1V19A

2-keto-3-deoxygluconate kinase from thermus thermophilus
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
301
structure length
301
Chain Sequence
MLEVVTAGEPLVALVPQEPGHLRGKRLLEVYVGGAEVNVAVALARLGVKVGFVGRVGEDELGAMVEERLRAEGVDLTHFRRAPGFTGLYLREYLPLGQGRVFYYRKGSAGSALAPGAFDPDYLEGVRFLHLSGITPALSPEARAFSLWAMEEAKRRGVRVSLDVNYRQTLWSPEEARGFLERALPGVDLLFLSEEEAELLFGRVEEALRALSAPEVVLKRGAKGAWAFVDGRRVEGSAFAVEAVDPVGAGDAFAAGYLAGAVWGLPVEERLRLANLLGASVAASRGDHEGAPYREDLEVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Thermus Thermophilus 2-Keto-3-Deoxygluconate Kinase: Evidence for Recognition of an Open Chain Substrate
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords 2-KETO-3-DEOXYGLUCONATE KINASE
total genus 95
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 2.7.1.45: 2-dehydro-3-deoxygluconokinase.
pdb deposition date 2004-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 1v19A00
3Q92A 3FHXA 3MBHA 3Q1YA 5C41A 1EKKA 1BX4A 3DZVA 3RU2A 2VARA 4E8WA 1VK4A 3RQQA 3NBVA 4S1IB 3RTCA 3H74A 4E8ZA 3VASA 3UQ6A 2R3EA 3IE7A 1ESQA 1DGMA 1RK2A 4S1MA 3RS9A 3LOOA 1V1AA 4N09A 4XDAA 3CQDA 5B6AA 1RKAA 1U2XA 2PKFA 1L2LA 2A9ZA 3GO6A 4O1LA 4K8CA 4LBXA 4XF6A 3RT7A 4K8TA 5BYCA 3RQ5A 4LCAA 1TZ6A 3B1NA 4S1IA 5C3ZA 3UBOA 3RU3A 1VI9A 3RT9A 5EY7A 3W4SA 4KALA 3NBWA 2R3BA 3RRJA 3NL5A 3RRBA 3PL2A 5CM5A 3DRWA 3RO4A 3RTBA 2I6BA 2JGVA 4K8KA 4GM6A 3KTNA 3NL2A 5CGAA 1V19A 3RRFA 1UA4A 5CGEA 3K5WA 1LHPA 1V1SA 3NC9A 3RTDA 5EYNA 3B1RA 4B8SA 2DCNA 3B1OA 4E3AA 4XF7A 5COJA 3RS8A 2QCVA 2I6AA 4U7XA 5TRWA 1TZ3A 3H49A 2PKMA 4XCKA 4DC3A 3RTGA 3B3LA 3JULA 3BGKA 1RKDA 1LIIA 2XTBA 1LIKA 2NWHA 3KD6A 4UBEA 3RTAA 4EOHA 1GQTA 4EN4A 2AA0A 4B8RA 4YWRA 3NCAA 3RSQA 3FHYA 4WJMA 2I5BA 3RQ8A 1C3QA 4C5NA 4E8YA 5BYFA 3RTEA 3UMPA 3RM5A 3RREA 5TQIA 1TD2A 3NL6A 1RFVA 4E69A 4JKUA 1WYEA 2AFBA 3HPDA 3IN1A 3RSFA 3RQ2A 1VM7A 5BYDA 1GC5A 2ABSA 2F7KA 2RBCA 2V78A 3I3YA 3NM1A 5C3YA 1RFTA 2DDWA 4PVVA 4EBUA 4KADA 5F0ZA 2PKKA 2YXUA 2AWDA 4LBGA 3IBQA 3NM3A 4K9IA 3HYOA 3K9EA 3RSSA 1KYHA 4S1HA 3VAQA 3UQEA 2JG1A 3RPHA 3RQXA 1YGJA 4X8FA 4N08A 4LC4A 1LIOA 2DDOA 3UQDA 2DDMA 3BF5A 4JJPA 1YHJA 2C49A 3B1QA 