1V10A

Structure of rigidoporus lignosus laccase from hemihedrally twinned crystals
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
494
structure length
487
Chain Sequence
ATVALDLHILNANLDPDGTGARSAVTAEGTTIAPLITGNIDDRFQINVIDQLTDANMRRATSIHWHGFFQAGTTEMDGPAFVNQCPIIPNESFVYDFVVPGQAGTYWYHSHLSTQYCDGLRGAFVVYDPNDPHLSLYDVDDASTVITIADWYHSLSTKAPPAPDTTLINGLGRNSANPSAGQLAVVSVQSGKRYRFRIVSTSCFPNYAFSIDGHRMTVIEVDGVSHQPLTVDSLTIFAGQRYSVVVEANQAVGNYWIRANPSNGRNGFTGGINSAIFRYQGAAVAEPTTSQNSGTALNEANLIPLINPGAPGNPVPGGADINLNLRIGRNATTADFTINGAPFIPPTVPVLLQILSGVTNPNDLLPGGAVISLPANQVIEISIPGGGNHPFHLHGHNFDVVRTPGSSVYNYVNPVRRDVVSIGGGGDNVTFRFVTDNPGPWFLHCHIDWHLEAGLAVVFAEDIPNIPIANAISPAWDDLCPKYNANN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure of Rigidoporus Lignosus Laccase Containing a Full Complement of Copper Ions, Reveals an Asymmetrical Arrangement for the T3 Copper Pair
pubmed doi rcsb
molecule tags Oxidase
molecule keywords LACCASE
total genus 130
structure length 487
sequence length 494
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2004-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v10A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v10A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v10A03
1AR1B 4KO9A 1ET5A 3KW8A 2FQFA 4KNTA 3HEIB 1JZJA 5AZUA 1BAWA 2OJ1A 3IN0A 1AAJA 4DP0X 1URIA 2XUWA 3N55A 1SDDB 3PLYA 3RYMA 3GDCA 2W88A 4AI7A 2GHZA 4X4KA 1L9QA 2YAEA 4G7SB 3S3BB 2HZHA 1AG0A 2Q9OA 4BDVB 5ANHA 3S8GB 5I5IA 3UABA 1E65A 2I85A 2YXVA 5B3SB 1JXGA 2YAHA 2FNWA 3EH5B 1AS8A 3NJGA 1W8EA 1GSKA 4YVNA 2J57A 1X9UA 2VM4A 4G71B 4BWUA 4DP9X 3EH4B 1PNDA 4A2EA 1N70A 1AZCA 1VLXA 4HCFA 3OMIB 5AKRA 3BVDB 2YAQA 2PLTA 1MZYA 5B1AB 1M9WA 2VW6A 2BP0B 2DY2A 1ASOA 1A4BA 4CSPA 5I6NA 5B1KA 2DWTA 2XV3A 1PMYA 4A2GA 3ABKB 3NYKA 1CYWA 1PCSA 1ZDQA 1SFDA 1WA2X 1M56B 3NSDA 2VW7A 3V9EA 1A4AA 4K9JA 1NZRA 2MRYA 4HAKA 1L9RA 3IBOA 5I5JA 1ZPUA 3KW7A 2PPAA 5PAZA 3AG3B 3SBRA 3NJJA 4YSPA 3IE9A 2AVFA 2YQBA 3H4HA 4A2HA 3QQXA 1JVOA 3ABLB 8PAZA 1L9PA 4NAJA 4G7QB 4YVUA 5B7FA 1CUOA 3TASA 5I6MA 4DP5X 2ZONA 1L9OA 1L9SA 4GP4B 3CVDA 4AKOA 3EH3B 1PLBA 3OMNB 3QJTB 5F7BA 1SJMA 2IDSA 2AFNA 1QNIA 4GP8B 3ZIYA 2GI0A 1OOWA 2IWKA 4E9WA 2R7EA 3PAVA 3FSAA 2WO2B 4A2FA 2UXGA 2TSAA 4WKXA 4HIPA 1MZZA 1SFHA 1KBVA 2EIJB 3MX0B 5B1JC 4WTQA 5LDUA 1JXDA 3FQ1A 3X1FA 5I28A 2B3IA 3G5WA 1J9TA 1SF3A 2DYSB 2XXGA 1SNRA 1JZEA 2HXAA 5TK4A 2W8CA 3NP3A 1IBZA 2WSDA 1KBWA 1JZHA 2BZ7A 2X87A 3ASOB 4FAAB 3PCYA 4Q89A 1BYOA 2XYBA 3UACA 1M57B 2HLEB 1AQ8A 2FJSA 3OM3B 2UX7A 1PAZA 5IY5B 1GW0A 4AX3A 3WI9A 4YSDA 1BXAA 1ZV2A 2YAMA 1V54B 4HHGA 2JKWA 1NINA 2A3TA 4NB7A 3OD3A 4YSTA 2ZXWB 1E67A 3NJLA 5E9NA 4YSRA 4P5SA 1ILSA 3NP4A 2AZUA 4DP6X 2QDWA 2UX6A 2FQGA 3AZUA 1AS7A 2XV2A 1ASQA 1E5YA 2N0MA 1TU2A 3AY2A 1A8ZA 2PCFA 1QLEB 2HX7A 2PPCA 4E9QA 5FC9A 2YAPA 3FQYA 3FS9A 1BQKA 9PCYA 1QHQA 3JTBA 3UADA 1KDJA 2R7EB 1IBYA 3QJQB 2BW5A 3WG7B 1WS7A 2JXMA 3AG2B 6PAZA 3EHBB 3DKHA 1OF0A 3QJRB 5PCYA 1CYXA 2ZOOA 1ASPA 1FFTB 4BDVA 2CJ3A 3AG1B 1E30A 1J9SA 2H47C 2UXTA 3AG4B 3N2JA 3JT2A 2BP8A 3OQRA 5A7EA 5I6KA 3T71A 1JZIA 2HX8A 4KOBA 4HZ1A 3L45A 1NIEA 1CURA 1OV8A 3TA4D 2QPEB 1KDIA 3ZDWA 2IWFA 2J56A 3H56A 1NDTA 2Y1AA 1KCWA 3T6XA 2GBAA 2FT8A 2J55A 2FQDA 4KO6A 2IAAC 2EINB 3FSVA 1J9RA 2IDFA 4HALA 1N68A 2BP0A 5B1BB 1RKRA 1NTDA 1RCYA 3WKQA 4DP4X 1TEFA 2XX1A 2B08A 2H3XC 1GS8A 1NPNA 4AKPA 2FT7A 2I7SA 3WNIA 4CSZA 4YSUA 1BXVA 2BW4A 2XWZA 2PCYA 3S3DB 2X88A 1J5CA 1WS8A 1GY2A 5F7AA 1XB8A 4NERA 2YXWA 1NIBA 3CVBA 1OCOB 1ILUA 2YAFA 1BYPA 2GB2A 2DV6A 3T6VA 3S8FB 2EIKB 1NIAA 5AFAA 5B7EA 1TKWA 3FYIB 3TBCA 5B7MA 4BXVA 5D4IA 1MDAA 2H5UA 2BWIA 1XB6A 1ZIAA 3WNJA 1GS6X 3FU7A 2VSMB 1W6WA 4PAZA 1ETJA 2Q5BA 2EILB 3C75A 3QJUB 4KNSA 4E9VA 1BXUA 4DPAX 2TSBA 3BQVA 4QKTA 3X1BA 2PP9A 1T5KA 1IUZA 3ABMB 3CVCA 3FPXA 4MFHA 3NT0A 1JZFA 3TBBA 2VW4A 1B3IA 1TEGA 2YARA 2WO3B 4G70B 1UATA 4E9RA 3HB3B 4JHUA 2IH8A 3EF4A 3X1NA 4HCIA 3CDZB 2OV0A 3AW5A 4BK5C 5TK2A 4W9ZA 4YSQA 2VN3A 2XLLA 3T6WA 3T9WA 3SBPA 4F7KA 2OCCB 1PZAA 2BWDA 3NSFA 2PP7A 2FWLB 2BO0A 3FYEB 4N8UA 4YSOA 4Q8BA 1PZCA 4KOCA 4BXSV 5I26A 1PLCA 2IWEA 1KYAA 3WKPA 1CC3A 1HAWA 1XMEB 2DWSA 1AACA 2PPEA 4BWTA 4YSEA 4YL4A 1AZRA 3NJIA 2LLNA 3IEAA 3NJHA 3NJNA 1OCRB 2HX9A 3T6ZA 2IH9A 1AOZA 4UF7C 4UANA 2XVBA 1BQRA 4HHWA 1XB3A 3WIAA 3PAZA 3H4FA 3ZX1A 1MG2C 1I53A 3FQ2A 3NSCA 1V55B 2UXFA 3S3CB 1BQ5A 1SHWA 1PLAA 2IDUA 3QJSB 4GP5B 4ENZA 4RH4A 3CG8A 4A2DA 3PAUA 4DP2X 2AANA 4DPBX 4JHVA 2Y69B 1HFUA 1OE3A 4A67A 2UXVA 3ABGA 1ID2A 3OMAB 1ZIBA 4BWWA 1AG6A 3FSZA 3FU7B 2XXFA 2CCWA 2DYRB 1E5ZA 4F2FA 2CBPA 3CDZA 1L9TA 3UAEA 2CALA 4YSAA 1EHKB 5D4HA 2J5WA 4N4YB 2QPDB 3X1EA 3ZBMA 1J5DA 4W1TA 1FA4A 4GYBA 2E86A 1ET8A 2P80A 1SF5A 1KGYE 4A66A 2CUAA 2BZCA 1HAUA 2FTAA 1KV7A 3PPSA 4DP1X 3NSYA 5D4JA 2AZAA 3V9CA 1AZUA 1R1CA 5I5MA 4E9XA 3FU9A 4YSSA 4KO7A 2YAOA 2FQEA 2FT6A 1JOIA 3IN2A 1WA1X 3SBQA 1ZDSA 1FWXA 3QPKA 3TU6A 2XV0A 3X1GA 2MTAA 2JFCA 2VM3A 1NIDA 4JKNA 1NPJA 4E9YA 2GC7C 1PY0A 2PPFA 4E9TA 4GY4A 3SQRA 1GR7A 1JZGA 2EIMB 1A4CA 1SDDA 2BHFA 5I6PA 1PF3A 4KNUA 1BEXA 2XX0A 4GXFA 1ET7A 1OE2A 1F56A 4UAHA 4EF3A 1KCBA 3CZUB 1AANA 4DP8X 4M4RB 1WAEA 1NWPA 1AIZA 1X9RA 1OCCB 5B1JA 3UGEA 3NJKA 4PCYA 2CAKA 2HRHA 1GYCA 1RZQA 1W6LA 1DYZA 1WA0X 2GC4C 4ZK8A 4QLWA 4HCGA 2IDQA 4P5RA 1PZBA 3X2QB 2NRDA 5EHFA 2QDVA 2ZWNA 1MG3C 1J9QA 2GIMA 4AZUA 2I7OA 4L0PB 4AKQA 1PNCA 1OE1A 2VMJA 1ADWA 1JERA 1GS7A 3GXUB 1RZPA 4F2EA 4A68A 1SHXA 3NJMA 4FA7B 4YSCA 2HRGA 4DPCX 1YLBB 1EZLA 2P80D 4G72B 1A3ZA 3NJFA 2PP8A 3GYRA 4KO5A 3PXLA 5I6LA 3ERXA 3FT0A 3FPYA 3QJVB 3MBWB 2BP8B 1IC0A 3UAAA 1JXFA 1AZNA 1AS6A 1OCZB 4E9SA 1IKOP 1GY1A 4G7RB 1NIFA 2QT6A 1DZ0A 4TXVB 1JVLA 1A65A 2IDTA 1V10A 2PPDA 2XU9A 4DP7X 3FSWA 4M3HA 3ASNB 3DIVA 1AZBA 2GSMB 1NWOA 3DTUB 2RACA 3FU8A 5I6OA 2VSKB 3D12B 1NICA 7PCYA 3U25A 6PCYA 7PAZA
