1V1OA

Staphylococcal superantigen-like protein 7
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
196
structure length
196
Chain Sequence
RVQHLHDIRDLHRYYSSESFEYSNVSGKVENYNGSNVVRFNPKDQNHQLFLLGKDKEQYKEGLQGQNVFVVQELIDPNGRLSTVGGVTKKNNKTSETNTPLFVNKVNGEDLDASIDSFLIQKEEISLKELDFKIRQQLVNNYGLYKGTSKYGKIIINLKDENKVEIDLGDKLQFERMGDVLNSKDIRGISVTINQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Relationships and Cellular Tropism of Staphylococcal Superantigen-Like Proteins
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Virulence factor
molecule keywords EXOTOXIN 1
total genus 53
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1v1oA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1v1oA01
2O2LD 1FNWA 1UUPA 4RHSA 1KLGD 1S5DD 1CHPD 1PRTC 2NTSA 2G9HD 3O13A 1YN3A 1SEBD 1AN8A 1ENFA 1KLUD 1HQRD 1SJHD 2RDHA 4TSSA 1PRTB 1LTSD 3TSSA 4NZLB 1LT5D 2XRQD 4L6TB 1EFID 2QILA 1PTOF 3BYTB 1V1PA 1AW7A 1EEID 1FD7D 4RGOS 4DXFA 2XNAC 1LLRD 1YN5A 1GOZA 1PZID 3R2IA 1I4QA 1S5FD 1V1PB 1S5BD 1TS2A 2IPKD 1PYWD 1PZKD 2Z8LA 4OHJA 1PTOH 1RF2D 2RDGA 1EU3A 1I4PA 1LTBD 1I4XA 4DXGA 5ELCA 1LT4D 1SBBB 3BYYB 5D3DA 1QILA 1JR0D 4RCOA 1HXYD 5ELEA 5ELFA 4UDUC 3W2DA 1PZJD 1BCPB 1LO5D 1S5ED 3DWAA 1EEFD 3R8BA 2XN9C 1LT6D 1D6EC 3EA6A 1D5MC 1RDPD 5I4DA 4RGMA 1I4GA 1PTOD 2XRSD 4L63B 1PTOC 5D3IB 5FK9C 4BWGB 3EFXD 1SE2A 1D5XC 1L0XB 1STEA 1FNUA 4RFBA 1V1OA 3CHBD 1UNSA 1CK1A 3URYA 1JWUD 1LTGD 3KLSX 2CHBD 1DJRD 4O1NA 1LT3D 1YN4A 4RH6A 1JWMD 1LTID 1BCPD 1PRTD 1LTTD 3OWEB 4ZYSA 1MD2D 1I4RA 3DWQA 2TSSA 3BVZA 3GP7A 1TS4A 3MC0B 1ESFA 1F77A 3R2TA 3DWPA 1BXTA 2IJ0A 1FNVA 1M4VA 4RGTA 1TS3A 1DYQA 2AQ1B 1TY0A 2NTTA 1CQVA 1S5CD 2SEBD 1RD9D 2AQ2B 5FKAC 