1V1HA

Adenovirus fibre shaft sequence n-terminally fused to the bacteriophage t4 fibritin foldon trimerisation motif with a short linker
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
103
structure length
103
Chain Sequence
VSIKKSSGLNFDNTAIAINAGKGLEFDTNTSESPDINPIKTKIGSGIDYNENGAMITKLGAGLSFDNSGAITIGGSGYIPEAPRDGQAYVRKDGEWVLLSTFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FIBRITIN, FIBER PROTEIN
publication title Adenovirus Fibre Shaft Sequences Fold Into the Native Triple Beta-Spiral Fold When N-Terminally Fused to the Bacteriophage T4 Fibritin Foldon Trimerisation Motif
pubmed doi rcsb
source organism Human adenovirus type 2
molecule tags Adenovirus
total genus 9
structure length 103
sequence length 103
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00608 Adeno_shaft Adenoviral fibre protein (repeat/shaft region)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.20 Mainly Beta Ribbon Laminin reovirus attachment protein sigma1; domain 1 1v1hA01
3.30.60.240 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1v1hA02
1KKEA 1QIUA 2BT8A 1V1IA 2BT7A 2JJLA 3S6XA 2VRSA 4GU3A 4GU4A 2BSFA 1V1HA
chains in the Genus database with same CATH superfamily
2GKVA 2RNLA 1O5DL 2WPIE 5JBAE 1ZAQA 3NTGA 1FJSL 1FF7A 1CVUA 3GOXA 1G2MB 1CT2I 2BOKL 2SGFI 2WCYA 3R5BA 2NU3I 2KB9A 1P0SL 2K2SB 1LMMA 4E1PA 3HS5A 2Y7ZB 2F9BL 1EBVA 2Y80B 2JXDA 2V1CA 1IQEL 1WKXA 1Z6EL 1IVOC 2RC4A 1HZ8A 2Y7XB 1XA6A 2WGCA 1WGCA 4RUTA 3QH0A 2P94L 3MQEA 4OTYA 2EI6B 1HPTA 2W3KB 3TBDA 1SGNI 1X74A 1TURA 1JV2B 1FAQA 3GCWE 2MHPA 1FAKL 3KQBL 1N13A 2ERWA 5EGMB 2N1AB 1NFWB 2FLGA 1XX6A 2E5RA 5IKQA 3R5DA 3LAQA 2VVUL 3N8YA 2FNFX 2VH6B 1CGII 4Y7AB 1YUFA 3QCWA 3HO5A 2J87A 1HJ7A 5JVYA 1MOXC 1PTHA 4JYUL 1P9JA 1DX5I 1PCEA 4UXJA 1IW4A 1DVAL 1XFEA 3UOEA 1ULKA 4ISIL 2YGQA 2G00L 5F1AA 4UXIA 2UVOA 2GKTI 3BJIA 2L7XA 1R79A 1DQBA 5E8DA 2KMQA 1TOTA 3KK6A 5IKVA 1MQ6L 1NZIA 1XKBA 2KL7A 2XBVL 1UHAA 1VDDA 1U5KA 2LEOA 1HDLA 4CUFA 1C5MF 3Q3KB 2W86A 2GD4A 2ROWA 1K7VA 1G2LB 1KBEA 4JYVL 4Y7BB 1CT4I 1KLOA 2BT8A 2PR3B 4OTJA 4TGFA 1BMOA 1BUSA 1ATEA 1GK5A 1NXUA 1IP0A 2WFXB 2P3TA 2SGPI 3QTLD 