1V1OA

Staphylococcal superantigen-like protein 7
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
196
structure length
196
Chain Sequence
RVQHLHDIRDLHRYYSSESFEYSNVSGKVENYNGSNVVRFNPKDQNHQLFLLGKDKEQYKEGLQGQNVFVVQELIDPNGRLSTVGGVTKKNNKTSETNTPLFVNKVNGEDLDASIDSFLIQKEEISLKELDFKIRQQLVNNYGLYKGTSKYGKIIINLKDENKVEIDLGDKLQFERMGDVLNSKDIRGISVTINQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Relationships and Cellular Tropism of Staphylococcal Superantigen-Like Proteins
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Virulence factor
molecule keywords EXOTOXIN 1
total genus 53
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1v1oA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1v1oA01
1CQVA 1CT1D 1CHQD 2IJ0A 1LT3D 1D5XC 4UDUC 1AN8A 2RDGA 2ICIA 1PZJD 4RHSA 1LTTD 1SXTA 1I4PA 1FNVA 1XTCD 1LO5D 1PRTD 1TS4A 1TS2A 1DYQA 3BZDB 4RCOA 1V1PB 1PTOD 1TY0A 1SE2A 3BVGA 1EWCA 1V1OA 1S5FD 1BCPF 2XRQD 5D3IB 1RCVD 1UNSA 4NZLB 1BXTA 1QILA 1ENFA 1FNWA 1PZKD 1TY2A 1PTOH 3GP7A 1HXYD 1AW7A 2TSSA 1FD7D 2CHBD 1G8ZD 2IPKD 4RH6A 3DWPA 4K6LA 1JQYD 1T5XD 1STEA 2Z8LA 3V05A 1CK1A 1KLUD 1PYWD 1UUPA 1LTSD 1V1PA 3CHBD 1S5BD 1EEID 1S5DD 1HA5A 1EFID 5ELCA 1PZID 1S5CD 1YN4A 1PTOB 3EFXD 1LTBD 1I4RA 3BYYB 1SE3A 2J4XA 1ET6A 1JR0D 3KLSX 1RDPD 1SE4A 5FKAC 1FNUA 4RFBA 3BVMA 5TSSA 1BCPC 3R2TA 3MC0B 1JWSD 1XXGA 1HQRD 1PTOC 2AQ1B 1KTKA 2NTSA 1TS5A 1I4QA 5ELFA 3R8BA 1JWUD 3DWQA 1BCPD 1L0XB 2QEJC 5ELEA 1LLRD 4O1NA 1LT5D 1S5ED 1LTGD 1B1ZA 1SEBD 3R2IA 3BYTB 5ELDA 5D3DA 2WV6D 1DJRD 4RGNA 4DXGA 2XN9C 2O2LD 1ESFA 2G9HD 3URYA 5I4DA 1MD2D 5FK9C 3O13A 4RGOS 1FGBD 1PRTC 2QILA 1TS3A 2AQ3B 3SEBA 1BCPB 4RHRA 1M4VA 1B44D 4C56C 3EA6A 4Z9CB 5ELBA 1HTLD 4OHJA 3TSSA 2R61A 1YN5A 1RF2D 1EU4A 2SEBD 1PTOF 4L6TB 1LTAD 1SJED 2AQ2B 3MFGA 1LT6D 1YN3A 3DWAA 1EEFD 1SJHD 1F77A 1L0YB 1I4GA 1LTID 1CHPD 2NTTA 4BWGB 1I4HA 1RD9D 1ET9A 4ZYSA 3W2DA 1PRTB 1KLGD 3OWEB 4L63B 1GOZA 1D5ZC 4RGTA 2XRSD 1PRTF 1LT4D 1D6EC 4TSSA 1SBBB 1JCKB 3BVZA 2XNAC 4DXFA 1JWMD 2RDHA 1I4XA 1D5MC 1EU3A 4RGMA 1LTRD
chains in the Genus database with same CATH superfamily
4NPNA 1WWTA 4DR2L 2BVCA 1W6KA 4YXDB 4RHSA 3CF6E 2IGGA 4PT5A 2LJIA 1TKYA 2NBWB 4XWTA 3GTLH 2QEXA 2KDMA 5IYDG 4B9XA 1WGDA 1XLOA 4B9WA 3BJUA 2EDGA 4A9AA 2XWJB 2EY5A 3GTOB 3ONAB 5GXGB 5K5PA 1EYGA 3HOVB 4K5VA 1EWCA 3J7AF 1RM6C 5D3IB 3ULLA 4S3SA 3WDNA 3Q24A 1S40A 2B63B 1JWAD 1YJIA 1LYLA 4A3EG 2FBWB 4GDKB 4KKIA 4J8QA 3CCEA 2P5ZX 3PLUA 1QWYA 4ZHPA 3A54A 5DM73 4E74A 1G8ZD 3ZXRA 1L1OC 5CMDA 5JEAG 3NK9A 3AV8A 4A55A 4ODGA 1HZ9A 2HTME 3GTGH 4LF4L 2FUG1 4C3HH 4A3FG 4GDLA 3PHXB 1TWFB 3KW5B 4JLCA 2F0KA 4MNOA 4EQNA 3GV6A 4DV7L 5FO9B 2RDBC 3V62A 2LSSA 1V6EA 4WJ4A 4X3SA 4G0NB 2MWSB 3AEGB 3RN2A 1WFQA 4NP5A 5EJWA 4LF5L 1R4MI 3WOFA 3K0XA 1WE7A 4C4VA 1F0ZA 5BMIA 3DBRI 4LDTB 1C1YB 3OSOA 3PUYA 2PQAA 5E6NA 1ZGUB 5D14A 2L15A 1F2RI 3OMGA 4MN3A 3PLVA 2N78A 4DUYQ 1Q0WB 4HEDA 3I57A 3MC8A 3RN9C 2MO0A 3IFWB 3FILB 2V1CC 2NMQA 2KENA 3D8GA 1UWMA 4F7ZA 1IBXB 2B63G 2KWVB 3OHXC 2WXPA 3X3MA 4B6WA 3MWYW 3TP5A 1STBA 4POFA 3R7QA 4IFDG 2LKVA 3KH0A 3DBHB 4HDQA 1PH1A 2EMSA 5LXIB 2IGDA 2LGYA 5G2NA 2L1BA 3HRZC 4CJ2C 1GG3A 2ZZPB 4QIWB 2KN5A 2EYMA 2CW0D 4N9F4 3ZRCA 4DNTB 2EJFC 4RGNA 4DXGA 4HIMA 3PO2G 1E8YA 2WXJA 2WXRA 2KJ6A 2AL6A 3Q3OC 4F7XA 4JV5L 5KHQA 5CX3A 3BDCA 2L11A 4OWWB 2A8VA 3ZO5B 5AFWA 5LNK1 1KRSA 2ACZB 2LHDA 2K6AA 4I7ZC 3I4OA 3OPOA 4ABNA 2MBHA 4Q2JA 1B70B 4B3TL 1X56A 2AQ3B 2Q8IB 5FLXL 2NVQH 1VDZA 5DPTA 1D1IA 3EA6A 1XMOL 1DD2A 3U8ZA 2B2TC 4NW2A 4ANWA 2V3PA 2CCZA 1RFAA 3OWFA 3TDQA 2BW2A 2Z6KA 1EFWA 1PTOF 4M00A 1MG8A 1SYGA 1SJED 1QNUA 3M4YA 4MZ9A 4DR3L 3ETRA 4HEA1 4ZOHC 5G55A 3CU7A 3U52E 5CHFA 3IVFA 1WTOA 2L55A 2BWFA 2VQEL 2MCNB 1JC7A 1EO6A 2K5HA 2O6VD 1Q8IA 4NAWA 3NXWA 3NVVA 3DPDA 1VMPA 3A55A 3AQQA 1TT5B 2D10A 1N33Q 1I5FA 5HKHA 1SMYD 1XD3B 2IHFA 4FA6A 1PRTF 4LF4Q 4JYAL 1TZOA 1BBUA 3AEEB 5CHWA 1X3PA 3Q22A 2N7DA 1CM9A 1UEAB 5CGKA 1E7PB 3HVDA 3I63C 4YL8A 1BKBA 5FJ8H 2C7NB 1VCBA 3HOXH 2PJHA 1B3QA 3SHQA 1GUNA 1LT3D 4KHPQ 3BK2A 4P75A 3KDFA 1C78A 3N1YC 2ZT9C 1I4PA 3CRLC 3VYRA 4OELB 3H7SA 1XLPA 5EPJA 4HDOA 3H09A 1OXSC 3AE8B 4JPSA 2A1AA 5I9PA 1PH7A 3CD6A 1A15A 3EFUA 3NSWA 2VNUD 3AEBB 4WWOA 3H0GB 1KNEA 4X62Q 1GM5A 3G71A 1V1OA 2DY7A 2WLBA 3TQYA 3MXUA 1YOVB 2JXXA 1QILA 2Y3AA 3GTPH 1FXIA 3DBSA 1NVID 2MBQA 4ME3A 4ALPA 2CHBD 2F3WA 4HIDA 5C5LA 3T1YL 3DWPA 2D11A 3ONSA 1T5XD 3HOUB 3RD4A 3I3CA 4TKNA 4WJWA 4CDEC 1TWGB 4OZAA 4JVZA 1WRIA 5AUKA 1A5RA 1V1PA 3B1LX 4MGKE 1YIWA 5LL6S 5JAVA 1GJZA 1B3AA 1UEBA 2L83A 3KLSA 3C19A 1VQMA 1PTOB 1OTCA 3A8IE 3PF4A 1LTBD 3DWMA 2M0XA 1C9FA 3T53B 4ASWC 3TZDA 1PYSB 2BKFA 4X65Q 1JALA 1TKGA 4TVAB 3WANA 4IUPA 4WQMA 2IL8A 1I94L 2PW7A 1LM8B 1PTOC 3QC8B 2OT2A 1WTPA 5GQOA 2ZW1A 1E1OA 3M85A 1VQ9A 4DR5Q 3DWQA 4LF8Q 4FBJB 4GN5A 3S1MB 2ES2A 3KF6B 3EVQA 3T1HQ 1ML0D 3T3NA 2D5GA 1C0AA 5JVG3 4JI8Q 2GBNA 1N32L 4A93B 2JZZA 5ELDA 5D3DA 1VQOA 2FMMA 4FF1A 1E7UA 2WDQB 3PRPB 1VQBA 3I4MG 4JE3B 1PH6A 2IY0B 1EZ6A 1IKLA 5EGTA 2G9DA 1JB7A 2FCNA 3Q69A 5JJLA 5I9OA 1WMHB 2WNMA 4GIVA 1TQOA 3AYHB 4JI1Q 2XK5A 5D6JB 4WWNA 1B44D 2N7EA 4G4KA 4GN1A 