3RQHA 1LIJA 2HLZA 2QHPA 3LKIA 3PZSA 4YL5A 1EKQA 5BYEA 3LHXA 3RPZA 5F11A 3GO7A 2C4EA 3N1CA 4K9CA 2PKNA 5C40A 3RSGA 4C5KA 1JXHA 4KAHA 2A9YA 4KANA 2AB8A 3B1PA 1LHRA 2AJRA 3LJSA 3OTXA 2ABQA 4KBEA 3NL3A 3QA2A 4O1GA 1RFUA 3QAIA 3KEUA 3IQ0A 3GBUA 4E84A 3RQ6A 2JG5A 4K93A 4K8PA 1YGKA 2F02A 3ZS7A 1JXIA 3MBJA 4DU5A 2HQQA 1TYYA 1V1BA 2YXTA 3IH0A 3UMOA 3NC2A 3IKHA 4C5JA 2Q5RA 3EWMA 4C5LA 4C5MA 1RKSA 2AJPA 3RY7A 2HW1A 1ESJA 3HICA 4EUMA 4JKSA 1UB0A 3KZHA 2AX3A 2FV7A 3UQ9A
chains in the Genus database with same CATH superfamily
3Q92A 3FHXA 3MBHA 3Q1YA 3EAGA 5C41A 1J6UA 1EKKA 1BX4A 3DZVA 3RU2A 2VARA 2JFFA 1VK4A 4E8WA 3RQQA 3NBVA 4S1IB 3RTCA 3ZM6A 3H74A 4E8ZA 3VASA 2GCBA 3UQ6A 2R3EA 3IE7A 1ESQA 1DGMA 1RK2A 4S1MA 3RS9A 3LOOA 1V1AA 4N09A 4XDAA 3CQDA 5B6AA 1RKAA 3ZL8A 4BUCA 2VTEA 1U2XA 2Y68A 1L2LA 2A9ZA 2PKFA 3GO6A 4O1LA 4K8CA 4LBXA 4XF6A 4C5JA 3RT7A 5A5FA 3LK7A 4K8TA 5BYCA 3RQ5A 4LCAA 5A5EA 1TZ6A 3B1NA 4S1IA 2VOSA 3UBOA 5C3ZA 2GC5A 3RU3A 1VI9A 3RT9A 5EY7A 3W4SA 4KALA 3NBWA 2R3BA 3NRSA 2WJPA 3NL5A 3RRJA 4QDIA 3RRBA 2WTZA 3PL2A 5CM5A 3DRWA 3RO4A 3RTBA 2I6BA 3UQDA 3HJ6A 2JGVA 4K8KA 4GM6A 1GQQA 3KTNA 3NL2A 3QCZA 1V19A 3RRFA 1UA4A 5CGAA 3K5WA 1LHPA 1V1SA 3NC9A 3RTDA 5EYNA 3B1RA 3ZM5A 2DCNA 3B1OA 4B8SA 4XF7A 2XJAA 5COJA 3RS8A 4E3AA 2QCVA 2I6AA 2XPCA 4U7XA 5TRWA 1TZ3A 3H49A 2PKMA 4XCKA 4DC3A 2GC6A 3RTGA 3B3LA 3JULA 3BGKA 1RKDA 1LIIA 2GCAA 2XTBA 1LIKA 2F00A 2NWHA 3KD6A 4UBEA 3RTAA 1GQTA 4EOHA 4C13A 2AA0A 4EN4A 4B8RA 4YWRA 3NCAA 3RSQA 3FHYA 4WJMA 4CVKA 2I5BA 3RQ8A 1C3QA 1FGSA 4C5NA 4E8YA 5F11A 4C12A 5BYFA 3RTEA 3UMPA 3RM5A 3RREA 2Y67A 5CGEA 1E8CA 5TQIA 1TD2A 3NL6A 1RFVA 2Y66A 4E69A 4JKUA 1WYEA 2AFBA 1E0DA 3HPDA 3IN1A 3RQ2A 3RSFA 4BUBA 1VM7A 5BYDA 1GC5A 2ABSA 2F7KA 2RBCA 2V78A 1P3DA 3I3YA 3NM1A 5C3YA 1RFTA 2DDWA 4PVVA 4EBUA 2UUPA 4KADA 5F0ZA 2PKKA 2YXUA 2AWDA 4LBGA 3IBQA 3NM3A 4K9IA 3HYOA 3K9EA 3RSSA 3N2AA 4HV4A 1KYHA 4S1HA 3VAQA 3UQEA 2AM2A 1W7KA 2JG1A 3RPHA 3RQXA 1YGJA 4X8FA 4N08A 1GQYA 4LC4A 1LIOA 2DDOA 4QF5A 2DDMA 3BF5A 4JJPA 4UAGA 1YHJA 2C49A 3B1QA 3RQHA 1LIJA 2HLZA 2QHPA 3LKIA 2JFHA 3PZSA 1EKQA 4YL5A 4CVLA 3UAGA 5BYEA 3LHXA 3RPZA 3PYZA 1EEHA 