1J9CL 1TUSA 5L2ZL 1ULMA 2XRCA 5EX3A 2HORA 2DKVA 2PQ8A 4E1RA 2KNIA 1IY6A 1CSOI 2ORWA 4DNCA 4E1GA 4ZAEB 2KV4A 3FFGL 4RRWA 2OVOA 1IQIL 4HGUA 4XBMA 1EQHA 2ORVA 4Z6AL 2A20A 3N8ZA 4NGAL 3ZYIB 2B7DL 7WGAA 2FD6A 1WTJA 4Y76B 4FM5A 3GCXE 1OB1C 2H9EC 1JL9A 2F3CI 2J94B 3TK5B 2OZUA 2JZMA 2QQEA 5DAEA 5J8CA 2DB6A 2NU0I 2AYLA 1PPFI 1XBTA 4FKDA 3HPTA 2RIJA 3OXLA 4ZXXL 1B9WA 1EPIA 1ATBA 1UZJA 1G1TA 1COUA 1UVGA 1LPGA 1K7TA 2P6AC 1FFMA 2WZPP 2GVIA 3UGLA 3ENSA 5HI7A 1TOZA 3V64C 4CSYA 1MJAA 1AUTL 2RA0L 4ZHAB 5JB9E 1HEVA 3PGHA 1LMJA 2XC4L 3NJPC 4X8UL 1CHOI 4MMXB 3S6XA 3SW2A 4CUEA 1EQGA 1Q4GA 3ZYJB 1G1QA 2P3FL 3OXGA 1TPGA 4BTIA 4GU3A 1Y1BA 3TO6A 1FYBA 2BO2A 4A24A 1HT5A 4O02B 1CVWL 4WP4A 1QIUA 2ADXA 2P16L 1PJUA 2XBYL 3KRKA 1CQEA 1SGDI 1SGRI 1IGZA 2OYEP 1IQFL 1LK9A 1H0ZA 1BF9A 2J38B 2W2NE 1MJ9A 4AMLA 3HS7A 1IQHL 1IQKL 2ELIA 3LTGD 2J2UB 3BPSE 1PGEA 2M74A 3BT2A 3LIWB 4JZDL 1G1RA 2W2OE 5KN5C 1APOA 2OYUP 2WG3C 4SGBI 2P95L 1K7UA 3UGDA 2Y82B 3KL6B 3FCSB 1SZBA 2Y5GL 1N7DA 1HAFA 1LR9A 3RU0A 1LPKA 1IJQA 1U67A 1FARA 3OL0A 3R5AA 4BDXA 1M1XB 5IKRA 2N52A 2WPKE 2KMPA 2QQ0A 3TJQA 1FAXL 4Y6DB 1EPJA 1KLIL 2VWNL 4BXWA 1OYVI 2BQ7A 9WGAA 3GISX 3N8YB 3KQEL 1IQGL 1KLJL 2BOXA 1A3PA 2GKRI 2YUUA 3R5CA 2WYGB 3UEJA 4RS0A 2FZZL 3CFWA 2P93L 1NUBA 1TGSI 1V1HA 1ULNA 5IKTA 2BOUA 3LC5B 2JYYA 4PH9A 2BT7A 2WVJA 4Y71B 2YQPA 4RRYA 4X8TL 2V1CC 2VVCK 3F1SB 2W0TA 3U7UG 3IITB 3QMOA 1WGTA 3QWPA 1W7XL 1HCGB 3U73A 2JA1A 1M8CA 2V53A 2WYJB 3LN0A 4GU4A 1IOXA 2WPLE 3DEMA 3Q7DA 2Q1JB 2GIVA 1AN1I 3E59A 3KQDL 2N71A 3HS6A 1HT8A 2BQWA 4BTUA 1Y1CA 4BTTA 4D90A 1V3XB 2NPRA 3POYA 3FBYA 3UGIA 1UZKA 4Y79B 1K36A 4YZUB 5JB8E 2CJIB 3NTBA 2ARPF 1IQLL 1F7EA 1TBOA 1F0RB 4CUDA 2QPOA 1P9ZA 1P9GA 5FUYA 1Y8FA 1N1IA 3MEKA 5COXA 3RR3A 2BZ6L 3OLTA 1S20A 4YT6L 3N8WA 1EPHA 1YU6C 4RRXA 3M37L 4A7IA 3D00A 1DS3I 4O1ZA 2L8EA 1SGPI 3HO4A 4BXSA 2SGQI 3KQCL 2PUQL 1CE3A 1IQNL 2Y38A 5JHWC 2UWPB 1I0UA 4BDWA 1DIYA 1SGQI 1UVFA 3TK6B 2E73A 1OVOA 3VE5A 1MT1A 2VWLL 4XLWA 1W8BL 2MGRA 3OVOA 1KBFA 3HH2C 1CT0I 2FLRL 1YTPA 1EMNA 4ISHL 1K37A 1IQJL 1APQA 2QQCA 1NFUB 2J95B 2P3UA 2NU1I 1KKEA 5EX0A 1UZPA 1WU1B 1XDTR 3QAHA 2P3FN 1M8BA 1KMAA 4A94C 2LB7A 