2A74C 3Q0AA 3TMPB 2RA4A 3JC66 4BBSB 4QF4A 3KLWA 3K5LA 1YJNA 2XK5B 3W1YA 1UWVA 2CFMA 2RBMA 1B2TA 3L13A 4HK2A 5HURA 1SJHD 1V1QA 4LFAQ 2MJEA 1S1QB 3KUZA 4QL5A 1WJUA 2NZ1D 4IPDA 1ISNA 1WR6E 4A3JB 4GSWA 5IWAQ 3ZJTA 2AKWB 2OTLA 1EF1A 3A9KB 3ZNID 4G7ZC 5IT9L 2RKSA 3VR2A 2O4XA 1U0LA 2QCPX 2JA8B 1HHVA 3NWTA 2K3UA 2KWCA 3VYSA 2AWNA 2XRSD 3A5ZB 3M7GA 3CC4A 3W1SC 5IYBH 1KD1C 2FCMA 3KF6A 1V43A 2DZJA 1CTMA 1LXDA 1OXXK 4RGMA 1LTRD 3TBIB 4DV2Q 5LMNL 2IGHA 4G11A 1BT0A 1PGXA 2L8JA 1I6HH 1E90A 5I2YA 4UY8C 1EUJA 3M3YB 2PMZB 2DGYA 4BBSG 4GLVB 2NVXB 2DHZA 3U7DA 1XCTL 2L52A 2NCNA 5E6OA 1BUVT 1MJEA 3BZCA 5M5WH 2KN4A 2PTLA 2X6GA 4HKZE 4XWWA 2BOSA 2LHEA 4RKLA 2R93H 4A3JG 4IUNA 2XBBC 4IKGA 2R7DA 2N9PC 1TY2A 3RZWC 2JA8G 1QLBB 1KDAA 3X0WA 3CMAA 1TWCB 2LGSA 2B8GA 3HHMA 1R9TB 1SB3C 4BBNF 2K52A 2EXDA 2SOBA 2JA6H 4HJKA 3NELA 2OXPA 2A69C 4GLAC 2FUHB 2F0OA 5ELCA 1XNRQ 4DV3L 3AI5A 1HNZL 2WACA 4A3IH 1I4RA 1XQQA 5L37A 4PS7A 2QSDA 1BMLC 1AYFA 1JOOA 3QB3A 5C44G 4JI4Q 4AP4C 3KUDB 4I7AA 5M5XB 1XXGA 4MGIE 3RNUA 1Z9FA 5EPKA 4CHTB 1Q1OA 4BZAA 5LL6X 3LX0A 2FMCA 4X3KA 2UXDL 1JE5A 1DOMA 5ELEA 4GOCA 1JT8A 2Z0EB 4KGTA 3WAOA 3UDGA 2Z9HA 1LT5D 2V3NA 2NBFA 3APFA 3FC4A 2KOXA 1A0IA 4BBRG 3C2PA 1YJ9A 4NKLA 2AWOA 2RF4A 4QGUA 1PHJA 2DAFA 3QCAA 4ZRIA 2GB1A 3FEWX 4K1RB 3K8AA 1HE8A 5GAHC 1PMRA 2LXAA 3H3VI 4APVA 1KQSA 2M56B 2UUCL 3DVNV 4HJ9A 3H6NA 2VL6A 1FGBD 2N55A 2EVBA 3M4QA 4BFRA 4KVGB 1NR4A 5BO4B 3K6OA 5C44B 3PPAA 1ACCA 1TWAH 2UU9Q 2K14A 3OTOL 2DZKA 2E6XA 3J9CA 4P1BC 5FLXE 3GTJH 2E2IB 5CBAE 3C1FA 1CA5A 3RLFA 4M8MA 2HQLA 1MSGA 5FLMH 4EEWA 1RF2D 3HM6X 3RZOH 3Q8EA 5J17A 3AU5A 1SYEA 4IDIA 4LMQD 2Q5WD 2R2QA 4K5WA 1KF6B 2I07B 3CSFA 2B2VA 4K6DA 2CWAA 3R7RA 1WY8A 1Y56A 2BYEA 5IP4D 1I4HA 1Q1EA 2LS01 1IBML 1JORA 2PYKA 1C4QA 3U58A 1J5EL 5JOBA 3H3VC 4KZ0A 1IBXA 2K04A 3RCZA 1QZEA 3PZDA 2LRWA 3FKIG 2N8NA 2WDVB 3A0JA 4P6VF 1C8CA 3ND9A 4GOPC 3DQVA 4I6PA 1A3UA 2KK8A 2KQ7A 1ZEQX 1CT1D 5I6WA 5LMNW 4L23A 5JPMC 4JOIA 4DV0Q 3M4OH 1EY8A 1SFOB 1LQBA 1I50H 3ABVB 3A9JA 2KECA 3IXSA 1WX9A 1XTCD 4LJOB 4US9A 3K9PB 3KUPA 1QCBD 1CFMA 3D6CA 1C79A 2R2OA 2JA5H 2QKIC 1DYQA 2E2HB 1F2MA 1Y1WH 1FIQA 2KACA 3MJ5A 3CAMA 4MH0E 4JI2Q 2XRQD 4DAVA 4KJNA 2FIDA 2PW9A 4LTUA 4JV5Q 4WURA 1ILPA 4A3KB 2MLBA 2DNEA 2A4ZA 3ZRFA 4DR6L 4M8AA 1JRPA 1PFMA 4J3OD 3A56A 4CHKA 2IPKD 1O80A 5I6YA 1AWDA 3FKIB 1QT9A 2A69D 2Z6BA 2N1WA 3B9JA 3LB8C 3RT3B 3FVQA 3RNEC 1STEA 4HKQA 4II3B 1KLUD 4X66L 2WAQG 2IX1A 4I6NB 2LJ5A 1SSNA 4N8FA 1WX8A 3FKIH 1XLQA 3PO3B 1WZ0A 5C4HA 2K8BA 1E6EB 3MHSD 4FJVB 3X3NA 4GDKA 2LVQA 3W9CB 2YTVA 1WTRA 4B08A 1EYCA 4LW1A 2CR5A 4LNKA 4YTMB 1PFNA 3UDFA 3KJOA 1B50A 3KYDD 1QNKA 1Y14B 2IWHA 1KRHA 2BKRB 3KLSX 3GZNI 4LDTD 4A8XC 2V0GA 4Y7NH 1XMQL 3MEHA 1WR1A 4JBJA 1H9KA 5A35A 1Y1WB 2O5IC 1A6XA 1LUZA 2YEPB 4J6IA 3TEYA 2KFJA 5BMGA 2J0MA 2XWBB 3PT2B 4REZA 2WQYB 1VQGA 2QW7A 1YIJA 1L1OA 2BF8B 2PCFB 5DAUA 5C3JB 1H9SB 2EOTA 3IT6B 1BDOA 3SXHA 1SFOH 2KVRA 3M4OB 1I3QH 3CP0A 2BQQA 3QJYA 4O1NA 4HAEA 1B9MA 4CGYB 2UUBL 3SD5A 2A6HC 2CH4W 1SEBD 2IX0A 4B3MQ 1F1HA 1HTOA 4UP9A 1D1KA 4HVBA 2KBNA 4URKA 4OL7A 3VYTA 2D3CA 5J39A 5GMVA 2IZVB 4PQXA 5EAYA 4JPBW 3MHZA 3NVWA 4H13C 2LUEA 3ZW3A 3TJPA 1PRTC 1TR5A 2M17A 1Q3LA 3VDYA 4IPGA 4GKJL 1K3RA 4A3DG 3M7NA 3OAWA 5IIFA 3QOJA 2Z0SA 4DDID 5DNFA 1C3TA 3UE1A 1H8CA 1VQFA 2R61A 3RZOB 3I2ZA 1NMFA 1VJKA 3TEWA 4MTNA 1SE9A 3CIRB 3SK8A 1VQJA 4RF0A 5CC4A 3GTJB 4QIWE 4NJ7A 4PK1A 3NWSA 3LYYA 3HOVG 1TWAB 1L0YB 2Y5PA 3G4SA 5C44H 3RUIB 4DR1Q 3QAQA 4HIKA 4DR6Q 4KY7A 1RD9D 2HDLA 4A3MG 1KLGD 4W9GA 2KCMA 5KYIA 2GOWA 2LGIA 1D5ZC 4OIJA 4GGQA 4A3LG 3ZJVA 4C3IG 1Y8OB 2EY2A 3W5VB 3S15H 2JA6G 1K73C 5LMUL 4KV6A 4RM8A 2E5LQ 3D4WA 1VDVA 1TWHB 5HY6A 1XEEA 3N52A 2JVCA 3H7PA 5JJZA 1XO3A 1ZOYB 1GUWA 1EIHA 3GTQB 4IWOA 1HZBA 2UXCL 3K58A 1ESRA 5KIXA 4X6AH 1WF9A 3SU8X 1AN8A 1VQIA 4PYZA 5IAAC 1X3EA 3ZJYC 4I65A 5M9OA 2INCC 2JYTA 1L5PA 3MTSA 3OLMD 1LO5D 2MW5A 2M2LA 2W3SA 3WALA 2C60A 1P9DU 1N32Q 1E8WA 5CHVC 4HMIA 1PDQA 3H6MA 3J7ZC 5IE8A 3W1GA 1A70A 4XTCS 3RNGC 2KA7A 1DGJA 3A74A 1J8IA 4OO1G 4OWXB 5HFYA 1E5WA 4BKSA 4CDDC 1N5XA 3A8JE 2JA6B 1EM7A 1WI0A 2ATWA 3AU7A 4PG3A 1OO9B 3NPPA 3NVZA 1UUPA 4IFDI 2MH7A 4OIKA 5CORA 3A1QA 3UF8A 4ZRJA 1HA5A 4QJFA 1VQPA 3IL8A 3J7AV 2Q8TA 1WGHA 1G6ZA 5D7GA 3ML9A 4KKTA 1NDDA 3BYYB 2MA9B 4NJ6A 2IYDB 3DOWA 1QF6A 1DGSA 3E9HA 3HKZG 4BY1G 1NUCA 2KFKA 3VRAB 4G7HC 2K5QA 4KKUA 5M5WB 1XPUA 1VR9A 4F87A 4GNXA 1R4QB 4B3SQ 1X55A 4DR2Q 1UD7A 2A68C 3FDTA 3N1ZC 1IHZA 3NP8A 3IFDA 1TS5A 2F0MA 3AE3B 1JWUD 3GO5A 2DJFC 3F2UA 3KK7A 4ILWA 4U68A 2VQEQ 4AYBE 4YT0B 4ZLTF 3PS6A 1KABA 3KWLA 1V81A 2WIIB 4QQBX 1GHJA 1VQ8A 2QMTA 2WXQA 3A7LA 3M62B 2IW3A 2FIFA 2W82A 4ZUIA 2OCEA 2XN9C 4ITKA 1GD7A 4Y7NB 3AXCA 4H7BA 3URYA 4BS9A 1CQFA 3AFPA 3CCVA 1TJEA 3J80E 2O6VB 4LF7Q 5M3FH 3A4SC 1H9SA 3KLRA 5J1ZA 1PYBA 2REXA 2M0AA 3NY5A 4KGRA 2EXZA 4W9LA 3HOWG 1ENAA 3HKZB 1GC7A 1MHXA 3CWIA 3HUIA 4C56C 1YI2A 4TV3A 1EY5A 3T13A 4ANVA 2WB1B 5I2XA 2WXLA 2Q2TA 5M3MG 1M90C 1GB4A 1YN5A 2M1MA 2F0DA 2KJXA 4DK3C 4DV1Q 4AQYQ 1AP0A 2BWES 2I1KA 5JZEB 3A8KE 2EYFA 5CV4A 4BBSH 4DHJB 4DR7Q 1V80A 1LT6D 2EYPA 1WJ6A 3H0GG 