA 3O6FB 4B3EA 3UX9B 3HI6H 1OSEA 4NIKB 2O5YH 1BJ1H 4FI7A 4GG6B 3MV9A 4K15A 5GZNC 1H6TA 4M4PA 3P9MB 2OYKA 3VWJD 2WANA 2R8SL 3BP4A 4R8WH 2P8LB 1ZTMA 5F9AC 4EO5A 2ZOLA 4M6NH 5E5RB 4XMTA 1T7VA 1E2WA 1FGNH 4JHBA 1X5XA 4AW7A 1SBBA 1CGVA 5HTSA 3SDCA 4FL4B 3B2XA 4LEXH 1UOLA 4R7DB 4EOWH 3LTVA 1XD1A 1QSFE 3UTSB 1ESOA 3VXSA 4G7VH 1KG0B 1VCAA 1A7RH 4CGTA 3WTYA 4UNIA 4YSPA 3WMQA 5E6UB 4KNTA 2AJYL 3K1DA 4YUEH 2VSCA 1OCCB 3PDOA 5D70H 3LEYL 3P0YL 3ZIYA 3VFOA 2ITDA 2DEWX 3MNMA 5IW3A 1NIDA 4H26B 3ZTJG 1R3LA 4AYMC 1WFNA 3UJTH 4C55A 4YDIH 1IFRA 4I0PB 3T77B 5HPMA 4KUCF 5E00B 3X1BA 2X4UB 1XVSA 1W72L 3M1BA 4M6MH 2FX9L 1HEJC 3WLWD 3T2NL 2XQBL 2VDQB 3GHBH 4HD9A 2FSEA 4DSYA 5GS0L 1E5AA 4KV5E 4PRIE 4R9HA 1HEZA 4LARH 4POZD 5ESVA 4IIQB 3RGVB 5E94B 2P48B 3UGUA 2HT4D 3BKYL 4LGPB 1MCPH 5D1QC 5JO5A 1KBKA 4WFHD 1GKOA 3DX0A 4QHNB 1JN6A 5C0EB 3L3GA 5KANI 5C0DB 4I2XA 1FFQA 3PY9A 2UYLB 3OMZA 1MREL 3QJXA 4JM2B 1WSST 4Y5VB 3PFQA 3ASWA 3D3VA 2FZ3A 5AALA 4HFUH 4BUQA 1OF2B 2F7QA 1FL3B 2VRKA 3OR7B 1WLHA 1DVFC 5AB9A 3TA4D 4OFPA 1AY1H 1DQIA 5GGUB 5CLTA 3BSGA 3D34A 2XNAA 5DUJA 5I75B 4OZFB 1IAKB 4GBXA 5KYXB 5D7IE 5ACZA 3GXIA 5GGTL 5J6HA 1XDTT 2CLVA 3T09A 4RMUA 1TJMA 2EEFA 4PRIA 4ZXBD 4LSVL 2P7TB 1R9FA 4N8VB 4IM8A 1FYTA 2YK1L 1URLA 3DGCR 3OMIB 3SBWC 4BSVA 2VYRE 4OLZL 3HUJB 1MG2C 1CVSC 1ZWIB 3OKLB 3LKOB 3TOPA 3MLPA 2XWZA 1IGML 3C5JB 2XN9D 3DJTA 3LZFL 2WNKA 4KHTL 2ZAHA 3Q01A 5CIPA 4KZDH 3MR9A 1MFMA 4P99A 1A6WH 4L8SC 2R83A 4F9LC 4LESA 1AE6L 4X7FC 4TUOA 2VABA 4J4PD 1FBIL 4EQ3A 4QRRB 3AACA 1AQ8A 4G71B 4OLVL 3MRFA 5LG1A 4TPRL 4ZQKB 4YXHL 4ODWA 15C8H 2XWJA 1FAIL 5KZCB 1IE5A 3D2UD 1EZVX 1I8LA 3L3OB 3LZNA 4GP4B 3WJJC 4GKOA 3KM1A 2AS5M 4F93B 2JB5H 5DFVC 1BBJA 1Z5LA 4QO1A 3QJOA 5IEKA 5IBTL 5DJ2B 1OV8A 2DWYA 4ZMQA 5IW6A 2WVVA 4Q74A 5E1AA 2HVBA 4JY5L 3BUDA 5D71H 3KPNB 2FHFA 2PPCA 3TM6A 4PVLA 2VLMD 1RSFA 3VTMA 2PETA 4NN5C 4BK5C 5IM7A 2ZQKA 4FFTA 2PXYA 3FUIA 1ML0A 5J3HD 3TBTB 2FWSA 4LDOB 1PEWA 4L9LB 3NA9H 4X7TB 4ATWA 4OI7A 1O7VA 2FWLB 5I71B 1BZ8A 4X7SL 4JFEB 3SKOB 4HJ1A 3EADA 2LE9A 4HKBB 2FATL 3OKEA 3CFJA 5ESAA 3TESA 4WI3A 4XNZC 5LUMA 4U6XA 2DTSA 4MTMA 1AQKL 4OFDA 4MCZA 5CJOL 5KVFE 2C1PB 2X7LA 1WFUA 3STLB 2GIXA 2O5ZL 4WO4D 3SYAA 3B9VA 4RWHA 2YD4A 5HJ3B 4DCQB 4O2EA 2UX7A 3FULA 4U4BA 3B9DA 1ECYA 3HG1E 4TNEA 4L8BB 2YA2A 4LLVA 2BRQA 2H26A 2F0CA 1FNEB 3LPOA 2A38A 2ENSA 3PHOB 4GAGH 4U6HA 4PJ5D 4L1SA 3C08H 3V0VA 2UY7A 2WY3B 1HJCA 2BRRH 4KMTH 5IVZA 1LO0L 5HGDA 1SJXA 35C8H 4GMTL 4DTGL 5E1HB 5HD8C 2MQ0A 1OZUA 1E3ZA 4KI5E 4PJEE 2PW2A 3GYRA 1KJVA 5DJ8A 4DQOL 1TQCC 4HZAA 2W0LA 3NEOA 1E27A 4MAYB 3HNSL 3EHBC 4KTEL 4BBWA 5FO8A 1U21A 4ENED 3GSQB 5JIMA 3A47A 4AE0A 3OKYA 4TUJA 1C12A 3GBEA 1AZZC 1TOXA 3MZGB 2H41A 2K6WA 2B39A 4XB7A 3P4MA 1OSZA 1ASPA 3EDKA 4NQEA 2XN0A 4UILH 4MQ7B 4Z23A 5L6YH 5DO2C 1UOKA 1F3DJ 3MV8D 1BD2B 3T4AB 2DQCH 4CC4C 2D4FA 3AAZA 3V4LA 2FLRT 3FTVA 4EVNA 2R1WA 5HGGS 2I9LB 2TRHA 4JFXA 2D7NA 5DRXA 5HYJE 1OL0A 2VQTA 1DUZA 3TBWA 2X9WA 3FB7B 4XBEH 3QRGH 3V0HA 5I26A 1O7DE 2WUCL 4LPYA 3V10A 1SMDA 5T1DL 1AD9B 3N50A 1FE8H 2AP2A 3WTXA 1E7VA 1RCYA 3KLHC 2V9QA 5IOPA 2WXGA 3KPRB 4HXBH 4RFNB 5A2JH 1RUPH 3RKPA 3G5YB 1ZAGA 4H1LA 1IEHA 5BZZA 