3GO7A 2C4EA 3N1CA 4K9CA 2PKNA 5C40A 3RSGA 2VORA 4C5KA 1JXHA 4KAHA 4ZIYA 2A9YA 1JBVA 1W78A 4KANA 2UUOA 1O5ZA 2AB8A 3B1PA 1LHRA 2AJRA 3LJSA 3OTXA 2ABQA 4KBEA 3NL3A 3QA2A 4O1GA 1RFUA 3QAIA 3KEUA 2JFGA 3IQ0A 3GBUA 4E84A 3RQ6A 2JG5A 2X5OA 4K93A 1JBWA 4K8PA 1YGKA 2F02A 3ZS7A 1JXIA 3MBJA 4DU5A 2HQQA 1TYYA 1V1BA 2YXTA 3IH0A 3UMOA 2UAGA 3IKHA 2AM1A 2Y1OA 1P31A 2Q5RA 3EWMA 3NC2A 3HN7A 2VTDA 4C5MA 4C5LA 1RKSA 2AJPA 1GG4A 2HW1A 1ESJA 3HICA 3RY7A 4CVMA 4EUMA 4JKSA 1UB0A 3KZHA 2AX3A 1UAGA 2FV7A 3UQ9A
chains in the Genus database with same CATH topology
3Q92A 3FHXA 3MBHA 3Q1YA 5C41A 1EKKA 1BX4A 3DZVA 3RU2A 2VARA 4E8WA 1VK4A 3RQQA 3NBVA 4S1IB 3RTCA 3H74A 4E8ZA 3VASA 3UQ6A 2R3EA 3IE7A 1ESQA 1DGMA 1RK2A 4S1MA 3RS9A 3LOOA 1V1AA 4N09A 4XDAA 3CQDA 5B6AA 1RKAA 1U2XA 2PKFA 1L2LA 2A9ZA 3GO6A 4O1LA 4K8CA 4LBXA 4XF6A 3RT7A 4K8TA 5BYCA 3RQ5A 4LCAA 1TZ6A 3B1NA 4S1IA 5C3ZA 3UBOA 3RU3A 1VI9A 3RT9A 5EY7A 3W4SA 4KALA 3NBWA 2R3BA 3RRJA 3NL5A 3RRBA 3PL2A 5CM5A 3DRWA 3RO4A 3RTBA 2I6BA 3HJ6A 2JGVA 4K8KA 4GM6A 3KTNA 3NL2A 5CGAA 1V19A 3RRFA 1UA4A 5CGEA 3K5WA 1LHPA 1V1SA 3NC9A 3RTDA 5EYNA 3B1RA 4B8SA 2DCNA 3B1OA 4E3AA 4XF7A 5COJA 3RS8A 2QCVA 2I6AA 4U7XA 5TRWA 1TZ3A 3H49A 2PKMA 4XCKA 4DC3A 3RTGA 3B3LA 3JULA 3BGKA 1RKDA 1LIIA 2XTBA 1LIKA 2NWHA 3KD6A 4UBEA 3RTAA 4EOHA 1GQTA 4EN4A 2AA0A 4B8RA 4YWRA 3NCAA 3RSQA 3FHYA 4WJMA 2I5BA 3RQ8A 1C3QA 4C5NA 4E8YA 5BYFA 3RTEA 3UMPA 3RM5A 3RREA 5TQIA 1TD2A 3NL6A 1RFVA 4E69A 4JKUA 1WYEA 2AFBA 3HPDA 3IN1A 3RSFA 3RQ2A 1VM7A 5BYDA 1GC5A 2ABSA 2F7KA 2RBCA 2V78A 3I3YA 3NM1A 5C3YA 1RFTA 2DDWA 4PVVA 4EBUA 4KADA 5F0ZA 2PKKA 2YXUA 2AWDA 4LBGA 3IBQA 3NM3A 4K9IA 3HYOA 3K9EA 3RSSA 1KYHA 4S1HA 3VAQA 3UQEA 2JG1A 3RPHA 3RQXA 1YGJA 4X8FA 4N08A 4LC4A 1LIOA 2DDOA 3UQDA 2DDMA 3BF5A 4JJPA 1YHJA 2C49A 3B1QA 3RQHA 1LIJA 2HLZA 2QHPA 3LKIA 3PZSA 4YL5A 1EKQA 5BYEA 3LHXA 3RPZA 5F11A 3GO7A 2C4EA 3N1CA 4K9CA 2PKNA 5C40A 3RSGA 4C5KA 1JXHA 4KAHA 2A9YA 4KANA 2AB8A 3B1PA 1LHRA 2AJRA 3LJSA 3OTXA 2ABQA 4KBEA 3NL3A 3QA2A 4O1GA 1RFUA 3QAIA 3KEUA 3IQ0A 3GBUA 4E84A 3RQ6A 2JG5A 4K93A 4K8PA 1YGKA 2F02A 3ZS7A 1JXIA 3MBJA 4DU5A 2HQQA 1TYYA 1V1BA 2YXTA 3IH0A 3UMOA 3NC2A 