1HJAI 3PDNA 4M10A 5E3QA 4M11A 4X8VL 2LUYA 5E3PA 2BMGA 2OD1A 1MJBA 3CXLA 3LN1A 4MMZB 2UWLB 1UUCA 1F7MA 1JBUL 5CKQA 2BQ6A 5FDQA 3IJEB 1Z2IA 3OXFA 4JCVE 1XKAL 1HRFA 2UZ3A 2KMRA 3HO3A 5CKMA 1EPGA 2BUSA 1L5GB 1EZQB 5CISA 5JBBE 1X4SA 3B4VC 1ATAA 4NA9L 3N8XA 5CCMA 3SOBB 1EGFA 3SGBI 1Z6CA 3CENL 3CA7A 1IQML 5JBCE 3MDLA 3OLUA 1YGCL 2EI8B 2J34B 1NT0A 3E2IA 3H5CB 1DDXA 4C16A 2SGDI 5HQ8A 1KIGL 2B8TA 1CCFA 2VWOL 3M36L 1NFXB 2UWOB 1LPZA 2NU2I 3UFFA 1CX2A 4ZXYL 6COXA 1PTRA 5K0HB 3LTFB 5KIRA 2OU2A 2WPJE 4XL1A 2YGOA 1W3SA 1YUKB 4X8SL 2SGEI 1Q9BA 1LQDA 1UZQA 2W2QE 1L3YA 1RFNB 2ODDA 3EGFA 3VDPA 1IGXA 4NG9L 1CCVA 5E3RA 4GI3C 3TOAA 1WHEA 1FE2A 2P26A 1X7AL 1U8CB 1HX2A 4ZH8B 4JZEL 1TBRR 3SOQA 2XC5L 3LC3B 4COXA 4B6DA 1PFXL 2J4IB 1NPEB 1IOEL 1EAIC 1WHFA 4OVOA 3R05A 4G1MB 2VH0B 2D1JB 4LMFA 4MPIA 1OMUA 2XBXL 2TGFA 2Y5HL 2Y0MA 2NU4I 1URKA 3SEKC 1PXXA 2WG4B 1DS2I 2CWFA 1HREA 4UXHA 2FLBL 3ASIA 1YUGA 2PHBB 1OMTA 3KY9A 1ADXA 1TBNA 2BOHA 4RRZA 2WPHE 2JKHL 1F0SB 2Y5FL 4JZFL 1LR8A 2I9AA 3N8WB 2KCXA 1QFKL 5CCLA 1KSNB 5FUWA 4D0EA 4LORA 3SOVA 2BSFA 3FC3A 1TIHA 2QQDA 5J8FA 2VVVL 5FUVA 1Z7KB 3KCGL 1SGEI 2ENNA 3TGFA 3TOBA 2JJLA 4L9MA 2VRWB 3TZIA 1IY5A 2M5XA 2K2TA 2MGPA 2W26B 2CJSC 1FY7A 1R0RI 2EI7B 2VJ3A 5JVZA 2I9BA 2N17A 2JW6A 2YGPA 3K9XA 1RFHA 3TO7A 1NFYB 1HAEA 2DIPA 4D0FA 2VRSA 3UEYA 2P28B 3C9AC 1FSBA 3CS7L 2CWGA 3ELAL 2XC0L 1SGYI 3NT1A 1CEJA 5JW1A 3FSXA 2VWMK 4YT7L 1TBQR 2W3IB 4AQTA 1EMOA 3F6UL 1PTQA 2ENZA 3VDUA 1NQLB 2B0UC 3TO9A 3V65B 1LR7A 1TLEA 5F19A 1MQ5L 2RHPA 2WFTA 1ATDA 2J9RA 3BT1A 2DDUA 3N8VA 1W4RA 1V1IA 2WPME 3SGQI 2H9EL 2W2PE 2CWHA 1PRHA 5L30L 2X3TA 3ZYGA 2Y81B 2XBWL 4Z0LA 5L2YL 2HOXA 5I46L 1G1SA 2W2ME 1YO8A 4Z0KB 3FSYA 5FUXA 2K9HA 2X52A 3P5BL 1CGJI 3TH3L 4MMYB 5CKNA 2KMOA
chains in the Genus database with same CATH topology
2GKVA 3OXLA 1W3SA 3UGIA 1UVGA 2P6AC 2GVIA 2SGEI 3UGLA 2ODDA 3VDPA 5HI7A 3GOXA 2SGFI 1CT2I 2WCYA 2ARPF 4GI3C 1TBOA 2NU3I 2QPOA 5FUYA 1Y8FA 3MEKA 1TBRR 4E1PA 4B6DA 1CHOI 3S6XA 1YU6C 2JXDA 2V1CA 3D00A 1DS3I 4OVOA 3OXGA 2L8EA 1XA6A 1SGPI 1OMUA 1Y1BA 4GU3A 1FYBA 4A24A 1HPTA 1SGNI 1X74A 2NU4I 1QIUA 1PJUA 1TURA 2SGQI 3SEKC 1SGDI 1SGRI 