3U0TA 3OKOA 1MRCL 5E2VH 4KI5D 4HHGA 3VXUB 2A1WL 3ULVF 3LKQA 1C7TA 1IBDA 2ZP9A 4L2LA 1YAIA 3LYRA 2APSA 4XMLH 2EIZA 4M8RA 1CFNB 4M1CC 3EHBB 1I7UA 3SGJC 1BG1A 1BG9A 1ZLVK 1BVOA 2WQSA 1JG9A 5I6PA 2OXHA 5E2JA 2X6UA 4E5XB 1CQYA 4KC3B 1AP2B 1QLEB 2AITA 4JM4H 3ISRA 4LVNC 1EDYA 4NQXB 4EUPA 2XVKA 3FB6B 5T5FH 4XCCH 1WBZB 4L37A 5CD5D 1RZJC 3IFOB 4H0LC 4OZFA 1YECH 2DTML 2IH9A 4PRAB 4Z78A 5L2KB 3DHMA 3LDBB 3JWDL 4H8WH 1F4HA 1KTCA 1S7QA 3AC0A 4FOMA 4BD4A 4Z0BL 2NT1A 3LPWA 3DDGA 1JVKA 4N1HB 2VDOB 5KSAD 4PTTB 1JFHA 1K8DB 1Q38A 5C6TH 2GK0B 4KNSA 5EUKA 4UIKH 2DLHA 3WDHA 3CFEB 4NWUL 1MJUL 5AVXB 1EVTC 4DZ8B 1CGUA 4KJPD 5EU6B 3P0VH 2HT4C 4X8CA 3U9PL 4IKNA 1SN0A 2WW8A 4YSAA 1PIGA 3SE9L 5D72L 2EEAA 1NCGA 1IAIL 3ZIMA 4IMKC 1M7XA 1AGEA 4ELKB 4H7VA 4P5TD 4E9VA 1JI1A 4Z3HA 2QZQA 3HS0B 1SJHA 4NAMA 4E9XA 3VRJA 1XBRA 4JDTL 4ETYA 1FVCA 3WTWA 4Q97A 5E08H 5LXGL 5CU5A 2ZG1A 3RWGA 5EB9A 2NXZB 3CH1B 3DETC 1CO1A 2AJVL 4HC1L 4W9HC 2IMMA 4OCXH 3WNMA 1NBQA 1H3PL 5GSVA 1YJDL 4NKIH 1BM3H 1U8IB 2XN9B 4OZFH 3VTTA 1DLHA 3QR1A 3L3OA 1JGDA 4MAYC 2K1MA 2A83A 4RX4A 3RAJH 3PWNB 4P3CH 5DT1L 3VXNB 4BFNA 4WUKH 3WEXA 5JPNB 3DGDA 3OPZL 2WSKA 3RVXD 3LY6A 3UTQA 5CN1A 3CH8A 1DQTA 2EDQA 1X6NA 3GZKA 3VA6A 4XNQB 4U1GC 1SXSA 5IMMA 1WCBA 2H6OA 4R96A 2EUWA 4W9JC 5K9OA 4TRPL 2Y3NA 3FQWA 1ASQA 3EO9L 3EOTL 4OF7A 4ZTPH 1S7XB 4JY6A 1NFDF 1AQHA 4NDMB 1JNHB 1F86A 1K3ZA 3L3IA 4KHXH 4R2GD 2XY2A 2J8UB 1DJXA 1SYSB 3QRLA 5F7KC 1TNNA 1XGQA 3MA7A 3MJ9L 4KX7A 4ZFOL 5JHAA 1P4BL 4XHJD 4AQEA 4ODSH 4P9HL 1N0XH 3EJRA 4U4IA 1PDKB 3D25A 1XF5B 3AABA 1S7TA 2NNAA 2ZSWB 3MA9H 3O3UN 4XC3L 4EZMA 2FWOA 1MJ7L 1WAAA 2ZX8A 2ZXDA 2WZPA 1J9SA 1MW3A 5MEQB 3NCYP 2CJUL 3CHXA 3G5XB 5DVMA 1HCYA 5DEFB 1BFOB 2ZXWB 4PM1A 1DLHB 3ZKSD 4XCNB 1AC6A 3FSZA 2OZNA 2IV9A 2DLEA 3MRGB 3DVNB 4L3FA 4BFGA 1KJ2A 3UIYA 1PFCA 2YAMA 4JM2A 3C6SB 2H2SD 3BKMH 5E1GA 4WWKB 3ZDWA 2Q8AH 4K7PX 3RWCA 2CUHA 4OLUH 3ZDXF 5F1NB 4DN3L 4FZEL 1YMMA 4BE5A 2YXVA 1ZIAA 4FNPA 4X8JB 4MFHA 1YSOA 5AKTA 5GGSB 4EI6B 2RD0A 2AK4E 3AU0A 4Z7WF 3HZMA 1R47A 3OLEA 3HKZA 2DQMA 3BAEH 4RGND 4XAWL 2XN1A 1CLCA 1DN0A 3BAJA 1XF2B 4JUTA 3EDEA 4Y19E 3VD2A 5IJVB 3IJSB 2IWGA 5IJKC 4DEWA 1JF6A 1I9EA 3T1FB 5CWSA 1LXMA 1EXUA 1ZE3H 1KIUA 4LQ1A 3GQFA 2EYTA 2XQYK 2VUOA 2GBAA 1EEYB 3W5NA 1XGTB 3ABKB 4GKZA 3ARYA 2ZPKL 1AZUA 2VXUH 4CU7A 2ITEA 2CBTA 5C0BA 5EIIG 3QBTB 1MHEA 2X05A 1IKOP 1S9XA 3H0TB 3LV3A 4MA3B 4KNUA 5TF1L 5D1ZC 2XG4A 4UIMB 1PS3A 2QQQA 1XR8A 5FW8A 2BO0A 3FN0L 1TSRA 4BCYA 4CW1A 1UQSA 4TMPA 2YD5A 1IC0A 1KBGL 4NN6B 2XZQL 1P5UB 1JXJA 1FSKC 3D18B 3FTGB 3QZWB 1ORQA 3ZE2E 1N9PA 3F85A 3SO3C 2EKSA 2ZUYA 3HBGA 3QI9A 2K8QA 4KY1L 2OLDA 4N8VG 4OZ4A 2VKXA 4CDHA 4QRQB 3G04A 1S7VA 1U3HA 5EOQL 4LLUA 4LCCA 3BUQA 1EHNA 3C09C 1TLKA 5HYFA 1GOHA 2DQJH 2Q9OA 3F7PC 4R6UA 3VFNA 3S4SB 1WA1X 2IANE 3IDGB 2X4TA 5JYMA 5L2JA 1KWKA 2CO6B 5FHAH 4LSTH 1E50A 1MFCL 3GXTA 4OH2A 2DD8H 5TE4L 5ALCH 2Z31C 4YHPA 4QRBA 4HIJB 4WKZA 5AVZB 4LLYB 5HDQL 2DMCA 2ZTBA 5DJYA 5FGRA 2IBBA 1WBXB 1TETH 1EUTA 1Z5HA 2ZCKL 3G5YA 4XO8A 3U9UB 2E75C 4B50A 4N2IA 3UP1A 3I02A 4UM9B 4KKZA 2H0PA 4MS8C 1ZVSB 2EIDA 3ULUL 1G1CA 2I69A 5ERWA 1KGUA 3HAEH 3JZ7A 2HMID 2X89A 4BQ9A 5KWYC 4N6QA 