3IKHA 4C5JA 2Q5RA 3EWMA 4C5LA 4C5MA 1RKSA 2AJPA 3RY7A 2HW1A 1ESJA 3HICA 4EUMA 4JKSA 1UB0A 3KZHA 2AX3A 2FV7A 3UQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q92 A;  3FHX A;  3MBH A;  3Q1Y A;  5C41 A;  1EKK A;  1BX4 A;  3DZV A;  3RU2 A;  2VAR A;  4E8W A;  1VK4 A;  3RQQ A;  3NBV A;  4S1I B;  3RTC A;  3H74 A;  4E8Z A;  3VAS A;  3UQ6 A;  2R3E A;  3IE7 A;  1ESQ A;  1DGM A;  1RK2 A;  4S1M A;  3RS9 A;  3LOO A;  1V1A A;  4N09 A;  4XDA A;  3CQD A;  5B6A A;  1RKA A;  1U2X A;  2PKF A;  1L2L A;  2A9Z A;  3GO6 A;  4O1L A;  4K8C A;  4LBX A;  4XF6 A;  3RT7 A;  4K8T A;  5BYC A;  3RQ5 A;  4LCA A;  1TZ6 A;  3B1N A;  4S1I A;  5C3Z A;  3UBO A;  3RU3 A;  1VI9 A;  3RT9 A;  5EY7 A;  3W4S A;  4KAL A;  3NBW A;  2R3B A;  3RRJ A;  3NL5 A;  3RRB A;  3PL2 A;  5CM5 A;  3DRW A;  3RO4 A;  3RTB A;  2I6B A;  2JGV A;  4K8K A;  4GM6 A;  3KTN A;  3NL2 A;  5CGA A;  1V19 A;  3RRF A;  1UA4 A;  5CGE A;  3K5W A;  1LHP A;  1V1S A;  3NC9 A;  3RTD A;  5EYN A;  3B1R A;  4B8S A;  2DCN A;  3B1O A;  4E3A A;  4XF7 A;  5COJ A;  3RS8 A;  2QCV A;  2I6A A;  4U7X A;  5TRW A;  1TZ3 A;  3H49 A;  2PKM A;  4XCK A;  4DC3 A;  3RTG A;  3B3L A;  3JUL A;  3BGK A;  1RKD A;  1LII A;  2XTB A;  1LIK A;  2NWH A;  3KD6 A;  4UBE A;  3RTA A;  4EOH A;  1GQT A;  4EN4 A;  2AA0 A;  4B8R A;  4YWR A;  3NCA A;  3RSQ A;  3FHY A;  4WJM A;  2I5B A;  3RQ8 A;  1C3Q A;  4C5N A;  4E8Y A;  5BYF A;  3RTE A;  3UMP A;  3RM5 A;  3RRE A;  5TQI A;  1TD2 A;  3NL6 A;  1RFV A;  4E69 A;  4JKU A;  1WYE A;  2AFB A;  3HPD A;  3IN1 A;  3RSF A;  3RQ2 A;  1VM7 A;  5BYD A;  1GC5 A;  2ABS A;  2F7K A;  2RBC A;  2V78 A;  3I3Y A;  3NM1 A;  5C3Y A;  1RFT A;  2DDW A;  4PVV A;  4EBU A;  4KAD A;  5F0Z A;  2PKK A;  2YXU A;  2AWD A;  4LBG A;  3IBQ A;  3NM3 A;  4K9I A;  3HYO A;  3K9E A;  3RSS A;  1KYH A;  4S1H A;  3VAQ A;  3UQE A;  2JG1 A;  3RPH A;  3RQX A;  1YGJ A;  4X8F A;  4N08 A;  4LC4 A;  1LIO A;  2DDO A;  3UQD A;  2DDM A;  3BF5 A;  4JJP A;  1YHJ A;  2C49 A;  3B1Q A;  3RQH A;  1LIJ A;  2HLZ A;  2QHP A;  3LKI A;  3PZS A;  4YL5 A;  1EKQ A;  5BYE A;  3LHX A;  3RPZ A;  5F11 A;  3GO7 A;  2C4E A;  3N1C A;  4K9C A;  2PKN A;  5C40 A;  