chains in the Genus database with same CATH superfamily
3W0WA 4PU2A 3S34H 3A47A 4YXHH 1DP0A 2VLRE 2VAAB 4DGIL 4LFHG 3DURB 1DVUA 3G5ZA 1AAJA 3ZO9A 4DQOH 3QDMD 4S1DC 2VJXA 3U0PB 1PIFA 3FAXA 1TQTA 1M2VA 2AJ3B 5DTFB 3S3BB 4I1PA 2ZXCA 3J07A 1R5IB 1X5FA 4G9FA 3KPOA 1KPVA 2OQJB 2YPLA 2YXVA 1QFUH 3P3RA 5B3SB 4Y89A 3REVA 2PMZA 5EEXA 2NLJA 1I3UA 4L4VE 3D4CA 4XCCH 4LCWA 3MRKB 1H8NA 4YHKL 1G9EA 3EYUL 5KAQG 4JM2A 5KYUA 4BYHA 1CICC 3C9NB 2QHLA 3F7RA 3MGTB 3ZJAA 2WBJB 3GBDA 4ZMNA 5I5RA 3F8UB 1EO8L 2IAND 2OYMA 1A9BB 4BINA 1EJOL 1E90A 3AROA 3MRMA 3MV8A 1RK0B 3OAZK 1N18A 3KBEA 5DHVA 2FJFB 3THMH 1CYWA 3SEPA 1HDMB 3HOGA 2Y06L 3B83A 4J1UA 3RUGF 1UFUA 1E43A 3ATFA 5IB1A 4E41D 1SM3H 2A74C 3AU0A 4MYWB 2VDOL 1ONQA 1QEWA 4U0QB 2CG9X 1IZJA 2XXCB 1U8MB 2D2OA 1A6AB 1ESOA 2X7LB 2PPAA 3VFRA 3IFNL 1CMOA 4DKFL 3VH8B 4LSVL 1YEDA 3DNKA 1DJZA 1AKPA 5JXED 4NQDD 3CC5A 25C8L 4EZLA 2WM0A 4Z7OB 4TSCL 3C08L 3KPRB 4Y2DD 2DLEA 5A6IA 1I1CA 3AQDA 1MUJB 4MA8L 3O8XD 1AHWC 5F0LB 3QULA 1CPUA 2OZ4H 2WQWA 4JFOB 3TASA 1IBGL 3GF8A 4R0LC 1KLGA 1EV2E 5JA8B 1K2DB 3M07A 5D1QD 5IKCB 3MAWA 1XZWA 2AXFB 3IFOA 2D7PA 3IXTA 4IOSD 4X8JB 2B16A 5DMGC 2X3AA 2V8LA 4WWOA 1YYLH 4QY8B 5C0BA 2YK1H 2UXGA 4TNWK 4WKXA 1RQ5A 1ZHBA 5JMOC 1UCBL 4L8CA 1FJ1A 4PJGA 1J11A 2OMZA 1FHGA 5B1JC 1G5GA 2I9LA 1XSOA 4UQAA 5LNDA 2YD5A 1MCEA 5L6YL 3CWGA 1J8HB 4PS3A 2HXAA 2AMUA 3F7VB 4FZEH 5JW4M 3WFDH 3UACA 5EF1A 3O3BB 4YGAB 4XB3A 3U7WH 4AYEC 2VISA 4HSQA 1MFAL 1Y6MR 2OMTA 4HBCL 2CUHA 4HWBL 4X9HA 4EXKA 1V27A 5CGBA 1SY6A 1ZV2A 4WAFA 5T5FH 2K6YA 1KPUB 1E28A 2FYYA 3OBAA 2XWDA 4NB7A 4G5ZH 5CF3A 4MXQC 2K1MA 4XPGL 1CDGA 2ZXWB 5IEKB 1YNLL 4R90H 1J1XL 5MENA 1DUYA 4MD0A 1ZD6A 1LK3L 3PGDA 3SDYH 3WKNA 3NP4A 2AXWA 2WUBL 2P5ED 3FTZA 3CFDA 1LJMA 1BBDH 1FGVL 5A2AA 1X7SA 2F8XC 1KTBA 5D4QA 3O3BA 2ZWSA 3HUJB 4MQXD 4S1RH 2WZPA 1J0ZA 4BFGA 5B8CA 2A7BA 1RZIB 2MCMA 2P42B 5ADPH 3MNVA 4CW1B 5AOJA 4AYGA 3WHXA 1JDAA 2HFGH 3KL3A 3L1OH 1OK8A 1WYJA 4BQ8A 3IXAA 4JL2A 5KS9E 1U8IA 3RVVD 3H42L 5SV3A 5E24E 4QXWA 4HXAH 4X4ZA 3SE9H 3LNGA 4MVBD 2P26A 4MCNA 1II4E 3B1TA 3ZDXE 4RNRA 3FTXA 1MFEH 1NUNB 1FVEB 1R9FA 2GFBB 1DQVA 4ILDA 2APFA 4NFDA 3FSOA 5DF0A 3EHBB 1Z9NA 3KYMB 1N4XL 1ASPA 4QRTA 5FO8A 4N86A 4FFZA 4K7PH 1G6RH 5CD5C 3BSHA 3VQ2C 1WCBA 2DI7A 4DZ8B 4AL8H 5I6KA 1GYVA 3RU8L 5BQ7A 3HE7D 5I9QC 5K39B 3FBKA 4EI6B 4FZ8H 1HEHC 3SYAA 8FABB 5AW9B 5B21A 3ZDWA 1M71B 4CN4A 5K9QG 2OTWB 4WWKD 1HQ4A 5DUPH 3O9WB 5ETUB 4ZUVB 3WY1A 3V0VA 4TUJA 4UV4H 3LQAC 4YBLC 4BRVA 2A6JB 3WKYA 3ZIMA 1KN2H 2VE6A 3SDXF 1AQKL 2BVQB 1NEZA 3ZU8A 5LN8A 3SJVA 4LPXA 2ESVB 2BNRE 1GJWA 2ISDA 1HHJB 3FN3A 3HG5A 3WFHA 1E8WA 5GJTH 4OZFA 4MA7L 3I74A 4XC1H 3VXNA 3BSZA 1XGUB 3DSNA 2IVFC 3L3IA 4HGWB 1JNNH 3H6JA 1E7UA 5F7DA 1UWGL 4F92B 2A9BA 1LNUB 2XICA 4U1SA 5E8EA 5CEZE 2NX5B 1CXIA 1QVOB 2DLFH 1FCCA 2XWEA 2ZCZA 4IJ3C 3DRQA 1RZFL 5CN2A 5FO7A 1SEBA 1CFVL 1Z0MA 2H6UA 4L5FH 1KZYA 4GQ9H 4OUUA 3QR2A 4KBPA 4PY8J 3TBCA 4B3EA 5B7MA 2HA1A 3SJVB 4KRPC 1TZ8A 1G7QA 1UD6A 1XCXA 4TSCH 3C08H 5DGQA 2EDQA 4G3YH 1NDGB 1NMAL 3CN4A 3GMPA 5DRWB 1T21A 5T3ZD 1IGTB 2YEQA 4JRYB 4X5RA 3NIGB 5FYJL 1UB5A 3KL0A 1NCBL 3ME0A 5E2VL 4I89A 1MCIA 3R1GH 3S88H 2B1AH 1TJHH 3OXSB 4LB8A 3ARBA 5CIPH 3X3GH 4K7FA 4BKLB 3RFZC 3APMA 3DX9A 3A67H 1H3GA 3KLKA 2COQA 4TQ8A 5EU6E 1VKXA 2Y9RT 4N1EA 4XN5A 3PWVB 2MHAB 4U1MB 3Q7JA 5E00B 3EF4A 5A16A 1MFMA 4KRPD 5SX4H 3ARWA 1IEAB 3ARFC 5FA4B 4WTXA 4QRSA 2EUXA 3RVXC 1ED3A 4YQXL 1B2YA 3QYMA 1S9VA 4GT0A 5DJCA 4F7PB 3TT3L 1MEXH 3GSUA 4UQ2A 1PQZA 3ZTNL 1Q94A 2VR8A 3U4AA 5A2FA 3P0VL 2QGCA 1TO4A 1P84K 4HFUH 1B3JA 3ESUF 3L54A 3UTOA 1Z0NA 2OPCA 5KYXA 2L3BA 5AVWB 4LGPB 2MOGA 4BWTA 5CZKA 4YSEA 1TYJA 2JCWA 3DV4B 2DLHA 3TZVC 1W8OA 4NXSA 2AEQH 2DQCL 1N64L 2BHYA 3RX5A 1MDTA 5E1AA 3PWNB 1DQMH 3I85A 2WINB 3AU1B 4E0RA 1JHLL 3FMGH 1A14L 4FHKA 4S1RL 32C2B 1CYGA 2MCPH 1BQSA 5DZLA 1TPXC 3VXOB 4BCXA 2PYED 3SDXA 3OC8A 3JWOL 5IG7B 3HKFA 4PJDF 4DP2X 4ANUA 3PV7A 2DQDL 3RA7H 2XA3A 1QFPA 1U8IB 4OGZA 5TQ2H 1QRND 1X5IA 3RVTC 1A1NB 2B9BA 3ULVL 1XH3B 4KXAA 4PWGA 5HSFA 3N85H 3Q6FB 2Q10A 4A63A 1LMIA 1K6QL 1YVLA 3CTTA 1GYAA 2L8AA 3L3OA 5AAWC 5TJWK 2FBJH 2OSLA 4PTTB 1JPFA 1SOXA 4IIQA 3X12B 5DA4A 2QPDB 4YE4L 2DB8A 1U8MA 1YEIH 2YC1B 3GI9H 3KWTA 1P1VA 2CGZA 1SF5A 4R4FH 2G0LA 2WWKT 3RGBA 1CLCA 1OP9A 1XT5A 1KV7A 5DJAA 1F8TL 1I31A 4FZ8L 4I9XA 3L5JA 4FGMA 1WFOA 3VW3L 1DJIA 3CE1A 2FBRA 3ULVD 2YFNA 5K9KA 1MJUH 4XVSH 1U8LB 4LP5A 4UV4L 1MHHB 3A22A 4JFOA 5HHPB 4L3EA 4QDGA 5E0QA 4Z7WB 4IS6A 5GGQH 3U1QA 1W0VB 2H1PL 4WO4C 2OJZH 4M61B 3R06B 1ZLDA 3B9DA 3QZOA 