4FP5D 4FVMA 2V4IB 3DHGC 1C9OA 2RDFA 2HTHA 2Z1CA 2MHJA 3NRZA 5C0XJ 2GMIC 1Q90A 2K6QA 1YJWA 2WXHA 1O7YA 3AB5A 1WVLA 2I5MX 4FF3A 1IYFA 2D0OA 2GI9A 2JA5B 1LT4D 2KC1A 2R6GA 3J81i 3P4PB 2N9LA 5FO7B 3PZ7A 1N34Q 2LRUA 4XQJA 2MJDA 2KHIA 1WTVA 1NI2A 1RRBA 1WXQA 5KRUA 2MBEA 1E7VA 1STGA 1YNJD 4L5QA 4A3PA 4EVOA 4O2DA 2BE5D 4LFCL 1L0VB 2L3ZA 2DZMA 2LXCA 1QOGA 1C7YA 2B2WA 2KQSA 2NBVB 3MXGA 3P20A 3RNBC 3ZDMC 1E24A 4II2B 2V4DA 4B3TQ 4A3OA 4TKOB 5L95C 1N6ZA 1PTOD 5IO9A 2ZPNA 1XMOQ 5ELOA 2LWPA 3BY4B 3IBEA 1KDCA 1PVOA 4PS8A 4FXCA 1UE7A 1FNWA 2QJLA 3VHTC 1PTOH 4JQWC 4KV2A 1Q81C 1IBLQ 2K0PA 2LEKA 4DU9A 3AE2B 1VQNA 3EN2A 1SROA 1CA6A 2JXMB 3R66C 1D3ZA 2AMCB 4B95A 3VVWB 1WX7A 1Z2MA 3J80i 3I4MB 3H91A 3CHBD 5G5HA 4D2KA 4X3UA 1EFID 3VUWA 3ZUNA 1WXVA 1N33L 1YN4A 4FYDA 1JE4A 3Q23A 2NN6G 4R9WA 4JL9A 2IHEA 3J7A5 1CJEA 3RFZB 3RZDB 2JU6X 3WA0A 1TTNA 1BCPC 3I4NB 2OF1A 4R8IA 2NYZD 1ICWA 2MUYA 3EQLC 1V9JA 3L08A 4BOSC 1LTLA 5DCNA 4DHZB 1J5EQ 2M4NA 1KTKA 3AU4A 3MZ5A 5ELFA 4MEMA 2B8FA 2VUMB 2VB2X 2M19A 5FJ8G 1ZDXA 2K39A 3JSVA 1U5KA 4KHVA 3OG5A 2A6ED 2N49A 4JG2A 1TU2B 5CV8A 1PH4A 3ND8A 4FXDA 1PGAA 5FR6A 5H8YE 3CRKC 2I5HA 5FLMG 5E4WC 1DJRD 1OXVA 2VS1A 1Q82C 3P4SB 3HGBA 3ML8A 3PHWB 1ZKHA 1CKNA 1JROA 4FLHA 4YHHL 2Y0SG 3DM1A 3AE5B 4W9CA 3FKYA 1IXRA 1TS3A 4BXXH 4IO9A 4KDLB 4MT5A 2K4KA 2PMZE 1AE3A 3EUB2 1VMCA 4DR4L 2WXNA 3PO0A 2UYZB 5AUIA 5FLXc 1BBXC 2ENBA 4IW0A 2FINB 2EIFA 3TSSA 4M0WB 2JF5A 4X57B 3B0AA 3P4QB 2WXIA 1MPEA 3QHTA 1CSPA 1EWYC 4L6TB 1U4MA 3H3VH 1K51A 2KMAA 1GO3E 4IN3A 4LWCA 2WXKA 2NVQB 1LTID 2JY6A 3Q3MC 4P16A 1FFVA 4BY7H 1K3BC 5JPNC 2EELA 2NBUA 2G5DA 3RLNA 5E3FA 4EQOA 3GS2A 1FFUA 4WH4A 2LASA 5JXVA 3PUZA 1L4ZB 3OIQA 2Y0SB 1B8AA 5CV9A 1EWIA 5EPLA 4DK6C 1AH9A 2OHFA 2GRIA 2ZCBA 1IP9A 4IUVA 4IM2A 1VQAA 3IRBA 4DUYL 3M9BA 1EZ8A 3NENA 2A5HA 2WAQE 3M3YH 1MI0A 3VFKA 4US8A 2BYFA 2ASQA 2JK8A 2WWZA 2F0QA 2EKIA 4QCLA 1DOIA 1WCMG 5DPSA 2MBBB 1WYDA 1EY4A 3PCOB 4JC0A 4BVUC 3L16A 5KGUA 4GLXA 1A2UA 1TS4A 1PH5A 3VDZA 5C1ZA 1TS2A 2QGQA 3GTKB 2UUBQ 2JA8H 3FPPA 4RNAA 5E6PA 3B6YA 2Q8RE 1TY0A 4F8MA 2D0PA 1XJVA 2Z6KC 2L0TA 1HQMC 1I7HA 1L1OB 1A3VA 4LUZA 4A3JH 3L10B 2Q2IA 4BOZB 2KX0A 3NS1A 4PZ6A 5HI1A 2KVMA 4BA2I 5D65A 1TKWB 4WJQA 4XZ4A 2J52A 2E3TA 4HCNB 1TWFH 4C3HB 3GTGB 3GTMH 2E76C 1C4CA 1CMXB 4FF4A 1E8ZA 1J6QA 2DJGC 1IL2A 2G4DB 4QUCA 2L7RA 4P71A 1FCCC 2IO1B 1Z7TA 1P7EA 3MXPA 2V1YA 1E22A 4HJ5A 1OQYA 4DR3Q 1K8OA 5A2QE 2B63H 2EYOA 2FXQA 1ENCA 3NTIA 5IYBG 1HNXL 1TIID 2WDRB 3GTOH 4K0KL 2L76A 2N9XA 2Y0SE 4KK7A 1TBEA 1T5EA 1X1MA 3VR9B 4EZKA 2JXTA 3B2GA 1KRTA 3NBHB 4KHZA 4LJPB 2BPSA 4JI5L 4FXKC 4A93H 3E3XA 2L00B 1N8RC 4A3CH 1QZGA 2DYMA 1QUQB 3UQBA 1CKNB 1Y8NB 4KJOA 1MHHE 4DAYB 3S1MH 2ALYB 3DVGY 1J7BA 1S5ED 3U9OA 3VRBB 2L32A 2E2JH 2ID0A 3PSEB 3HP3A 3TS2A 4W9JA 4TMAB 4XYQA 4PMWA 3G6JB 1XX8A 2B2UC 3Q8CA 3BDLA 5C5MA 2PZUA 3E5SA 2K6DB 3IKJA 2G9HD 4DUZL 3P63A 2WS3B 1H9RA 3CMEA 3S2DB 3PRZA 3PUXA 1T0SC 1C4AA 3OYYA 3J81c 4DA2A 4X62L 2QCZA 3H8HA 4K8IA 4XYCA 5GADC 1Y1VB 2CHZA 4HJ8A 2UUAL 4Z9CB 2WXFA 3TP6A 2X69A 1V8QA 1ZKOA 5C0XG 1SIJA 1TZ1A 3PVLA 5C3WA 4NDXA 4IFDJ 1K8MA 3UIPB 4E71A 2DY8A 1L6UA 2HD3A 3GV3A 5JVH3 4C1NI 3AEVA 3S17B 1C77A 4XE0A 1W3SA 1C48A 2F0JA 2KQ4X 1YN3A 5DLQE 3S9WA 1ICFB 2VH2A 4YWLA 3WWVA 2RD0A 3QA8A 3ZDTA 4BBRB 1ET9A 4A3KG 4H2AA 3I73A 3JAMc 4MGZE 2LMCB 3MHBA 1GOZA 2EZVA 5IYCG 4HSPA 3AULA 3H0GH 4RGTA 1DZ1A 4DHZE 3PSIA 2A19A 1AFPA 4KX6B 3T3OA 1BR9A 2EJMA 1D2BA 1D4BA 2RCNA 2DAJA 2K22A 2RDHA 4GXBA 2NN6H 3SR1A 5CBEE 1I94Q 3I9V1 4KSKC 3LJ3A 4Y52H 4LF5Q 2MHVA 5IT9c 1D5XC 1HZ5A 1WYWB 5BMHA 3HOXB 1J9OA 2RQXA 3GTMB 5IOIA 5J18A 1SXTA 2NZOA 3G7LA 3SHLA 3S1RH 4OW0A 1DOYA 5C4XG 3AEDB 1MGSA 1V9PA 4AQ7A 1CKMA 3I91A 1V2YA 3RD2A 1FM0D 3CMMB 2ZJPA 3U30A 2DUDA 1WXSA 3UINB 1B53A 3VTUA 2PI2E 3S24A 1IBKQ 4JI3Q 1PQSA 1G6PA 1UNSA 5A2QL 1UWXA 3NQTA 1PV4A 2DLBA 2LY7A 1L4DB 1IYUA 4EOYA 4DWFA 4EZLA 1QVGA 1OTRB 1L2NA 4C3IH 1HXYD 5AZHA 4PNYA 2N9EB 2TSSA 4J1MA 3CCRA 2EKEC 2V3SA 4FJYA 1DONA 3QJZA 3N1XC 4CKBA 4YWMA 4GN4B 3M3JA 4HCSA 5CYUA 4PZ7A 1FD6A 1VQ6A 2I2YA 4Q0FA 1M8AA 4BXXG 4CKEA 4GZYC 3Q6BA 2HCCA 3V96A 4HROA 4DV1L 1S5CD 4AQYL 3ERSX 3K9OB 3A9KA 3EGRA 3HOXG 4GKJQ 3V61A 3HKSA 4DR7L 1NAPA 1WFYA 4UHVA 3A1QB 5K36G 5C4XB 1WRDB 2HUGA 4B3RQ 4WFN3 3AE4B 4WJNA 1FNUA 3PUWA 1WTWA 5C4XH 1D8LA 5IWAL 1G91A 2B3GA 2K1FA 1PFDA 2O2VA 3U4VA 4PYUA 4QB4A 4BY7B 1IW7D 2N88A 2F0EA 2RHSB 2XVSA 4E6IA 2BTEA 5FO8B 2D07B 3R8BA 3VYUA 2ZXOA 5J3BA 1L0XB 2ASBA 2KJRA 5T8IA 1AEXA 3MC9A 1K83B 4PV1C 1E3PA 5JJKA 2JT4B 4OO1H 3H9DA 3UGBB 4AYBG 3MA2B 4AJYB 1V8CA 3R2IA 2FCQA 2QA4A 2RSUA 3FPUB 3AE1B 4L5SA 4OZBA 2WAQB 2L5TA 1SYBA 2YEPF 1I42A 4GKKQ 4P72A 4C3IB 1YQ4B 2GN5A 3AB9A 4IUUA 1FJGQ 2H1EA 4NAMA 1E8XA 1N60A 2WU2B 5J2RA 2HHHQ 5EE9A 3HKZE 1P16A 2N9KA 3LNNA 2IY5B 3NZ3A 2JP1A 2KFKB 4QY7A 2WX1A 3DWGC 1HTLD 1JJ2A 1FEHA 3K7UC 2HJ1A 1YNJC 1WYGA 1LGRA 1N36L 1E0ZA 1V5OA 3HG9A 5CR3A 2VUMH 3MEFA 3HOZG 4L5TA 2PVOD 1KOTA 3TEHB 3PV1A 4YCUA 4HJ7A 1R4PB 1KJTA 1EIYB 3VR6A 4ZKCB 4G3XB 4MACA 4JCVE 4ZYSA 2CHXA 4MELA 3HOVH 1YBYA 1P8LA 3N9YC 3RZDH 3TP8A 3Q8FA 5ISRA 4TSSA 2IDYA 2J7QB 3EC8A 1JWMD 1X65A 