1V1AA

2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2-keto-3-deoxygluconate and adp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
301
structure length
301
Chain Sequence
MLEVVTAGEPLVALVPQEPGHLRGKRLLEVYVGGAEVNVAVALARLGVKVGFVGRVGEDELGAMVEERLRAEGVDLTHFRRAPGFTGLYLREYLPLGQGRVFYYRKGSAGSALAPGAFDPDYLEGVRFLHLSGITPALSPEARAFSLWAMEEAKRRGVRVSLDVNYRQTLWSPEEARGFLERALPGVDLLFLSEEEAELLFGRVEEALRALSAPEVVLKRGAKGAWAFVDGRRVEGSAFAVEAVDPVGAGDAFAAGYLAGAVWGLPVEERLRLANLLGASVAASRGDHEGAPYREDLEVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Thermus thermophilus 2-Keto-3-deoxygluconate kinase: evidence for recognition of an open chain substrate.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords 2-KETO-3-DEOXYGLUCONATE KINASE
total genus 97
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 2.7.1.45: 2-dehydro-3-deoxygluconokinase.
pdb deposition date 2004-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 1v1aA00
3RS9A 1TZ3A 2R3BA 4K8CA 2Q5RA 3RQQA 3B1QA 3EWMA 3UMPA 3UQ9A 1EKQA 2AJRA 1YHJA 3IQ0A 4B8SA 2PKFA 4DU5A 4E8WA 4K8PA 4S1MA 3RTAA 3IE7A 1LIJA 1V1AA 2NWHA 3BF5A 3B1NA 3VASA 3JULA 2PKNA 1BX4A 2A9ZA 4S1IA 4C5NA 1RKSA 4JJPA 5BYCA 2AA0A 3NL3A 4E3AA 1EKKA 4YWRA 3RRFA 3RTGA 4E84A 3I3YA 5BYEA 2A9YA 3UQDA 3RO4A 3RS8A 1GQTA 3RQ2A 4X8FA 5B6AA 1YGJA 3RTBA 3DZVA 3NM3A 3RQXA 3KZHA 3RU2A 3RTEA 2PKKA 3LJSA 4YL5A 2FV7A 3HPDA 3NL6A 4N08A 3RY7A 4KAHA 2YXTA 3PL2A 3CQDA 1LHPA 1V19A 1VM7A 3LHXA 1LIOA 1V1SA 3B1RA 3NM1A 3PZSA 4KANA 5TQIA 4XDAA 4C5KA 3LKIA 2AFBA 2JG1A 4KADA 3NL2A 2HW1A 2I5BA 3RQ8A 1DGMA 3NCAA 3NC2A 4O1LA 4E69A 4U7XA 3RREA 3IBQA 4O1GA 3K9EA 1RFVA 3B1OA 3RQ6A 1VI9A 3RRBA 2JGVA 3W4SA 5BYDA 2C49A 3QAIA 2R3EA 2JG5A 1U2XA 3GBUA 4E8ZA 1UA4A 5CGAA 2PKMA 3HYOA 3K5WA 3H74A 3RQHA 3KEUA 1VK4A 3H49A 3VAQA 4E8YA 3QA2A 2HQQA 1RK2A 4K8TA 4S1HA 4B8RA 3HICA 4EBUA 3DRWA 4LBXA 3MBJA 4JKSA 3RTCA 2DCNA 4KALA 4LCAA 3RPHA 5EYNA 5CM5A 1TYYA 2YXUA 3OTXA 1UB0A 2QHPA 1LIKA 1KYHA 2F02A 4LC4A 3RQ5A 3ZS7A 3RU3A 2AWDA 3BGKA 3FHXA 3RPZA 1C3QA 4EN4A 3Q92A 3RT9A 4EUMA 2AB8A 1V1BA 4N09A 4XF6A 3RSSA 1JXIA 1RFUA 4K9IA 3NBVA 4WJMA 2C4EA 3UQ6A 1YGKA 4K93A 3RM5A 4K8KA 