1LTRD 1XXGA 2QEJC 2WV6D 1JCKB 4Z9CB 1SXTA 1JQYD 1TS5A 1JWSD 1BCPC 1PRTF 5ELBA 5ELDA 1HA5A 1EWCA 1EU4A 1FGBD 3BZDB 1ET6A 1HTLD 1CT1D 2J4XA 1SE3A 3BVGA 1G8ZD 2R61A 5TSSA 2AQ3B 3SEBA 4RHRA 4K6LA 3V05A 1L0YB 1XTCD 1B44D 4RGNA 1KTKA 4C56C 1SJED 1ET9A 3BVMA 1D5ZC 3MFGA 1PTOB 2ICIA 1I4HA 1T5XD 1CHQD 1TY2A 1B1ZA 1BCPF 1RCVD 1LTAD 1SE4A
chains in the Genus database with same CATH superfamily
1GXDC 2NBFA 2JEBI 2UYZB 3OMCA 2CJNA 1I5FA 1Q90A 2C35B 2M00A 2NTSA 3WOEA 1L6VA 3DVNV 2KLGA 2KWDA 3IHPC 3QWZB 2BA1A 3RUIB 1WCMB 3I3CA 1P8LA 5FJ8G 2Q8TA 1D3ZA 1YNJC 4GDLB 3MJ5A 4DNIA 3RN2A 4MDKE 5J3BA 2FMMA 4DHZE 4H13C 1IKLA 5T1GA 1W2BA 4A3JG 3J7ZC 3PSIA 4CJ2C 2JA7H 1RKNA 4NY0A 1N62A 4OO1G 3PHWB 1PTOH 2WNMA 4WH4A 3ND8A 2ZJRA 4OEMB 5COYA 2TMPA 4GN3B 2ZM6L 2M19A 5GROA 2LRUA 1WOCA 2OXPA 2R6GA 4OELB 2L0TA 1I94Q 1EYGA 3GTKH 1SSNA 2CCZA 4HJGE 2L1AA 1YJ9A 2OEDA 3HOVB 2J53A 5G5GA 4BFRA 4HRSA 1EL0A 3S1QH 4JBJA 2KACA 3R3MA 3S24A 3W1SA 4IFDJ 3PT2B 1Q1OA 5LMNQ 4ARCA 3GDEA 1ESRA 1EZ6A 2KDFB 2KCMA 1WD1A 2NZHA 1SMYC 2PMZB 3PGEA 3QIJA 3OMGA 4LUOA 4A90A 1X3GA 3HOUB 1XCQL 5C4XH 1DGJA 1L6UA 4MACA 2KANA 1VQ7A 2UXBQ 1DZ1A 4N8X1 1P1AA 2MFIA 1E7VA 1OFFA 5KHOA 3BVZA 2Y5BB 4IKGA 2YTVA 3RNAC 4ICUA 2ZPYA 3KH0A 4ZK9B 3ICEA 2E2IB 3DBHI 2AWTA 1F2MA 3AFPA 2E2HH 1D7QA 3NBHB 1TY0A 1SN8A 3U2SC 5G3LF 2K01A 2NPTB 4C80A 3GV3A 4GLAC 1PDQA 1EF1A 4MEMA 1F9QA 1SF0A 1WGYA 2WV6D 4ME3A 1PUTA 1MI2A 1SXTA 4C3JG 1JQYD 2L55A 1B3AA 4NB3A 2LY7A 2K03A 3DBHB 4KHZA 5CBEE 3QHTA 4KDIC 1GAQB 2DYBA 2NZOA 4DKAC 1K8MA 1PH2A 4P1BC 1BR9A 4XDDA 3G48A 4ZHOA 1DOYA 3JAMc 1Y8PB 4BXXG 2PMZE 3L2PA 2E2JB 2EXZA 2V9HA 1EFWA 5C44G 1CQFA 3OWFA 2ZXPA 4KHPL 1SE3A 1NI3A 1E8YA 4C3HG 3K0XA 2L52A 1GO3E 