2Z4HA 3NHHA 4K14A 4YHHQ 4P1CC 3ULJA 2O2VB 5AZGA 3QWNA 1SMYC 1CQVA 3TMEA 1Y8PB 4LJZC 3S17H 3EBEA 3L4PA 1HEZE 2GA4B 2L0CA 4WIPA 1VQEA 1K8RB 4R4CA 4B3RL 1IYJB 3I55A 1U4LA 1O78A 2A73B 1JB3A 3KJPA 1XNQQ 2K5NA 1NSNS 2E8GA 3DBRB 2I1JA 3DHIC 4WJ3M 1R4MB 2OJWA 1V5TA 3E56A 3JW0X 4P2CB 3S2DH 5KNBA 1RCVD 2MNAA 2JRIB 2KWUB 2JEAI 1UE5A 5D94A 1Q10A 3Q6SA 3UIOB 4XYOA 4MIUA 4ID6A 4NY0A 5H92C 4RWSC 1VQKA 2X38A 2MBOA 3PUVA 4IJLA 3V05A 5BYRA 4YTPB 1FVIA 5DEHA 1SF0A 3KYHC 1PYWD 3U50C 3UI2A 4DR1L 3PO2B 1LTSD 2TMPA 1BBWA 1ZW7A 1VLBA 2WKCA 4K81A 1S5DD 1U4PA 3HRDD 4C3JH 2NUCA 2HHHL 1FMAD 3C8YA 1VQHA 1KAAA 1Z6HA 4GOPB 4DK5A 4ZCKA 3CC7A 2RCFA 3Q14C 1Z47A 2VQFQ 1G6JA 3I4LA 4WWMA 3BG3A 1YD8U 1FL0A 2ZJQA 2GBKA 3PZ8A 4LNIA 1TKEA 3LGJA 3R2TA 1MBYA 1DXMA 4WORA 1N36Q 3DVGX 2SNMA 4G7OC 2C7HA 2KAJA 4QAYA 3GB1A 2F3VA 3QIAA 2FHTA 1UE6A 1FXTB 1P0RA 2KJHB 4IM0A 2EYLA 3I7FA 1EY7A 3HOZH 1TIFA 3Q8DA 2G4SA 2K33A 5EE3A 1B1ZA 3BYTB 2WV6D 4M8NA 2KDBA 2DZIA 2WXOA 2RSOA 2RVLA 3F2DA 4DK0A 3Q3FA 3MJWA 2O2LD 3PIOA 1SGHA 1ESFA 4IM3A 1NNXA 3KVFB 4RM9A 2RGFA 4GLSC 4K2KA 1EY6A 2ZXPA 4YIJA 4XXEA 5LMNQ 1F2RC 3SEBA 1XF5L 4W9FA 1L2FA 1C4PA 1VQDA 3GTKH 1A63A 4BY1B 5JHBA 2CWPA 2KX3A 4XDCA 1JOKA 5ELBA 4ME5A 2D2CC 5IY0A 2VXWA 5IP7G 3P1MA 2R92B 2DBYA 3U4EG 5BN5A 3GQBA 3E0JA 1WCMH 2I0QA 3ITPA 1VS0A 4K3CA 4TQ0A 2LI5A 3Q3JA 4JI5Q 5G3LF 2NPTB 4K8JA 1CHPD 3A33B 2XTIA 1Q7YC 1U9RA 2SDFA 4IURA 1RODA 4AOFA 2FAZA 2JA7B 1XT9B 1E2ZA 3DMUA 3OWEB 4FNFA 2D3AA 1YHAA 4NXNL 1G51A 2OQKA 4MGYE 2JUOA 3VQIA 2K01A 3E9SA 1ZXTA 4DNRB 3RI7C 3AFQA 1T0QC 3S1QH 1D6EC 1F9JA 1SBBB 2PMVA 2B2YC 1VF5C 4FDBA 4XQQA 1K52A 4DV4Q 3HS0C 4X3TA 1AZQA 1HNZQ 1FO4A 1CHQD 3ZIMA 2WB1G 1X3GA 2NPTA 3TZUA 1SSOA 3RPFC 1VF7A 1N62A 2MP1A 3OIPA 1HCZA 3E9IA 1STAA 4RMFA 2HE7A 3N30A 3BZDB 3I4NG 2O5JC 3NVYA 4KY5A 4NNJB 1SE8A 3IFTA 4JBKA 3IT4B 3KFUA 2J0KA 2K25A 3KBXA 4LK0M 1EUVB 4P7IA 1ENFA 1QOHA 3BZKA 1L6VA 5F2DA 3CSTA 2QF7A 1KC8C 1HR0W 4WJOA 1FD7D 4DUZQ 1Q12A 2LZ6A 2A6EC 3RLOA 1FRDA 2I38A 1CUKA 1SR3A 2PIAA 2WU5B 4IOIE 4HCPB 2MJ3A 2FE8A 3AE7B 2E74C 3ALBA 5DM63 1EIFA 2B2WC 4KN4C 4UAIA 4ANXA 1YQBA 3GTQH 4OEMB 4PZ8A 1KIXA 1J8CA 1TWHH 3TUOA 4JI0Q 3N3KB 2GVAA 3V2TA 2N3SA 3OTOQ 3I4NH 1XCQL 3C46A 3LWEA 1JR0D 3BDOA 2UXBL 2CJOA 2NR2A 5G5GA 4YSZB 3MC0B 3L17A 4ZAIA 3DUZA 2DNFA 3AN1A 4I6LB 1RAXA 3Q8BA 3VA5A 3MTNB 5LHY1 5FR3A 3NEMA 4FF2A 3GZNB 1QVFA 1KHIA 1WGYA 3H94A 4NB3A 3I72A 3FAHA 4OVUA 2F0LA 3SK4A 1GJXA 2QEJC 1WTHA 3NUCA 4R8NA 3I4MH 2PE9A 3T8MA 4G57A 3GE3C 4DFAA 2BA0A 2ZXRA 3E0EA 3HOUG 1OQRA 1X54A 1Q1BA 3TBLD 5JHAA 2F0PA 1XPRA 1E2VA 2J42A 4BA1I 1PH2A 4LFBL 2B39A 1SYCA 3A7AB 1J19A 3K5MA 2B3AA 2GLSA 3NBIA 2KYWA 4M0WA 4L1BA 1UAPA 2K28A 4JI3L 2B2VC 5GAEC 2K1BA 4HJAA 1IBKL 1V49A 5L83A 3AMZA 2M00A 3QR8A 2CKHB 2ZNVC 4KGSA 2KCNA 3AECB 5IP7H 2JWUA 2YTXA 3HEJA 1F2LA 1N5WA 2D3GA 1KXLA 1VD2A 3L7ZC 2W54A 2J53A 2KT7A 2H89B 2F1MA 3QQ8B 3VH4B 3ZXVA 5M3FG 4A3CG 1A2TA 2YU9H 1YX6B 1AE2A 3QG1A 3RNFC 4A93G 3J80L 2CQAA 4K2LA 5TR5A 3PIO3 2D62A 1RIPA 1YQ3B 2R7ZB 1P1AA 4CQNA 1QVCA 4X66Q 1WGRA 3WIMA 4GKKL 5CV6A 5E1FA 1RFKA 5MPOA 5HHDG 4HPLB 3BINA 2PLPA 2W9NA 2K5VA 4IWQA 4J6HA 1WM2A 1GXDC 3PO3H 3D32A 3CQZH 2F4IA 4KN7C 2AHOB 2N7JA 4MDKE 3S16B 1WOCA 1L7YA 1LTTD 3PREA 2B2TA 2HQEA 1BO0A 2DN8A 2L9HA 4R1JA 1QOFA 4DDGD 5KEEA 4E3CA 4K0KQ 1J0GA 1HNWQ 2UUCQ 5M3MH 4IOCA 2G1EA 4FHKA 2H4OA 4MM3B 2BH2A 3ENEA 4MJSA 4XGAB 5M3FB 1S5FD 2I5LX 4KZCA 1EYAA 5COYA 1SNDA 1JWBD 2AX5A 1PZKD 3RZFA 4V0BA 3GP7A 1J7AA 2OEOA 4LUOA 2VY3A 3K81C 2HJ8A 4DNIA 3JVZX 3CCUA 2ON8A 1VCIA 2INDC 2Z8LA 2K8CA 1GUOA 4W9EA 1S4ZA 2JSVX 1I50B 2BS4B 3CPWA 3F1ZA 1Q86C 1P98A 2JRHA 3SK5A 2QDFA 1E9MA 1VRAB 2ZPYA 3KWVA 4JX1C 2K03A 2MO1A 2PVGC 2PQAB 2JQOA 3TS0A 4A3MH 2KOLA 1YNTE 2BS3B 2KHJA 3UDIA 1ZXHA 1QOAA 3LDZE 4DAYA 3IHPC 1F9PA 4ZRQA 3QARA 3ZKJC 3ZTCA 1SE4A 3EHVA 2D9UA 1OXUA 4YCWA 3HOYH 1T0RC 3IG3A 3NZSA 4GDLB 2K5DA 1T3QA 4HJGE 4IJHA 2C7MB 1ZXIA 5C2TB 3ZQ4A 3P75A 4JK1C 2JPHA 2F03A 2F52A 2PW5A 1SYDA 4F1SA 4N59A 2WFWA 5AJ3L 3OJ4B 1N34L 4C3HG 1X6OA 4A3FH 1MFWA 3G6EA 1GUSA 1HZAA 2YYZA 3T1YQ 1JMLA 2VZKB 3DVNU 4HPPA 4WJPA 1CI3M 5M5YH 2YVCA 4IFDH 3O65B 3VR4A 3AE6B 2F4VL 4DQOC 3N6RA 3K7AB 1WJJA 2WDTB 5EE0A 4UP7A 5EDSA 1HJPA 4A3IG 1A62A 1VQ7A 3L0WB 5EBCA 1NJIC 4N9TA 1HFGA 3CCJA 4LNNA 5G3LD 4LF9Q 1NR2A 4H0LC 4OZCA 3S2HB 2NVYB 1B9RA 5E7NA 2IBIB 1RJTA 2JEBI 1ASZA 2WP9B 2UU7A 4X65L 4HIOA 2ZVOA 2X6LA 2ICEC 3A5UA 2CKZB 4YY3L 5J22A 2JYOA 2VZAA 2CJNA 3CCLA 5CV5A 4KD3A 3VUXA 2MQHA 5BYQA 4NAWB 4OX9Q 4R4TA 2NVUI 1Q8KA 1F9QA 2ZM6L 1HNXQ 4A3GG 1IW7C 4K7UA 1UBIA 5IGDA 1N63A 4GN3B 2FNJB 2KQ3A 5BYSA 2PZWA 4CJ0B 2V4LA 3S15B 2OJRA 3W2DA 3WOEA 2PEAA 3C1EA 4C1NK 1EF5A 1KFYB 4A3LH 2GVBA 3VR8B 4FULA 2KDEB 5C3EB 3HZXA 4A3IB 3BVZA 4JI6L 2XNAC 4FADA 3PIP3 3MFYA 2LMCA 2WYQA 4W9IA 3ERQA 1G2SA 1NBFC 4B3ML 1IL8A 3Q3NC 4ACFA 3NG0A 2KWDA 3QIJA 4P73A 4IQZA 1IZ6A 3D3RA 1GC6A 3JAML 2RDGA 4JI1L 3HOWH 2JE6I 4N6EB 4WWPA 1AZPA 3BU2A 4USAA 4YCVA 2K75A 2UXDQ 4LNOA 1TWCH 3NQIA 5T1GA 5EKKA 3NOBA 1PRTD 2RMMA 4CYEA 4B3SL 1D7QA 2AL3A 1GUGA 2PNHA 4A3GB 3BVGA 4CDCC 1U4AA 2MSED 4BY7G 1WE6A 3JAMi 4LFAL 1MG4A 