3ROOB 1DLFH 3CSYB 5AEAA 2I7SA 4HJ0C 3EOYG 5B39B 1RAMA 1LEIA 1OM3L 3GRGA 4OIAA 1RPUA 5DLML 2ZSVB 3NN8B 2H1PL 3AY4A 4NI6A 5E70A 5EOTB 2XLLA 3H4HA 4O9HH 5LNEA 3L3IB 3SGKC 2PW1B 4TSBL 2HLEB 3KPMB 5HHPB 4XO3A 1I8MB 3Q2WA 2P5EA 3H9HA 2NSXA 4X6BA 1SXZA 3I9AA 3HNVH 2JJTA 4NP4L 5E99L 4HWNA 5H35A 2F15A 3D18A 3FTGA 3U4AA 2IH1A 4PJDE 3ZR5A 4K8RH 1E8YA 4YVUA 1JV2B 2YMOA 4WV1C 4APXA 1CFVL 5I5JA 1BQUA 2RBLA 4LP8A 3OWRA 1XZ0A 3RVUD 3IJ7A 3B9AA 4RMRA 3TV3H 1MEXL 3V0VB 1D2PA 2XKNA 3PXLA 4UT9A 1AZCA 4ZFOB 1L4IA 4YN3A 3GFUA 2ED8A 3WNOA 2GVYA 4Q14A 1EXGA 4NQVB 4YSEA 3U83A 4OF8A 2ZAGA 1JZEA 5BZXA 3EDFA 4CUCA 4GSQA 1F2XK 3KPOA 4AENA 2CO7A 2QLYA 5IQ9B 3MLZH 3EGXB 3U2JA 1KCRL 1A7NH 2NCEA 5CU9A 3EFOA 3UZVA 4G9FB 4NLHA 1P4IH 3HC4L 1DN0B 1FDLL 2Q87A 1MCWW 4FLSA 3MYJA 4BGDA 2VLRB 3IU4H 4PJFA 4PP2A 1RHHB 4QRRE 2IDTA 5GGTA 1T1XA 4JDZA 3HAEG 3L4UA 1XSOA 4ONGH 4QRQA 4KROC 4RRPA 5IB4A 3S5LG 2OJZL 2AK4D 5AZEH 3V6OC 3P0GB 3WNKA 3KPQB 1ERNA 4G3YH 2QMKA 3B4NA 1QZNA 2X2JA 3S8FB 1F3DH 4O58L 3QZPA 2PCXA 1J05B 4L48A 4ZUTA 2CHDA 4X9FA 4X9HA 2ZKHH 1F1DA 3HAEB 3OV6A 4M5TA 4Y7OC 5ADPH 4UB0L 4F57L 2XYCA 1QR1A 5I1CH 1M7IB 2VXVL 4KFZC 5FYJH 1UATA 1FG2B 1JHLL 5FO7A 3D0LB 1HSBA 2LLLA 4LPWA 4X6BB 1X5KA 9CGTA 2P5EB 1KT2A 1QPKA 3E2HB 1H3WM 4K94L 1Z1WA 2OMVB 2CHNA 3BPLC 1QVOB 5TDNA 5JW4R 1E90A 2CM5A 4PJ8C 2WQXA 3O4OB 1AACA 1FC2D 1TLMA 1KGCE 2XBZA 3T1FA 4L3ED 2FHCA 1PX3A 2J71A 1KSRA 1BF5A 3C60A 4OFYA 3BZDA 4PW3A 3EYQD 5D9SA 5CJQH 1KLGA 2DB8A 4I77H 3VGHA 3QFDB 2Y7QA 3F00A 1TTBA 4LCUA 3NOIA 2ZCHH 4HEPA 2VMCA 2DH2A 3BE1L 3GSRB 2KH2B 2O72A 3MRMA 2NMSA 3ELAT 5CAYB 2VW7A 1AO7A 4PHXA 4U1HB 4U0QB 3WHXA 3KH4A 5FLUA 4BZ1L 4KKBC 4JFDB 1G84A 2VR6A 4UUJB 1OK0A 1YRKA 1HNFA 4ZPVA 4GI8A 1BZDA 3HE6D 3L3JA 4GW5A 1QQDA 2LLNA 5E8DL 5I1EL 3EJCA 3QQ4B 5AVVB 4RGNC 5E9AA 1THCA 4FG6D 5J11C 2AVGA 4LLQA 1WIUA 1KLUB 5I5RA 3MUZ1 2N56A 3SE4C 4I87A 1HXYA 3GSWA 4E0RA 2C4FU 4D0DA 3CFKB 3ECWA 2GSMB 2NSMA 3VYOA 4YFEA 2VWEE 2QKIA 4FNSA 3VXQA 4H20L 2W91A 3GDBA 4QXGH 3KL5A 5D1XC 2GBTA 3VXRB 2Q3XA 1KCBA 3ABMB 1MSPA 2OK0H 4KKNA 4LRIC 1CZ8H 2Z35B 1Y7VA 4JGJA 2YD2A 2Y5TA 3LS5H 5F1IB 4FQXA 2R1XB 1A4CA 1JF1A 2P47B 4BKSC 1D5ZA 5GIRB 2JCCE 1L0YA 1T21B 4LKXB 4KWUA 1U8KA 4DVBB 1ORSB 1UQSB 2X2IA 1DDHA 1S78D 4BK5A 1H9VA 4U1KA 1EJOL 3BCDA 4L1DA 4WEBH 1KYFA 1G4MA 4AGLA 4ZMYA 1NAMB 3OL2A 2CGYA 4A7QA 4UMGA 3BZFA 3U36B 1D5RA 1ORSA 3GSVB 2XETA 1KACB 5HVHB 2F19H 5HBBA 3GGWB 2H9GA 1LO3H 4MKMA 4XX1E 3S34L 3VXSE 2W88A 5FFGA 4F9PC 1MI5B 4ESKA 5MEOB 3GXMA 1UFGA 3WKPA 4XVUC 2ZUSA 5G5DB 1PF3A 5J1SC 4H1LG 2OW7A 2EADA 4I88A 1PD0A 5JQIB 1MFVA 2E27L 3RWJB 3RE0A 2GCYB 2XKUA 4ODTL 3C12A 3H42H 4YBLB 3SE3A 1DSFL 2XJKA 1OAYH 3CFBA 2X40A 1E42A 1OQOA 3ECUA 1CLOH 4PJXB 2XBTA 1A4KA 2NY5C 4OCRH 1F4YH 2V5YA 1CBVL 3SBWA 5D1ZA 5C0IB 1RUML 3ILDA 3DHJA 3QDJB 3QCVL 4HQQH 4BXSV 3KD4A 4JFEE 1PEZA 5ABDE 3F01A 1IC4H 4HJUA 4JHUA 3QISA 4U3CA 2FO1A 3T3PF 3D1MC 1S7UB 2FJGA 3IK2A 1TZHA 4NZRH 5C0RH 2IDFA 2X1OA 1KWGA 5ID1B 2D7PA 2GAZA 3SPGA 1RJCA 1V7NH 5BRZE 2EJ1A 1JWSA 4UTAL 2BVOB 1J88A 2UX6A 3MRPB 4R4ND 5I24A 2OV0A 4QHMB 2VO8A 5JW4Q 3NIGB 3AM8C 4XNXL 5DURB 5LGHH 4MMYB 4BHUA 4L37B 2Z35A 5JIKA 1FO0H 3LXUX 