4RHRA 1FXTB 1A2UA 4HJ7A 4A3EB 2RR9A 1VCIA 4GN4B 4IPDA 5D6JB 2NB0A 4DR7Q 4HIKA 3VDZA 1KTKA 4M0WA 3H3VC 3JAMi 4ANVA 2JWZA 3DWGC 4IM2A 5J22A 4BKSA 2VY3A 1PTOB 2K33A 1Q86C 4GLXA 1HR0W 4LF6Q 3HOWH 1TY2A 1CUKA 3ZYYX 3CCMA 4A3IB 4B3RL 4QF4A 1XPRA 2ES2A 1FPYA 3Q6BA 5NUCA 3HOVG 3DBRB 4LNIA 4A3DH 4DHJB 2CJOA 4A3GG 2B63B 1Z5SB 1WXAA 4HPMB 5BN4A 3U30A 3ECIA 3I3TB 1WCMH 2Y0SE 3RFZB 4BBRB 4KN7C 2E5LQ 4RM9A 1V1PA 3I55A 3OJ4B 1LLRD 1NSNS 1YJJA 2LGSA 3UI2A 3SDZA 1HH2P 4J1MA 4R8IA 2A5UA 3U52E 2WIIB 5IWAQ 1BUIC 4OW0A 2W3RA 2Z1CA 4LF7Q 1WZ3A 2HHHL 5E3FA 1UE7A 3PIP3 2WAQB 3X3MA 1JT8A 2IBIB 1N36L 2Q2UA 4QAYA 2JVCA 3ZNGC 2KXJA 3NEMA 2WB1E 2JQRB 2KHWB 3NY5A 1MHHE 1FVIA 3AEEB 4N9TA 4MJSA 2KQ4X 2MX2A 3MXPA 4Q0FA 3TRZA 5KYLA 4TV3A 2WYQA 3FILB 3RD4A 3WAOA 2VQFQ 4MJSB 1CKOA 1V86A 2WXMA 3T13A 1U4AA 2SNMA 4BBSH 3PPAA 2EY2A 5C0XG 2OHFA 4H0LC 3D6CA 4L5TA 2PE6B 2FCQA 1XMQL 4LCDE 4FXDA 1T0YA 3PUZA 4MM3A 3SU8X 1HZ9A 2F0FA 2KVZA 1ZDXA 3FRPB 2Q8RE 4X64L 3MXNA 2AYOB 5IE8A 3A56A 4X62Q 1WRIA 1ENCA 1K51A 3AV8A 1K3RA 1NBWA 2B2TA 1A63A 4POFA 1C76A 2ZJDA 1XX8A 4LF9Q 1CMXB 3AYHB 1TWGB 2KQ7A 4W9IA 2WXPA 3S1NB 2YEPF 4Y7NH 4REZA 3ZIMA 4IFDH 4PYUA 2K5NA 5I2YA 2V3NA 5JEAG 2KJRA 4NPSA 1HNXQ 2VZKB 3QX1A 5EBCA 4DN4M 1WIAA 4JE3B 3NOBA 1UD7A 3ZDMC 2RHSB 1M8AA 3TIXA 4B9XA 2M9VA 5FR3A 4HPLB 4A76A 5IGDA 3HKZG 3AE9B 2A69D 2DNCA 1CSPA 2G5DA 3AE3B 5IYCG 1JCKB 2PNRC 4AH6A 1TS5A 4LFBL 5DM63 2PI2E 2KHIA 2D0PA 2E8GA 1SB3C 2F0MA 3SVMA 1XNQL 1SRUA 3PS6A 3KBGA 2MWSB 4HCPB 4PQXA 1ET6A 4W9JA 4XWTA 3T3OA 1TKGA 4BBRG 1JJGA 5GMVA 3ZNZB 2J7QB 1GUAB 2UUAQ 2SDFA 2ZCCA 2IYDB 1GVPA 3GV6A 5GQOA 3G4SA 2D11A 4URKA 4A3MH 5ISRA 3PO3G 2B29A 2R93H 3AULA 3HK0A 1TU2B 1SJED 2KX3A 3J7A5 