2K50A 4K5XA 3U4ZA 3RNAC 3ZJUA 4ZK9B 4LCDE 3I70A 1K50A 2MJ8A 3APDA 3SDZA 2Q2HA 5EKLA 3DHHC 3P4RB 2NVXH 1KAWA 4AYBB 2D2QA 5BR8Q 3FHWA 3DDCB 3VH3B 4L2YA 4FHJA 2QDBA 1I3QB 1YNND 1FJGL 2MQJA 1OEYJ 2BBCA 2LGXA 4GNXC 1EL0A 3VUYA 4LF9L 2EY1A 3RULA 2DX5B 2B29A 1QUQA 4O42A 2VZKD 5JEAJ 1NCVA 3NTKA 1PUTA 2J4XA 4HN7A 3F8TA 3PQIA 1TVXA 3NBHA 5FKAC 2VW9A 4F88A 2C9OA 3BVMA 4YY3Q 1SNCA 3DCGA 4AUQC 1XYIA 1IBMQ 1O7ZA 4K7SA 4EZJA 2F0SA 5IP9G 3SR6A 1EOTA 2NTSA 4YWKA 1I4QA 4OX9L 1QE6A 1JRUA 5C0XH 2ZEQA 1FXAA 1M94A 3CKIB 1OGWA 2XEWA 1NYRA 1RTOA 4H44C 3M63B 5EBDA 1ONLA 1LABA 1PXUA 3KOJA 5KNDA 1AARA 1OFFA 2KXJA 4FJZA 3V3XA 3PMFA 3DXJC 3TRZA 4KTAA 1YZ6A 2KNBA 4AJWA 1GVPA 3L0OA 1X32A 4RCNA 4F8CB 3MAQA 5C23A 1E2WA 1PFSA 1RHPA 4A3KH 2K5PA 4EQPA 3S1NH 2N4FA 5IYDH 2MP2A 2F0UA 3DEOA 1SNQA 3FILA 3V60A 1RL2A 4YTNB 2E2HH 3L9AX 4HXDA 5IGGA 1O7IA 4DAMA 2ZJRA 1XTDA 1XNQL 3MP9A 2QHOA 1NY4A 1RYJA 1EU4A 3LXFA 2JWZA 1WD1A 2L4NA 1LTAD 3ZYYX 3MFGA 2BDOA 1LV9A 1X3FA 2F0IA 2K7VA 3DWAA 1JW9D 1ZP0B 2VH1A 4MSQB 1GUAB 2EE1A 1VZ8A 1I4GA 4IPCA 3QO2A 2WP8J 2F0GA 1PA6A 1SNMA 2NVYH 3Q8AA 1GAQB 3P2BA 3J7YW 2PZTA 4IUQA 2AEHA 2Y5CA 4ZRKA 1DCZA 2HIXA 2M8SA 4H02A 5M5YB 3OJ3A 1K0RA 3HVZA 1SMXA 4LUVA 2GBMA 4A6QA 3KF8B 3L2PA 4A3FB 1K8AC 4KY6A 5E4XA 3EECA 5EE1A 4LNQA 2IJ0A 3I8ZA 1YMHE 4YSYB 4ICUA 1P3QU 1TWGH 1HR0Q 2VQFL 2ZTEA 4XDDA 3NE5B 2E2IH 1SLJA 3DHQA 2IX3A 3CCQA 3D4RA 1FPYA 1ILQA 2F0HA 1SIFA 5T1IA 1E7ZA 1T6BX 3HOYB 4HR7B 2XSCA 1SE2A 3GTPB 3RYTA 4W9KA 2SNSA 1BCPF 3HFZB 4DPGA 2RSNA 3BS1A 3ZLZA 4A3MB 5AEKB 4NXML 2QC8A 4KKJA 1AW7A 2F3IA 1J7CA 4LFBQ 2WXGA 3D31A 2KMCA 3PIPA 4OVVA 4N9PA 2PQEA 3RN5A 4A4IA 4K6LA 1JQYD 4PMCA 1UF0A 2WB1E 4A75A 1V86A 2CW0C 3VTWA 3WCQA 4BKTA 4NPSA 1KH0A 4OGQC 3SGIA 1BNZA 3MVVA 1WZ3A 4PS3A 5LXHA 1QB5D 2C5CA 1TGZB 1YVCA 3OW2A 1N9WA 5C6AA 2BYVE 4J15A 2DYOA 3ECIA 4O0AA 1GPXA 4KI0A 4V190 2X8XX 5CTRC 3DBHI 4HWIB 1WTXA 4S0RA 5HGTA 2XGTA 4RG1A 4NMZA 4JOIC 2R93G 2D5DA 1GNUA 3T4AC 4OO1I 2GBJA 1SE3A 1M1KC 2AWTA 2KDIA 3M95A 3PRMB 4A20A 2KZRA 2K8HA 1ET6A 4IUTA 5M5XH 1II3A 3S1NB 1RDPD 4EUTA 3GDEA 2JSOA 1WM3A 2INPE 3HOYG 2N1VA 3CPFA 3VTVA 4R3DA 4BKGA 4IG7B 5M3MB 4JI7L 3IAYA 2EPBA 2AQ1B 2R92G 3JSVB 1MKHA 5E6JA 2J7ZA 4IZ8A 2BE5C 2SAKA 3SVMA 4LFCQ 1RKNA 1BCPD 3KUCB 3IAS1 2J0TD 3SFDB 4NJCA 1QKZA 1NYQA 5CV7A 2C9WB 1FYCA 3K80C 4DV6L 1DM0B 1LTGD 3EJIA 3PGZA 3RMHA 3J80c 1E0BA 2BH8A 1R9TH 4HPMB 4G50A 2HCIA 1NEKB 2BT6A 3AEFB 1NTGA 4W9DA 4KIKA 2R7ZH 3GOEA 3E6ZX 5IT9E 2JA5G 2OEDA 1ZYRD 4UP8A 4DV4L 1ASYA 5I4DA 1X3QA 1IBLL 1HNWL 2R93B 4C7YA 1STNA 4RGOS 2ZJDA 2YU9B 1KDBA 3BIID 4OVZA 5DPRA 1YHQA 5LLIA 1IYVA 5HG2A 4BKSD 3UE0A 2Z4IA 4R4OA 1HZCA 1ZPSA 4M02A 1V97A 1PLFA 1SDFA 2F0NA 3JAME 3AMUA 1K0SA 1F9RA 2R3ZA 1I6HB 2LFIA 4S17A 4A90A 3UQAA 3SE0A 4TRDA 3TP7A 1HTQA 4CBVA 4PMBA 5IYCH 1PH8A 2KTRB 4XX5A 3KBGA 3K0YA 1IKMA 4DKAC 4WRDA 3WAMA 3CCMA 1WJ4A 1T0YA 1EY0A 2V9HA 1DOLA 2CVRA 2EYHA 2M9VA 4GS3A 3F2BA 2NS5A 5IP9H 4A3GH 2AYOB 5KYLA 2NZHA 4KD4A 2CS4A 1STYA 2AUJD 4RF1A 1GHKA 4HMJA 1VQ5A 1UGJA 1UZXB 2KCCA 4TQ1A 2E2DC 1A3TA 2ZCCA 2KKCA 4CDFC 3A4RA 3J81E 1I4XA 4MH8A 4N58A 2MPMA 3FP9A 3HOWB 2BA1A 1K53A 2KHWB 4OONA 1CSQA 1NMGA 3K5NA 1FRRA 3MXNA 2BB6A 2C5LC 2KLCA 1PZJD 2IO2B 2I46A 3PGEA 4KIKB 4DR5L 3DEPA 1QG7A 1W6JA 2IY1B 5C3EH 2GBRA 3VXWA 4JI7Q 4NQKE 4RKBA 3ZNZB 1NBWA 4M01A 1EQVA 2JQRB 2UU9L 3CC2A 3QWZB 1YJ1A 3R93A 2ZM6Q 1MJDA 1BXTA 3K59A 4EQ5A 3QK0A 4TQUS 4K3BA 4EFOA 2VUMG 2JA7G 4U673 4XT1B 5D2MB 2HDMA 2ZTCA 1SAPA 1YNXA 1G2TA 2WX0A 4XC2A 4DXAB 1GUTA 3WAPA 4KKSA 5IGEA 1S72A 2LGDA 4XDXA 1E10A 5NUCA 3W1BA 1TYGB 4NQLB 1HUNA 1KM7A 2E5LL 1HH2P 4JYAQ 2K05A 2KUMA 1S5BD 2EQSA 2YLMA 4YSXB 4JBWA 4UPAA 1PZID 3RR5A 3D6WA 2C35B 5BN4A 1EY9A 3S2HH 2MGSA 2DENB 2W3RA 3DBLB 4BBNC 2FCSA 1WGGA 2WGSA 1FR3A 2CHWA 4GMVA 2LUMA 1ZDVA 1YEZA 2PO4A 2VRRB 3K7AH 4RFBA 5TSSA 4RA8A 4EGVA 4LF6L 1XLNA 3KQ4A 4FXGC 1JWSD 5C0XI 1Z5SB 2HDEA 2L05A 4A3EH 2CU1A 2NVTH 4DV0L 2EY6A 4W9HA 1JOQA 1U4RA 1B7YB 2BS2B 4XQNA 1O7LA 1Y69U 1HA6A 1QQRA 2F0WA 2WHIA 2LXKA 2LFNA 3AH7A 1R4NI 1NI3A 3P7JA 5HGQA 1JJCB 1VQLA 2KO3A 1ZYRC 3HOUH 4LNFA 4GOPA 2L1AA 2CU3A 2MP2B 3MXNB 5GROA 4JI2L 3N32A 3PV0A 3S1QB 4JGHB 4M1UB 2R7ZG 2RPVA 3C0RB 3JYUA 4C7ZA 3P1HA 4R4QA 2JA7H 5FK9C 3OOCA 3O13A 1S3SG 2RHQB 1IGCA 1LM0A 2G45B 4GB9A 1Y8RC 1M4VA 2KCTA 2HT1A 2F0FA 4A3BH 4MTKA 4OXPA 1S3OA 4EE2A 1VQ4A 4DV7Q 1WCMB 2BGFA 3ZGZA 4ICVA 2OOBB 4DGZA 1EQQA 4ARCA 2MFIA 4ZRPA 4MSMB 4JI0L 5C4ZA 2JYEA 1DOXA 4HSVA 1OEYA 4ZRZA 2KC2A 1QOBA 4ZUJA 1XMQQ 4BWGB 4JIOU 3V6EB 3TIXA 3NUHB 2Y5BB 5KHOA 3A9JB 1SRUA 4JI8L 2RPQA 2KTRA 4L63B 5IA7A 4A3DH 4FN2A 3B08A 2DWQA 3ZNHB 1SNPA 5C4JB 3APCA 1E1TA 2PNRC 4JI4L 4K7WA 2L0FA 5KNCA 3TEXA 4AIMA 1TT2A 3I90A 1C76A 3EROA 5ELNA 2G3QB 4LF7L 3S16H 1K28A 1PFBA 1BQQT 3CQZB 1DOKA 1EQTA 4BAXA 1N61A 4MJSB 1OXTA 1FNVA 4HTHA 4ZQ3A 3HK0A 2KD0A 5C3XA 3U7ZA 2W55A 3NHEB 1FGUA 3NTHA 4RCOA 4L5RC 5EQ0A 1V1PB 3T56B 3VAWA 2OQ0A 4DN4M 4NZLB 4RAUC 5AJ3Q 4WAAA 1EWHA 2IT1A 3VR3A 1F52A 1JQ4A 2A5UA 2QIEB 4RH6A 1QZHA 3I3TB 4Q5VA 3EIVA 2VB3X 3GD7A 2K9XA 1IGDA 4DR4Q 1LFDA 1F2YA 2AUKA 1EEID 2PKOA 1MJCA 4AH6A 4N8X1 1H4RA 2JN4A 