2R9HC 4G5ZL 4PTUB 4CN1A 1T6VN 5FR3A 2CKBA 4DP5X 1RERA 5CHNB 3HC0A 3LXCA 1KEGH 4NN7C 2BK8A 3R8BB 1CR9L 4BZYA 1NLDH 2VDPB 2JI1A 1FH5H 2R0ZH 3DX7B 2QQNH 4CC4A 5ABZA 4UDUA 3RVUC 1SXBA 3FH5A 3F84A 3AB0C 3SOTA 3WJJA 1E4KA 4JO8A 5DC4B 1B9KA 2Y5EA 3EYFA 3HCVB 4Z3JA 3SGEH 5TDPB 2ZOTA 5ICZB 4JFHD 4JJHA 3S8WA 3HNTH 3CSYA 4KQ3L 3ILQD 4FERA 2WLNA 1ZHBB 2KQMA 3A67H 5CZKA 4O02B 1Z9PA 1MF2H 1IGIH 3U82B 1QR1B 1A8ZA 3ARBA 1KDJA 2KLTA 4EF3A 4S2SB 2PO6B 3ZL4L 4Y4KC 2E6JA 4G42A 3ARDB 1NLBH 1AD9A 1L3NA 2AZUA 3F5WB 2BS8A 1HKLL 2JJUA 2NTFA 3M17B 2E7LC 2NY0D 5D1ZI 2C1PA 4W1TA 1A14L 3APFA 1F4WH 2VLRE 2VMJA 2ERJB 3GLDA 5KYWA 3NRFA 2QVTA 3IETA 3O8XB 3C6LB 3RJQB 2ZG3A 3BKCL 3I6KB 4M7JH 5CLXA 5D2LA 2JELL 5LB1A 4YDJB 4PS7A 3T1WA 3SDXE 1MCWM 2G3MA 4PWFA 2QZ5A 2O30A 3M46A 5CWSB 3ML9A 3AUWB 4HKZB 1UC6A 4Y2DC 5T1JA 3MRHB 4G7YL 1NDMB 2DYPA 3IJ8A 4QRPE 5J3HC 4NUGL 1FPTL 3G7TA 4N0YL 5CGYC 1HU8A 3PWJB 2YEVB 5MEOA 5FIEA 2FR4B 3B8YA 5T1MA 2P5ED 1KJVB 3VFPB 2VLME 2YPLE 2KQNA 2JF1A 3JV6A 1KYAA 4YSCA 5I9QB 3FUKA 3KNBA 1K8IA 1OGTA 4B3VA 3ZTNL 4OKVA 2JIXB 4L05A 4HH9B 3ULUD 4NZTH 3HRPA 4OFYD 1C08B 4UM8A 5BV7H 4DT2A 3Q5TA 1TVBA 1B0RA 4KMQA 1NINA 2ED6A 1IGCL 3KBPA 4KUZL 2H3NA 3NQKA 3SODB 3L16A 2EIJB 4TVPL 3B3IB 5MENB 3EYQC 4UTBL 2ZOLB 1FVEA 4DCQA 4AKOA 5CP3A 4G9DB 5LO7A 4PV9A 1QX1A 3LD8B 4GAYB 4Y4KA 3V95A 3P4LA 3VI4B 4X4YB 1P6FA 1XL4A 3C6EA 2OYLA 5A2FA 4GRLA 3VXPB 1HSAB 5BMFL 4E9WA 1KXVA 2EDKA 5C07A 2IFGA 3O6FA 2IAND 3T3PB 3V4VL 1TG8A 3MFGB 4J6RL 1BAFH 4EUPG 7FABL 2EE0A 5JIPA 1KN2L 3MBXL 3AMKA 4NPKA 1JZGA 1LHZA 3K4DA 5JHDE 5JORA 3REWB 4A7VA 3SDAB 4RAVB 3PUCA 1NA8A 2Q1EA 3CJJA 3CK0H 3DOIA 3KVPA 3X11A 4F7TA 7PCYA 2XTSA 3D39A 4YHLH 2A3TA 2BSTA 1GGTA 3FH8A 4HEPG 3AG1B 1IM3B 1YNLL 3ETTA 4GXUN 4GNKB 4JPSA 3VRLE 1EJ8A 5MEQA 3U9UA 1BMZA 4F3FB 5EU7C 3PCYA 3WUZA 3RTQA 3PHSA 1XB3A 1TJGH 2A6JA 2XWRA 3JZYA 3K80A 3L3GB 4FXKB 5IJCC 2GABA 3U0PA 4AZ8A 1SQ2N 3KXFE 4HUKB 3QCTL 1SXAA 3QUZD 2VDKB 2R4RL 3NIDB 3UTTD 3BDBA 4FADA 3MRMB 4N2LA 3T4YA 2Y36L 3SEPA 4BA8A 2JCWA 3OKDB 5GZOD 1NGYB 1XGPB 4TUOB 1KB9K 3AXIA 3MV8E 1LP9B 3VGGA 4N25A 4O2CB 4EN3D 5FCUH 1JZ7A 2BFVL 4MMXA 2Q10A 1H3GA 3KYKL 4OGZA 1ROCA 3HR5A 1DVQA 5DHEA 1JZ5A 1Z7JA 2XA8H 2RFXB 2CE6A 3OZ9H 3II3A 4H8UA 5FGBA 4CADB 5I8CA 1YQVL 3H6JA 3GNML 1WTLA 4ZAKA 2A77L 1UB6A 3MRCB 3VNYA 4RGNE 1TJHL 1H5BA 1PVHA 4N0CC 3QUKA 2PR9A 2VDML 1IQWL 5BRZD 4QHMA 4KXDA 5AOKA 2HB0A 4PJIB 1ZS2A 2A9BA 2F5BH 3OJ2C 4JPQA 3GJFH 4DUXA 3KMDA 3ZY7A 1BD2D 3IDYB 2YR3A 3RU8L 3HAEA 1KC5H 4M93B 3WMSA 1YEEL 5KVEL 4IW4C 3VXTA 1TCMA 4CSPA 1JZIA 1RULH 4FLOA 4HWBA 1DO5A 3Q9PA 4RBPK 2G5BA 2D03H 4PU2A 1M2OA 5CGTA 5K1JA 4QHUB 4A7GA 1BEXA 2MSPA 1FHGA 1EO8H 2G75A 3O2DH 3QIWB 4OAWA 4XP6H 5D1XE 5FYKH 1KXVC 3SHSA 4AQAB 4EEEA 5IB2A 2X53A 2EC9T 5J5EA 2OSYA 5ABAA 4IBWA 1XTLA 5J6SA 1HHHB 2W80C 5GRXG 1UZGA 5JOEA 4MD5B 1MCCA 5C97A 1CUOA 2VERN 2R2EB 5I9QC 4QTHA 1A1MA 2X70A 3HMWL 3MLSH 1ICTA 4PJXE 1HINL 5E1QA 4HKJA 5CCKL 1T03L 5CBEB 4K71B 3LZRA 3VSVA 1U3HD 1WJ3A 4ADJA 5ICYB 3SPHA 1U4EA 3HUJE 4AZ8B 3U0PB 1NFIB 1NC2B 1ZLVH 1VGEH 4I1RA 4XP4H 5E7BA 3RVWD 1UXWA 2B1AL 2ZXGA 3MNWA 3FBQA 2R9HD 4LL1A 1IO4C 5B38G 2AGJL 3UTSA 2B4CL 3HE7D 2C3VA 