2V9RA 3GPEA 2P8PA 1PLGL 2GJ6D 4LKCA 3RY6C 3UDWA 5FYLD 2EO7A 3ILQD 4GY4A 1GR7A 4K3DH 1KC5H 5JHDE 2P48B 5FGBC 4JPSA 3MV9B 3ATAA 5C0AE 1I8IA 4KNUA 5C2BL 1KJ3H 3B7UX 3QCVH 5HYIA 2YGNA 1KF9B 3V5DB 1N5YL 3FCGA 3ZSTA 1Z3GH 3CZUB 1UUSA 4YX2L 1JWUB 1JF6A 3VFOB 2V17H 3VCLA 1J5IA 4M5YH 2XXMB 4L1DA 3FB6A 5KN5A 4XXCC 4WFFD 1NDGA 5AKVA 1FLRL 3L8QA 1KEMH 3NCYS 5C0CA 1U3HD 2ZTBA 3BHBA 1T7ZA 3L3GB 3PJLA 2FLBT 4K9EL 5HYEA 4FEMA 4NYLA 3W39B 5KUKA 4G7YH 4XO4A 5I1AB 2BDNH 5FV1L 5AOZA 5KVFH 1GC1L 3T0EE 4AZUA 5GS0H 4IRSC 1PNCA 3QQDA 2R2BB 4V1DE 3O8XB 5KVGL 3GMNB 2H8PB 3VXRE 1GH7A 2DLIA 2GHWB 4MDIA 1OPGL 3FFCA 1K8IA 4IJ3B 5J89A 4U6HA 1MI5B 4RGOH 3FULA 2IADA 4EN3B 4ODVL 5CJQL 4R7NB 1P7KB 2CHZA 2AERT 2BHZA 3T0DA 4GBXD 3ULVC 2E59A 1HESA 1NCWH 2ITCB 5I19L 3EKCA 2WJ5A 4BH7B 4L3EE 3IFLL 1E4WL 3MJ7A 2DN7A 1MFUA 3MFFA 1T3FA 4GSXA 5EEWA 4NQQA 15C8H 4NUGH 4L1BA 4N5EC 2M8XA 4G6KL 2EYTA 2OP4H 4HFUL 5MP6H 1IC0A 4C4KT 4KJYA 1AS6A 1OCZB 3MLZL 2JCCB 1NBYB 1QOKA 2QT6A 2ZUSA 1DZ0A 3GNML 4X6CA 4JM2B 5H4ZA 4HU8A 2YRBA 4PRPD 3GXTA 1YDPA 2EDBA 3D6GA 3QJFB 4QRTB 4R4ND 3DTUB 5F88B 3AWEA 3D33A 3IETB 3TV8A 3JTSB 4XP5H 3UBGA 3N44F 2GUYA 3PUUA 4N0YL 5D96B 5GGRA 2PCXA 3AU1A 3RP1A 2EC9T 3QARA 4UIKH 1FL6B 1A6WH 4FJ6A 1Z5LA 2NY0B 3B6SB 3WIFB 1BAWA 3MMEB 1UASA 1QFWL 4I3GA 3GDCA 2WN3A 3V79C 1S6NA 1DR9A 2HFEB 4JS7A 4DKAA 4MAYB 1RK1B 1ES0B 5EUOE 3ZE2B 2YPVL 1UOVA 4KJPD 1AG0A 2Q9OA 4NJ9H 2VZVA 2I85A 1R19A 1ZTXL 3EH5B 1Q1JL 4S1DD 3NJGA 5D7KE 4AMKL 1YY9D 5J6HA 2A6DA 4DP9X 2AJSL 2PXYA 4YAQA 4NQCD 1E5UI 1XGQB 1Z9OA 2OTUB 4V1DA 2I9TA 4XPHH 3KEDA 4JK0D 1BP3B 3OLDA 3QI9A 3HC0A 5F7DB 1T4KA 2X4RB 5I76A 2WMPB 5IVXB 1MCBA 1URLA 2WLJA 1FL5B 1F4YL 4YE4H 5MHSD 2VW6A 2EH7H 1YEIL 3EUUA 5BZDA 5E6ZA 1U33A 2X4SB 2CJUH 1PMYA 4BCZA 1A6ZA 3FCBA 5C9KA 1QYGL 3AT9A 3IS0X 1J8RA 1GZHA 3VWKD 4XC3H 3UZVA 1VADA 1KJ2L 1MCOL 3NSDA 5T5NG 2F54B 3OGCA 3HR5A 3HMXH 3VFVA 3UL4A 5HDQL 2WLLB 5CXPA 5AVVB 5B3NA 4Z7QB 4PCKA 3VX1A 4OF5A 4FTVE 2BIQA 2B1OA 3PXJA 5EC1B 1LXMA 5CU9A 4N3TA 3LIZL 4NQED 4ALAC 4EI0A 5KSBF 4MMZA 5KOVC 4U1JA 2NNRA 5J1AB 4PRAB 5K9QI 4L3FA 4EPSA 5T3XD 1XVSA 4LOEA 5TGBB 5AYTA 1N8ZB 2BIMA 1OF2A 4EOWL 3LMJL 2WWMC 3D69A 3IYLW 4FXGB 5I24A 1FFNB 1G4RA 1VB9A 3QFJB 4Z7VF 4DP5X 1KJ3L 5C2BH 1T6WA 4LEXH 2X6AA 1I1FB 1HI6B 1BZQK 3V5DA 5HHVL 2P7TB 2O5YL 3GM0A 4M5YL 1MRDL 4R97B 1WP6A 4GEIA 1KXHA 3KM1A 4W9IC 5AW0B 1BVKA 2ZJSL 4FG2A 2FX8L 1YC8A 1J8HE 3WLBA 4AEHL 3TJEL 2FO4A 3US0A 3QJHB 2IQAB 4ZFOA 4HMDA 1XIWC 2TSAA 2BCKB 2ZNWA 3KLDA 3L81A 1UWEH 4MCYB 1SZNA 4P07A 4RGMB 5BUGA 4JREC 4V11A 2WXLA 2CNZA 5C09D 1RIVH 4GAJH 4WDIA 3SDDD 5I28A 3G5WA 4J2QA 5FFGA 5KVFL 2IOMA 2WPGA 3IDYC 3L3KA 2CMRL 4MA1C 4PJIB 2FGWL 1JZHA 4PJ7F 1T22A 2ITFA 2EDDA 2XYBA 2P47B 1KB3A 3DVGA 5IHUL 1PAZA 3WCYA 2DJMA 4KROC 5DR5L 3WMSA 3OHXA 1JN6A 5HGHB 4YXLH 4AYFB 3UDWC 1CR9L 2B4CH 2HFFA 2JH2A 2XZAH 2JKIS 4GUPA 4X4YB 1OGPA 3D2UB 3VRLE 2R29A 3E6FA 4ZS6D 2PWFA 4GI9A 3BVXA 1WFMA 3QEGL 4A04A 4YDNA 2VR7A 4KJYB 3AT8A 1IGYB 3AJ7A 2DQEH 2XV2A 43CAB 4RGND 5GJSL 1JZ3A 1HZHL 3OX8B 4EZJA 1T0MA 1XH1A 3F2LA 5J56B 1JN6B 4WHYH 2D7QA 4UM8B 3TM6A 3CH1A 3VUAA 2EVHA 1DBAH 5GS0D 1R3HA 2V6HA 2YAPA 5JIDA 4JG9A 3T3PE 3GTTA 4KGLA 1ZLEA 3SOBH 3GBMH 5ILTH 1SBBA 4UIKL 3LEXB 3P11H 1A6WL 2MQ0A 4OLXL 2MPAL 3RNQB 2VDPH 3V10A 4NCC2 5ADOH 1EDQA 5GHWH 3LDBB 1Q90A 2B20A 3GSVA 5JHBA 2DQTL 2Q6WB 5D7LD 1DFBH 43CAA 4Z7WF 1P4LB 4N26A 5ACMA 3BIBX 3OZ9H 4HZAA 4ZMXA 4OT1H 4M7JH 2OZNA 3FXIC 3F00A 3WNNA 4URKA 4H20H 2H1XA 4PJXB 1IBHA 5J6HB 2OR9H 1VPOL 2CGRH 3ETTA 1DN0A 4HZ1A 4KOBA 1AYOA 5A2IH 1INDL 1OCWL 3II1A 2J56A 5FKPA 3UTTA 3QSKB 5IZ7A 4JE0A 2YGQA 2Z91B 3MLSH 3ZT5A 4K07A 1F4HA 5G4NA 1F4YH 4P9ML 2CO7B 3I9AA 1NTDA 3N91A 1EQWA 3W0WB 3VXRB 2ITDA 1WTGT 2PCPA 3BUYB 4DGWC 3M46A 2D9QB 3LSOA 4WEBL 5FS5A 3BEVA 3DSFH 5SX5H 4C47A 2XWZA 5I1JL 5E00A 5IROD 4P05A 1FFOA 1NCUA 2FECL 2Q8AL 3UH8A 1IIKA 2CO6B 1D9KB 5CUSH 3I3DA 2BVOB 4J4PA 5C6PB 2FIKA 3VGHA 4ISVB 2QMJA 3C60C 3N44B 4IW4C 5ICUA 1XF3B 3FYIB 3MPCA 5GGTL 4LLYA 3V6ZB 3FQWA 1C16A 4PY7A 1YPZA 3OG6B 1UD8A 1VA9A 3KAAA 5EU5B 3BP4B 3W3BA 4JZJC 1I8KA 2DM2A 1YEHH 4ONHA 4HJGB 5K9OB 3EGSB 4ODSH 3CVHL 2XFXB 4CMMA 3IGAA 4D0BB 4KNSA 2WOBA 3IVKA 1AHWA 3ARDB 1CXLA 2X4UB 3BDYH 4LBAA 2ZX9A 4LOUD 4NNXB 2B0SH 4NQCE 3M17A 1TF4A 3FPXA 4J3SA 5HJGA 4NKDB 4LOFA 5KTEH 1E4XL 2O6DA 4BELD 3ARQA 1BLIA 1HL4A 4M6OL 5JNYA 4ZMOA 5HGBA 7FABH 3ZKMC 5DS1A 1RULL 2F08A 4HKXA 1C16B 4PWEA 3TJEH 5IQ7L 2L0DA 3ZDZB 5LB1A 3B2VH 4BFRA 5DUMH 3CDZB 2BLFA 3VSUA 1FORH 5C8JB 1DCEA 3HZVA 2QTVA 5INDA 4FX5A 3DTDA 2FD6L 4HSAC 1RIVL 4GAJL 3QJFA 4DEPB 1KYOK 2XLLA 1A8JH 4EE2A 1XGTA 1B4LA 3TOPA 5IJVB 4JFZL 1M05A 1SXZA 4HG4K 2JV6A 3VACA 1V3KA 2GIXA 3REVB 2AK4A 4HUCA 4FXGC 2DBJA 3WN6A 4GB9A 2JKLA 1CK0L 3MUY1 4FXTA 4WV1B 1TCRA 4XP4H 3S36X 3T4AB 1QR1B 2PPEA 2N1TE 1NDMA 4OZIA 3L2NA 3BE1L 3X13B 2RAMA 5EIIA 3RZCD 1GCYA 1BREA 5FF6B 4N8VG 2UZYB 1WWCA 1A9BA 4FQCH 3O4OB 1MCDA 1TQVA 2DQGL 1UACH 1UYWL 1ZT4B 1A25A 1U30A 1MHEA 1YMMA 4D7BA 1ZY9A 1I9JL 1Z9SB 1UENA 1A9VA 4WNJA 4B9JA 5JZ7C 2Y3NA 4JFDE 1F4WL 4H2CA 3BGAA 4HIJB 3ZZSA 4KK8D 2XG5B 2BRRL 3ULUL 2VRQA 3FNKA 1ZE3C 2ADJB 1KLUB 1V3LA 2JLPA 3HI6H 2Y69B 4EBQL 2WJ7A 3WLWC 