2ONQA 3K5OA 3QX1A 2PE6B 1BF4A 3EFXD 4DV2L 4IWPA 2LVOA 4RMAA 3D0FA 3P42A 1W2BA 3NZUA 1CZGA 1HPCA 1HR0L 2Z59B 4B9KA 2BDNA 1K9MC 2MRPA 5IOCA 3TCAA 3M4PA 1UE1A 3L54A 1UBQA 5JJIA 2JZPA 1HQRD 1YITA 2FJ2A 1EIGA 4KHPL 1UELA 3LWUA 3AEAB 3T51B 4JWSC 1HTPA 1PDXA 1WXAA 2NWGA 2LXJA 4XIGS 3OW7A 1ROEA 1H9MA 4QUFA 3STBC 1IUEA 3I56A 1H9JA 3FRPB 3SFEB 4DHJD 1BVSA 2IO0B 3KYCD 1KL9A 3SK6A 4GU2A 5JEAH 4IALA 4JI6Q 5C3EG 1MVKA 4DK1A 3FMCA 2XIWA 1XNRL 2B2YA 1VQCA 3ICEA 4POGA 1A8VA 1EOVA 1YX5B 2IO3B 3W1SA 1HFNA 4LAAA 2LVPA 1RWSA 2J0JA 3NJTA 1T9HA 4OHJA 5IGFA 3GTLB 1UH6A 2KEEA 2INNE 3KF8A 4JBMA 2B76B 2KTFA 3CCSA 4AWJA 3DM3A 4ZKBB 5AZFA 4ZHOA 1GB1A 2SEBD 1YHBA 1SNOA 2PI2A 3R3MA 4KMUC 4QMGA 4B0EA 2L12A 2O6VA 2Z0DB 1F77A 3IAM1 3ZTDA 3UI3A 2R7FA 5H1SE 4WQOB 4L8JA 1B4OA 1GKHA 2CQOA 3EFCA 4DV6Q 1PRTB 1WGKA 3T9LA 3C3LA 5IODA 3TEZA 4C80A 1Q46A 4LF8L 2WINB 2HIVA 1OQQA 3ZVVA 3VR5A 2WXMA 4KLKA 1JCKB 3T1HL 3Q2AC 2UXBQ 3TREA 1R7SA 4IC7B 3PF5A 2ZVNA 3S14H 3I5JC 1EU3A 3H15A 4B0MA 1PGBA 1Y1VG 2DNCA 4DV5Q 1HRJA 1K83H 2Q2UA 2ZNVB 4ANUA 4ZDVA 2ZW0A 2KANA 4UDUC 4X64Q 2ICIA 4C4VB 2F4VQ 2KVZA 3J81j 3AM9A 2KEDA 1I6VC 2MEKA 1JJGA 4OWTB 5FOBB 1P7FA 2KLGA 3RMKC 3AE9B 1Y1WG 1VZ7A 1B9NA 4XT3B 3STBD 5K36H 2HD5B 1L0WA 4JW0A 4IUMB 2KHSA 4LLGM 1XWEA 4R4IA 3CXCA 1WTQA 1ZUD2 3TL5A 1WMHA 3HM3A 2A6HD 4IOAA 2RR9A 2KMMA 4C00A 1WI5A 2E75C 4KSLC 1WXMA 1CK1A 2K32A 1MI2A 2WKDA 5IGBA 2YTYA 2UUAQ 2R92H 4A3BG 4CKCA 2D3BA 2DYBA 1RLFA 2LD9A 4C2MB 1YJJA 3S2AA 3NS8A 1ZE3D 2H88B 2H5XA 1R4NB 1SN8A 4BY1H 5C4JH 3RUZA 1UGMA 3HIZA 2BB5A 4HCEA 2JJQA 3H1UA 2NB0A 1PH9A 1EYDA 3K57A 4WAFA 1FCLA 4A3DB 1XPOA 4C3JG 1QJOA 2UWQA 3H7PB 2BYTA 2QDLA 1Q5WB 4KDIC 5IGCA 1F2ZA 5BN3A 2NN6I 4MHEA 1LACA 3L3OC 3T16A 1I35A 5IN7A 3S1RB 1MIUA 3DBLI 4ZYNA 4YWGG 5LMUQ 4P74A 4C2MH 3HOZB 2K5WA 2ZTDA 1WSPA 4A76A 1LLRD 4TUUA 4ULLA 1NE3A 2EYJA 1IPGA 3SDLC 1WH3A 2UXCQ 3TN2A 3CF5A 1BOSA 2FFKB 1JMCA 3DLLA 4NXNQ 1WJNA 4MM3A 4ARIA 3BK1A 4A3BB 1CZWA 1PH3A 1YNNC 1CKOA 1TXYA 5IKCM 3PO3G 2PPHA 1NENB 3R3OA 1JICA 1MD2D 4HRSA 4BBRH 3UDXA 2QILA 3W5OA 5GAGC 3VA7A 5BR8L 4DV5L 3PTFC 1RTNA 3G48A 4X64L 1BUIC 3N20C 1BCPB 4RHRA 1WD0A 4C3JB 5DPWA 3ULPA 3B2FA 3J81L 4HLEA 5JH5C 1EQRA 1HZ6A 3X23A 3PO2H 2BCOA 4LF6Q 4CJ1B 2OTJA 3ZNGC 4EKUA 5EKIA 4JWUC 4DAPA 1KLVA 1F9SA 3QOLA 3W5UB 4DBGA 3GE8C 2AQ2B 2F0VA 3U9SA 3RNCC 1EEFD 1VZ6A 3S14B 1Y1VH 2NTTA 2A68D 2EJGC 1MSHA 2JZ3B 2PPBC 4NXMQ 1KNAA 2NVTB 4DF7A 1X9NA 4A3EB 4LK1C 2OWOA 3D4DA 3KDFB 1STHA 4CO7A 2EMTA 3BWUD 1K8GA 2MX2A 1H95A 2N0SB 1G291 3W3AA 2JA9A 2F0TA 1MHWC 3ER0A 2CH4A 1SYFA 4EX5A 1WIAA 2KDFB 3F2CA 1CZPA 4FO2A 2B2UA 4DXFA 3OMCA 3V6CB 1HUMA 4AS1A 2E2JB 4IPHA 1D5MC 2JX5A 4DV3Q 3U2SC 4GNXB 3CW2C 2YV5A
chains in the Genus database with same CATH topology
1WWTA 1W6KA 4YXDB 4RHSA 4PT5A 2IGGA 2LJIA 1TKYA 4XWTA 2KDMA 4B9XA 1XLOA 4A9AA 4B9WA 2EDGA 2XWJB 2EY5A 3GTOB 3ONAB 5GXGB 5K5PA 3HOVB 4K5VA 1EWCA 3J7AF 1RM6C 5D3IB 3WDNA 4S3SA 2B63B 3Q24A 1JWAD 1YJIA 2FBWB 4GDKB 4JWUC 4KKIA 4J8QA 1QWYA 4ZHPA 3A54A 5DM73 1G8ZD 5CMDA 5JEAG 3NK9A 3AV8A 4A55A 4ODGA 2HTME 2FUG1 1TWFB 2F0KA 4EQNA 3GV6A 5FO9B 4X3SA 3AEGB 4NP5A 5EJWA 1F0ZA 3WOFA 5BMIA 3OSOA 3PUYA 5D14A 1F2RI 3OMGA 4MN3A 4HEDA 3I57A 3FILB 2NMQA 3D8GA 1UWMA 1IBXB 3OHXC 2WXPA 3X3MA 3MWYW 3TP5A 1STBA 4IFDG 2LKVA 2IGDA 2L1BA 3HRZC 4CJ2C 4QIWB 2EYMA 2CW0D 4DNTB 2EJFC 4RGNA 4DXGA 3PZ8A 2WXJA 2WXRA 4F7XA 3BDCA 2L11A 5LNK1 5AFWA 2ACZB 2LHDA 2K6AA 4I7ZC 3OPOA 4ABNA 4Q2JA 2AQ3B 2Q8IB 5FLXL 1VDZA 1D1IA 3EA6A 1DD2A 2B2TC 4NW2A 2V3PA 3OWFA 3TDQA 2BW2A 1PTOF 1SYGA 1SJED 1QNUA 3M4YA 3ETRA 4ZOHC 4HEA1 3U52E 3CU7A 1WTOA 2L55A 1JC7A 1Q8IA 3NXWA 3NVVA 1VMPA 3A55A 1SMYD 1PRTF 1TZOA 3AEEB 1X3PA 3Q22A 1CM9A 1UEAB 5CGKA 1E7PB 3HVDA 1GUNA 1LT3D 3BK2A 1C78A 2ZT9C 1I4PA 3CRLC 3VYRA 1XLPA 5EPJA 3H09A 1OXSC 3AE8B 4JPSA 5I9PA 1A15A 3NSWA 2VNUD 3AEBB 3H0GB 1KNEA 1V1OA 2DY7A 2WLBA 3MXUA 2Y3AA 1QILA 1FXIA 1NVID 2CHBD 2F3WA 5C5LA 3DWPA 1T5XD 3HOUB 3RD4A 3I3CA 4WJWA 1TWGB 4OZAA 1WRIA 5AUKA 1V1PA 5LL6S 5JAVA 1B3AA 2L83A 3KLSA 1PTOB 3DWMA 3A8IE 1LTBD 1C9FA 3T53B 3TZDA 1JALA 1TKGA 4IUPA 4WQMA 2IL8A 2PW7A 1PTOC 2OT2A 1WTPA 2ZW1A 3M85A 3DWQA 3S1MB 3T3NA 3EVQA 1ML0D 2D5GA 5JVG3 4A93B 5ELDA 5D3DA 4FF1A 2FMMA 2WDQB 4JE3B 1EZ6A 1IKLA 5EGTA 2G9DA 3Q69A 5I9OA 2WNMA 1TQOA 1B44D 4G4KA 2A74C 3Q0AA 2RA4A 4BBSB 4QF4A 3K5LA 2RBMA 1B2TA 5HURA 1SJHD 2MJEA 2NZ1D 4A3JB 3ZJTA 4G7ZC 5IT9L 2RKSA 3VR2A 2O4XA 2QCPX 1HHVA 2JA8B 2K3UA 3NWTA 3VYSA 2AWNA 2XRSD 3M7GA 1V43A 1CTMA 1OXXK 4RGMA 1LTRD 3TBIB 2IGHA 1PGXA 5I2YA 3M3YB 2PMZB 2NVXB 1XCTL 2L52A 1BUVT 2KN4A 2PTLA 2X6GA 4HKZE 4XWWA 2BOSA 2LHEA 4RKLA 4IUNA 4IKGA 1TY2A 1QLBB 1KDAA 1TWCB 2B8GA 1R9TB 1SB3C 2SOBA 2OXPA 2A69C 2F0OA 5ELCA 2WACA 1I4RA 2QSDA 1BMLC 1AYFA 1JOOA 3QB3A 5M5XB 1XXGA 5EPKA 4CHTB 5LL6X 3LX0A 2FMCA 4X3KA 5ELEA 1DOMA 4KGTA 1LT5D 2V3NA 2NBFA 3FC4A 3C2PA 4NKLA 2AWOA 2GB1A 3FEWX 1PMRA 2M56B 1FGBD 2N55A 2EVBA 1NR4A 3K6OA 5C44B 1ACCA 2E6XA 3J9CA 5FLXE 2E2IB 5CBAE 3C1FA 1CA5A 3RLFA 1MSGA 1RF2D 1SYEA 4IDIA 4LMQD 2Q5WD 4K5WA 1KF6B 2I07B 2B2VA 4K6DA 1Y56A 1I4HA 1Q1EA 2LS01 1JORA 2PYKA 1C4QA 3H3VC 5JOBA 