1UZ6E 4UTCA 1DVXA 5KYNA 2DYRB 1MCFA 3CDGA 4E42B 4IBTA 4M93C 3L2LA 4G11A 4APXB 3IFOA 2DQUH 3T2NH 1DJSA 2EIBA 2NX5E 2JQZA 2YSSB 1FI8C 1H0DB 3MV9D 5FYLH 1UB5A 3VE0A 4TQEL 3WKML 2MCPH 5D6CA 1AI1H 2RFXA 1G6RA 1YUHB 5PCYA 2I32A 3RZCB 3B7TA 4HBQA 1P84K 3DX7A 4WO4C 3UTSD 4IRJC 4FQHA 5C08D 2R2HA 4J1UA 4DUVA 2EO1A 3B9KB 5C07B 4P2CG 5TE7H 3VYNA 1M2VB 2YZ1A 3LHPH 5MERB 1A5FL 3AWGA 3NN8A 1L9TA 2ORBH 4K7PH 3T4YB 1JF5A 4Y89A 5CN2A 3T8VA 3BWUF 2IOMA 5BQDA 1BJMA 2IDUA 4XNQA 4KVCH 3NH7H 1MQKL 3FBKA 3NCMA 2MEJB 1AAJA 4OCYH 4V1DE 3VXUD 4UANA 3ZMRA 1B4LA 2Z7ZA 5HD8D 1N6QH 4X9BA 3NYKA 1V8HA 4ZSOB 3L4WA 1NUFA 3VX1A 3L4ZA 1W0WA 1G9HA 2BNRA 2ENYA 3OG6B 4PHZA 3CDGB 4QWWD 3SDAD 1D5XB 4ZFFB 4MRCA 1Y6KR 2EVGA 2VN7A 2BVEA 4IOFD 1U3YA 3FQTA 3I9PA 4E9TA 4TOYH 4NM8H 3COOA 1LDPH 4EVNB 4JRXE 2FWOB 1YPZB 4ZUWA 5B1CA 2X10A 4MA1B 2CXGA 4MCZB 1TKWA 1LGVA 2DW5A 4M48H 5CBEA 5KSAA 2RH0A 2QEJA 1GZHC 3S4SA 2GUOA 1DBKH 3UG4A 3UYRH 3NFNA 3MBEA 3P2DA 3PQYA 4AIOA 4J3OF 5G5DA 3WY1A 3PP4H 4WI8A 1QLFB 4XXCC 2XQ0A 5I15H 1RI8A 1GCFA 1LJMA 1U2YA 4LLWA 4LVEA 2L8AA 3ROLB 1P7BA 3UPAA 1KB9J 5D7IA 5D96B 1NM4A 4NJAH 1JL8A 1MLCA 2XTJD 5AZ2L 4UQ3B 5IEHB 1ZT1B 5I1KH 3VWKD 4CJ0A 2NY1C 5F6IB 2IFFL 1UT9A 4I3SL 4G43A 4NC1E 5EU3A 2DMBA 4JO4L 1UH3A 2X89D 1U8HB 4PBXA 4KKCC 4UZSA 4Y5XA 4CN4A 1DDHB 3QYNA 3D3VE 1W72A 1HQ4A 4KRMB 4OCWL 1KY6A 3MXWH 4ZS6D 4G8FB 5C0BB 1CXLA 4RZKA 2PN5A 4L4VE 1OCWH 4QR7A 5CZXC 3RGVD 3EYOB 1T1WB 2A9DA 2B2XL 2GJJA 1UCBH 3NBNA 2FD6L 3TBVB 3ZUNC 4QOKB 3UZEA 2XTJB 5A2KH 2X4OA 5EU5B 4P2OC 4W9KC 3SKOA 2D3NA 4W93A 3O0LA 2GC4C 1KEMH 4PJFF 1OE3A 1JGUH 2WYHA 3L45A 4PW4A 4WU5B 4JAMB 1F18A 1LP9A 4PJEF 3QFJD 5GS2H 1EO7A 1G94A 4G6JH 4LO9A 3ARUA 3QUZB 3UTTB 3H9SA 4GB9A 4LRNL 2BVQA 1BBDL 3IB4A 1HXKA 2H47C 2XTJE 3UOAB 4LSUL 3AY4C 1A3RL 2OL3A 1NBVH 5HI3D 3QZMA 4XB8A 3HG1D 3QI9D 4LHQB 2N3JA 3ZO9A 2AFNA 5EF3A 4ZFGH 5DJCB 4FXGA 1I1CA 3TFKD 1G9NC 1TQSA 1RZIA 4P5KB 3QJQB 5IUSA 5J4MA 3D3VB 4FNLH 3FB7A 4I4WB 1JPFA 4G7QB 3H7LA 3IMVA 1GJIA 4JFTA 5CLZA 1GTFA 3LZLA 4F1SA 4NEHB 2OL3H 5ANME 5ANHA 1YEHL 3OLIA 3RIFK 3DETD 4G6ML 5EULV 3NP4A 2DN7A 1S6NA 4NQDA 4TULH 1TCRA 3QDAA 3EIFA 2B5IB 4DGUA 4R3SA 4DO4A 1ZLWH 4CMMA 5LCVA 2GSGA 4NO0B 3HC0B 4P2OB 1AS6A 4MB1A 4M3KB 4PRIB 2CRMA 1SVCP 2RIKA 4DKEH 5B8CC 2G60H 1AXSA 3S88L 1MIMH 4I13B 4C4UA 3DI2B 4GP5B 1P1VA 3LIZL 3CFQA 3MJ7B 1JZ6A 4PD4K 1H3VA 1F6AB 1CWVA 2K6ZA 2QSTA 3J7HA 3NESA 4FA7B 4ANUA 3QYCA 2EUVA 2N01B 4L4VB 4AM0Q 4P57B 2YD6A 1U6AL 4C54A 8FABA 1MNUH 3Q8FA 5T3XL 5DDHA 1IAII 5B1JA 5IR1A 4PJBA 4QHLA 3O6KL 3LKRA 3IAPA 5AQ0A 3SPIA 5D5MB 1WPCA 2J20A 1VHPA 3MNWB 1G7LA 3EH3B 3N0PB 2Z7UA 4LAJH 4JFUA 3I6SA 1NGZA 1A6VH 2X4RB 3CHQA 5FGCE 5C7XL 2WZ0A 4C56A 1INQA 1OT2A 1UT2A 1GZQB 3P9MA 2IBGA 3CH1A 3BPCB 3MX0B 4WFGD 3BFOA 2QVIA 3GXPA 5IMKA 4DFHA 4H88L 4WTZA 4V1DB 3OAWA 4HXAL 4XPAL 4OB5L 1AS8A 2YGOA 3X1FA 3NZ8A 2R2EA 4ONFL 5CR1A 1TVHA 2C7FA 1HEHC 2B1OA 3IJ9A 4JQVC 1HFUA 3RVWC 1RLBA 2FLBT 2PYEA 4BJLA 1EXHA 3UZVB 4K9JA 4FFVD 3NACL 1BYPA 3W0WE 1CD0A 3GMNB 3PAUA 2BVTA 5E6IC 1UYWH 2BCMA 2CHWA 3FOMB 3TEWA 3GGWA 5KSBF 3U46B 4LOUC 2YUZA 4Y5XC 4ONHB 3UTZB 1GS8A 3DJ9A 4X5XB 4HIIB 1L6ZA 5T33L 3F7KA 3QZWA 3ZTDC 