3RSG A;  4C5K A;  1JXH A;  4KAH A;  2A9Y A;  4KAN A;  2AB8 A;  3B1P A;  1LHR A;  2AJR A;  3LJS A;  3OTX A;  2ABQ A;  4KBE A;  3NL3 A;  3QA2 A;  4O1G A;  1RFU A;  3QAI A;  3KEU A;  3IQ0 A;  3GBU A;  4E84 A;  3RQ6 A;  2JG5 A;  4K93 A;  4K8P A;  1YGK A;  2F02 A;  3ZS7 A;  1JXI A;  3MBJ A;  4DU5 A;  2HQQ A;  1TYY A;  1V1B A;  2YXT A;  3IH0 A;  3UMO A;  3NC2 A;  3IKH A;  4C5J A;  2Q5R A;  3EWM A;  4C5L A;  4C5M A;  1RKS A;  2AJP A;  3RY7 A;  2HW1 A;  1ESJ A;  3HIC A;  4EUM A;  4JKS A;  1UB0 A;  3KZH A;  2AX3 A;  2FV7 A;  3UQ9 A; 
#chains in the Genus database with same CATH topology
 3Q92 A;  3FHX A;  3MBH A;  3Q1Y A;  3EAG A;  5C41 A;  1J6U A;  1EKK A;  1BX4 A;  3DZV A;  3RU2 A;  2VAR A;  2JFF A;  1VK4 A;  4E8W A;  3RQQ A;  3NBV A;  4S1I B;  3RTC A;  3ZM6 A;  3H74 A;  4E8Z A;  3VAS A;  2GCB A;  3UQ6 A;  2R3E A;  3IE7 A;  1ESQ A;  1DGM A;  1RK2 A;  4S1M A;  3RS9 A;  3LOO A;  1V1A A;  4N09 A;  4XDA A;  3CQD A;  5B6A A;  1RKA A;  3ZL8 A;  4BUC A;  2VTE A;  1U2X A;  2Y68 A;  1L2L A;  2A9Z A;  2PKF A;  3GO6 A;  4O1L A;  4K8C A;  4LBX A;  4XF6 A;  4C5J A;  3RT7 A;  5A5F A;  3LK7 A;  4K8T A;  5BYC A;  3RQ5 A;  4LCA A;  5A5E A;  1TZ6 A;  3B1N A;  4S1I A;  2VOS A;  3UBO A;  5C3Z A;  2GC5 A;  3RU3 A;  1VI9 A;  3RT9 A;  5EY7 A;  3W4S A;  4KAL A;  3NBW A;  2R3B A;  3NRS A;  2WJP A;  3NL5 A;  3RRJ A;  4QDI A;  3RRB A;  2WTZ A;  3PL2 A;  5CM5 A;  3DRW A;  3RO4 A;  3RTB A;  2I6B A;  3UQD A;  3HJ6 A;  2JGV A;  4K8K A;  4GM6 A;  1GQQ A;  3KTN A;  3NL2 A;  3QCZ A;  1V19 A;  3RRF A;  1UA4 A;  5CGA A;  3K5W A;  1LHP A;  1V1S A;  3NC9 A;  3RTD A;  5EYN A;  3B1R A;  3ZM5 A;  2DCN A;  3B1O A;  4B8S A;  4XF7 A;  2XJA A;  5COJ A;  3RS8 A;  4E3A A;  2QCV A;  2I6A A;  2XPC A;  4U7X A;  5TRW A;  1TZ3 A;  3H49 A;  2PKM A;  4XCK A;  4DC3 A;  2GC6 A;  3RTG A;  3B3L A;  3JUL A;  3BGK A;  1RKD A;  1LII A;  2GCA A;  2XTB A;  1LIK A;  2F00 A;  2NWH A;  3KD6 A;  4UBE A;  3RTA A;  1GQT A;  4EOH A;  4C13 A;  2AA0 A;  4EN4 A;  4B8R A;  4YWR A;  3NCA A;  3RSQ A;  3FHY A;  4WJM A;  4CVK A;  2I5B A;  3RQ8 A;  1C3Q A;  1FGS A;  4C5N A;  4E8Y A;  5F11 A;  4C12 A;  5BYF