1IBXA 2K04A 2WDVB 4P6VF 1C8CA 3ND9A 1A3UA 1ZEQX 1CT1D 5I6WA 4L23A 5JPMC 1EY8A 1SFOB 3ABVB 2KECA 3IXSA 1XTCD 4US9A 3KUPA 1QCBD 1CFMA 3D6CA 1C79A 2QKIC 1DYQA 2E2HB 1F2MA 1FIQA 2KACA 3MJ5A 2XRQD 4DAVA 4KJNA 2PW9A 4LTUA 4WURA 1ILPA 4A3KB 2DNEA 4M8AA 1JRPA 1PFMA 4J3OD 3A56A 2IPKD 1O80A 5I6YA 1AWDA 3FKIB 1QT9A 2A69D 3B9JA 3LB8C 3FVQA 4HKQA 1STEA 1KLUD 2IX1A 1SSNA 1XLQA 3PO3B 5C4HA 1E6EB 3X3NA 3W9CB 1WTRA 4B08A 1EYCA 4YTMB 1PFNA 1B50A 1QNKA 4A8XC 2IWHA 1KRHA 2V0GA 3KLSX 3MEHA 5A35A 1Y1WB 1H9KA 2O5IC 1A6XA 2YEPB 3TEYA 5BMGA 2XWBB 4REZA 2WQYB 5C3JB 2PCFB 5DAUA 1H9SB 2EOTA 3IT6B 1BDOA 3SXHA 3M4OB 3QJYA 4O1NA 4HAEA 1B9MA 4CGYB 2A6HC 1SEBD 2IX0A 1D1KA 4OL7A 3VYTA 5J39A 4PQXA 3MHZA 3NVWA 4H13C 1PRTC 1TR5A 1Q3LA 3M7NA 5IIFA 3QOJA 5DNFA 2R61A 3RZOB 3TEWA 1VJKA 3CIRB 3SK8A 4RF0A 5CC4A 3GTJB 3NWSA 3LYYA 1TWAB 1L0YB 2Y5PA 4KY7A 1RD9D 2HDLA 1KLGD 5KYIA 2LGIA 1D5ZC 4OIJA 3ZJVA 4C3IG 1Y8OB 2EY2A 3W5VB 4KV6A 3D4WA 1VDVA 1TWHB 1XEEA 3N52A 5JJZA 1XO3A 1ZOYB 1GUWA 1EIHA 3GTQB 3K58A 1ESRA 5KIXA 1AN8A 4I65A 5M9OA 2JYTA 1L5PA 3MTSA 1LO5D 2M2LA 2W3SA 4HMIA 1PDQA 3H6MA 1A70A 4XTCS 2KA7A 1DGJA 1J8IA 4OO1G 5HFYA 1N5XA 3A8JE 2JA6B 1EM7A 3AU7A 1OO9B 3NPPA 3NVZA 1UUPA 4IFDI 2MH7A 4OIKA 5CORA 1HA5A 3IL8A 3J7AV 2Q8TA 1G6ZA 5D7GA 4KKTA 3BYYB 1QF6A 1NUCA 3VRAB 4G7HC 2K5QA 4KKUA 5M5WB 1VR9A 4F87A 1R4QB 2A68C 3FDTA 1IHZA 3NP8A 3IFDA 1TS5A 2F0MA 3AE3B 1JWUD 3GO5A 3F2UA 3KK7A 4ILWA 4U68A 4YT0B 4ZLTF 1KABA 3KWLA 2WIIB 1GHJA 2QMTA 2WXQA 3A7LA 2IW3A 2W82A 4ZUIA 2XN9C 4ITKA 4Y7NB 4H7BA 3URYA 4BS9A 1CQFA 1TJEA 3J80E 4KGRA 1H9SA 3KLRA 5J1ZA 2M0AA 2EXZA 1ENAA 3HKZB 1MHXA 3CWIA 3HUIA 4C56C 1EY5A 3T13A 2WB1B 5I2XA 2WXLA 1GB4A 1YN5A 2F0DA 2KJXA 1AP0A 3A8KE 2EYFA 5CV4A 1LT6D 2EYPA 2V4IB 4FP5D 4FVMA 2RDFA 2Z1CA 3NRZA 5C0XJ 1Q90A 2WXHA 1O7YA 3AB5A 1WVLA 4FF3A 2GI9A 2JA5B 1LT4D 2R6GA 3P4PB 2N9LA 5FO7B 3PZ7A 4XQJA 2MJDA 1WTVA 1WXQA 5KRUA 1STGA 1YNJD 4EVOA 2BE5D 1L0VB 1QOGA 2B2WA 3MXGA 3P20A 2V4DA 4TKOB 1PTOD 1KDCA 4FXCA 1FNWA 2QJLA 1PTOH 2K0PA 2LEKA 4DU9A 3AE2B 1CA6A 2JXMB 3I4MB 3H91A 3CHBD 5G5HA 4D2KA 4X3UA 1EFID 1YN4A 4FYDA 1JE4A 3Q23A 2NN6G 4R9WA 1CJEA 3RFZB 3RZDB 2JU6X 3I4NB 1BCPC 2OF1A 4R8IA 2NYZD 1ICWA 2MUYA 3EQLC 1KTKA 3MZ5A 5ELFA 2B8FA 2VUMB 2VB2X 2M19A 1ZDXA 4KHVA 2A6ED 5CV8A 1PGAA 1TU2B 5H8YE 3ND8A 4FXDA 3CRKC 5E4WC 1DJRD 1OXVA 3P4SB 3HGBA 1JROA 3DM1A 3AE5B 1TS3A 4MT5A 3EUB2 1VMCA 3PO0A 2WXNA 5AUIA 1BBXC 2ENBA 2FINB 3TSSA 3P4QB 2WXIA 1MPEA 1EWYC 4L6TB 1U4MA 1K51A 4IN3A 2WXKA 2NVQB 1LTID 4P16A 1FFVA 5JPNC 2EELA 5E3FA 4EQOA 3GS2A 1FFUA 4WH4A 5JXVA 3PUZA 1L4ZB 3OIQA 2Y0SB 2OHFA 5CV9A 5EPLA 2GRIA 4IUVA 1EZ8A 2A5HA 1MI0A 4US8A 2F0QA 2EKIA 4QCLA 1DOIA 1EY4A 5KGUA 1A2UA 1TS4A 1TS2A 3GTKB 4RNAA 3FPPA 2Q8RE 1TY0A 4F8MA 1HQMC 1I7HA 1A3VA 3NS1A 5HI1A 2KVMA 4BA2I 5D65A 1TKWB 2J52A 2E3TA 4C3HB 3GTGB 2E76C 1C4CA 4FF4A 4QUCA 1FCCC 1Z7TA 1P7EA 3MXPA 1K8OA 5A2QE 2EYOA 1ENCA 3NTIA 1TIID 2WDRB 4KK7A 3VR9B 1T5EA 2JXTA 3B2GA 4KHZA 4FXKC 2DYMA 4KJOA 1Y8NB 1MHHE 1J7BA 1S5ED 3U9OA 3VRBB 2L32A 2ID0A 3HP3A 4TMAB 4XYQA 4PMWA 3G6JB 1XX8A 2B2UC 3Q8CA 3BDLA 5C5MA 2PZUA 3E5SA 3IKJA 2G9HD 3P63A 2WS3B 1H9RA 3S2DB 3PUXA 1C4AA 4DA2A 3H8HA 4K8IA 1Y1VB 4Z9CB 2WXFA 3TP6A 2X69A 1V8QA 1ZKOA 5C0XG 1SIJA 5C3WA 4NDXA 4IFDJ 1K8MA 2DY8A 1L6UA 3GV3A 5JVH3 3S17B 4C1NI 1C77A 4XE0A 4YTNB 1C48A 2F0JA 2KQ4X 1YN3A 3S9WA 4BBRB 1ET9A 4H2AA 3I73A 2LMCB 3MHBA 1GOZA 2EZVA 4HSPA 4RGTA 1DZ1A 4KX6B 1AFPA 3T3OA 1BR9A 2EJMA 1D2BA 1D4BA 2K22A 2RDHA 2NN6H 3SR1A 5CBEE 3I9V1 2MHVA 1D5XC 1HZ5A 5BMHA 3HOXB 1J9OA 2RQXA 3GTMB 1SXTA 3G7LA 3SHLA 1DOYA 4OW0A 3AEDB 1MGSA 4AQ7A 3I91A 1FM0D 1B53A 1UNSA 5A2QL 1UWXA 3NQTA 2DLBA 2LY7A 1L4DB 1IYUA 1HXYD 4PNYA 2TSSA 4J1MA 1DONA 4CKBA 4HCSA 5CYUA 1FD6A 2I2YA 4Q0FA 1M8AA 4CKEA 4GZYC 4HROA 2HCCA 3V96A 1S5CD 3EGRA 1NAPA 5K36G 5C4XB 2HUGA 3AE4B 4WFN3 1WTWA 1FNUA 3PUWA 1G91A 1PFDA 4QB4A 4BY7B 1IW7D 2N88A 2F0EA 4E6IA 2XVSA 2BTEA 5FO8B 3R8BA 3VYUA 2ZXOA 1L0XB 5T8IA 1AEXA 1K83B 4PV1C 4OO1H 3MA2B 1V8CA 3R2IA 3FPUB 3AE1B 4OZBA 2WAQB 2L5TA 1SYBA 2YEPF 4C3IB 1YQ4B 3AB9A 4IUUA 2H1EA 4NAMA 1N60A 2WU2B 5EE9A 2N9KA 3LNNA 3NZ3A 2JP1A 3DWGC 1HTLD 1FEHA 1YNJC 1WYGA 1E0ZA 3HG9A 5CR3A 2PVOD 1R4PB 3VR6A 4ZKCB 4MACA 4ZYSA 3N9YC 3TP8A 3Q8FA 5ISRA 4TSSA 2IDYA 1JWMD 2Z4HA 4K14A 3NHHA 3QWNA 1SMYC 1CQVA 3TMEA 1Y8PB 4LJZC 3L4PA 1HEZE 2GA4B 2L0CA 4WIPA 1U4LA 1O78A 2A73B 1JB3A 1NSNS 3E56A 4P2CB 5KNBA 1RCVD 2JEAI 1Q10A 3Q6SA 4XYOA 4MIUA 4ID6A 5H92C 4RWSC 2X38A 3PUVA 3V05A 5BYRA 4YTPB 5DEHA 1SF0A 1PYWD 3UI2A 3PO2B 1LTSD 2TMPA 1VLBA 2WKCA 1S5DD 1U4PA 3HRDD 2NUCA 1FMAD 3C8YA 1KAAA 1Z6HA 1Z47A 3I4LA 4WWMA 3BG3A 1TKEA 3R2TA 1MBYA 1DXMA 4WORA 2SNMA 4G7OC 2KAJA 3GB1A 2F3VA 3QIAA 2FHTA 2EYLA 1EY7A 2K33A 5EE3A 1B1ZA 3BYTB 2WV6D 2WXOA 2RSOA 2RVLA 4DK0A 2O2LD 1ESFA 4GLSC 4K2KA 1EY6A 2ZXPA 4YIJA 4XXEA 1F2RC 3SEBA 1XF5L 1C4PA 4BY1B 4XDCA 1JOKA 5ELBA 4ME5A 2D2CC 2VXWA 3P1MA 2R92B 2DBYA 3U4EG 5BN5A 3GQBA 3E0JA 3ITPA 4TQ0A 5G3LF 4K8JA 1CHPD 1U9RA 2SDFA 4IURA 1RODA 2JA7B 1E2ZA 3DMUA 3OWEB 4FNFA 3VQIA 2K01A 3E9SA 1ZXTA 4DNRB 1D6EC 2PMVA 1SBBB 2B2YC 1VF5C 4XQQA 1K52A 3HS0C 