4K9CA 4XF7A 2VARA 3KD6A 3UQEA 3RSGA 3N1CA 2DDMA 4S1IB 2ABSA 2XTBA 5EY7A 4C5LA 4EOHA 5F0ZA 3GO6A 5BYFA 3LOOA 3MBHA 3B3LA 3GO7A 2F7KA 3NBWA 4LBGA 2DDWA 4C5MA 1WYEA 2I6AA 3KTNA 4KBEA 1LIIA 3UBOA 5C40A 4UBEA 3IKHA 2QCVA 1GC5A 1L2LA 1ESJA 1RKAA 2ABQA 2HLZA 3IH0A 5TRWA 3RSQA 5C3YA 4XCKA 2I6BA 2DDOA 2AX3A 3RTDA 3RRJA 1TD2A 3FHYA 4GM6A 3NC9A 1ESQA 4JKUA 2V78A 4DC3A 3RT7A 4PVVA 3Q1YA 5CGEA 1RFTA 1TZ6A 5C41A 1JXHA 2AJPA 3B1PA 3IN1A 5COJA 3RSFA 1LHRA 4C5JA 5F11A 3UMOA 3NL5A 5C3ZA 2RBCA 1RKDA
chains in the Genus database with same CATH superfamily
3RS9A 1TZ3A 2JFFA 2VTEA 2R3BA 3HN7A 2XJAA 4K8CA 2Q5RA 3RQQA 3B1QA 3EWMA 4QDIA 3UMPA 3UQ9A 1EKQA 2AJRA 1JBWA 2VTDA 2GCBA 4CVMA 1YHJA 3IQ0A 4B8SA 2PKFA 4BUBA 4DU5A 4E8WA 4K8PA 1EEHA 4S1MA 3RTAA 3IE7A 1LIJA 1V1AA 2NWHA 3BF5A 3B1NA 3VASA 3JULA 2PKNA 1BX4A 1GQQA 2A9ZA 3PYZA 1RKSA 4JJPA 4S1IA 1E8CA 2AA0A 3NL3A 5BYCA 4E3AA 1EKKA 2XPCA 4YWRA 3RRFA 3RTGA 3I3YA 3N2AA 4QF5A 4E84A 5BYEA 2A9YA 3UQDA 3RO4A 3RS8A 2Y67A 1GQTA 3RQ2A 4X8FA 5B6AA 1YGJA 2UUPA 3DZVA 3RTBA 3ZL8A 3NM3A 3RQXA 3KZHA 3RU2A 4UAGA 3RTEA 3W4SA 2PKKA 3LJSA 4YL5A 2FV7A 3HPDA 3NL6A 4N08A 4HV4A 5A5EA 3RY7A 4KAHA 2YXTA 3PL2A 3CQDA 1LHPA 1V19A 1VM7A 3LHXA 1LIOA 1V1SA 3B1RA 3NM1A 3PZSA 4KANA 1GQYA 5TQIA 4XDAA 4C5KA 3LKIA 1FGSA 2Y1OA 2AFBA 2JG1A 4KADA 3NL2A 2HW1A 2I5BA 3RQ8A 1DGMA 3NCAA 3NC2A 3ZM6A 2VORA 4O1LA 4E69A 4CVLA 4U7XA 3RREA 3IBQA 4O1GA 2F00A 1RFVA 1UAGA 2WJPA 1VI9A 3B1OA 2JGVA 3K9EA 3RQ6A 2C49A 2GCAA 2WTZA 2R3EA 2JG5A 1U2XA 3GBUA 3QAIA 1UA4A 4BUCA 4E8ZA 5CGAA 4C12A 2AM1A 2PKMA 3HYOA 3K5WA 3EAGA 1P31A 3H74A 3RQHA 3KEUA 1VK4A 3H49A 2UUOA 3VAQA 4C5NA 3QA2A 4E8YA 2HQQA 1RK2A 4K8TA 4S1HA 4B8RA 3HICA 1O5ZA 4EBUA 4CVKA 3DRWA 4LBXA 3MBJA 4JKSA 3RTCA 3RRBA 2DCNA 3ZM5A 4KALA 4LCAA 3RPHA 5EYNA 5CM5A 1TYYA 2YXUA 1P3DA 1UB0A 3NRSA 3OTXA 1W7KA 1LIKA 2QHPA 1KYHA 2F02A 4LC4A 3RQ5A 2Y66A 3ZS7A 3RU3A 1J6UA 2AWDA 3BGKA 3FHXA 3RPZA 1C3QA 4EN4A 3Q92A 3HJ6A 3RT9A 2AB8A 1V1BA 4N09A 4XF6A 3RSSA 2JFGA 4EUMA 1JXIA 1RFUA 4K9IA 3NBVA 4WJMA 2C4EA 3UQ6A 1YGKA 4K93A 3RM5A 4K8KA 4K9CA 4XF7A 2VARA 3KD6A 4ZIYA 3RSGA 3N1CA 3UQEA 2DDMA 5A5FA 5BYDA 4S1IB 2ABSA 2XTBA 5EY7A 