3BO8B 1EX0A 2P9RA 2IWGA 3DGGA 1NGXB 4P9HL 2ZYHA 1GCFA 1WZ1H 2OCJA 3P11L 3IJSB 4LFHD 3TEYA 1T1XA 4AH2B 3TJPA 1G7LB 3OMAB 4XNXH 1DDHB 4PPTA 3S4SB 4ELME 3GS4A 2WD0A 4AW4A 2DYRB 2DQTH 1UWYA 4JFPA 1LP9A 2J4WL 2CIIB 4A7GA 3TO4C 1LE5B 4PJFB 4UZGA 1X5AA 5B38B 4WQOA 4B0MM 3F12B 3MNWA 5DD1H 2WYIA 3BZ4B 4GNKB 3UGUA 2Q3AA 1R4XA 2QKIA 5HYJB 2OMVB 5JQ6L 4W6XB 1CE6B 4F7MB 3WD5H 3BWUF 1M7DA 4DF9A 1INDH 1P6WA 1YEEL 2Q7YA 2RR3A 3O3UN 3P2BA 1ZSHA 4ZMAT 2D03H 3OKMB 3ZUCA 2HT2D 3BHBB 3Q8FA 3QUML 2KC0A 4FI8A 4P48A 4XCEA 5JYMA 2IQ9L 3K72B 2FQEA 1JVKA 1CL7H 4KU1A 3BPCB 3FUKA 5DD5L 3TO4D 4M93B 5E7FA 1T7VA 2KZWA 2VSDA 5JW5A 3HRZC 3D8MA 5F1SA 3EXLA 1S7QB 1D5MA 2OMYA 3KYOA 4A55A 3D25A 1O6SB 1JFQL 4JQVC 5I82A 1F6AB 5H2BB 1AY1H 1FG9C 3PJSA 3TZVD 3MLTA 4B9YA 4CSTA 1SY6L 5TE7L 4W6WB 2J6WA 1JGEA 3APCA 3ZZQA 2H9GB 1PCXA 5E1IA 5CFHA 1A6TA 2QQNL 4QOKA 2NY1C 3PREA 4K94C 1OAUH 2BNQB 5C0GA 2MQ3A 1XF3A 1JNJA 3K5SA 4LNRA 5HGGS 1XSIA 3RL1A 1FGNL 4M7ZC 4HQQH 35C8L 4EIUA 1RZQA 1P6AB 2WB1A 4GMTH 5E2UL 4QLWA 1UD4A 4NM8L 2ZP8A 5B8CB 4FZEL 5IF0B 2DQHL 2W81C 3D39B 2B0SL 3VRJB 3D2UA 5D7LA 2D0FA 5LGJA 3GXDA 4Z0XA 1HOEA 4HBCH 5JQHC 3ARRA 3PNWB 1R0AH 2X38A 1GS7A 2B59B 3O6ML 2IAMD 3F7QA 5E0FA 2NNAA 3U7AA 4DZBB 1U8OA 3KPNA 2F53E 2H6PB 3QDJB 4J3WA 4XPGH 3NACL 4N6RA 1TQSA 4UQ3B 4FTDA 1B9KA 4ZO9A 2FD6H 2ZICA 3DX8B 1JGDA 4WFHD 4ADJA 5JPMB 1FGVH 3CU7A 3GSXA 1G6VK 2C4FU 2KPWA 1RZJL 3D85B 1T2JA 2YOCA 3MBWB 1E9PA 3GLZA 4BFEA 5INCA 1L3WA 5DEJA 4FXKA 4J3OF 1IKOP 3G6AB 3QNYB 4Z7UA 3GB7B 4MJ2A 2WNKA 2XU9A 5G5DB 4PJAE 4OCRL 4F37F 3ZTJH 2CK0H 1AZBA 4TPRH 1JTTA 4IBQA 5D1ZC 1WIPA 4FQCL 4B96A 1JNLL 1ZHLB 4Q74A 4L1HA 5CCJA 4KRNA 3HEIB 3AGVA 5CMAB 3FTGA 1MHEB 4ZQKB 4KKBD 1XSJA 2XUWA 5C07D 4DUXA 1SDDB 5LXGL 3HPJA 2ODHA 4RAUA 2RH0A 1DDTA 3LD8C 3QRBA 2YAEA 2BRRH 3RU8H 4CN1A 1KGWA 4YH6A 4FQPA 4CN6A 5KEZA 3ZSSA 3D09A 3DRQB 1BEYL 1YJDL 3DV6B 2JKXA 4OIFA 3T5WA 3T08A 5BVJB 2FNWA 4KKCD 1UT9A 4H8WL 3BSGA 2VDRH 4LRNH 5GRJL 1MCHA 4FI7A 4NBZB 3QIUA 3L4ZA 2Y36H 1ZLUK 2OX5A 1H5BA 1TYRA 2X12A 2WXIA 4C58B 1YEGL 4GG8A 1WDAA 5FOJA 3WS3A 5ID0A 2BC4A 4R7DB 1LE5A 1FC2D 2F53A 5E8PA 4XP6L 1VZGA 2FVNA 3FOLA 4BZ2H 1DLHA 1TJIL 4XC1L 3LKOA 3ZGHA 2EEDA 3UYRL 4LMQI 1AGFA 2MKWA 5HYJD 3LZLA 2C5DC 2EDWA 2JI2A 3WD5L 5J0BA 1S7TB 2XIIA 1FL3B 4G9DA 4HPYH 3UBXA 3KLHD 5CCHE 3NAAL 1ZV5A 1HINH 2DQIH 2ADYA 3HZKA 4O5LL 4F8PA 4YHZH 4K9JA 3QJOA 4ZFZA 2WLYA 1S8DA 2QR0B 4P5TA 4C54A 4I48A 3HB3D 3K72A 2LGNA 1ZPUA 5JLZA 5E8PB 3C60D 5PAZA 5LGHL 3MI6A 3KDMA 4UOZA 5DJCB 2NW2A 4R0LA 2HTKC 3ESVF 5I0WA 3PGDB 2YQBA 2BVPA 1ML0A 3QORB 4RFEA 3S96A 5KG9A 1CD9B 1RJLA 3RKDC 2ZOUA 2HT3C 5CZXD 5H37A 3QXAB 5LGYA 5EF2A 3GLDA 5HVHC 2V3DA 4RMVA 3TN0D 3MLYH 4RMRA 1XAUA 3DBSA 4JO2L 3EOYG 1L9SA 4O4YH 4GP4B 3RWCB 5DD0L 1PLBA 2FB4H 3GSNH 1RPQA 2VXQL 2Y7NA 1EZSA 3GWJA 4GQRA 4E68A 5EEUA 4P2QA 1JIBA 2H41A 4JVWA 2G2RA 2XPZA 3OHXC 4X8CA 2VR5A 2WO2B 4KV5E 1G87A 3SN6N 2F2HA 4MLSA 3TT3H 4DW2H 4Y19A 1MZZA 4OJYA 2FR4B 1NFDE 2EIJB 1DQQA 1S9XB 3C2AH 3MKKA 4IU2B 4OGQC 2XPGB 1JK9A 3AM8C 3EBGA 4KROD 1SNRA 2ICWB 2KZBA 3OKOA 4NKMB 3NP3A 4FQ2L 3SE3A 4MNQE 1EJ6A 1BYOA 3GLEA 4TTDC 5KVGE 3O6MH 1HHGB 5FA3A 3GQFA 3ZQ9A 1IO4C 1W0WA 1M1XB 2DQCH 3GK8L 1H9DA 1OO2A 1T0NA 4IRSA 2AHIA 2D3LA 1CN4A 1OTSC 4MA3A 4HS6B 4P59L 2Z64C 4UBDD 2X2UA 3R4DA 4XPBL 2UWEA 3LKNA 3Q2LA 4WSKA 4K2UH 4MD5B 1KOAA 4JN2A 4J2XA 2B2XL 1MFDH 4U6VL 4LHUA 4UINL 3VM5A 3QC5X 4YSRA 3MV8D 5D7IE 1Z1WA 3MRRA 1QBLH 1GPOH 1NC4B 2IFFH 2QLYA 2DQDH 4HJIA 3RA7L 2N0MA 3AXHA 5CZVH 1S5IH 4ZMZA 4GW1A 5E8EB 2CKBB 1PJ9A 1A8ZA 2AJXL 3TO2B 1WBZB 2PO6A 3M8OL 2ICCA 2OMBA 2Y23A 4AIOA 5I1HH 4IIZA 4Y5YA 5F6HJ 4PHZA 1TTCA 4QRQA 4R7XA 4OJAA 1MN4A 1ZWIA 4PRIA 4LLMB 4QNPF 1J1OL 4K8RC 4JDZB 4OLEA 4DKEL 4IMLB 2FJGB 3FUFA 3DJ9A 6PAZA 5FYLL 5E5MA 2DYPB 4JKPL 4AQ1C 3US9A 4NGHH 4QO1B 2H0PA 3G3LA 4JKKA 4FNLH 1E27A 3BWAB 5ICZA 1AXSB 3IJHA 4HH9A 1YYCA 4BSWB 5IEKA 5C0CD 1BD2B 5A40E 4NM4H 3T71A 3ARUA 3O9WC 4Y4KA 2YA1A 1J1PH 5C86A 3J2PA 1BVLB 3L17A 2RCSL 2IMNA 3DUSA 2DQJL 4HISA 5EZOL 4YHNB 1EGJH 3QHTC 1HU8A 2JB6B 1MI5E 2AMGA 2EKJA 2XFXA 1U8NB 3ILEA 4GRLC 1GRWA 4LEOB 1PLGH 5B1BB 4GXVH 3OXRA 3LOWA 1AO7A 2R8SH 1ZMYA 1KXQA 2VXTH 2B08A 3LPGA 4M5TA 1KC5L 5BXFB 5IB3A 3K2KA 2AW2A 4CSZA 5EPMA 5FKAA 5ISZA 3TA3C 3HCVB 3MRKA 3RWDB 3ULVE 3KLAA 1PJWA 2X88A 3ATEA 3T65B 5MEPA 3ABZA 1Y6KR 4A7GF 4RMTA 2MPVA 2ZKHH 1EXHA 1TJGH 5HYSA 3WENA 1CL7I 4KVNL 1I8UA 2EIKB 3GMRB 1BM7A 3E6HB 2FJFA 1NCAH 3WEOA 2OJEB 1L5GB 3F62A 2H5UA 3MLVH 1B9ZA 1NANH 32C2A 2VDPB 4NNYA 2BSBA 3S2AA 2VSMB 1W6WA 3CFKA 3DK2A 3VGDA 2IALA 3ARXA 4GS7C 4HP5A 5CINH 3L9EA 3CZKA 2X6MA 4UDUA 3QUKA 4M02A 5T5NF 4R3SA 3CVCA 3O2WL 3CSBA 3KPTA 1N3NA 2RJMA 5CILL 4JRXE 4YPJA 4Z78A 1TEGA 3L4CA 3T8VA 4X5XB 1AP2A 1KG0A 1EMTH 4JHUA 4HX1A 1FZJB 1EFXA 1WITA 4G8FA 4NI6A 2G60H 4JFXB 5C97A 4YR6A 3K6NA 3QWOA 4NP4H 3SZ6A 5SWZB 4YMPA 1HK6A 4CU7A 2HFEA 1CLOH 4LLAA 5JDSB 2B1HH 1OSZB 1Y07A 1IT9L 1RY7B 2XTJD 3NFPB 4R5VA 4IBLT 1HE8A 5DHYB 1RZ8A 1ZRUA 4JQVA 3SBPA 1LGVA 4RRPA 1E9OA 2CDFA 4OLVH 3K0WA 5C9JB 3SE6A 4BZ1H 1LWHA 1GSMA 3I6KA 5I26A 1CFTA 1LP9B 5IQLA 1KYAA 4JRYA 1FH5L 4PJHA 2YZ1A 4ONGH 4M48L 3QXWA 1S7SA 2FUQA 1R3LA 1CG9A 3CFMA 5EEYA 