1FAQA 1DS2I 4UXHA 1N13A 2ERWA 1CE3A 2N1AB 5JHWC 1H0ZA 1OMTA 3KY9A 1SGQI 1TBNA 1UVFA 1XX6A 2E5RA 2E73A 1OVOA 3VE5A 2FNFX 1MT1A 2ELIA 1CGII 3OVOA 1KBFA 4SGBI 3HH2C 1LR8A 2J87A 1CT0I 1YTPA 2KCXA 3UGDA 5CCLA 5FUWA 2BSFA 1PCEA 4UXJA 3FC3A 1TIHA 2QQDA 1IW4A 1LR9A 5FUVA 3RU0A 1Z7KB 2ENNA 1SGEI 2QQCA 1FARA 2JJLA 4L9MA 2VRWB 3OL0A 1IY5A 2M5XA 4UXIA 2NU1I 1KKEA 2N52A 5EX0A 2CJSC 2KMPA 2QQ0A 3TJQA 2GKTI 1R0RI 3BJIA 2L7XA 1R79A 1OYVI 2N17A 2KMQA 1TOTA 1M8BA 1KMAA 2JW6A 1HJAI 3PDNA 2LUYA 1RFHA 2DIPA 1VDDA 2VRSA 2OD1A 2YUUA 3CXLA 2GKRI 3UEYA 1U5KA 2LEOA 1UUCA 1HDLA 3UEJA 3OXFA 4JCVE 2ROWA 2UZ3A 2KMRA 1NUBA 1TGSI 1V1HA 1KBEA 4FKDA 1CT4I 2JYYA 2BT8A 2BUSA 2BT7A 1X4SA 1BMOA 1SGYI 2WVJA 3B4VC 1BUSA 3QTLD 2SGPI 2YQPA 2V1CC 2W0TA 1TBQR 5CCMA 3QWPA 3VDUA 1PTQA 1TUSA 2ENZA 2B0UC 2XRCA 1LR7A 5EX3A 3SGBI 4E1RA 1IY6A 1CSOI 2J9RA 2JA1A 1M8CA 2ORWA 2V53A 1W4RA 1V1IA 3E2IA 2OVOA 3SGQI 4GU4A 4HGUA 2ORVA 2A20A 2SGDI 5HQ8A 2B8TA 2F3CI 2JZMA 2NU2I 2K9HA 2QQEA 1AN1I 5DAEA 3E59A 2DB6A 2N71A 5FUXA 3UFFA 1CGJI 1PTRA 2KMOA 2NU0I 1PPFI 1XBTA 1Y1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KKE A;  1QIU A;  2BT8 A;  1V1I A;  2BT7 A;  2JJL A;  3S6X A;  2VRS A;  4GU3 A;  4GU4 A;  2BSF A;  1V1H A; 
#chains in the Genus database with same CATH topology
 2GKV A;  2RNL A;  1O5D L;  2WPI E;  5JBA E;  1ZAQ A;  3NTG A;  1FJS L;  1FF7 A;  1CVU A;  3GOX A;  1G2M B;  1CT2 I;  2BOK L;  2SGF I;  2WCY A;  3R5B A;  2NU3 I;  2KB9 A;  1P0S L;  2K2S B;  1LMM A;  4E1P A;  3HS5 A;  2Y7Z B;  2F9B L;  1EBV A;  2Y80 B;  2JXD A;  2V1C A;  1IQE L;  1WKX A;  1Z6E L;  1IVO C;  2RC4 A;  1HZ8 A;  2Y7X B;  1XA6 A;  2WGC A;  1WGC A;  4RUT A;  3QH0 A;  2P94 L;  3MQE A;  4OTY A;  2EI6 B;  1HPT A;  2W3K B;  3TBD A;  1SGN I;  1X74 A;  1TUR A;  1JV2 B;  1FAQ A;  3GCW E;  2MHP A;  1FAK L;  3KQB L;  1N13 A;  2ERW A;  5EGM B;  2N1A B;  1NFW B;  2FLG A;  1XX6 A;  2E5R A;  5IKQ A;  3R5D A;  3LAQ A;  2VVU L;  3N8Y A;  2FNF X;  2VH6 B;  1CGI I;  4Y7A B;  1YUF A;  3QCW A;  3HO5 A;  2J87 A;  1HJ7 A;  5JVY A;  1MOX C;  1PTH A;  4JYU L;  1P9J A;  1DX5 I;  1PCE A;  4UXJ A;  1IW4 A;  1DVA L;  1XFE A;  