4C5LA 4EOHA 2GC5A 5F0ZA 3GO6A 5BYFA 3LOOA 3MBHA 2AM2A 3B3LA 3GO7A 2F7KA 3NBWA 4LBGA 2DDWA 4C5MA 1WYEA 2I6AA 3KTNA 4KBEA 1LIIA 3UBOA 2X5OA 1E0DA 5C40A 4UBEA 3IKHA 1ESJA 1GC5A 1L2LA 1RKAA 2ABQA 2HLZA 2QCVA 3IH0A 5TRWA 3RSQA 2Y68A 5C3YA 3QCZA 4XCKA 2I6BA 2DDOA 2GC6A 2AX3A 1JBVA 3RTDA 3LK7A 1TD2A 3FHYA 4GM6A 1W78A 3NC9A 3RRJA 1ESQA 4JKUA 2V78A 4DC3A 3RT7A 4PVVA 3Q1YA 5CGEA 2UAGA 2VOSA 1RFTA 1TZ6A 5C41A 3UAGA 1JXHA 2AJPA 3B1PA 3IN1A 5COJA 2JFHA 1LHRA 3RSFA 4C5JA 5F11A 3UMOA 1GG4A 4C13A 3NL5A 5C3ZA 2RBCA 1RKDA
chains in the Genus database with same CATH topology
3RS9A 1TZ3A 2R3BA 4K8CA 2Q5RA 3RQQA 3B1QA 3EWMA 3UMPA 3UQ9A 1EKQA 2AJRA 1YHJA 3IQ0A 4B8SA 2PKFA 4DU5A 4E8WA 4K8PA 4S1MA 3RTAA 3IE7A 1LIJA 1V1AA 2NWHA 3BF5A 3B1NA 3VASA 3JULA 2PKNA 1BX4A 2A9ZA 4S1IA 4C5NA 1RKSA 4JJPA 5BYCA 2AA0A 3NL3A 4E3AA 1EKKA 4YWRA 3RRFA 3RTGA 4E84A 3I3YA 5BYEA 2A9YA 3UQDA 3RO4A 3RS8A 1GQTA 3RQ2A 4X8FA 5B6AA 1YGJA 3RTBA 3DZVA 3NM3A 3RQXA 3KZHA 3RU2A 3RTEA 2PKKA 3LJSA 4YL5A 2FV7A 3HPDA 3NL6A 4N08A 3RY7A 4KAHA 2YXTA 3PL2A 3CQDA 1LHPA 1V19A 1VM7A 3LHXA 1LIOA 1V1SA 3B1RA 3NM1A 3PZSA 4KANA 5TQIA 4XDAA 4C5KA 3LKIA 2AFBA 2JG1A 4KADA 3NL2A 2HW1A 2I5BA 3RQ8A 1DGMA 3NCAA 3NC2A 4O1LA 4E69A 4U7XA 3RREA 3IBQA 4O1GA 3K9EA 1RFVA 3B1OA 3RQ6A 1VI9A 3RRBA 2JGVA 3W4SA 5BYDA 2C49A 3QAIA 2R3EA 2JG5A 1U2XA 3GBUA 4E8ZA 1UA4A 5CGAA 2PKMA 3HYOA 3K5WA 3H74A 3RQHA 3KEUA 1VK4A 3H49A 3VAQA 4E8YA 3QA2A 2HQQA 1RK2A 4K8TA 4S1HA 4B8RA 3HICA 4EBUA 3DRWA 4LBXA 3MBJA 4JKSA 3RTCA 2DCNA 4KALA 4LCAA 3RPHA 5EYNA 5CM5A 1TYYA 2YXUA 3OTXA 1UB0A 2QHPA 1LIKA 1KYHA 2F02A 4LC4A 3RQ5A 3ZS7A 3RU3A 2AWDA 3BGKA 3FHXA 3RPZA 1C3QA 4EN4A 3Q92A 3HJ6A 3RT9A 2AB8A 1V1BA 4N09A 4XF6A 3RSSA 4EUMA 1JXIA 1RFUA 4K9IA 3NBVA 4WJMA 2C4EA 3UQ6A 1YGKA 4K93A 3RM5A 4K8KA 4K9CA 4XF7A 2VARA 3KD6A 3UQEA 3RSGA 3N1CA 2DDMA 4S1IB 2ABSA 2XTBA 5EY7A 4C5LA 4EOHA 5F0ZA 3GO6A 5BYFA 3LOOA 3MBHA 3B3LA 3GO7A 2F7KA 3NBWA 4LBGA 2DDWA 4C5MA 1WYEA 2I6AA 3KTNA 4KBEA 1LIIA 3UBOA 5C40A 4UBEA 3IKHA 2QCVA 1GC5A 1L2LA 1ESJA 1RKAA 2ABQA 2HLZA 3IH0A 5TRWA 3RSQA 5C3YA 4XCKA 2I6BA 2DDOA 2AX3A 3RTDA 3RRJA 1TD2A 3FHYA 4GM6A 3NC9A 1ESQA 4JKUA 2V78A 4DC3A 