2O93L 4OD1L 5K5YA 3KS0H 3UC2A 4UINH 3V7AE 3NA9H 3TIEA 3VXSB 2ALWA 4PRNA 5FYJE 1RP8A 3HMWL 3V0EA 4LU5L 2HT4D 3TBVB 3UIYA 1PX8A 1A66A 5FCUL 2GTZB 1QLRA 2P28B 3TFBA 4ERSH 1EZUA 2DLTA 3TYFB 3O6KH 1VFAB 3RUGB 4M29A 3T0BA 1BOGA 3TWYA 1UJ3A 5EU6D 5FA4A 4ZFQA 3SGDH 3MRHB 1IAOB 1C08B 4YBQC 2AJSH 1J18A 5C92A 2WXRA 1ICTA 2HRPL 3QZWB 2FX7H 1ZGLP 1M6OA 1IVLA 1P9MC 3BVVA 4YHMH 2VLLA 3FZUD 1RMFL 3HS0B 2VQUA 1ZWIB 4NUQA 4PRIB 1CLZL 4BWWA 4EMZA 2XXFA 5IB4A 3IAPA 4J6RL 2Q8BH 2CBPA 2F8OA 5DZ9A 4N2HA 5BO0D 2AJ3A 4K7PY 1KUMA 2X70A 1MHPL 1RZ7L 2V5SA 3MRHA 1A6TB 5T1LD 5I1CL 3MODL 4RA3A 4ENED 3FZUC 5FLUA 2NY3C 3ESNA 1ET8A 4NWUH 5FFLA 2XN9A 4S11A 5E5UB 3GJFH 5KYYB 4HIIA 2G2NA 2KMWA 5D2LB 3D39D 4XZUA 5EU3A 3GRWL 1MXGA 3FFCB 1QPKA 1BQLL 3U7YH 4TOYL 1A0QH 4ES9A 5AB9A 1ZGLA 3MLWL 4TUKH 3BEWA 1XCWA 4Y8DC 1HHHB 3HLAB 5ECJE 1YY8A 4JPIB 1IQWH 2C1OB 3MZGB 1SXNA 2ITCA 5DHVB 5GGUB 3DROB 3MU3A 4RISL 3HVNA 3MR9B 4QRRA 4EOWH 5J12B 1QTYT 4G6AC 3TFKD 2PTUA 1X9QA 3BP7B 5AVRB 5GGSY 5LUMA 3BZEB 4KZEH 1BQUA 2K4AA 5MERA 5JXAL 2PR9A 2R1WB 3OGOE 5HHVH 3ZYOA 2NUPA 3PQYA 5EUKB 1N6QL 3SPIA 1TTUA 3BEWB 3QIUD 4JJHA 5E7BA 1U21A 5C0ND 1OE2A 1A6VH 3A6CL 3ZYJA 3C6SA 1LLAA 1BG1A 3A4DA 4KK6C 3L4XA 4OF3A 4Y4FA 2N4IA 1TNMA 1WAEA 3NBNA 3V4UH 1P7BA 4QRRB 1SQ2N 1SMDA 3QQ9D 5LCVL 3DIFA 4AEEA 1UWXK 4NDMB 3VFMB 5I1GH 3QNYA 3QIWC 1YG9A 3F5WB 4HEME 5T3XH 4U7KA 4QTIL 5AVSB 4UT7H 2NOYA 1T2QH 1SVZA 4LBEA 1E5AA 1KLGB 2FGWH 4BH8A 3FU5A 3DO7B 1MVFA 3O3AA 5DZOA 3CH1B 3X2QB 2GUOA 3ZTCC 2Z65C 2ZAIA 3W11C 4E9LA 4FCHA 3VFGH 4Z7NB 5DR5H 1N3NB 2I7OA 4BGDA 3CLFH 3ZMRA 3KGRA 5J9PB 5FCSH 2VIRB 1HYSD 2A9MH 4Y5XA 3BJLA 4G2AA 3BCFA 4JDEA 5SWZD 4LSUL 4PWJA 1GGUA 1AMYA 1W16A 4ABQA 1UM6L 4HOWA 2B8OT 5HXMA 5AW4B 2B1HL 5CSZB 1B0GA 1JHTA 4Y2DB 5DJ2B 4ICWA 2H0JA 4NCC1 3RVTD 2E5EA 3BQUD 4PJAB 5D2NE 3VI3E 5AAMA 3LNIA 3EYFB 4IDJL 3FT0A 5F2FA 4O02L 4OLVL 3SCMB 2G3XA 4Z95H 3UAAA 4ZYKA 2R39A 1AZNA 2E6PA 2OMWB 3D2TA 2XZZA 4I2XA 1KCSL 4J3OH 3V0JA 5A2JH 3DPBB 2Z9TA 5IBTL 2IBBA 3LS4H 3D08A 3EGSA 5FM8A 2OYLA 1EWHA 1Z7JA 2DDQL 3GBML 4JHWH 4K3EH 1CG9B 1U58B 5HVGB 2Q3ZA 4BA8A 2WVTA 1MXDA 3NCCB 4U1LA 4WUUE 3SQOL 5I6OA 5IV2B 5KW9H 1OPOA 1O7VA 4ORGB 4YBLB 5IKCA 3BMVA 1ET5A 2YMOA 1J0KA 3BD3A 1XGPB 4LASL 3GMNA 4XT1C 3O3DA 1P9MA 2EXYC 1A6PA 4M7JL 2ZXQA 1DSFH 5C0BB 2XTJE 2JELL 2X4OA 3DPBA 4EZKA 2I26N 2WVVB 1PGRB 5EBLB 3UOAB 5CAYB 1C12A 4P3DA 3RGHA 4IHBA 3WFBL 5DJDA 3FUMA 3U9UB 4AGMA 1OZUA 5FDWA 4ZO7A 5BS0E 1S9WB 5IV2A 4DAGL 2LAAA 1RIUH 4PJ8B 3F7VA 4OZGF 1I75A 4JPWL 4JRXD 3Q5YA 1DQLH 3HE7B 3BP5A 1GJIA 1NBYA 4X6CB 2AF2A 3OWEA 2G75B 5AKRA 3PGCA 4P49A 3H9HB 4HT1H 4MQTB 5I74C 3HBGA 1LK2B 5CKGA 2PLTA 5I1CH 5I6XC 4KXDA 1A4BA 3KE0A 3VWJC 3PPEA 4G9FB 2APSA 3A4AA 5TF0A 4GRMA 2OJEA 4YDZA 1G7HB 3DTXB 1KTLA 4R2GD 3WTWA 1IFGA 1ECYA 2NY7H 1L7IL 2MTPA 2VW7A 5CJXA 2G4EA 1U36A 2YPLD 5A43C 1RU9H 2YBGA 3GBLA 4DFIA 5IJKA 2YN3A 3C12A 3P9WB 4NKQB 2KZ1B 5EU4B 4OM1L 2AVFA 3NFSL 2F74A 1LTXA 3NABL 3IFPB 3VU1A 4F8QA 3ABLB 1L7TL 1GIGL 3KYNA 2WHVA 4FFYL 3IGKA 2X6CA 2DIJA 2VDML 4YVUA 2X3CA 5B7FA 1KB5H 1LO2L 3A6OA 4JFWA 1RLWA 2PETA 1JPTL 1IAIL 4JDTH 4ZOEA 3MVSA 1XV8A 2MJWA 3FT3B 3CCHA 3VXTA 3GPSA 3M7FB 2X4SA 3O6FD 3TZVB 4F7MA 4D8OA 1YEDB 3EYOB 1AFVL 1NAMA 1UZGA 1RZKH 2VC2H 1DEEB 3M1BA 1NMBL 3QYCA 3P77A 3ZK0A 1O7DE 4XN8A 4NHCL 4WLCA 1W72H 4O2CA 4TVPL 3QQ9C 4WNSA 3LH8A 4PTUB 5IMMB 2F7PA 3WIIL 2DM7A 4ZAKA 3HRZB 3C8KB 1NC2A 4XNUH 2B3IA 3OAUH 4EUPH 1SF3A 2VE6B 2FNBA 2WZ6A 2K3TA 4KJQC 2WIMA 3RILA 4MMZC 4X0KB 4WUUB 5TPWH 2X87A 1ZE3H 4HCRA 2DIBA 4XAWL 3PCYA 4POUB 1DVSA 4R5TA 3IDYB 4B9PA 2A77H 4AX3A 1F1DA 2DOCA 3O0RL 5KSVB 3LRLA 4S2SB 3EJRA 3EJYC 4I13B 5KBMA 1UACL 5IJCC 3NIGE 2EKSA 4Q2ZB 5JORA 3HAEH 4JKLA 3NZSA 4K0OA 2KHAA 3DLQR 3LKRB 4PJAF 5T8IA 3OD3A 5DVOA 2O5NA 3RKDD 3I6GA 4HUKB 4U1KB 4M7ZB 4KX8A 1OTTC 2K4WA 2V3FA 2R69A 4F8LA 3CLEL 5GPRA 4JUSA 4ZYKB 1KCSH 4XNMA 2UX6A 2Q7YB 3RZCA 3BKJL 3DUSB 3QRLA 1E42A 2WOYA 1TNNA 5AW3B 4KKQA 3TN0B 1GKEA 2NUTB 3HI6L 5D1QC 5DCCA 5F1KC 1QWHA 4H7VA 4EDWH 5CCKH 5BZWA 2J20A 3QNXB 3EJZC 4ENEC 5EZJA 5DZAA 2X41A 3L1EA 4PR5A 3BVUA 4MNQD 4NC2B 2J1XA 4B9CA 4M1CD 1LDPH 1BFVL 5EU5A 5DQJA 5C08D 1MIMH 4TUJB 4J7RA 3GGWA 4PBXA 4OIBA 3ZDZF 1CYXA 4QRSB 3GUFA 4HZLB 2BNRA 2VMDA 3BD5A 4TUUA 3V2AR 3IETA 2BVTA 3B3IA 1OTUC 3N06B 3N2JA 5H8DA 4YDJB 3FF8A 4PWHA 3QA3A 3RGVA 4NZUH 1RJCA 5BOZG 1LQBC 2JLLA 3S35X 4KY1L 4AWJC 2DI9A 4JFDB 5DD3L 3RWGA 3S3JA 1AD0A 3C5JA 3IFNH 2I60H 1KY7A 4D9RE 2BJMH 2D7MA 2HJLB 4XMKH 1ES0A 3MGOA 3TBYB 3KL5A 1PL3A 3O41B 4LDCA 5E51A 3QNFA 4X80H 3GFUA 5EN3A 2I5YL 2BXZA 2X3BA 1IM9B 4R3SB 2ZOLB 3GUTB 4PS7A 3RTLA 1SY6H 3UCQA 1G9NL 2AXGB 3CIAA 3R19A 4AKPA 2GJ6B 3WNIA 1EEZA 5J6GB 1H6FA 5KSAA 2Y22A 3SDDC 1BWWA 1NBVL 4BFNA 3EJJX 3QJXA 4FQXB 1M71A 4IGBC 3MRJB 3SSGA 5F7AA 3IE4A 1MOEA 3H55A 3BAJA 3LRKA 1NFIA 1QTPA 2H1LM 3OJDB 2L4OA 1OCOB 3SE4C 2FRGP 4WUKL 1S7RB 1ZS8A 5J1SC 2MWCA 35C8H 4JZJB 4DGIH 3WFHB 1GIGH 4NQDA 2BWIA 1KXQE 1W72A 3GI8H 3GXFA 4OLYH 3SY0A 3TWCH 4X4XB 3L4UA 1DVFA 1QABA 2K45A 1IIIA 1U8KB 4R5XA 1U41A 3CQQA 1SVBA 4KPHH 5BV7B 1QFUL 2PP9A 1OAYH 3ABMB 3QGVA 5JPNC 1MFAH 1JZFA 1ZJBA 2ITDB 3FB6B 5KN5B 4KTEH 4I8DA 5FAAA 4NHCH 1T66C 1FYTB 3NJVA 