3S2HB 1T0SC 1J0GA 3CQZH 5HY6A 1H9SB 2A4ZA 2MLBA 3HGBA 4LF8L 2KNBA 1SYFA 3V6CB 4FULA 2P5ZX 4OWXB 3QB3A 3GP7A 1KAWA 3IFTA 2VQEQ 5M3FG 1RLFA 1A0IA 1JWBD 1NTGA 2ZXRA 1STHA 1AWDA 1TWHH 5DLQE 2NVTH 3CCSA 4AYBG 1F2ZA 1EO6A 4DV0L 3DM3A 2EXDA 1ENAA 3QK0A 3APDA 3H7PB 4IUQA 4IUTA 1L2NA 3KF6A 4JOIC 3SR6A 1CZGA 1OO9B 3MTSA 4DBGA 3IG3A 2X6GA 1WSPA 3QJYA 3PRZA 1S5FD 3E6ZX 3NPPA 4K8JA 3S1RH 5IT9L 3S14H 1QOBA 1KJTA 1R4NI 4C1NK 1IBKQ 4JL9A 1EU3A 1NAPA 1WTHA 4LF4Q 1LTBD 2ZCBA 2KMAA 3C8YA 3P4SB 1CSQA 3Q69A 2LWPA 1W6KA 4GKJQ 5AUIA 2KECA 3W5UB 2Q8IB 1H95A 1E0BA 2EVBA 2B63H 2VUMG 1U4RA 1X6OA 1OXVA 3U4VA 4JBKA 3LGJA 1BCPB 2KAJA 2WLBA 2WXLA 3RLFA 4KK7A 5C1ZA 1EEFD 4MELA 2I5HA 1H9SA 4C3JB 4K7UA 2M0XA 3M95A 4OX9Q 1TZOA 5CHVC 5IP4D 1JC7A 2K5WA 2XRSD 4DR3Q 4JI0Q 4BAXA 5C23A 2QDFA 3AE6B 4A3PA 5HFYA 1JMLA 1NEKB 3L54A 3PQIA 1O7IA 3RNGC 1O7YA 1EUVB 1KF6B 4WWMA 4RH6A 3TZDA 5E6NA 3LWUA 4ASWC 4M00A 5L37A 4F8CB 4MTKA 2LMCB 3MC0B 3PV0A 5HHDG 1RWSA 3VUWA 5EPKA 5GXGB 2VS1A 4R9WA 1ZKOA 4UY8C 1D4BA 1UGMA 1ZPSA 4L8JA 3K7AB 2Q2HA 3A5UA 3Q23A 2INCC 3J80E 2NPTA 1UF0A 4RMAA 4OX9L 2XK5A 4DAMA 1MG8A 1WX8A 4LFAQ 1IW7C 4HR7B 1YHBA 1I6HB 2AL3A 1SIFA 1ILPA 4CDCC 4RM8A 3EFUA 4YTPB 3LJ3A 3JC66 4TQ1A 2PYKA 5AZGA 3GTQH 2OTLA 1ZDVA 4MN3A 4KD4A 4KTAA 4KSLC 2MHJA 1QWYA 2PQAB 1WX9A 4EEWA 1GHJA 2K6AA 1FGBD 3PO2H 3A0JA 2GB1A 5BYSA 1Q8KA 1NJIC 5BR8L 1YMHE 2MBBB 1Y1VG 1FEHA 4M1UB 5TSSA 3AE5B 4NAWB 4JBMA 2X69A 3VYUA 3P1MA 2LGYA 2N9KA 5HGQA 3RCZA 4IUPA 3CCVA 1WH3A 3Q3NC 1X55A 2X38A 4ZDVA 4DV1Q 4HKQA 1CM9A 2AEHA 2YV5A 3WDNA 5FLXc 5FR6A 2HDMA 2IY1B 2O5IC 4JC0A 4GKJL 4KKTA 1IBXA 4DV2L 2NVTB 2PPHA 1JE5A 3N1YC 2GBKA 1MSGA 1Y69U 3KLSA 2BYFA 2MBHA 2R7DA 4RAUC 4R1JA 1BCPF 