3MBWA 3NJGA 4KKRA 4JM2D 1Q0YH 3C5XA 4NJ9L 4IS6B 1P7KB 2DQGL 3PWUA 4G5AA 1NCHA 3N0AA 2EE6A 2MIZA 5IVXA 5TE6L 3F7QA 2IH1B 4N3UA 5HJGA 3CDFA 4OBRA 3BUIA 3OPUA 1YPZE 4PLKD 2DM4A 4QGYA 2XZAL 4NBZB 4ZMXA 3IXAB 5B7EA 3CWGA 1AXSB 4Q7DA 4YO0B 5KVGL 5CEZH 5LQBL 4L3EA 5LJYH 3ZT5A 4QY8B 5FDWA 1JV5A 4HAFA 4HCRH 4KAQL 5F96H 5I17B 1UWEL 4AITA 3DBXA 4UT6H 2YXMA 4HUXA 3DWTA 5AVQB 4XN9A 2NYYC 1R3KB 3L4YA 4PJCF 5K9OB 1F56A 4QY8A 4UCFA 2FGZA 5D4QA 1C1EH 1AIFB 1IC1A 1N8OE 3FS9A 4G6AC 3VRIB 1KT2B 3NFSH 1I1RA 2ISDA 2Q86B 2ZYHA 4ACTA 1YJDC 4J8RA 4WV1A 5I1AA 3APCA 3MRBB 1KTJA 4EIUA 3P73A 4PGEA 4CSSA 4AQ1C 1LE5A 4A39A 4F3FA 3TNMA 1U8IA 4IS6A 2AK4B 2ZIDA 5IW1A 1LK3L 2FJGB 1WWAX 4UQ9A 2WNXA 1MJJA 1PTZA 1J10A 4UNTA 4UQEA 1AKPA 4IJTA 3A23A 3CE1A 4FFYL 1WRFA 3CN4A 2YXFA 1RUAL 3TBVA 1RUQL 3U46A 2ZXAA 1MHCB 3CQPA 1QATA 1PLCA 2D8KA 2YWZA 2ZX6A 4FULA 1RQ5A 2WLLA 4IKLA 1YN6A 3FO1B 2UWEE 5AVWB 3AS2A 3IBEA 4KNQA 3VWJA 1J0JA 2D3LA 2OKMA 5ANMA 4Q8BA 3K5RA 5IWLA 2H9GB 3ZZ1A 4PV9B 4XVJL 4XN8A 2DLFH 4NB7A 3SGEI 1ZSHA 4IMKA 2FQFA 2F53B 4M62L 4X0KA 3MV7A 4EBQL 1T89C 3GSNH 2XPGB 3C60D 4HJGB 1VEOA 2FZ3B 3NTCH 2OMBA 4N1CA 5F88B 5I0XA 3BAWA 1MHEB 4OKDA 4MQSB 1R5VA 3ELQA 4ETQA 3CPLA 1JN6B 5C0EA 5DD0H 4ZUSB 3RI5K 3GBDA 3KGSA 5A6LA 1I9RL 5IF0B 2HFGH 1UHVA 4QCIA 4DPRA 5IQNA 3TJHC 1DVFB 3C5SA 4PJFB 4GO9A 4PP2B 5JIQA 2CU9A 4FQ2L 3L7EB 5C08A 3KJ6L 4UYQA 1O6TA 5F7DB 1XF2A 5J0BA 4MRBA 2IBZX 3QI9C 4FGMA 5IQ7H 4QNPF 2YBGA 3AZUA 4R8WL 3LKNA 2EC9U 4QXUL 2EXYD 3O0RL 1FYTE 1VSCA 4XTRC 3T3PE 4UU9A 3IF1A 1ZJAA 3KLAB 5HJBA 1FGNL 1FZMB 3Q6GH 4AENB 5EUOF 3R1GL 2JFCA 1SXCA 4PY7A 2Z8RA 1MCNA 5D6DA 2W0FA 3OF6A 5PAZA 3MUHL 5I6NA 1CLZL 5SV3A 4X5LA 1HESA 4G7VL 1OAXL 4P5KA 3WU1A 5AL8A 2AJYH 2XRAH 2XXCB 4HIPA 5KVGE 3RFZA 3EO1A 3EJYD 4ZSOA 5D70L 4ES8A 1LNUA 2WXQA 4LQFH 4LVOC 3VX0A 1BVNT 1DVSA 1OIOA 4WV1B 4EXKA 2JMRA 4OZGB 1IBFA 1QSEB 3MRKA 1FF5A 5DK3A 5AENA 1BQKA 3QT2A 5I8KL 1GY1A 1FFOA 4GIAA 3D9AH 3VSTA 4LCUB 2JSFA 2IAMC 2JV6A 3CZFA 1TQWA 3O8XC 3R7RA 2VC2B 3NSFA 5C70A 4HUXB 5EA0L 5E4EB 2F61A 4PJGA 3U2IA 2LU3A 4LHUB 3GJEB 2Z4TA 4HEMA 1M6OB 2R15A 1D5BA 3QC6X 3TWCL 4JCLA 4FF9A 2CNYA 2IH3B 5EF1A 3NCCB 3QB7C 5J6GB 3CVHA 3SGDH 2Y6TE 4R83A 4X2UA 4E68A 1A6UH 3ZE1B 1TEGA 4RISL 2P24B 3UYPB 2OMXA 1AY1L 2HJKA 2YAEA 3ZE0E 1ILUA 1DQMH 4JS7A 3VWKA 2JI2A 3RY6A 3OXRA 4PJ8D 2B16A 1M6UA 3SQBB 2K3TA 3HG2A 4XNDA 5IZ7A 2ITFA 3PREA 3ZOAA 1E3FA 4JANB 3CXDL 4PGZA 3F7YA 4I3RH 5A2IH 1LEGA 2W9DH 4PYHA 4ALAH 1E9PB 2WIMA 4HA1A 3T2QA 3MXVL 3MRQB 3P4OA 3FHAA 5DTFB 1UVQB 3LN4B 5GRVL 2KLSA 4KZDL 3RIFF 3MV9E 1E8XA 3EH4B 3HLKA 4MQTB 2SODB 4G82A 4DJMA 5B22A 4AIXA 3L17A 5EO1B 2IAMB 1EERB 3Q05A 1ES0A 3TT1H 4G72B 3NFNB 2YJLA 4YZFE 4XP1L 3P9LB 4OZIB 3N40P 1FAIH 3FOLB 4YXLL 3RWHB 3EG9B 1E6JH 1I3VA 1TU2A 1YVLA 3IWUA 3BMWA 1ZTXE 4JPIB 1UOWA 2OQJA 3I6GA 5EZPA 2JB5L 4XO4A 1MRFH 2D2OA 3UGEA 1IQDA 5EO0A 2FO4A 3QJUB 2YC1A 1H5BB 2CR6A 4AQOA 2EVIA 1H6EA 5I1LB 1E6OL 2XG4B 3L08A 5FYJE 2K3HA 1PYWA 4ODHL 5CZVL 2WB7A 2BSSB 1YEIL 5C1MB 2Q2LA 3FFCA 4Z7UE 2NY6C 3CZNA 1NCBH 1YYMH 3CFUA 4KK8D 5D1XD 3RILA 2NYYD 2J6EL 3DIFA 4M1GH 3NA9L 1JK8B 5BS0A 1DJGA 2X7LB 5FEBA 3DK2A 1P84J 4LSSH 5I0WA 5LKNA 