4X3TA 1AZQA 1FO4A 1CHQD 3TZUA 1SSOA 3RPFC 1VF7A 1N62A 2MP1A 3OIPA 1HCZA 1STAA 3BZDB 2O5JC 3NVYA 4KY5A 3IFTA 3IT4B 3KBXA 4LK0M 1ENFA 1QOHA 1L6VA 5F2DA 2QF7A 1FD7D 1Q12A 2A6EC 1FRDA 2I38A 2PIAA 2WU5B 4IOIE 2MJ3A 2FE8A 3AE7B 2E74C 5DM63 2B2WC 4KN4C 4UAIA 3TUOA 3V2TA 1XCQL 3C46A 3LWEA 1JR0D 3BDOA 2CJOA 5G5GA 4YSZB 3MC0B 4ZAIA 3DUZA 3AN1A 5FR3A 3Q8BA 3VA5A 5LHY1 4FF2A 3H94A 3I72A 3FAHA 2F0LA 3SK4A 1GJXA 2QEJC 3NUCA 4R8NA 4G57A 4DFAA 2BA0A 2ZXRA 1OQRA 1Q1BA 2F0PA 1E2VA 2J42A 4BA1I 2B39A 1SYCA 3A7AB 3K5MA 4M0WA 3NBIA 4L1BA 1UAPA 2K28A 2B2VC 2K1BA 3AMZA 2M00A 4KGSA 2KCNA 3AECB 2JWUA 3HEJA 1F2LA 1N5WA 2W54A 3L7ZC 2J53A 2H89B 2F1MA 1A2TA 3QG1A 3J80L 2CQAA 4K2LA 3PIO3 2D62A 1YQ3B 2R7ZB 4CQNA 5CV6A 5E1FA 1RFKA 5MPOA 5HHDG 2PLPA 4J6HA 1GXDC 2F4IA 4KN7C 2N7JA 3S16B 1LTTD 2B2TA 2HQEA 1BO0A 2DN8A 2L9HA 1QOFA 5KEEA 2G1EA 4MM3B 2H4OA 5M3FB 1S5FD 1EYAA 5COYA 1SNDA 1JWBD 2AX5A 1PZKD 4V0BA 3GP7A 1J7AA 2OEOA 2ON8A 1VCIA 2Z8LA 1GUOA 1S4ZA 2JSVX 1I50B 2BS4B 3SK5A 3KWVA 1E9MA 1VRAB 4JX1C 2K03A 2PVGC 2KOLA 1YNTE 2BS3B 1ZXHA 1QOAA 4DAYA 1F9PA 4ZRQA 1SE4A 2D9UA 1OXUA 4GDLB 2K5DA 1T3QA 4HJGE 1ZXIA 5C2TB 3ZQ4A 3P75A 4JK1C 2F03A 2PW5A 1SYDA 4N59A 4C3HG 1GUSA 2YYZA 1JMLA 2VZKB 1CI3M 4IFDH 3VR4A 3AE6B 4DQOC 3N6RA 3K7AB 5EE0A 5EBCA 4N9TA 1HFGA 5G3LD 1NR2A 4H0LC 4OZCA 3S2HB 2NVYB 1B9RA 1RJTA 2JEBI 2WP9B 2X6LA 2ICEC 5J22A 2JYOA 2CJNA 5CV5A 4KD3A 5BYQA 4NAWB 1F9QA 1IW7C 5IGDA 1N63A 2KQ3A 5BYSA 2PZWA 4CJ0B 3S15B 3W2DA 3WOEA 3C1EA 4C1NK 1KFYB 3VR8B 5C3EB 3HZXA 4A3IB 3BVZA 2XNAC 3PIP3 3MFYA 2LMCA 3ERQA 1G2SA 1IL8A 2KWDA 4IQZA 3D3RA 3JAML 2RDGA 2JE6I 4N6EB 1AZPA 4USAA 3NQIA 5T1GA 5EKKA 1PRTD 2RMMA 1GUGA 4A3GB 3BVGA 4K5XA 3ZJUA 4ZK9B 3I70A 1K50A 2MJ8A 3SDZA 5EKLA 3P4RB 4AYBB 4L2YA 2QDBA 1I3QB 1YNND 2BBCA 1EL0A 2EY1A 4O42A 2VZKD 5JEAJ 1NCVA 3NTKA 1PUTA 2J4XA 4HN7A 1TVXA 3NBHA 5FKAC 4F88A 2C9OA 3BVMA 1SNCA 1XYIA 1O7ZA 2F0SA 3SR6A 1EOTA 2NTSA 1I4QA 1QE6A 5C0XH 1FXAA 3CKIB 1NYRA 1RTOA 4H44C 5EBDA 1ONLA 1LABA 1PXUA 1OFFA 5KNDA 3V3XA 3PMFA 3DXJC 4KTAA 4RCNA 1X32A 3MAQA 1E2WA 1RHPA 2K5PA 4EQPA 2F0UA 3DEOA 1SNQA 3FILA 3L9AX 5IGGA 3MP9A 1RYJA 1EU4A 3LXFA 1WD1A 2L4NA 1LTAD 3ZYYX 2BDOA 1LV9A 2F0IA 3MFGA 1JW9D 2K7VA 3DWAA 1ZP0B 1VZ8A 2EE1A 1I4GA 3QO2A 2WP8J 2F0GA 1SNMA 3Q8AA 1GAQB 3J7YW 2PZTA 4IUQA 2Y5CA 1DCZA 5M5YB 3HVZA 4A6QA 4A3FB 4KY6A 5E4XA 5EE1A 2IJ0A 3I8ZA 1YMHE 4YSYB 4XDDA 3NE5B 3DHQA 2IX3A 3D4RA 1ILQA 2F0HA 5T1IA 1T6BX 3HOYB 4HR7B 2XSCA 1SE2A 3GTPB 2SNSA 1BCPF 2RSNA 3BS1A 4A3MB 4KKJA 1AW7A 1J7CA 2WXGA 3D31A 4N9PA 2PQEA 4K6LA 1JQYD 4PMCA 2CW0C 3WCQA 1KH0A 4OGQC 1BNZA 3MVVA 1QB5D 2C5CA 2DYOA 5C6AA 1GPXA 4KI0A 4V190 1WTXA 5HGTA 4NMZA 2D5DA 3T4AC 4OO1I 1SE3A 1ET6A 4IUTA 1II3A 3S1NB 1RDPD 2JSOA 2INPE 4R3DA 5M3MB 3IAYA 2EPBA 2AQ1B 5E6JA 2J7ZA 4IZ8A 2BE5C 2SAKA 3SVMA 1RKNA 1BCPD 3IAS1 2J0TD 3SFDB 4NJCA 1QKZA 1NYQA 5CV7A 1FYCA 1DM0B 1LTGD 3EJIA 3RMHA 1E0BA 2HCIA 1NEKB 2BT6A 3AEFB 3E6ZX 5IT9E 2OEDA 1ZYRD 5I4DA 1X3QA 4C7YA 2R93B 1STNA 4RGOS 2YU9B 1KDBA 3BIID 4OVZA 1IYVA 5HG2A 2Z4IA 1ZPSA 1V97A 3AMUA 1PLFA 1SDFA 2F0NA 3JAME 2LFIA 1F9RA 2R3ZA 1I6HB 4A90A 3SE0A 4TRDA 3TP7A 4CBVA 4PMBA 3KBGA 3K0YA 1IKMA 4WRDA 1EY0A 3Q8EA 1DOLA 2CVRA 2EYHA 2M9VA 5KYLA 4KD4A 1STYA 2AUJD 4RF1A 1GHKA 4HMJA 1UGJA 2KCCA 4TQ1A 2E2DC 1A3TA 3J81E 1I4XA 4MH8A 4N58A 2MPMA 3HOWB 2BA1A 1K53A 3K5NA 1FRRA 2BB6A 3MXNA 1PZJD 2I46A 3DEPA 1QG7A 1W6JA 4RKBA 1EQVA 2JQRB 3R93A 1BXTA 3K59A 4TQUS 4U673 4XT1B 2HDMA 1SAPA 1G2TA 1GUTA 4KKSA 5IGEA 4XDXA 1E10A 5NUCA 1TYGB 1HUNA 2K05A 2KUMA 1S5BD 4YSXB 4JBWA 1PZID 3D6WA 5BN4A 1EY9A 2MGSA 2W3RA 1FR3A 2LUMA 1ZDVA 2PO4A 4RFBA 5TSSA 4RA8A 4EGVA 1XLNA 3KQ4A 4FXGC 1JWSD 5C0XI 2HDEA 2EY6A 1JOQA 1U4RA 2BS2B 4XQNA 1O7LA 1Y69U 1HA6A 1QQRA 2F0WA 2LFNA 3AH7A 1NI3A 3P7JA 1ZYRC 2L1AA 2CU3A 3PV0A 3S1QB 4M1UB 2RPVA 4C7ZA 3P1HA 5FK9C 3OOCA 3O13A 1IGCA 1M4VA 2F0FA 4EE2A 1WCMB 3ZGZA 4DGZA 4ARCA 4ZRPA 5C4ZA 2JYEA 1DOXA 4HSVA 4ZRZA 1QOBA 4ZUJA 4BWGB 3NUHB 4L63B 2DWQA 1SNPA 5C4JB 2PNRC 5KNCA 3TEXA 1TT2A 3I90A 1C76A 3EROA 1PFBA 1BQQT 3CQZB 1DOKA 1EQTA 1N61A 1OXTA 1FNVA 4HTHA 4ZQ3A 5C3XA 3U7ZA 2W55A 3NTHA 4RCOA 5EQ0A 1V1PB 3T56B 4DN4M 4NZLB 4RAUC 1EWHA 2IT1A 3VR3A 1JQ4A 2QIEB 4RH6A 4Q5VA 2K9XA 2VB3X 3GD7A 1IGDA 1F2YA 2AUKA 1EEID 2PKOA 2ONQA 3K5OA 1BF4A 3EFXD 3P42A 1CZGA 1HPCA 2BDNA 5IOCA 2JZPA 1HQRD 2FJ2A 1EIGA 3LWUA 3AEAB 3T51B 4JWSC 1HTPA 1PDXA 2NWGA 4XIGS 3OW7A 1ROEA 1H9MA 4QUFA 1IUEA 1H9JA 3FRPB 3SFEB 3SK6A 5JEAH 4IALA 1MVKA 4DK1A 3FMCA 2XIWA 2B2YA 3W1SA 1HFNA 4LAAA 1RWSA 4OHJA 5IGFA 3GTLB 2KEEA 2INNE 3KF8A 2B76B 4ZHOA 4ZKBB 1GB1A 2SEBD 1SNOA 4KMUC 4QMGA 4B0EA 2L12A 1F77A 3IAM1 3UI3A 4L8JA 1B4OA 1WGKA 1PRTB 3C3LA 5IODA 3TEZA 4C80A 2WINB 1OQQA 3VR5A 2WXMA 1JCKB 1R7SA 1EU3A 4B0MA 1PGBA 2DNCA 1HRJA 2ZW0A 4UDUC 2ICIA 3AM9A 2KEDA 1I6VC 2MEKA 5FOBB 1P7FA 3AE9B 1VZ7A 1B9NA 4XT3B 5K36H 2KHSA 4LLGM 1XWEA 1WTQA 1ZUD2 2A6HD 2KMMA 2E75C 1CK1A 2K32A 1MI2A 2WKDA 5IGBA 4CKCA 4C2MB 1YJJA 1ZE3D 2H88B 3RUZA 2BB5A 4HCEA 4WAFA 2NB0A 1EYDA 3K57A 1FCLA 4A3DB 4C3JG 1QJOA 2BYTA 5IGCA 1F2ZA 5BN3A 2NN6I 4MHEA 1LACA 3L3OC 3T16A 3S1RB 4YWGG 3HOZB 2K5WA