3UOE A;  1ULK A;  4ISI L;  2YGQ A;  2G00 L;  5F1A A;  4UXI A;  2UVO A;  2GKT I;  3BJI A;  2L7X A;  1R79 A;  1DQB A;  5E8D A;  2KMQ A;  1TOT A;  3KK6 A;  5IKV A;  1MQ6 L;  1NZI A;  1XKB A;  2KL7 A;  2XBV L;  1UHA A;  1VDD A;  1U5K A;  2LEO A;  1HDL A;  4CUF A;  1C5M F;  3Q3K B;  2W86 A;  2GD4 A;  2ROW A;  1K7V A;  1G2L B;  1KBE A;  4JYV L;  4Y7B B;  1CT4 I;  1KLO A;  2BT8 A;  2PR3 B;  4OTJ A;  4TGF A;  1BMO A;  1BUS A;  1ATE A;  1GK5 A;  1NXU A;  1IP0 A;  2WFX B;  2P3T A;  2SGP I;  3QTL D;  1J9C L;  1TUS A;  5L2Z L;  1ULM A;  2XRC A;  5EX3 A;  2HOR A;  2DKV A;  2PQ8 A;  4E1R A;  2KNI A;  1IY6 A;  1CSO I;  2ORW A;  4DNC A;  4E1G A;  4ZAE B;  2KV4 A;  3FFG L;  4RRW A;  2OVO A;  1IQI L;  4HGU A;  4XBM A;  1EQH A;  2ORV A;  4Z6A L;  2A20 A;  3N8Z A;  4NGA L;  3ZYI B;  2B7D L;  7WGA A;  2FD6 A;  1WTJ A;  4Y76 B;  4FM5 A;  3GCX E;  1OB1 C;  2H9E C;  1JL9 A;  2F3C I;  2J94 B;  3TK5 B;  2OZU A;  2JZM A;  2QQE A;  5DAE A;  5J8C A;  2DB6 A;  2NU0 I;  2AYL A;  1PPF I;  1XBT A;  4FKD A;  3HPT A;  2RIJ A;  3OXL A;  4ZXX L;  1B9W A;  1EPI A;  1ATB A;  1UZJ A;  1G1T A;  1COU A;  1UVG A;  1LPG A;  1K7T A;  2P6A C;  1FFM A;  2WZP P;  2GVI A;  3UGL A;  3ENS A;  5HI7 A;  1TOZ A;  3V64 C;  4CSY A;  1MJA A;  1AUT L;  2RA0 L;  4ZHA B;  5JB9 E;  1HEV A;  3PGH A;  1LMJ A;  2XC4 L;  3NJP C;  4X8U L;  1CHO I;  4MMX B;  3S6X A;  3SW2 A;  4CUE A;  1EQG A;  1Q4G A;  3ZYJ B;  1G1Q A;  2P3F L;  3OXG A;  1TPG A;  4BTI A;  4GU3 A;  1Y1B A;  3TO6 A;  1FYB A;  2BO2 A;  4A24 A;  1HT5 A;  4O02 B;  1CVW L;  4WP4 A;  1QIU A;  2ADX A;  2P16 L;  1PJU A;  2XBY L;  3KRK A;  1CQE A;  1SGD I;  1SGR I;  1IGZ A;  2OYE P;  1IQF L;  1LK9 A;  1H0Z A;  1BF9 A;  2J38 B;  2W2N E;  1MJ9 A;  4AML A;  3HS7 A;  1IQH L;  1IQK L;  2ELI A;  3LTG D;  2J2U B;  3BPS E;  1PGE A;  2M74 A;  3BT2 A;  3LIW B;  4JZD L;  1G1R A;  2W2O E;  5KN5 C;  1APO A;  2OYU P;  2WG3 C;  4SGB I;  2P95 L;  1K7U A;  3UGD A;  2Y82 B;  3KL6 B;  3FCS B;  1SZB A;  2Y5G L;  1N7D A;  1HAF A;  1LR9 A;  3RU0 A;  1LPK A;  1IJQ A;  1U67 A;  1FAR A;  3OL0 A;  3R5A A;  4BDX A;  1M1X B;  5IKR A;  2N52 A;  2WPK E;  2KMP A;  