1OAXH 3G9VA 4JANA 2Y3AA 1YNLH 5E6IA 3P1VA 2E7DA 3QRFM 1QAWA 1RERA 3QEHA 3C8KA 1EO8H 3QUZB 4N22A 5DRZB 1EJOH 5CJXC 1S9YB 1LEIB 3WJLA 3BT0A 4FTVD 3BOVA 4JW3A 4PBVC 4WU5B 1SLXA 5DDHB 4F7KA 1XF2B 2R2BA 1XH0A 3MUZ1 4KHXL 4JZNB 4YFEA 5C0EB 2YA0A 5G55A 4N8UA 3ULVF 5F70A 3QFDA 4Q8BA 4DNLA 2YBRA 3JV6B 4ZOAA 1P0SE 5DC2A 4JHAL 4APQA 1KXTA 4Y4FC 1E6JL 5IB2A 1CE1L 4MB4A 2CGYA 1OLLA 3WE1A 4GXUN 2WNXA 4UANA 2XV6B 1JWUA 4LLQB 4GAGL 4WW2B 3VMPA 2Q86B 3MYJB 1CXEA 5ALBL 3V5HB 5CGYC 4NENA 3LPPA 1HH9A 4C57C 2PR4L 1PLAA 5DT1L 4ENZA 5IW6B 2K70A 4NRZB 5CCKL 5C0JA 1LK2A 2HVBA 3BVTA 2HVKA 4XGZA 4PJHE 4R8WH 1AGDA 43C9A 3SB3A 3TO4B 1X6NA 4JG1L 5IOKA 2UXVA 3Q8BA 4HYTB 4N2NA 4PJ5A 2FEJA 2CCWA 1SGKA 4IBZA 1OK0A 3FT2B 4L3EB 1BFSA 1OGAB 1U8JB 4MJ6B 3K6FA 3CC1A 2Y1VA 4LHUB 5LG6A 2VLKD 3A4EA 5D1ZB 5DYOB 3SKUD 5D5MA 3GSWA 2BZCA 2FTAA 3LAFA 1P7QD 4KX7A 5AW7B 1PZSA 3P3TA 2EDJA 4IMKC 4FG0A 4JY6B 3P3SA 1RPKA 4OGXH 5DFAA 3SCMD 3O6LH 3UC0H 2NY3D 4U4BA 1QSEE 1SYSA 3LZOA 3RGVD 3UYOD 3WUWG 4MDJA 1A7BA 4YSSA 4L8DB 2YAOA 3Q13A 2Q7AA 5BZDB 4FQQA 5M94B 4KJWD 3QIBB 1KENL 4Q6YA 3TS8A 2IBGA 1ZDSA 1NUDA 1U95A 4QRQB 4DIXA 4IRSD 2J88L 2MTAA 1R5VA 5I2IA 4NNPL 2JFCA 2AXGA 4YNYA 2R0ZL 5E9DB 1DCLA 4E9YA 2FWUA 3ROLB 1NBVH 3MV7D 2UYLA 2B1AL 4Q6IC 3NCBB 1G7JA 2FB4L 3VI4E 1DBKL 4MB3A 2VXUL 2ZX5A 1FYTE 1U3HC 5I6PA 4ANWA 1A2YA 4RESB 5HP5A 1T89A 3ULSA 1E27B 4N2CA 4FFYA 2V3EA 3GJEB 1PTZA 1UQSB 1EDYA 1E8XA 3WOVA 4N9GA 3BUYA 1P5UB 2W0KA 1EBAA 2B4CC 1X9RA 3FFCD 4AZ8B 1M7DB 5B8CC 3JWNH 3G5VB 1IGML 2NY1B 1BZ8A 4RMWA 5E03A 3RTQD 4JM4H 1USQA 3N5AA 2CRYA 4KKAC 1DYZA 4NKOB 4NRYB 4TRPL 4N25A 1T4KB 4XCEB 3BP6B 1A4KB 4K3HA 5J3HC 3ML8A 2DMHA 2OYKA 3QIWB 1U6AH 3UJTL 5BV7L 5LGKA 2G3MA 2ZWNA 2WTRB 4Y16C 3QUYD 4L0PB 1OAQH 3OKDA 1MCNA 1FYTD 2ZSWA 3CSTA 3MCG1 2O1AA 2DEYX 1X5HA 1DQDL 3QZBA 3T3PF 4FA7B 3RJOA 2CLRB 4U6VH 1IBFA 3P4MB 2HRGA 4XMUA 3WAJA 1IEAA 4QTHB 3BGMA 3MV8E 4KI5F 1JV5B 2OK0H 2HLAB 5IFJA 4MMYB 1J87A 2VQ4A 4E41E 4RZKA 2OKMA 2OCFD 3SYOA 5FYKE 3VA2C 3QIWD 4IKNA 5FGBA 3HNSH 1QSED 1A1MA 1B4JH 1BV8A 1TLKA 4OJFL 5EUOA 1GY1A 3BLBA 4MDIB 3DBXB 4PJ9B 5DEFA 3UJJH 5I1HL 4H44C 3SGKA 3O6FA 1HQRA 2PPDA 3S34L 4O51A 4APQB 1AH1A 1RZFH 2UY6B 5T1KB 4R2GB 1E6JH 1ZT7A 4Y1AE 1L4IA 5ISZD 3WNPA 1CWVA 3BUBA 1G94A 2PUQT 5D55A 3RX9A 2E6JA 4DKEH 1DLFL 1SEQL 4I3RL 4POYA 3IF1B 2HLFC 4OJEH 2AK4B 4G3YL 3MUUA 4NZRH 2BOLA 1SOQA 1NFDB 3PP4L 5L9DH 3HZYA 2J44A 4TS6A 3PJNA 3ROOA 2IO5A 1NDMB 3N42F 3LNHA 4G7SB 4MJIB 3RAJH 1BVZA 2KYIA 2XC8A 1J5HA 3SGJC 3RB7A 4XVSL 1GZQA 5IW3A 3GKZA 3DYOA 1XCTA 4MJHA 1A1NA 1VIWA 2VM4A 2IPUG 2J57A 1A5FL 3KPRA 1DVZA 4O02A 4UQIM 3T6QC 3G6AA 3ECBA 1JWSB 2OJZL 1RZGA 4C83A 4IRZA 3FT2A 5AALA 1MWAB 2ZCHH 3WE6B 1JYVA 1X4ZA 2J2ZA 4NQUA 4YQXH 3ZZLA 1F3DJ 1MZYA 4PRHE 2CIKA 2X4TB 4WI8A 1EZVX 3ISWA 1XIWA 4ANXA 5E6ID 1KIPA 4BRJA 5D5MB 1PYWB 1GGCL 3EYOA 4X9FA 3WDIA 3NYKA 2GTZA 1BMZA 4XNDA 5LLIC 1QBML 3A3YB 4I5BB 4RDBA 3T2NH 3W9DB 1Z3GL 2QZ5A 2EXTA 3MJ8B 3W2DH 1T7YA 4RAUB 5E94A 1IAOA 1I3GL 2DEWX 1N64H 3CAFA 5TF1H 3V6OC 3JWNG 3HS0C 4FULA 4IKKA 3X11A 4YSPA 1IBGH 2BMKB 3H4HA 5AOKA 5C6TL 1A14H 1F41A 5D2NC 5AYQA 4HD9A 4Y9FA 2IC2A 3VWJD 1H3PH 3F64A 3RPBA 2AJUL 2D8KA 3IMUA 1NCJA 2ATKB 1FNLA 1P4BL 4N8CL 3NJXA 1RFDH 5L8KB 4F33A 4MNGE 3TF4A 3AMKA 3WJJA 3H7LA 1QX1A 1KNOB 3HFML 3N42B 1HHKA 2D7TH 2HP4A 4OTXL 4YDLC 1QNZH 2DM3A 1OB0A 5DZVA 5HGHA 5KVEH 2DQ6A 1KV3A 5FOBB 2V2XB 1IFHL 2ID5A 2M83A 4PJ5D 1B88A 1GTFA 1K3IA 4M7KL 1U6AL 1BW8A 3IXAB 3X1FA 2WBJD 1M42A 2DYSB 1K8DA 3ZR6A 1Q0EA 3LIUA 4IRJC 2O6CA 4FQLH 5HHOD 2WSDA 4K9EC 3VW3H 5EC2B 4YEEA 4D9LL 1KPRB 2WBWB 3OM3B 2KI6A 3NEEA 3ZHNA 5ALCL 5EH1A 3N1PC 4ZFOB 4HVBA 4Z3JA 2UVEA 4LU5H 1F00I 1YEJH 1ACYH 2BRQA 1KYDA 1YRKA 2W0FB 3SJVE 1U92B 4K71B 2E9IA 3D5OF 1P7HL 5LGJB 2ARJB 2AQNA 4HKZB 4L3CA 1MCRA 2HFGL 1LP9F 4B5EA 5BW7A 1P4IL 4NKIH 2B59A 4XMVA 3PWPB 5D2LA 3LKSA 3ZRFC 4MAZA 4G5AA 4AJ0A 3U0WH 1WWWX 5CKAA 3G5ZB 4X9YA 5DEFB 2LVEA 3B56A 3GRBA 1E9QA 2DD8H 4KQ4H 2QSTA 2YKLL 3QCVL 4DK3A 1ZVSB 2PCFA 3L6FA 1JK9B 2GI7A 4AJYV 4AVIA 5FC9A 1JPSL 3DROA 1NKGA 3CC5B 3SKNB 1ZKAA 2JSFA 4P0DA 3EJSA 3Q6GH 3BLPX 4JCLA 5HGBB 4NOBA 1Z9SA 1XGUA 3L3IB 3DA0A 2XZQL 3QUYB 4HGWA 4X9IA 4DSYA 4CRPA 2EYSB 3GEWB 3AG2B 2V37A 3I9PA 5ID1A 1QYGH 5T1DH 3OG4B 2AABL 1CGUA 4IOIA 2ADJA 4F7CA 5I1IL 3NVQA 1AI1L 1R75A 1J9SA 5EORH 1J8HD 3K6SA 1TZOA 2KLRA 3SCMA 3SO5A 2D7NA 4F57H 3IJSA 3KLHC 4LSSL 4IJTA 2AQQA 3ATBA 3P4NA 1IZKA 3NK4A 4LDEB 1KDIA 4KK6D 1IQWL 4LVOB 5ESAA 2YD6A 2VXVH 5AB1A 3SKMB 3VYPA 1VHPA 3UTQB 5DHXB 5J1TC 2NSXA 4MAUH 4KQ3H 4LSTH 1D9KA 4TNGA 1GHFL 3RVUC 4UQBA 5I19H 4IEFB 2CKBA 1W80A 4H40A 1UXSA 4QT5B 2VLJE 4XHQA 4ABVA 3FQUB 3I3EA 5FF6A 4H1LG 1SRDA 2G2PA 1QKZL 3WXVL 1CE6A 1CU4L 3RQ3A 4C59B 1LD9B 5C0BD 5JXAH 1XDTT 2E4TA 3T04D 1P2CA 1HEJC 3D0LB 3VFPB 1BXVA 5C9JA 2EACA 1CI5A 4GG8B 2W59A 3MTXA 3RVWC 4FQJH 4WIQA 1WAPA 5D2LE 4BA0A 3QUXA 2C9QA 4JPKL 3QIBD 5AKSA 2NY0D 3RWIA 4JB9L 1UA7A 2WLLA 1IEHA 1A7RL 3GJFK 3J8F7 1NEZG 2YAFA 5FYJH 3FONB 1NCBH 3W82A 5B22A 5AG9A 1MCJA 1NLDL 4L1TA 3L4YA 2CHXA 3DOSA 5J1AA 2ZSWB 4PJFE 5FUCE 3GXIA 1N6VA 4N5UA 4OJCA 5KJ4A 2F18A 4K4KA 4JVPA 4GBXC 5D7SH 1S3KH 3F85A 4N2DA 4NZFA 2J6EH 4HC1A 1FO0H 