2J0KA 4GU2A 2AWOA 3VR8B 1BMLC 4HJ8A 2LZ6A 1SYDA 4ZRPA 4S17A 1FMAD 3O13A 4EVOA 2PTLA 3N32A 3TBLD 1KLUD 2HDLA 3WIMA 3X23A 4YXDB 5JOBA 3MHZA 4FO2A 3ERQA 3I7FA 1PRTB 2ZJQA 4LF8Q 1LTSD 2XK5B 4DQOC 1LT5D 1EFID 3F2DA 5M3MB 3WCQA 3NP8A 3KVFB 1Y14B 4GLVB 2QCPX 3MZ5A 3TEHB 2K8BA 3NWTA 3EECA 4HDQA 4C00A 1DOKA 2EQSA 1QZEA 4YHHQ 2L00B 4DK5A 4PG3A 3Q8FA 3GE8C 4BY7G 2AWNA 4KD3A 2R93G 2DUDA 3PRMB 4GNXC 1SNDA 2UUAL 2LMCA 4NJ6A 2L15A 4KVGB 3VH4B 4CDFC 4S3SA 4CHTB 1GC6A 2K5PA 2JK8A 2IO0B 2LFIA 1WXQA 1JWAD 5KNDA 2SNSA 4UDUC 2KFKA 4HDOA 3S2HH 3BDCA 1F9SA 1GJXA 1HPCA 3DWAA 4A3IH 4DV3Q 1LACA 1YNXA 3H94A 4EE2A 2B2VA 4G57A 5F2DA 3O65B 3NQIA 5C0XI 1QUQA 3BY4B 5IYCH 1I3QB 3HZXA 3N30A 4DV1L 2MEKA 1SE2A 1I42A 2KLCA 1D5XC 1L0XB 1STEA 1F1HA 4B95A 1T9HA 2G9DA 1WJUA 4JI7Q 5H1SE 4QL5A 4LFBQ 5HURA 4MHEA 5AJ3L 3H0GH 2M56B 5BR8Q 1TWAH 1UGJA 1U5KA 1WR6E 4ANUA 1NE3A 3DWQA 2MP2B 3I57A 4F87A 1EZ8A 1WRDB 1YVCA 3R2TA 4WJPA 3VFKA 2K7VA 2PIAA 2I1KA 2WQYB 3OOCA 1LGRA 2KQSA 5ELOA 3NUCA 3DDCB 5E6JA 3MXNB 1ICFB 4CJ1B 3TREA 3AEDB 3TEXA 1QZGA 5IGEA 1VQKA 2BYVE 4JI4Q 3TMEA 3UIPB 5CMDA 3VTWA 1Z6HA 1XXGA 4AWJA 4Z9CB 2MJDA 3IAS1 2VQFL 4IJHA 4US8A 1JWSD 1TWGH 1PRTF 4NP5A 1OXXK 5E4WC 4BKTA 2PW5A 2QA4A 1AYFA 1L4DB 2JWUA 5ELDA 1EU4A 3LWEA 4PV1C 3ABVB 3VR9B 1EY8A 2B39A 4J6HA 3N6RA 3QIAA 4GGQA 4BOZB 3L10B 4HIMA 3H7SA 3DM1A 1KDAA 4R4TA 1EY4A 1VQ5A 3I4MG 1K3BC 1HNWL 2K50A 3J9CA 1ROEA 5L83A 1GM5A 1RHPA 4F1SA 3FC4A 5IY0A 3ZVVA 3M9BA 5E1FA 1KIXA 2KKCA 4P1CC 2G3QB 3GZNI 4XYQA 3RZDH 3CRKC 2SAKA 3OW7A 4N58A 3DVGX 3UDGA 4H02A 2ICEC 2KFKB 1RFKA 3U9OA 1N36Q 1KD1C 1GPXA 5JXVA 3T1YL 1KLGD 3RN5A 4JI1L 1PRTC 3I73A 3K81C 5K36H 2J52A 2REXA 3MP9A 3H0GG 5CV4A 2RF4A 3KQ4A 3PREA 