3RT7A 4PVVA 3Q1YA 5CGEA 1RFTA 1TZ6A 5C41A 1JXHA 2AJPA 3B1PA 3IN1A 5COJA 3RSFA 1LHRA 4C5JA 5F11A 3UMOA 3NL5A 5C3ZA 2RBCA 1RKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RS9 A;  1TZ3 A;  2R3B A;  4K8C A;  2Q5R A;  3RQQ A;  3B1Q A;  3EWM A;  3UMP A;  3UQ9 A;  1EKQ A;  2AJR A;  1YHJ A;  3IQ0 A;  4B8S A;  2PKF A;  4DU5 A;  4E8W A;  4K8P A;  4S1M A;  3RTA A;  3IE7 A;  1LIJ A;  1V1A A;  2NWH A;  3BF5 A;  3B1N A;  3VAS A;  3JUL A;  2PKN A;  1BX4 A;  2A9Z A;  4S1I A;  4C5N A;  1RKS A;  4JJP A;  5BYC A;  2AA0 A;  3NL3 A;  4E3A A;  1EKK A;  4YWR A;  3RRF A;  3RTG A;  4E84 A;  3I3Y A;  5BYE A;  2A9Y A;  3UQD A;  3RO4 A;  3RS8 A;  1GQT A;  3RQ2 A;  4X8F A;  5B6A A;  1YGJ A;  3RTB A;  3DZV A;  3NM3 A;  3RQX A;  3KZH A;  3RU2 A;  3RTE A;  2PKK A;  3LJS A;  4YL5 A;  2FV7 A;  3HPD A;  3NL6 A;  4N08 A;  3RY7 A;  4KAH A;  2YXT A;  3PL2 A;  3CQD A;  1LHP A;  1V19 A;  1VM7 A;  3LHX A;  1LIO A;  1V1S A;  3B1R A;  3NM1 A;  3PZS A;  4KAN A;  5TQI A;  4XDA A;  4C5K A;  3LKI A;  2AFB A;  2JG1 A;  4KAD A;  3NL2 A;  2HW1 A;  2I5B A;  3RQ8 A;  1DGM A;  3NCA A;  3NC2 A;  4O1L A;  4E69 A;  4U7X A;  3RRE A;  3IBQ A;  4O1G A;  3K9E A;  1RFV A;  3B1O A;  3RQ6 A;  1VI9 A;  3RRB A;  2JGV A;  3W4S A;  5BYD A;  2C49 A;  3QAI A;  2R3E A;  2JG5 A;  1U2X A;  3GBU A;  4E8Z A;  1UA4 A;  5CGA A;  2PKM A;  3HYO A;  3K5W A;  3H74 A;  3RQH A;  3KEU A;  1VK4 A;  3H49 A;  3VAQ A;  4E8Y A;  3QA2 A;  2HQQ A;  1RK2 A;  4K8T A;  4S1H A;  4B8R A;  3HIC A;  4EBU A;  3DRW A;  4LBX A;  3MBJ A;  4JKS A;  3RTC A;  2DCN A;  4KAL A;  4LCA A;  3RPH A;  5EYN A;  5CM5 A;  1TYY A;  2YXU A;  3OTX A;  1UB0 A;  2QHP A;  1LIK A;  1KYH A;  2F02 A;  4LC4 A;  3RQ5 A;  3ZS7 A;  3RU3 A;  2AWD A;  3BGK A;  3FHX A;  3RPZ A;  1C3Q A;  4EN4 A;  3Q92 A;  3RT9 A;  4EUM A;  2AB8 A;  1V1B A;  4N09 A;  4XF6 A;  3RSS A;  1JXI A;  1RFU A;  4K9I A;  3NBV A;  4WJM A;  2C4E A;  3UQ6 A;  1YGK A;  4K93 A;  3RM5 A;  4K8K A;  4K9C A;  4XF7 A;  2VAR A;  3KD6 A;  3UQE A;  3RSG A;  3N1C A;  2DDM A;  4S1I B;  2ABS A;  2XTB A;  5EY7 A;  4C5L A;  4EOH A;  5F0Z A;  3GO6 A;  5BYF A;  3LOO A;  3MBH A;  3B3L A;  3GO7 