2QQ0 A;  3TJQ A;  1FAX L;  4Y6D B;  1EPJ A;  1KLI L;  2VWN L;  4BXW A;  1OYV I;  2BQ7 A;  9WGA A;  3GIS X;  3N8Y B;  3KQE L;  1IQG L;  1KLJ L;  2BOX A;  1A3P A;  2GKR I;  2YUU A;  3R5C A;  2WYG B;  3UEJ A;  4RS0 A;  2FZZ L;  3CFW A;  2P93 L;  1NUB A;  1TGS I;  1V1H A;  1ULN A;  5IKT A;  2BOU A;  3LC5 B;  2JYY A;  4PH9 A;  2BT7 A;  2WVJ A;  4Y71 B;  2YQP A;  4RRY A;  4X8T L;  2V1C C;  2VVC K;  3F1S B;  2W0T A;  3U7U G;  3IIT B;  3QMO A;  1WGT A;  3QWP A;  1W7X L;  1HCG B;  3U73 A;  2JA1 A;  1M8C A;  2V53 A;  2WYJ B;  3LN0 A;  4GU4 A;  1IOX A;  2WPL E;  3DEM A;  3Q7D A;  2Q1J B;  2GIV A;  1AN1 I;  3E59 A;  3KQD L;  2N71 A;  3HS6 A;  1HT8 A;  2BQW A;  4BTU A;  1Y1C A;  4BTT A;  4D90 A;  1V3X B;  2NPR A;  3POY A;  3FBY A;  3UGI A;  1UZK A;  4Y79 B;  1K36 A;  4YZU B;  5JB8 E;  2CJI B;  3NTB A;  2ARP F;  1IQL L;  1F7E A;  1TBO A;  1F0R B;  4CUD A;  2QPO A;  1P9Z A;  1P9G A;  5FUY A;  1Y8F A;  1N1I A;  3MEK A;  5COX A;  3RR3 A;  2BZ6 L;  3OLT A;  1S20 A;  4YT6 L;  3N8W A;  1EPH A;  1YU6 C;  4RRX A;  3M37 L;  4A7I A;  3D00 A;  1DS3 I;  4O1Z A;  2L8E A;  1SGP I;  3HO4 A;  4BXS A;  2SGQ I;  3KQC L;  2PUQ L;  1CE3 A;  1IQN L;  2Y38 A;  5JHW C;  2UWP B;  1I0U A;  4BDW A;  1DIY A;  1SGQ I;  1UVF A;  3TK6 B;  2E73 A;  1OVO A;  3VE5 A;  1MT1 A;  2VWL L;  4XLW A;  1W8B L;  2MGR A;  3OVO A;  1KBF A;  3HH2 C;  1CT0 I;  2FLR L;  1YTP A;  1EMN A;  4ISH L;  1K37 A;  1IQJ L;  1APQ A;  2QQC A;  1NFU B;  2J95 B;  2P3U A;  2NU1 I;  1KKE A;  5EX0 A;  1UZP A;  1WU1 B;  1XDT R;  3QAH A;  2P3F N;  1M8B A;  1KMA A;  4A94 C;  2LB7 A;  1HJA I;  3PDN A;  4M10 A;  5E3Q A;  4M11 A;  4X8V L;  2LUY A;  5E3P A;  2BMG A;  2OD1 A;  1MJB A;  3CXL A;  3LN1 A;  4MMZ B;  2UWL B;  1UUC A;  1F7M A;  1JBU L;  5CKQ A;  2BQ6 A;  5FDQ A;  3IJE B;  1Z2I A;  3OXF A;  4JCV E;  1XKA L;  1HRF A;  2UZ3 A;  2KMR A;  3HO3 A;  5CKM A;  1EPG A;  2BUS A;  1L5G B;  1EZQ B;  5CIS A;  5JBB E;  1X4S A;  3B4V C;  1ATA A;  4NA9 L;  3N8X A;  5CCM A;  3SOB B;  1EGF A;  3SGB I;  1Z6C A;  3CEN L;  3CA7 A;  1IQM L;  5JBC E;  3MDL A;  3OLU A;  1YGC L;  2EI8 B;  2J34 B;  1NT0 A;  3E2I A;  3H5C B;  