4P7IA 1SFOB 1IBLL 5M3MH 3W9CB 4LK0M 1B9RA 2V4LA 3BYTB 1TKYA 1NR2A 3DBLB 1STBA 2F0KA 2KC2A 3C1FA 4J3OD 3RLOA 3CCJA 1YJNA 4BKSD 2N8NA 2YYZA 2B2WC 3AEBB 3PUXA 3UF8A 4DK0A 3SE0A 3UDFA 5E6PA 3U7ZA 3ER0A 5LXHA 1IYUA 1VQAA 4HKZE 2RDGA 4RG1A 4CQNA 5GADC 1BO0A 1UELA 1VZ8A 4XT1B 1A3TA 4XIGS 4LF6L 4LLGM 1E2ZA 4Q5VA 1JR0D 1PFMA 1E3PA 2L0FA 3MJWA 4FADA 2D07B 2N9PC 1C4PA 4NPNA 4FVMA 1PMRA 4DUZQ 2RKSA 4X3KA 5IYBH 1YJ1A 2GMIC 2F0SA 2E75C 3PV1A 1GUGA 4WAFA 3J81E 3IAM1 2GOWA 3QWNA 1B2TA 1QT9A 4TQUS 2BW2A 1ML0D 2JA5B 3BDOA 2AL6A 2ZTDA 4W9HA 4KHPQ 1QZHA 2K8CA 4MM3B 4K3CA 5CYUA 2ASBA 2JZPA 2JZZA 4MSQB 4QB4A 1YIWA 2M1MA 2ZEQA 4ZRJA 3NVWA 5CV9A 2DY7A 3GTOB 3PZDA 3AMZA 1STYA 2WGSA 1W6JA 4ZKCB 4E71A 3T16A 3N9YC 5J17A 1PLFA 4PZ8A 3KJPA 1WTOA 1RODA 2F0PA 3DWMA 2TSSA 3P75A 2WXNA 3BIID 2L5TA 1FR3A 1FO4A 1NYQA 4WJ4A 2BF8B 3A9KA 1B8AA 4IUMB 4FP5D 3SR1A 4TRDA 1V8CA 3HOZH 1SNCA 2ASQA 3PTFC 1I6VC 4OZCA 2IHEA 4A20A 1WE7A 1U4PA 1EY5A 1CQVA 1K8OA 1NI2A 5C3JB 2BTEA 2BB5A 2HTME 3NELA 2YLMA 1JROA 1WTRA 4A3BB 4HXDA 3RZWC 2FMCA 3UQBA 3OJ3A 1I94L 1PH5A 2GBMA 4YCVA 1UBIA 4ITKA 5D65A 4G7HC 2RDBC 3D4DA 2NN6G 1YD8U 3PZ8A 1UE1A 1WMHB 3A1QB 2L7RA 3TEWA 3KF8B 5EGTA 3P20A 1JICA 1YQ3B 2KTRB 2HE7A 4M0WB 3Q24A 2LJIA 3QA8A 2B2UA 2QCZA 3KFUA 5D94A 2DZKA 2Z4HA 1B44D 3VA7A 5L95C 4G7ZC 3HHMA 1UWXA 4EQNA 2PVGC 5LMUQ 4OO1H 1JW9D 4K3BA 3CMEA 1E6EB 1SSOA 3AEFB 1T5XD 2E76C 3GTLB 4GNXA 3HM6X 4JLCA 2N88A 4K2LA 1TWCH 2OQKA 3N3KB 1LUZA 5FO7B 4WJ3M 1XLQA 2R2OA 4WJQA 3EBEA 1G291 5KYIA 2NVXB 3SK5A 1N34L 2G9HD 4FBJB 1YN3A 4PK1A 1SEBD 3LB8C 1AN8A 4JYAL 2M17A 1WJ4A 2WX1A 3HVZA 1QF6A 2B76B 3AE1B 1SJHD 3I91A 1QCBD 4TSSA 3PLVA 1JE4A 5CV6A 4G3XB 2HD3A 2JA5G 1F2RI 4M02A 4NZLB 