5KSBE 1S9VB 2FATH 4NO3A 4YL9A 4M3HA 4WTZG 4S1RH 4BA0A 5FUOH 1WQVT 2GKIA 1KXTB 2J8UA 1JGLL 3W81A 2R29H 3QAZB 3GDCA 4Z3TA 4POUB 2O5ZH 3Q1SH 4NQDB 1NC4A 3VQ2C 3KLSA 4F9LA 4GJTB 5DZJA 3F62A 4GQRA 4QI3A 2YOAA 1YUHA 1NGQL 2X4PA 4FQLH 2QSCL 3GIVA 3ZL1A 2WB1A 1SBSL 1WAAE 4DHLA 3O81A 1YC8A 4FN0A 3GBNL 5KVDH 1RK0B 2BRRL 4KMTL 3WD5H 1H5BC 35C8L 1BM7A 1CICB 1KTLB 4GMTH 1XB6A 2I9TB 2WBWB 3AT8A 1A7QL 1E8ZA 2J43A 4FI8A 5HXMA 1XF1A 2AQRA 1CLVA 2AABH 4IOSD 2ZICA 2ATAA 4LMQI 5DYFA 5JORB 1CLYL 1KJ2H 1EMTL 4KKLC 2WAHA 3H9ZA 1OTTC 4U7MA 3MUJA 1R1CA 3GRBA 2QLVB 1IZJA 2JKNA 1YEGL 1MHHB 2HZHA 5DGQA 3B2DC 4A2MA 5L6YL 3IDXL 5C6WH 3TA3D 1FLRL 4LLMB 3HG1A 2HLFD 3C60B 4N8UA 5JHMA 5DD3H 1Q9WB 4MSWA 4AEHH 3L13A 1CICD 5IJDC 4LCWD 1K6QH 1AD0B 4AI7A 2AQTA 2WSDA 2GSIB 4AQAA 2DI7A 5FB8B 2Q76A 4IIZA 2D7MA 1HWHB 5FA4A 3W9DA 3VXSB 3DVGA 3HPLB 2X5PA 2ZWSA 1XXFC 4JEGB 4LPTA 4HJGA 4K3HA 2AJ3A 4K71C 3H9YA 4MBOA 4UBDC 4AEFA 5EO9B 1BW8A 3QUXB 3ULVH 3ARBD 3LB6D 2NYZA 2HKFH 4NNXB 3NCFB 3MRIA 4F2ME 5HHNA 3AU1A 1UM4L 4WEUD 1EIBA 4U2YA 3MRHA 4GRMB 4YHOH 3ZDZB 3BVNB 4MASA 2B08A 4Y9GA 4XTRD 3MV01 3LNFA 2EXSA 5DJ0B 3TCXA 3IDJB 4Q89A 4GRLC 4N2FA 3ZBMA 2VXSH 1LILA 2PTUA 5JPNC 4UT9L 2OXHB 4JPVH 5J9PA 1ZHKA 2FEEL 3BH9A 2FEEI 4JKLA 5HI4D 2CG9X 2DJUA 4X6DB 4X7TA 3V6FB 1CTOA 4BCXA 2WXOA 5HYJA 3EFOB 2VDNH 4DZBB 2RQEA 1B0GB 3EJYC 3IETB 3IKKA 1HNYA 3Q2NA 3WXWL 2DTMH 1RL1A 1ODUA 4R90L 4H8WL 5I0DA 4X42A 2NY6B 3HG0A 1K4DB 2NY0C 4ZX4A 1AIZA 2R0KH 3EFDL 4WJ5B 4XZ4A 5KOVC 5BOJA 4RGMC 4OT1L 3MVSA 4URKA 3HB3D 4JO3L 4G6KH 4NWUH 1IM3A 1FV1B 2E7BA 4PGEB 4MJ2A 5FFLA 3PL6D 3U9PH 2OTWA 4LRIA 4OFQA 3WGVB 3FXIC 3MRLA 4HIHA 4MDIA 5F9WB 3FQUA 4R5TA 4HOWA 5IV2B 4J7RA 1FNSH 1KENH 2I9LA 3GLZA 3L4TA 4TS6A 5FCSH 2YD3A 1SYVB 2IDCA 5FKAA 1J7VR 5JHLA 1OCRB 4ZOBA 2P80A 4JDTH 4U1IA 3US0A 1VACB 2YOCA 3LPGA 5E08L 4P46B 4ANWA 4HDIB 4H0IA 1C12B 1DVUA 1U92B 4UINL 4YX2H 2Q2EB 1TQTA 4XMZA 2DJSA 3S37X 2WPGA 3FSVA 1QFHA 4MZRA 1WTGT 3AG4B 1L7TH 3R0MA 2CBQA 3WN5A 1G6RB 2WWKO 1KFGA 1YJDH 4CC1A 3ATFA 4HF5L 3CZJA 1H3TA 4NZDA 3BGMA 3MV7D 3MNDA 2C7UA 3BDXA 4K07A 4P3CL 5DT1H 5IESH 1J5CA 4ZQTA 4GLRH 3SDXB 3Q7JA 3WY3A 4CBPA 4HUVB 2ZUVA 1OALA 2PYEE 1J11A 3RGHA 4ABVA 3V4VB 2Z92B 1MH5A 2AI0L 5DZNA 3UCRA 1WBXA 3RWJA 2VM9A 4JRXA 3GSNB 4TRPH 1NFIA 1S5HB 4F7PB 4AKQA 3EO9H 5K59E 2VR9A 1YDPB 5KBNC 3L9RA 1MCDA 1CDUA 4R97C 3FRUA 3SDDB 2J72A 4K3GA 4CVZA 5IF0A 3CZSA 1U95B 4XPTL 4JFZH 4LEBA 1P4BH 4OGXH 4ODSL 3RHWK 4Z3FA 3M1BB 1AGBA 2X4UA 4GG8A 5JW4N 3CD4A 4A7TA 3PGDA 4XC3H 4V1DA 1KBWA 5E6RB 5I8EB 4DN4L 1NCUA 4WI5A 1AXTL 2F7IA 3ECBA 2AMUA 2F8OA 2FLMA 4YDJA 4QT5A 3JV4B 4C56B 4N22A 4U0RC 4U05A 1ZANH 2H0FA 3QH3A 1KGIA 2HJLB 4JVUA 4KXCA 3B9KD 4UQAA 5I6XC 5L88H 1OARH 3ARQA 5GIRA 5KAQG 5E1AB 2GTQA 3HS8A 4ELMB 3QUZC 3K71B 4JO2H 1N4XL 3D69B 4PRBA 4XXWA 4DGIL 2H26B 1KV3A 5I1DB 2GC7C 4NQSB 1T4KA 3TF4A 3NJVA 1T21A 4LKXA 2IV8A 3FMGL 3UG5A 5CSZB 3AWEA 2B0SL 2MWCA 3N04A 3QUKB 4S1SH 4X80L 3BAEL 4XAWH 3DJZA 2IWKA 3BZEA 1K3IA 1ZS8A 4JLRA 3S35L 3GS7A 3EYFB 3ME0B 1HZLA 2OJEA 5DWUL 5I1IH 4N0CD 2K4WA 5F9OH 2JJTC 3HUJA 4YPJA 3MREB 2ZPKH 1MJJB 3CC5B 3CZFB 3M07A 3R4RA 1PJ9A 4UOQA 4ANVA 4URTB 3BP5B 2X28A 3PABB 