1DDX A;  4C16 A;  2SGD I;  5HQ8 A;  1KIG L;  2B8T A;  1CCF A;  2VWO L;  3M36 L;  1NFX B;  2UWO B;  1LPZ A;  2NU2 I;  3UFF A;  1CX2 A;  4ZXY L;  6COX A;  1PTR A;  5K0H B;  3LTF B;  5KIR A;  2OU2 A;  2WPJ E;  4XL1 A;  2YGO A;  1W3S A;  1YUK B;  4X8S L;  2SGE I;  1Q9B A;  1LQD A;  1UZQ A;  2W2Q E;  1L3Y A;  1RFN B;  2ODD A;  3EGF A;  3VDP A;  1IGX A;  4NG9 L;  1CCV A;  5E3R A;  4GI3 C;  3TOA A;  1WHE A;  1FE2 A;  2P26 A;  1X7A L;  1U8C B;  1HX2 A;  4ZH8 B;  4JZE L;  1TBR R;  3SOQ A;  2XC5 L;  3LC3 B;  4COX A;  4B6D A;  1PFX L;  2J4I B;  1NPE B;  1IOE L;  1EAI C;  1WHF A;  4OVO A;  3R05 A;  4G1M B;  2VH0 B;  2D1J B;  4LMF A;  4MPI A;  1OMU A;  2XBX L;  2TGF A;  2Y5H L;  2Y0M A;  2NU4 I;  1URK A;  3SEK C;  1PXX A;  2WG4 B;  1DS2 I;  2CWF A;  1HRE A;  4UXH A;  2FLB L;  3ASI A;  1YUG A;  2PHB B;  1OMT A;  3KY9 A;  1ADX A;  1TBN A;  2BOH A;  4RRZ A;  2WPH E;  2JKH L;  1F0S B;  2Y5F L;  4JZF L;  1LR8 A;  2I9A A;  3N8W B;  2KCX A;  1QFK L;  5CCL A;  1KSN B;  5FUW A;  4D0E A;  4LOR A;  3SOV A;  2BSF A;  3FC3 A;  1TIH A;  2QQD A;  5J8F A;  2VVV L;  5FUV A;  1Z7K B;  3KCG L;  1SGE I;  2ENN A;  3TGF A;  3TOB A;  2JJL A;  4L9M A;  2VRW B;  3TZI A;  1IY5 A;  2M5X A;  2K2T A;  2MGP A;  2W26 B;  2CJS C;  1FY7 A;  1R0R I;  2EI7 B;  2VJ3 A;  5JVZ A;  2I9B A;  2N17 A;  2JW6 A;  2YGP A;  3K9X A;  1RFH A;  3TO7 A;  1NFY B;  1HAE A;  2DIP A;  4D0F A;  2VRS A;  3UEY A;  2P28 B;  3C9A C;  1FSB A;  3CS7 L;  2CWG A;  3ELA L;  2XC0 L;  1SGY I;  3NT1 A;  1CEJ A;  5JW1 A;  3FSX A;  2VWM K;  4YT7 L;  1TBQ R;  2W3I B;  4AQT A;  1EMO A;  3F6U L;  1PTQ A;  2ENZ A;  3VDU A;  1NQL B;  2B0U C;  3TO9 A;  3V65 B;  1LR7 A;  1TLE A;  5F19 A;  1MQ5 L;  2RHP A;  2WFT A;  1ATD A;  2J9R A;  3BT1 A;  2DDU A;  3N8V A;  1W4R A;  1V1I A;  2WPM E;  3SGQ I;  2H9E L;  2W2P E;  2CWH A;  1PRH A;  5L30 L;  2X3T A;  3ZYG A;  2Y81 B;  2XBW L;  4Z0L A;  5L2Y L;  2HOX A;  5I46 L;  1G1S A;  2W2M E;  1YO8 A;  4Z0K B;  3FSY A;  5FUX A;  2K9H A;  2X52 A;  3P5B L;  1CGJ I;  3TH3 L;  4MMY B;  5CKN A;  2KMO A; 
#chains in the Genus database with same CATH homology