A;  2F7K A;  3NBW A;  4LBG A;  2DDW A;  4C5M A;  1WYE A;  2I6A A;  3KTN A;  4KBE A;  1LII A;  3UBO A;  5C40 A;  4UBE A;  3IKH A;  2QCV A;  1GC5 A;  1L2L A;  1ESJ A;  1RKA A;  2ABQ A;  2HLZ A;  3IH0 A;  5TRW A;  3RSQ A;  5C3Y A;  4XCK A;  2I6B A;  2DDO A;  2AX3 A;  3RTD A;  3RRJ A;  1TD2 A;  3FHY A;  4GM6 A;  3NC9 A;  1ESQ A;  4JKU A;  2V78 A;  4DC3 A;  3RT7 A;  4PVV A;  3Q1Y A;  5CGE A;  1RFT A;  1TZ6 A;  5C41 A;  1JXH A;  2AJP A;  3B1P A;  3IN1 A;  5COJ A;  3RSF A;  1LHR A;  4C5J A;  5F11 A;  3UMO A;  3NL5 A;  5C3Z A;  2RBC A;  1RKD A; 
#chains in the Genus database with same CATH topology
 3RS9 A;  1TZ3 A;  2JFF A;  2VTE A;  2R3B A;  3HN7 A;  2XJA A;  4K8C A;  2Q5R A;  3RQQ A;  3B1Q A;  3EWM A;  4QDI A;  3UMP A;  3UQ9 A;  1EKQ A;  2AJR A;  1JBW A;  2VTD A;  2GCB A;  4CVM A;  1YHJ A;  3IQ0 A;  4B8S A;  2PKF A;  4BUB A;  4DU5 A;  4E8W A;  4K8P A;  1EEH A;  4S1M A;  3RTA A;  3IE7 A;  1LIJ A;  1V1A A;  2NWH A;  3BF5 A;  3B1N A;  3VAS A;  3JUL A;  2PKN A;  1BX4 A;  1GQQ A;  2A9Z A;  3PYZ A;  1RKS A;  4JJP A;  4S1I A;  1E8C A;  2AA0 A;  3NL3 A;  5BYC A;  4E3A A;  1EKK A;  2XPC A;  4YWR A;  3RRF A;  3RTG A;  3I3Y A;  3N2A A;  4QF5 A;  4E84 A;  5BYE A;  2A9Y A;  3UQD A;  3RO4 A;  3RS8 A;  2Y67 A;  1GQT A;  3RQ2 A;  4X8F A;  5B6A A;  1YGJ A;  2UUP A;  3DZV A;  3RTB A;  3ZL8 A;  3NM3 A;  3RQX A;  3KZH A;  3RU2 A;  4UAG A;  3RTE A;  3W4S A;  2PKK A;  3LJS A;  4YL5 A;  2FV7 A;  3HPD A;  3NL6 A;  4N08 A;  4HV4 A;  5A5E A;  3RY7 A;  4KAH A;  2YXT A;  3PL2 A;  3CQD A;  1LHP A;  1V19 A;  1VM7 A;  3LHX A;  1LIO A;  1V1S A;  3B1R A;  3NM1 A;  3PZS A;  4KAN A;  1GQY A;  5TQI A;  4XDA A;  4C5K A;  3LKI A;  1FGS A;  2Y1O A;  2AFB A;  2JG1 A;  4KAD A;  3NL2 A;  2HW1 A;  2I5B A;  3RQ8 A;  1DGM A;  3NCA A;  3NC2 A;  3ZM6 A;  2VOR A;  4O1L A;  4E69 A;  4CVL A;  4U7X A;  3RRE A;  3IBQ A;  4O1G A;  2F00 A;  1RFV A;  1UAG A;  2WJP A;  1VI9 A;  3B1O A;  2JGV A;  3K9E A;  3RQ6 A;  2C49 A;  2GCA A;  2WTZ A;  2R3E A;  2JG5 A;  1U2X A;  3GBU A;  3QAI A;  1UA4 A;  4BUC A;  4E8Z A;  5CGA A;  4C12 A;  2AM1 A;  2PKM A;  3HYO A;  3K5W A;  3EAG A;  1P31 A;  3H74 