1CG9B 2AEPH 3K6SA 5TF1H 1MLBA 3S96B 3U4EB 4XPBL 1P2CB 1CYGA 1YMMB 3IVKA 1F00I 2N1TE 3KPLA 4OD1H 3BPOC 3L6FA 3KL0A 1OCZB 3IE4A 1TPXB 4AIZA 1T0MB 4FQCL 4E9RA 5IKCB 2XZQH 3QWRA 2PTTA 1CYWA 2Q86A 2M26A 2B14A 2NY2D 5JR1H 2VXQH 4QRFA 3TTYA 2NSQA 5E6ZA 4Z5RA 2CDEA 3SZ6A 3HI1A 4KGJA 4KXAA 1CVRA 1T5KA 2E4FA 5B39G 5DA0B 2Z4QB 1KBBA 1DHKA 3DUSB 3WFCH 1U33A 3ZK0A 4MJ4A 5BPPA 1PG7L 1BV8A 5BV7C 4I2XB 3K3QA 5ESQA 3SDYL 2A74A 2ID5A 2W38A 4RZCB 4ZDHB 4EAEA 2DBJA 4Q6KA 1JDDA 2JCCF 3UXFA 2VN6A 1CXFA 3VCLA 1R34A 2MPAL 4AE1A 2FX7L 3D39D 1CGYA 3OAUH 5TJWK 1LEKA 3R8QA 2Q7NA 2VDQL 4G83A 4LSTL 4N90E 4S0SD 2DD8L 3KW8A 3LRMA 3EJJX 5FO9A 4HWEL 5TE4H 4EDWH 3L7EA 1JZ4A 3CBJB 3QQNA 4GKNA 3VU1A 3ARRA 4HS6B 5EPMA 2WWMC 4K2UL 4CBZA 2NQ3A 1LD9B 1GR7A 2ZCKH 3S6CA 2OJ1A 4AQ1A 1DQVA 3AITA 2JXMB 4AGOA 1OWWA 3ULUH 1QBLL 1KYOK 2D9CA 3NT0A 2JKXA 2BOBB 1BOYA 5HHOE 3PJSB 3T6WA 3U7YL 3I3DA 4GRLD 3JV4A 2FGWL 2YAPA 2Z34A 3QZNA 1N26A 2AXFA 5EBLB 3L95A 1XF3B 3LRSA 4XODA 5HI4C 4DK6A 3L2MA 2ZAIA 4NKDA 3MBEB 2CBOA 5BVPL 4P23D 3ZTEA 4HYTB 1HL9A 3W5MA 2H1PH 1QLEL 2DWTA 5JO5B 3EKCA 2F6AA 2NNCA 1CU4L 3DRTA 4ZTOL 4TSBH 3QDMB 4XHQA 1QFUL 4ZFZB 3IXTA 4U0RB 2AK1H 3OHMB 5HYQA 1IUZA 2FJSA 3D39E 5E9DB 4Z77A 4JZNB 3HNVL 3FQTB 3ZTJH 1OZTG 4BKLB 1IBYA 3TT3L 1XCWA 4MX7A 2ICCA 3UZQB 3EXJA 5C0AB 5IR1B 3BWAA 5JUEL 1ZGLP 1CFVH 4DOHE 3P2TA 4B7IA 4LSRH 3S5YA 3BGMB 1NCCH 4HS8L 2CLZB 2FAUA 3IMSA 4HJJL 4UT7L 4EN3B 4U7SA 3V5KA 2BY3A 2F54D 1J0HA 5BOZG 5CD3A 4HAGA 2AXFB 5EBLA 5MP6H 1T3FA 1UWXH 2VR3A 4F2EA 3ALXA 5BCAA 4OIIL 1JZ8A 4FTVB 3N1GC 2VRQA 4NOBA 5HHPA 1BGXH 1FIGH 2QELA 3QDJE 3HI5H 3QQXA 1BQLL 2AZAA 5CEXB 1ID5I 1A7NL 1KCRH 4IOIB 4I0CC 1UA6H 1OLLA 4D9RD 4PB0L 1NOLA 1XMWA 1FDLH 1G9NH 3GUFA 4JB9L 3MV9B 1I8KA 4HS6A 4GH7B 4Q9QH 2OAAA 3MCKA 1J8SA 1MAKA 4PI2A 5G2NA 1XX9C 3CVIH 3NEEA 5KJRL 2V9TA 3IU4L 3QGVA 5A7EA 4NDMA 4JGMA 2X4QA 3O4LD 3W1ZA 2Y1AA 4LLDA 3RPBA 3KCPB 3EJQA 5FV1L 1A9BA 3O6FD 5CINL 4KKAC 2BM3A 4LSQL 4G80B 4IRSA 4R4BB 4NHUA 3INUH 3L9YA 4TLSA 4W4NA 5I1GH 1QLRB 4YO0A 1TYEB 4AH2B 4P2QD 4GUCA 4ZS6C 3V5HB 2ED9A 2YARA 1NC2A 4OGYL 5EBGA 1A7OH 3PLYA 1NAKH 4X98B 4JDVA 5DMKA 3MLVL 1Q0XH 4MJJA 4EDXA 4UB0H 4OUUA 1TU2B 4PG2C 1QFWH 3WY4A 4OI9A 5E2UH 2ZKWA 5D96C 2UZYA 1E5ZA 4P2OD 5L0QC 3PDDA 1FO0A 3EGDA 1FC1A 1YY9D 3ULSA 1CURA 3FZUC 3CLFH 3VGDA 3CMGA 4JFXB 4PJDA 2H0JA 4LLUB 4UTBA 5C0AE 1QI3A 1MRDH 5B21A 2G9HA 5D7KD 1QP1A 1XGZA 3DURA 1UCTA 3DSFH 3WY2A 2ILLA 2P5EE 5KSVB 3TNNA 1ID2A 2F8XC 3F6JA 3SDCD 3FO2A 4O4YH 2ZD0A 25C8L 5I8OH 8PAZA 2CR3A 3FO0L 3KLLA 3I3BA 1BVKB 2BVYA 2CR0A 4XAKD 4X7CC 3AQDA 5BXFB 2JJVA 5I18H 3ZU8A 1A2YA 5H94B 4NPYB 4FFWC 4JKWA 5E5LA 2XWBA 3QI9B 2LV4A 2VXQA 3WHE1 2YHGA 2AJUH 4U3SB 3K71A 2A7BA 2KL6A 2F7RA 5GRJL 5DZ9A 3W11D 1KGJA 2PYED 3ZQWA 1NICA 2FH8A 1KN4H 5I1EH 4W9CC 3DXAA 5FB8A 1JPTL 3B9EA 1INEL 5JXED 5EC2B 5T5NF 3V0FA 3AROA 4F7CA 4NQSA 4Z7UA 1MFEH 5AVYB 3QPXL 4UIMA 5D7JA 1WT5A 4DF9A 1OE2A 2R39A 5KJ4A 3WFEH 3R0NA 4NENA 4LLDB 1O6SA 2KDYA 5AYUL 1WBZA 2ADJA 2CO1A 1M71B 1RPKA 3PJNA 1O5DT 4AUYA 2Z8VC 1IGYA 3VB9A 3RVTD 4LVOB 5KSAB 1GJUA 5F3FA 5I23A 4NWTH 3O4LB 4XH2A 2NY7L 4Z7OE 2B9BA 3GXUB 1GXEA 1CZ8L 1Q9LA 1NGWB 3OSKA 3SKMA