1PW3A 2NT0A 4QTHA 4YEFA 5JMRA 2A1WH 2VDKH 2P24B 3B7TA 5I1DA 2AK4E 3KPPA 4NC0B 5D1QE 5I75B 2NW2B 4MFHA 2D4DA 4JRYD 4YXLL 4ZPVB 3EJZD 1M6OB 2ED6A 2YARA 2D9CA 2J8UF 3VD5A 4UTCA 2VERA 1P7QB 4CKVX 4Z7UF 3P0VH 2YUZA 2EE0A 2EYRB 3AW5A 3ECUA 3ARSA 4NQDE 5TK2A 4ONHB 1G7IB 3RWCA 2CBOA 4KI1A 4M7KH 4F7EA 2GT9A 3U46A 1CZ8H 2R0LL 3EYSH 4DZ8A 3U6XS 1THAA 1UOKA 3HZ3A 4FQ1L 3GO1H 4NKDA 2VDNH 2K8MA 3FYEB 3ORJA 5HGDA 3BN9C 1KPRA 1RUPL 1IV8A 1UM5L 2GBTA 3PYCA 2E7BA 4MBRA 4UMSA 3G5XB 2YPKB 3ALPA 3SOBL 4LF3B 3HLKA 4RDQG 5EOCH 1OT4A 4JFHD 1QG3A 4WWPA 3R7QA 1EXUB 1KFAL 2LLNA 2UY7A 3PWJA 3BN3B 5D1ZA 3RVUD 1AOZA 4ZQTA 3AAZA 5LWYL 2XVBA 4PG2A 4HKZA 1XB3A 1YN7A 4L3CB 5AB0A 5JW4Q 5B4MD 5IFHH 3HW7A 1P4IH 4NKIL 5BOJA 1X5JA 3NEXA 4HX1B 2ZIDA 3D85D 3X3FL 3VFUA 3F7KA 4ZTOH 1BM3L 3G5XA 4RH4A 4XNYH 4LVEA 4FC3E 4MWFB 5F1IB 2HJKA 2DICA 3FQTB 4PIBA 4QHMB 5E4EB 1TJXA 3D39A 2AK4D 2RD0A 2BVUA 1F42A 4XBEL 4OB5H 4UQCA 5F3HA 3MLSL 4LOVA 5I2IB 3LRSB 5D1QA 1J9CT 2ZCLH 4QIRA 3Q6GL 5J6SA 4TQIA 5I73C 3BGFB 5C0CE 3M1OA 4NEHB 2PYEB 2C9RA 4XOEA 3V0DA 1DVFC 5C0FB 4F2FA 3QQ3B 4ZO8A 3MRIB 3NDYE 1U8OB 3KPNB 4YSAA 4MS8D 3MRFB 4X0NA 1B2WH 2JIXD 1VEMA 2Q1EA 4N4YB 5EUOF 3QHFH 1AI1H 5GZNC 5FWRA 4HPHA 1KJVB 2KERA 2NY7L 2WXOA 4P5MB 5KWYC 3HC4L 1WEJH 3FFCE 3IXTB 3L5XL 2DJUA 5IHUH 1D2OA 3L3HA 2FX9H 2H1PH 4HS3B 1DO6A 3LHPL 5C0FA 5I5MA 2JJSC 4L8SA 4B27A 3BW9A 3NFSH 4X50A 3LNEA 4P2RE 4HS8H 1YNKH 3EH1A 2HKFH 4AGPA 3MNWB 5KYWA 1AXSA 2MMXA 3IJHB 3QR0A 4HUXB 4W6YB 3TU6A 2XV0A 2DWDA 2ED8A 4A6YH 1TFPA 3GZQA 1M3IA 4U6YA 3GC3A 1ZSDA 3ZMEA 1NCDH 1BG9A 3KPQB 5SWZE 3B9AA 1U2CA 3CZLA 4YX2H 1SHSA 3VI3F 1IM9D 2R27A 2V17L 2BHFA 2K6WA 3QE5A 4BBWA 5LBSL 5GGTA 1CI3M 2CUIA 2WBJC 2FUTA 3QXVA 1OANA 1KEML 3GIVB 1F56A 1I7UB 4A7TA 4EF3A 4TVPH 4PY8I 3ASWA 5HHNA 5A2KH 2MPAH 4UILL 5TQ0H 2VLKE 5EZLB 3DBXA 1ECZA 4E5XG 3RVXD 4OLZL 5ESVB 5K69A 4YBHA 3PJSB 2EXYD 3OJVC 3DX8A 4X9BA 5HHXH 3L4WA 4NO5B 4YJZL 4MXVF 4TSBL 4N2GA 4XP4L 3KNBA 2Y7QA 1J9QA 1NQBA 2GIMA 2K7QA 3JYBA 3MBEB 3O0RH 1I9RL 2WCGA 3VSVA 3G6DH 1ADWA 1YEKL 5D7JD 3TXAA 1JERA 1E4WH 4FQXA 3LKPB 1AIFB 3FN0L 3O45B 5E08H 3FU6A 1EZLA 4M8QA 5FO7B 4TTGA 3GSQA 3HG4A 2QR0A 5AW2B 4AYDC 1WAAF 3QH3B 5IVZA 3PXLA 5A2LH 3AB0B 3TCLA 1UGKA 4AQ1B 1IEBB 4I4WA 1GZQB 4Y5XC 4ZTEA 5JHLA 4G7VL 4OQTL 4HWZB 4ETYA 5DLML 4X6EB 3S96B 5KG9B 3DXAB 4J23A 5A3ID 2OMXA 1JUFA 4OV6F 4DTGH 3RWGB 4MNQB 1PG7L 1FVCB 2IDTA 2BY3A 4N6QA 3LKNB 1UEMA 4P9HH 1X5XA 5ESQB 3S37X 4XVUD 3ASNB 1HXMB 4K55A 1FBIH 4M8QB 1KFAH 1G6RB 1U2YA 4IOIB 1QFWH 4K7FB 4BKLA 3D12B 3QDMB 1MIML 2FH6A 3P4LA 5E6SB 5AZEL 2EXWD 4PB0H 4ZD3H 3AABA 3IRZA 3EDEA 2XA8H 4TSAH 5DD1L 2OJ1A 4ALAH 1URIA 3TIDA 5F9JB 1IM3D 2W92A 4OW6A 1OHZA 4DN4H 3GMQB 3REWB 4LCCA 3UTSA 5HPMA 3S8GB 1G0YR 1E65A 1HN1A 1BFOB 1CXFA 3QP3A 3QUMH 5CJ8A 3AXLB 2KDYA 3PUCA 4QGTA 4XMKL 2WXGA 3EH4B 4WW2F 1T5XB 5DUML 2MKLC 4AMWA 4WHYG 1QWNA 3MO1A 4PM1A 4ELDA 2VLRA 4ODWA 2X89A 3MREB 5SX4I 1JRHI 3ETSA 5CNHA 4PW4A 1QI4A 3MDJA 4NIYE 5B1AB 1MCOH 4S0HA 4ODHL 1KJ2B 3BYTA 3CFNA 4QHKI 3ZVVA 4EN2A 5D8JL 3KYAA 3LZFL 1GGBL 4V33A 4F33B 4FTVB 1BFOA 3VGFA 3OF6A 3SDAB 3II3A 12E8L 3MN8A 2N7SA 5KS9F 3INUL 5T1JA 1WA2X 1M56B 2BS9A 3NFNB 2K6ZA 1PZ5A 2VDQH 4OF8A 2B77A 1TOXA 3CDGB 2QKIC 4ZW8A 2DI8A 1N9PA 2DWEA 4G80B 1E2ZA 2MH4A 1A7PH 4LSDA 2A73A 3MJ7B 1M7UA 4HQQL 4P2QB 2UZIH 3JV0A 3LN5A 1KELH 1YMHB 1JE6A 3BFQG 3SD5A 1NCDL 1C1EH 4KWUA 1YAZA 4ABWA 4HAFA 4FFTA 4KPHL 4L4TB 4ZSOB 1Q0YH 5F7EL 4AYFA 3N40P 1USZA 3LV3A 4Y16D 3HKZA 4RLDA 3F84A 3FRUA 3TC9A 3TPUA 4D9RD 3IDNB 1X3DA 4Q9CA 4JUTA 3QJTB 3GIVA 1OP3K 5IB2B 5H37H 4NZTH 4Q6IA 1WZ1L 4QOKD 4R0LB 4F8OA 4GP8B 3ZIYA 2K3HA 4HOXA 3B6SA 1G7PB 3QHZH 3P0YH 4ZS7H 1A7NH 1ACCA 1UG9A 4LLVA 4LVNC 2NY0C 4X99B 3BVNB 4FLHA 2CMRH 4UTAL 4FKHA 3VFTA 1TQCB 4ELKA 3QNZA 1SN0A 3WYRA 3BKCL 3LNDA 4FYTA 4M61A 1CFMA 3KH4A 3ZE1B 4Y1AD 5D7LB 2I32A 2W8CA 1NCGA 4AJWA 1YEEH 2CD0A 3ROLA 5HGAA 4TPRL 2QMKA 2QSQA 5EU6B 3V4VH 2NNAB 2VJ8A 1GYWA 1THCA 3O45A 3VDCA 5EEVA 1JPST 4GW1B 2A99A 5IQNA 1DFXA 1V54B 3MOQA 5L88H 1YNTA 4FNQA 2EUVA 5CIPB 4PS4H 5BMFH 2BVQA 4L3ED 3S4SG 1OT1A 4BSVA 5C08A 4FERA 4J3BA 5F7FA 3GMRA 4GI6A 2BY2A 4PD4K 1KWKA 3MJ9L 2J1YA 4X5LA 2FQGA 4XCFH 5ESAB 2W95A 2XWTB 4J3TA 4P5KB 3NCMA 3TGXA 4ZUTA 1YJDH 4TL5A 5GRXG 3C2SA 1JG9A 1JD7A 3QDHA 2IF7A 2VRAA 3EOBB 3UJIH 5FUZL 1FBIL 3T77A 5H94A 4O58L 3U4EA 2PWHA 2DKUA 2PPCA 4UI2A 3UBHA 4AIZA 5ADOL 2DS4A 2O26U 1YEGH 1ITCA 3UZQA 3CDFA 4X6DE 1EJ8A 4NPYA 1YPZE 1D6VL 4GKSA 4TLKA 1SMOA 3VFSB 4YHLH 4AQ8C 4OZHA 5LXVA 1P6FA 4TSAL 3U1SL 4NN6B 4HIQA 4DO4A 3PGFH 2Y06H 2BW5A 2XQBL 2CM5A 2VTFA 3QFGA 4WFFE 5J12C 1F4XH 3UYRH 1C7SA 4O2EB 1FV1A 2FCBA 2X4RA 3P2DA 5I76B 2PYFB 1I1FA 5BRZD 2O61A 1WBZA 1OL0A 1UFGA 5JPNA 2WBXA 3RIFF 4A7UA 1HINL 2DQIL 4RAHA 1MY5A 4JHZA 3TA3A 4JFEA 3D4GA 2RGSA 3LQZA 3HRPA 1JZIA 4KRLB 4M4RA 3EAKA 3OWRA 2DMKA 5CGYD 3UTSD 4APQD 3LS5H 1MW3A 4G8IA 4N0UB 2Z6FA 4HAGA 4P2AA 4J8RA 1FZMB 1MJJB 5A16B 1F3JB 1NDTA 4ZG1A 3T6XA 4XMTA 2Y6SC 2FJGA 3GZOA 4FLSA 3DDGA 1TIUA 2IPKA 3A5VA 6FABL 4L29B 2FAUA 4GQZA 5I1JH 4PSPA 1I3VA 1S9VB 3NH7L 3O4LD 1IL1A 4DP4X 4OR1A 4ZMTA 4WU5A 2EXWC 3ECVA 4YLBA 5KBDA 1MLBB 1LDSA 1OP4A 2BW4A 3FRPG 3QFDB 2R0WL 1YYLL 