A;  3RTE A;  3UMP A;  3RM5 A;  3RRE A;  2Y67 A;  5CGE A;  1E8C A;  5TQI A;  1TD2 A;  3NL6 A;  1RFV A;  2Y66 A;  4E69 A;  4JKU A;  1WYE A;  2AFB A;  1E0D A;  3HPD A;  3IN1 A;  3RQ2 A;  3RSF A;  4BUB A;  1VM7 A;  5BYD A;  1GC5 A;  2ABS A;  2F7K A;  2RBC A;  2V78 A;  1P3D A;  3I3Y A;  3NM1 A;  5C3Y A;  1RFT A;  2DDW A;  4PVV A;  4EBU A;  2UUP A;  4KAD A;  5F0Z A;  2PKK A;  2YXU A;  2AWD A;  4LBG A;  3IBQ A;  3NM3 A;  4K9I A;  3HYO A;  3K9E A;  3RSS A;  3N2A A;  4HV4 A;  1KYH A;  4S1H A;  3VAQ A;  3UQE A;  2AM2 A;  1W7K A;  2JG1 A;  3RPH A;  3RQX A;  1YGJ A;  4X8F A;  4N08 A;  1GQY A;  4LC4 A;  1LIO A;  2DDO A;  4QF5 A;  2DDM A;  3BF5 A;  4JJP A;  4UAG A;  1YHJ A;  2C49 A;  3B1Q A;  3RQH A;  1LIJ A;  2HLZ A;  2QHP A;  3LKI A;  2JFH A;  3PZS A;  1EKQ A;  4YL5 A;  4CVL A;  3UAG A;  5BYE A;  3LHX A;  3RPZ A;  3PYZ A;  1EEH A;  3GO7 A;  2C4E A;  3N1C A;  4K9C A;  2PKN A;  5C40 A;  3RSG A;  2VOR A;  4C5K A;  1JXH A;  4KAH A;  4ZIY A;  2A9Y A;  1JBV A;  1W78 A;  4KAN A;  2UUO A;  1O5Z A;  2AB8 A;  3B1P A;  1LHR A;  2AJR A;  3LJS A;  3OTX A;  2ABQ A;  4KBE A;  3NL3 A;  3QA2 A;  4O1G A;  1RFU A;  3QAI A;  3KEU A;  2JFG A;  3IQ0 A;  3GBU A;  4E84 A;  3RQ6 A;  2JG5 A;  2X5O A;  4K93 A;  1JBW A;  4K8P A;  1YGK A;  2F02 A;  3ZS7 A;  1JXI A;  3MBJ A;  4DU5 A;  2HQQ A;  1TYY A;  1V1B A;  2YXT A;  3IH0 A;  3UMO A;  2UAG A;  3IKH A;  2AM1 A;  2Y1O A;  1P31 A;  2Q5R A;  3EWM A;  3NC2 A;  3HN7 A;  2VTD A;  4C5M A;  4C5L A;  1RKS A;  2AJP A;  1GG4 A;  2HW1 A;  1ESJ A;  3HIC A;  3RY7 A;  4CVM A;  4EUM A;  4JKS A;  1UB0 A;  3KZH A;  2AX3 A;  1UAG A;  2FV7 A;  3UQ9 A; 
#chains in the Genus database with same CATH homology
 3Q92 A;  3FHX A;  3MBH A;  3Q1Y A;  5C41 A;  1EKK A;  1BX4 A;  3DZV A;  3RU2 A;  2VAR A;  4E8W A;  1VK4 A;  3RQQ A;  3NBV A;  4S1I B;  3RTC A;  3H74 A;  4E8Z A;  3VAS A;  3UQ6 A;  2R3E A;  3IE7 A;  1ESQ A;  1DGM A;  1RK2 A;  4S1M A;  3RS9 A;  3LOO A;  1V1A A;  4N09 A;  4XDA A;  3CQD A;  5B6A A;  1RKA A;  1U2X A;  2PKF A;  1L2L A;  2A9Z A;  3GO6 A;  4O1L A;  4K8C A;  4LBX A;  4XF6 A;  3RT7 A;  4K8T A;  5BYC A;  3RQ5 A;  4LCA A;  