 2GKV A;  3OXL A;  1W3S A;  3UGI A;  1UVG A;  2P6A C;  2GVI A;  2SGE I;  3UGL A;  2ODD A;  3VDP A;  5HI7 A;  3GOX A;  2SGF I;  1CT2 I;  2WCY A;  2ARP F;  4GI3 C;  1TBO A;  2NU3 I;  2QPO A;  5FUY A;  1Y8F A;  3MEK A;  1TBR R;  4E1P A;  4B6D A;  1CHO I;  3S6X A;  1YU6 C;  2JXD A;  2V1C A;  3D00 A;  1DS3 I;  4OVO A;  3OXG A;  2L8E A;  1XA6 A;  1SGP I;  1OMU A;  1Y1B A;  4GU3 A;  1FYB A;  4A24 A;  1HPT A;  1SGN I;  1X74 A;  2NU4 I;  1QIU A;  1PJU A;  1TUR A;  2SGQ I;  3SEK C;  1SGD I;  1SGR I;  1FAQ A;  1DS2 I;  4UXH A;  1N13 A;  2ERW A;  1CE3 A;  2N1A B;  5JHW C;  1H0Z A;  1OMT A;  3KY9 A;  1SGQ I;  1TBN A;  1UVF A;  1XX6 A;  2E5R A;  2E73 A;  1OVO A;  3VE5 A;  2FNF X;  1MT1 A;  2ELI A;  1CGI I;  3OVO A;  1KBF A;  4SGB I;  3HH2 C;  1LR8 A;  2J87 A;  1CT0 I;  1YTP A;  2KCX A;  3UGD A;  5CCL A;  5FUW A;  2BSF A;  1PCE A;  4UXJ A;  3FC3 A;  1TIH A;  2QQD A;  1IW4 A;  1LR9 A;  5FUV A;  3RU0 A;  1Z7K B;  2ENN A;  1SGE I;  2QQC A;  1FAR A;  2JJL A;  4L9M A;  2VRW B;  3OL0 A;  1IY5 A;  2M5X A;  4UXI A;  2NU1 I;  1KKE A;  2N52 A;  5EX0 A;  2CJS C;  2KMP A;  2QQ0 A;  3TJQ A;  2GKT I;  1R0R I;  3BJI A;  2L7X A;  1R79 A;  1OYV I;  2N17 A;  2KMQ A;  1TOT A;  1M8B A;  1KMA A;  2JW6 A;  1HJA I;  3PDN A;  2LUY A;  1RFH A;  2DIP A;  1VDD A;  2VRS A;  2OD1 A;  2YUU A;  3CXL A;  2GKR I;  3UEY A;  1U5K A;  2LEO A;  1UUC A;  1HDL A;  3UEJ A;  3OXF A;  4JCV E;  2ROW A;  2UZ3 A;  2KMR A;  1NUB A;  1TGS I;  1V1H A;  1KBE A;  4FKD A;  1CT4 I;  2JYY A;  2BT8 A;  2BUS A;  2BT7 A;  1X4S A;  1BMO A;  1SGY I;  2WVJ A;  3B4V C;  1BUS A;  3QTL D;  2SGP I;  2YQP A;  2V1C C;  2W0T A;  1TBQ R;  5CCM A;  3QWP A;  3VDU A;  1PTQ A;  1TUS A;  2ENZ A;  2B0U C;  2XRC A;  1LR7 A;  5EX3 A;  3SGB I;  4E1R A;  1IY6 A;  1CSO I;  2J9R A;  2JA1 A;  1M8C A;  2ORW A;  2V53 A;  1W4R A;  1V1I A;  3E2I A;  2OVO A;  3SGQ I;  4GU4 A;  4HGU A;  2ORV A;  2A20 A;  2SGD I;  5HQ8 A;  2B8T A;  2F3C I;  2JZM A;  2NU2 I;  2K9H A;  2QQE A;  1AN1 I;  5DAE A;  3E59 A;  2DB6 A;  2N71 A;  5FUX A;  3UFF A;  1CGJ I;  1PTR A;  2KMO A;  2NU0 I;  1PPF I;  1XBT A;  1Y1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...