A;  3RQH A;  3KEU A;  1VK4 A;  3H49 A;  2UUO A;  3VAQ A;  4C5N A;  3QA2 A;  4E8Y A;  2HQQ A;  1RK2 A;  4K8T A;  4S1H A;  4B8R A;  3HIC A;  1O5Z A;  4EBU A;  4CVK A;  3DRW A;  4LBX A;  3MBJ A;  4JKS A;  3RTC A;  3RRB A;  2DCN A;  3ZM5 A;  4KAL A;  4LCA A;  3RPH A;  5EYN A;  5CM5 A;  1TYY A;  2YXU A;  1P3D A;  1UB0 A;  3NRS A;  3OTX A;  1W7K A;  1LIK A;  2QHP A;  1KYH A;  2F02 A;  4LC4 A;  3RQ5 A;  2Y66 A;  3ZS7 A;  3RU3 A;  1J6U A;  2AWD A;  3BGK A;  3FHX A;  3RPZ A;  1C3Q A;  4EN4 A;  3Q92 A;  3HJ6 A;  3RT9 A;  2AB8 A;  1V1B A;  4N09 A;  4XF6 A;  3RSS A;  2JFG A;  4EUM A;  1JXI A;  1RFU A;  4K9I A;  3NBV A;  4WJM A;  2C4E A;  3UQ6 A;  1YGK A;  4K93 A;  3RM5 A;  4K8K A;  4K9C A;  4XF7 A;  2VAR A;  3KD6 A;  4ZIY A;  3RSG A;  3N1C A;  3UQE A;  2DDM A;  5A5F A;  5BYD A;  4S1I B;  2ABS A;  2XTB A;  5EY7 A;  4C5L A;  4EOH A;  2GC5 A;  5F0Z A;  3GO6 A;  5BYF A;  3LOO A;  3MBH A;  2AM2 A;  3B3L A;  3GO7 A;  2F7K A;  3NBW A;  4LBG A;  2DDW A;  4C5M A;  1WYE A;  2I6A A;  3KTN A;  4KBE A;  1LII A;  3UBO A;  2X5O A;  1E0D A;  5C40 A;  4UBE A;  3IKH A;  1ESJ A;  1GC5 A;  1L2L A;  1RKA A;  2ABQ A;  2HLZ A;  2QCV A;  3IH0 A;  5TRW A;  3RSQ A;  2Y68 A;  5C3Y A;  3QCZ A;  4XCK A;  2I6B A;  2DDO A;  2GC6 A;  2AX3 A;  1JBV A;  3RTD A;  3LK7 A;  1TD2 A;  3FHY A;  4GM6 A;  1W78 A;  3NC9 A;  3RRJ A;  1ESQ A;  4JKU A;  2V78 A;  4DC3 A;  3RT7 A;  4PVV A;  3Q1Y A;  5CGE A;  2UAG A;  2VOS A;  1RFT A;  1TZ6 A;  5C41 A;  3UAG A;  1JXH A;  2AJP A;  3B1P A;  3IN1 A;  5COJ A;  2JFH A;  1LHR A;  3RSF A;  4C5J A;  5F11 A;  3UMO A;  1GG4 A;  4C13 A;  3NL5 A;  5C3Z A;  2RBC A;  1RKD A; 
#chains in the Genus database with same CATH homology
 3RS9 A;  1TZ3 A;  2R3B A;  4K8C A;  2Q5R A;  3RQQ A;  3B1Q A;  3EWM A;  3UMP A;  3UQ9 A;  1EKQ A;  2AJR A;  1YHJ A;  3IQ0 A;  4B8S A;  2PKF A;  4DU5 A;  4E8W A;  4K8P A;  4S1M A;  3RTA A;  3IE7 A;  1LIJ A;  1V1A A;  2NWH A;  3BF5 A;  3B1N A;  3VAS A;  3JUL A;  2PKN A;  1BX4 A;  2A9Z A;  4S1I A;  4C5N A;  1RKS A;  4JJP A;  5BYC A;  2AA0 A;  3NL3 A;  4E3A A;  1EKK A;  4YWR A;  3RRF A;  3RTG A;  4E84 A;  3I3Y A;  5BYE A;  2A9Y