1MG4A 2WU2B 4HK2A 3PHXB 2WB1G 2QILA 4IM3A 4ICVA 4RGOS 3KDFA 2F3WA 3BZCA 5A35A 5HGTA 1VCBA 3RNUA 2B2UC 1WF9A 2BWFA 3TEZA 2WXFA 2MJ8A 2IPKD 2PPBC 1M94A 2YTXA 3S1MB 2KUMA 4DR5L 4JIOU 1GJZA 2W54A 2A8VA 1P7EA 4YSXB 1C9FA 4AYBB 2E5LL 5G55A 2LFNA 1ZGUB 1OTCA 3H6MA 3NG0A 2UUCL 5E6OA 1NBFC 5C44H 3RMKC 1SR3A 2A6HC 1VQLA 2LEKA 4X66L 3GTPB 2DHZA 1QILA 1KAAA 1MHWC 3WAMA 5ELEA 3BZKA 5D14A 3DVNU 3VDYA 2MA9B 2BDNA 4KY6A 2BYTA 1RTOA 2F4IA 5C2TB 1ILQA 2K9XA 3ENEA 2NN6I 4B3SQ 4DDID 1WJNA 3W5VB 3EA6A 2ATWA 2ZW1A 2IWHA 1NVID 2B2YC 3CW2C 5E7NA 1ZW7A 2WXJA 4YT0B 5FLXL 1QVFA 4YCUA 4JPBW 3C1EA 3PCOB 1PH9A 1QQRA 1XQQA 4IPCA 2L1BA 2K6QA 2F0UA 1JRPA 2KA7A 3CCEA 2D9UA 3PF4A 1VZ6A 2VXWA 4L5QA 4RFBA 2X6LA 1WYGA 1N63A 3DQVA 2ZZPB 3S17B 2KHSA 3OW2A 1WY8A 5IO9A 1E8WA 2PW9A 4IFDI 2HIVA 1PRTD 2MQJA 3OWEB 2F3VA 4F7ZA 4LNFA 3HG9A 5M3FH 2PMVA 4CDEC 1YIJA 2EYFA 3FVQA 2N3SA 4G4KA 4GMVA 1JRUA 1CKNB 1CA5A 3CC7A 4AQYQ 3TEYA 3CF5A 4NMZA 4YWMA 3MAQA 2CS4A 4XGAB 5EPJA 3FP9A 1U4MA 3OTOQ 4QJFA 1YX5B 1QOHA 1TIFA 5T8IA 1W3SA 1BCPC 5EE3A 3SHLA 2I5LX 4CYEA 5M5XB 1F52A 4HSVA 1EWCA 2EYJA 2A68C 1J5EL 4IZ8A 1T0RC 3AXCA 3S9WA 1K8GA 2DAJA 2BE5C 3BVGA 3MVVA 4L5SA 2X8XX 5IYDH 3ZTCA 5JZEB 2PZTA 2Y5PA 1MSHA 5LLIA 2L3ZA 2FE8A 4ZUJA 1GUOA 1L0YB 2MPMA 1FIQA 4C3HB 3EFCA 4TUUA 5H8YE 3GO5A 2HQLA 1HUMA 1ZXHA 1YNNC 4EZJA 3SFDB 4TQ0A 1VMCA 1ZYRC 1K83B 4BA1I 2LRWA 4E3CA 2BH2A 2JE6I 3J7AF 5LMNL 2BBCA 2FBWB 1A62A 2FUG1 3VXWA 2UUCQ 1VF7A 4P71A 2IGDA 3B08A 2YU9H 3AECB 1C3TA 3I4OA 3QCAA 3A8KE 3SDLC 1S5DD 1E7PB 5JEAH 4DR5Q 2LXKA 3DHGC 1A2TA 3U58A 3AN1A 1VQEA 1N8RC 1B9NA 1V81A 2BYEA 1G6PA 3P7JA 3ND9A 2ZM6Q 2GLSA 3VUYA 2V3SA 4DR6L 2PVOD 3UIOB 4L6TB 4JI1Q 1AE3A 5GAHC 3ZQ4A 4HCNB 