1TZ6 A;  3B1N A;  4S1I A;  5C3Z A;  3UBO A;  3RU3 A;  1VI9 A;  3RT9 A;  5EY7 A;  3W4S A;  4KAL A;  3NBW A;  2R3B A;  3RRJ A;  3NL5 A;  3RRB A;  3PL2 A;  5CM5 A;  3DRW A;  3RO4 A;  3RTB A;  2I6B A;  3HJ6 A;  2JGV A;  4K8K A;  4GM6 A;  3KTN A;  3NL2 A;  5CGA A;  1V19 A;  3RRF A;  1UA4 A;  5CGE A;  3K5W A;  1LHP A;  1V1S A;  3NC9 A;  3RTD A;  5EYN A;  3B1R A;  4B8S A;  2DCN A;  3B1O A;  4E3A A;  4XF7 A;  5COJ A;  3RS8 A;  2QCV A;  2I6A A;  4U7X A;  5TRW A;  1TZ3 A;  3H49 A;  2PKM A;  4XCK A;  4DC3 A;  3RTG A;  3B3L A;  3JUL A;  3BGK A;  1RKD A;  1LII A;  2XTB A;  1LIK A;  2NWH A;  3KD6 A;  4UBE A;  3RTA A;  4EOH A;  1GQT A;  4EN4 A;  2AA0 A;  4B8R A;  4YWR A;  3NCA A;  3RSQ A;  3FHY A;  4WJM A;  2I5B A;  3RQ8 A;  1C3Q A;  4C5N A;  4E8Y A;  5BYF A;  3RTE A;  3UMP A;  3RM5 A;  3RRE A;  5TQI A;  1TD2 A;  3NL6 A;  1RFV A;  4E69 A;  4JKU A;  1WYE A;  2AFB A;  3HPD A;  3IN1 A;  3RSF A;  3RQ2 A;  1VM7 A;  5BYD A;  1GC5 A;  2ABS A;  2F7K A;  2RBC A;  2V78 A;  3I3Y A;  3NM1 A;  5C3Y A;  1RFT A;  2DDW A;  4PVV A;  4EBU A;  4KAD A;  5F0Z A;  2PKK A;  2YXU A;  2AWD A;  4LBG A;  3IBQ A;  3NM3 A;  4K9I A;  3HYO A;  3K9E A;  3RSS A;  1KYH A;  4S1H A;  3VAQ A;  3UQE A;  2JG1 A;  3RPH A;  3RQX A;  1YGJ A;  4X8F A;  4N08 A;  4LC4 A;  1LIO A;  2DDO A;  3UQD A;  2DDM A;  3BF5 A;  4JJP A;  1YHJ A;  2C49 A;  3B1Q A;  3RQH A;  1LIJ A;  2HLZ A;  2QHP A;  3LKI A;  3PZS A;  4YL5 A;  1EKQ A;  5BYE A;  3LHX A;  3RPZ A;  5F11 A;  3GO7 A;  2C4E A;  3N1C A;  4K9C A;  2PKN A;  5C40 A;  3RSG A;  4C5K A;  1JXH A;  4KAH A;  2A9Y A;  4KAN A;  2AB8 A;  3B1P A;  1LHR A;  2AJR A;  3LJS A;  3OTX A;  2ABQ A;  4KBE A;  3NL3 A;  3QA2 A;  4O1G A;  1RFU A;  3QAI A;  3KEU A;  3IQ0 A;  3GBU A;  4E84 A;  3RQ6 A;  2JG5 A;  4K93 A;  4K8P A;  1YGK A;  2F02 A;  3ZS7 A;  1JXI A;  3MBJ A;  4DU5 A;  2HQQ A;  1TYY A;  1V1B A;  2YXT A;  3IH0 A;  3UMO A;  3NC2 A;  3IKH A;  4C5J A;  2Q5R A;  3EWM A;  4C5L A;  4C5M A;  1RKS A;  2AJP A;  3RY7 A;  2HW1 A;  1ESJ A;  3HIC A;  4EUM A;  4JKS A;  1UB0 A;  3KZH A;  2AX3 A;  2FV7 A;  3UQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...