A;  3UQD A;  3RO4 A;  3RS8 A;  1GQT A;  3RQ2 A;  4X8F A;  5B6A A;  1YGJ A;  3RTB A;  3DZV A;  3NM3 A;  3RQX A;  3KZH A;  3RU2 A;  3RTE A;  2PKK A;  3LJS A;  4YL5 A;  2FV7 A;  3HPD A;  3NL6 A;  4N08 A;  3RY7 A;  4KAH A;  2YXT A;  3PL2 A;  3CQD A;  1LHP A;  1V19 A;  1VM7 A;  3LHX A;  1LIO A;  1V1S A;  3B1R A;  3NM1 A;  3PZS A;  4KAN A;  5TQI A;  4XDA A;  4C5K A;  3LKI A;  2AFB A;  2JG1 A;  4KAD A;  3NL2 A;  2HW1 A;  2I5B A;  3RQ8 A;  1DGM A;  3NCA A;  3NC2 A;  4O1L A;  4E69 A;  4U7X A;  3RRE A;  3IBQ A;  4O1G A;  3K9E A;  1RFV A;  3B1O A;  3RQ6 A;  1VI9 A;  3RRB A;  2JGV A;  3W4S A;  5BYD A;  2C49 A;  3QAI A;  2R3E A;  2JG5 A;  1U2X A;  3GBU A;  4E8Z A;  1UA4 A;  5CGA A;  2PKM A;  3HYO A;  3K5W A;  3H74 A;  3RQH A;  3KEU A;  1VK4 A;  3H49 A;  3VAQ A;  4E8Y A;  3QA2 A;  2HQQ A;  1RK2 A;  4K8T A;  4S1H A;  4B8R A;  3HIC A;  4EBU A;  3DRW A;  4LBX A;  3MBJ A;  4JKS A;  3RTC A;  2DCN A;  4KAL A;  4LCA A;  3RPH A;  5EYN A;  5CM5 A;  1TYY A;  2YXU A;  3OTX A;  1UB0 A;  2QHP A;  1LIK A;  1KYH A;  2F02 A;  4LC4 A;  3RQ5 A;  3ZS7 A;  3RU3 A;  2AWD A;  3BGK A;  3FHX A;  3RPZ A;  1C3Q A;  4EN4 A;  3Q92 A;  3HJ6 A;  3RT9 A;  2AB8 A;  1V1B A;  4N09 A;  4XF6 A;  3RSS A;  4EUM A;  1JXI A;  1RFU A;  4K9I A;  3NBV A;  4WJM A;  2C4E A;  3UQ6 A;  1YGK A;  4K93 A;  3RM5 A;  4K8K A;  4K9C A;  4XF7 A;  2VAR A;  3KD6 A;  3UQE A;  3RSG A;  3N1C A;  2DDM A;  4S1I B;  2ABS A;  2XTB A;  5EY7 A;  4C5L A;  4EOH A;  5F0Z A;  3GO6 A;  5BYF A;  3LOO A;  3MBH A;  3B3L A;  3GO7 A;  2F7K A;  3NBW A;  4LBG A;  2DDW A;  4C5M A;  1WYE A;  2I6A A;  3KTN A;  4KBE A;  1LII A;  3UBO A;  5C40 A;  4UBE A;  3IKH A;  2QCV A;  1GC5 A;  1L2L A;  1ESJ A;  1RKA A;  2ABQ A;  2HLZ A;  3IH0 A;  5TRW A;  3RSQ A;  5C3Y A;  4XCK A;  2I6B A;  2DDO A;  2AX3 A;  3RTD A;  3RRJ A;  1TD2 A;  3FHY A;  4GM6 A;  3NC9 A;  1ESQ A;  4JKU A;  2V78 A;  4DC3 A;  3RT7 A;  4PVV A;  3Q1Y A;  5CGE A;  1RFT A;  1TZ6 A;  5C41 A;  1JXH A;  2AJP A;  3B1P A;  3IN1 A;  5COJ A;  3RSF A;  1LHR A;  4C5J A;  5F11 A;  3UMO A;  3NL5 A;  5C3Z A;  2RBC A;  1RKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...