1RAMA 2YGPA 1K4DB 1EBPA 2GKIA 4OZIE 3IDJB 3CDGA 4BCYA 4QF1A 1RUMH 1UCBH 3ZE1E 3FC8A 1U8NA 4Y4KD 4G8EA 4I0PB 4QHLA 4A7SA 4ADGA 2YLHA 3MCLL 1Z2KA 3QG6B 1L6XA 4FNUA 3K6OA 2VLJA 1EFXD 4MZRA 4X6BB 2GY5A 3D50A 1XGQA 3WFCH 1T66D 1MCPH 3QUGA 3EYVA 4JFDA 4EIZC 1N19A 4LVHC 1V7MH 4YGVB 2NY2B 5MERB 1DVXA 4PJ9A 1ZANH 2P46B 4WGKA 4FQ2H 5AZ2L 1NH6A 2HFTA 3V4PB 3APFA 4DVBB 3FQRA 4ZZKA 3SZKC 2NTSP 3G6JF 1T5KA 4F8NA 5KBNC 1E2WA 2X42A 3GUTA 4QJ3B 4ELMA 3EFFA 3DIFB 1B3IA 4JRYE 4NQCB 4XCYB 2HWZL 1B90A 2VWEC 3EOAB 3R4RA 2IPTH 1H19A 3P0YL 2DWYA 3DXAA 4JFZH 3HR5B 2BP3A 2WGNB 4Y19B 3DO7A 4XP6H 2IXQB 3QNZB 2WGXA 3BKCH 3DX1A 2CHDA 4YSQA 2VZ1A 5FLVA 3P40A 4QXUL 1G6RA 2FK9A 1GPOL 4X4YA 5F1OB 2VLRD 3ARFB 4WI0B 4XWGH 1A1OA 5J9PA 5KBPA 4RFOL 1NBQA 5ABDE 5TGBA 5EG6C 1C9SA 5E6IC 4JY6A 3VXNB 3OJMB 1P4UA 3VSQA 5EU6A 1VFAA 4LLUA 3RUGA 1T0NB 2AEPH 5HDBB 2DQGH 1UYWH 3QEQD 4WI2A 2V2TA 2NUPB 3ZHFA 4TNVF 3NJHA 5KVDH 4EI5D 3T6ZA 3AQZA 4G8GE 4UMGA 1F4WH 3ARGD 3ZHLA 1U95B 5JIIA 1IM3A 2FL5B 3OKKB 2NYKA 4LHUD 4Y4FB 3UTTD 3LN9A 2D31A 4QAWA 1JJUA 4HW6A 4PLJC 4NQVB 4JO2H 4FXKC 3DGDA 3MRCA 1L0YA 3MRBA 4O58H 3JV4A 1EH9A 1MJ7H 1SJEA 1UM4H 2F8IA 2VDLB 1FFPA 3W81A 4N90D 1NBZA 1UWXH 3RZWA 2AI0L 4H25B 5EB9A 2F58L 2XWBB 1XWVA 3NK3A 5C0RL 3B5HA 2FJHB 1D6EA 2V2WA 2MHAA 5GJTL 3KPQA 2JKTM 1HT6A 2KQNA 3HUJA 2F9BT 3D0VB 5AOMA 4WENB 3HHSB 2R8SL 2Z4TA 3L3GA 4U31A 3QI9D 1GGCH 3TNNB 3VI3B 1A6UL 3K6IA 4APXA 2WP3T 4HJJL 3NG5A 1PEZA 1BOGB 2ATKA 2OS7A 2R15A 1UD2A 1I7ZB 2F68X 1ROWA 3D05A 5D7LE 3TX4A 2VCOA 1OEZW 4NO0D 4HUMB 4N24A 5J57B 1BGXL 1JYWA 3C5ZA 1PSKH 4QKXB 3GMLB 2Q86A 5HYQB 5FB8B 3Q2CA 2I25N 4HDIA 1NMAH 2FO1A 4IU3B 2CR3A 3QVAA 1HHKB 4GRWH 2IADB 4EN3A 3HZVB 3TBSB 4E9XA 2XSKA 1XQ4A 3ARPA 4FP8H 3VD1A 1T03H 3OKEB 4QRPD 1X5ZA 3CHOA 5IROC 4FXLA 1NCHA 1RV6X 4NS0A 1R3KB 2ZWLT 1VGEL 1AGDB 5HJDA 5GISL 3SKNA 2WINA 2XVKA 2AJUH 1BOYA 1HDMA 3A67L 1J0YA 2J8UE 4YHOH 1W8NA 5FK9A 2EQDA 2I69A 3O2WH 4OF6A 5IMLA 1J48A 4NOFA 2AJXH 3I9GL 3GSQB 3M8OH 1DJSA 3N50A 3GM8A 1FPTL 1EMTL 3U9UA 4W9GC 2GJZB 1U3HB 3QG6A 4F15C 1DN0B 4BSJA 1E7VA 2BY1A 2C34A 3DO3A 1INEL 5FYKH 4KVCL 1V8HA 1WWAX 3ZDXB 2GCYB 3C5ZC 4XVTL 2Z1KA 2WW8A 2A74B 3EBHA 3QEUA 3OAYH 1MNUL 3P73A 5E2WH 4WI5A 5KAQF 1MG3C 1HNYA 1FNEB 1ORQA 1TZHA 2R2HB 2LT9A 1OSPH 1X44A 4UOQA 3SDCC 5EFIA 2WXPA 1GAFL 1ZVYA 1RZPA 4P4KB 5KSUB 2DBLH 4Y16B 5D70H 3ECBB 2HUHA 4UOW0 4I0PC 4L8CB 3NDZE 4M7LH 3HPLA 3GBEA 4B60A 1NGWA 4KAQL 3CFJB 4FFZL 4P2CG 3E1ZA 2ITEA 3TCTA 3CHRA 2R56L 3A6BL 3DOSB 3ELAT 2WTOA 3QJVB 4J8QA 4WHTB 1VZHA 4NPKA 3SPVA 3QWNA 3ULVH 3IFPA 3N85L 4Y5XB 2VXSH 1NIFA 4E42B 1BZ9A 2NQDA 4TXVB 2WVSA 4LCCC 4GINA 3MBXL 1TENA 5J7CC 4BFJA 1TTRA 4X42A 3WU1A 5LG1A 1LO4H 3OMZA 4NCDA 1Y7VA 3JUYA 1Z9LA 2VSKB 1DQIA 3OL2A 1D2PA 5EC1A 6PCYA 1CICD 3FB8B 1B0WA 2HTLC 3ZYZA 1NC4D 2JJTA 4L2YA 3MLVL 3W57A 3OAZH 2Y5TB 4N28A 3RIAK 3DUUB 3S97C 1BEYH 1NAKL 3WXWL 1U3JA 1QRNB 1OW0A 4NUPA 2R1XB 2C3VB 2WBJA 1Z6JT 2UUDK 2OMUB 4LARL 2CA4A 2Y36L 3V8OA 3N1FC 2GITA 4ODBD 3UX9B 1FN4A 5EZJB 4UM9B 5JW3H 2OMZB 1SJEB 2GJPA 3FK3A 3HVDA 4KKRA 5IQ9A 1BQLH 5D6CA 2CCLA 1YUHB 3U7YL 5C0RH 2YAHA 3RPIA 2OMVA 1GSKA 4L9LB 2UVFA 1X9UA 3GD1C 4EJ1C 4NAMA 2RALA 2ROYA 4A2EA 3KS0J 3S6CA 4LDLB 1AGBA 4L8BB 4YIQA 2YPKA 1WAAA 4BFKA 5I0XA 1HZLA 4YDKH 1BZEA 1I1RA 3OR6A 1KJMB 3CH8A 3CSPA 2QSVA 3FRUB 4H8QA 1WICA 4HPOH 4YDIH 1IT9H 4LPWA 1XX9C 1A6AA 2B39A 2UZYA 2X7LA 4H1LB 2WWMD 2C26A 5IBUB 5JORB 3O3EA 5DYFA 1DN2A 1Q72H 3QA3B 3QDGE 3RGVB 3VXPA 1N5YH 3S5LB 5JW5B 3H3PH 1DZBA 4NO0B 2A6IB 4JCMA 3Q05A 1CD0A 1KT2A 3N1QC 2F54E 1CQKA 1CTNA 2KDGA 2WZAA 4AYSA 5IM7B 1LL1A 1FLRH 1TVBA 1ZTXE 3I6LD 4HIJA 1A4AA 3C60A 2F5BH 5D72L 2NUTA 3M6DA 4PRPE 1MELA 5AVTB 2XKSA 4B7LA 3NEOA 4KNQA 2C1OA 2DWXA 3OJ2C 4LP4A 5I73B 5EU7E 2MNWA 3DGGB 4GKLA 4OZFH 3MRNA 3MLYL 3TCXA 4AW7A 1S3KL 2FSDA 3WS6A 1EEZB 4XO3A 3RIAF 5JDJA 4ZNCD 5CHNB 4YWGH 1WFJA 3PHAA 5DQJB 2NQCA 4L4VD 1QR1A 1MI5D 3I9GH 1HZKA 3EYQC 3ML9A 2Z35B 1FZOB 1M1SA 3OMNB 3UBXI 1EPFA 1FDLH 4OLUL 5C7ZA 1WT5C 2XYCA 2WXMA 1T04B 4Z9KB 4PJBF 2AEWA 2EUZA 1UM6H 1F58L 3EJQA 1ZEAL 5DVPA 3CZJA 1QFOA 2OP4L 4UB0H 1ANUA 3QQNA 4R96A 1ETZB 3OKNB 4PVMA 5CR8A 5FYKL 4HK0A 1OVZA 5HY9B 4RQQA 2OTWA 4IGBD 2WCPA 3TH3T 2HJLA 1RZ7H 1TVDA 3SHSA 3WNKA 3MODH 3NIFB 3LVTA 3ZT6A 4F80A 5IUSA 1J9TA 5DRXA 1MNUH 2GK2A 3BDBA 2VDLL 4U1KA 1ZHNA 4WUUD 3QBTB 5IBTH 3DX2A 1JZEA 4Z3IA 5H4YA 1XZ0A 4JN1L 4AZ8A 2E6QA 4IYKA 3GRWH 3ZHDA 2OULB 2D31B 1AQ8A 4DQAA 1HEZA 1U42A 1GMEA 3CMGA 4P2OB 3FUDA 3UTPE 1OXYA 3WI9A 4K8RD 1RURH 4MHHI 1OAZH 5LBVA 2HAZA 3QNXA 4RQQB 4F5CA 2KT6A 4LSRL 3R0NA 2H26A 1NINA 2A3TA 3WNOA 2CO7A 4RISH 3NJLA 1X6LA 4HWEH 2P5PA 5DUJA 3X3FH 2DMBA 3UFIA 5CZVL 2BSCA 2OL3A 4QXGL 5GZOD 1ILSA 1KB9K 1Q1JH 2OR8A 4N0RA 2YRPA 4U1HA 4ZTOL 3D0LA 4G8IB 4MSWA 4N0UA 2G9HB 1KNOA 2JI3A 3GHBH 4U6HB 3MLRL 5ESVA 1AS7A 5IVXE 2NPLX 4HD5A 3PP3K 1ASQA 3WUWA 1RHHB 2X5PA 2X44D 2ZUUA 4XR8C 3G6JB 4ZQKA 4OB5L 4P5TB 4MZ3A 3MNMA 2CNYA 3QDGB 2ZSVA 4W70A 2OBGA 1BCIA 1SDAB 2K0RA 5J8OA 5AEAA 1XTMA 1QW8A 2DIEA 3QORA 3FS9A 5LCVH 1WFUA 3RURA 5HHQA 1WVZA 4EI6A 8FABA 4HT1L 1XGRB 4G8GB 3DK0A 2D2CC 2Q0ZX 4FNLL 2AQPA 4I77L 3KLAB 4EUPA 1KJ2H 4JFQA 5DQ9A 2DQMA 3K4ZA 4UT7L 5HDOA