1STGA 4BY1H 1T3QA 1E8ZA 2QEXA 2WINB 1PZID 5EQ0A 3R66C 3DXJC 2NVXH 1EYCA 1VDZA 2CH4A 1TS2A 2CWPA 2JQOA 2Z0SA 5C6AA 4B3ML 1DOMA 4HMIA 4JYAQ 4YTNB 1EQRA 3GTGB 2WHIA 4DHJD 1HNZL 5BMHA 5JJKA 1JB7A 1U9RA 4X65L 4DU9A 5C4ZA 3TS2A 4WURA 4KSKC 2KX0A 3T1HL 4Y52H 3VUXA 4JV5Q 5HKHA 1V5TA 1DD2A 4KKUA 4K8IA 2FINB 4NAMA 1KC8C 1PZJD 1ASYA 4XDCA 2PLPA 2E2IH 3PO2G 3M7GA 4DV5L 4WWPA 1R4NB 3I4NG 1J6QA 5IGCA 3L0OA 1YHQA 4FN2A 1VMPA 2KWCA 2LGXA 4MH8A 1WJJA 3Q0AA 3UE0A 3KUDB 1H4RA 1Q1EA 5FK9C 4ARIA 1U0LA 3JAME 1KHIA 4XWWA 3U7DA 1NMFA 4X3SA 2L9HA 1HZAA 4ZRIA 4A3BH 1TWCB 1WFQA 2QC8A 1KDCA 4R8NA 4LNNA 1NUCA 4ULLA 2CHBD 1C79A 2L83A 3J81j 2VZKD 3A4SC 4AOFA 3A9JB 5I6YA 5M5XH 4IALA 1S72A 2Q2TA 2FCNA 3RR5A 2L05A 4AP4C 4EKUA 3E3XA 3UINB 1I50B 1TBEA 1O7ZA 3SFEB 1QVCA 4G0NB 2NMQA 1HZBA 1I50H 1AARA 1ESFA 3D3RA 2GI9A 4H44C 2KDBA 3I2ZA 2I0QA 1BXTA 4ZHPA 3HOVH 2IO1B 4LFCQ 4AJWA 4NXNL 2A73B 3VYSA 1NY4A 3ZJUA 1DYQA 4HIDA 2B2VC 2F3IA 2HQEA 1QLBB 4OWTB 4A3GB 3H0GB 4GDLA 4DF7A 4A3KH 1C7YA 3ZKJC 4G11A 3PRPB 2DNEA 3NBHA 4HIOA 3HOZG 1L5PA 4UP7A 2EELA 4OGQC 2M8SA 4GN5A 2VH2A 3I63C 3I9V1 1VF5C 1A6XA 3PO0A 4WIPA 5IP9H 2JA7B 4A3JB 2F0NA 4GOPB 1QNKA 2H89B 1TR5A 2GVBA 4OVUA 1L1OA 4NJ7A 2WP8J 1PXUA 5BMIA 3BZDB 3VA5A 3GZNB 4LNOA 4KJOA 3VYRA 4JI8Q 1PVOA 3Q3JA 1PYSB 1G8ZD 3EGRA 3L08A 4BVUC 1HR0L 4DHZB 3HOZB 1C78A 5EKLA 1ONLA 5JPNC 4EX5A 1ZE3D 1EWYC 3V05A 1KH0A 3TP6A 3QARA 3ZNHB 3S1QB 5JVG3 3D4WA 1IP9A 4FF2A 4MH0E 4K5WA 4BY7H 2BVCA 4RGNA 4C3JH 4A3LG 4PMWA 1D5ZC 1QOAA 3U9SA 2MBOA 2VUMB 1TT5B 2KOLA 1RL2A 3GTPH 4KV6A 4WORA 4W9EA 3ULPA 1GUNA 3V61A 2KHJA 1XMOQ 4K1RB 2IX0A 1U4LA 5BN5A 2AHOB 3P2BA 1PH7A 1WYDA 3DBRI 5FLMG 3AU5A 3ZTDA 3FPPA 2NVYB 3EJIA 4GKKQ 3KUPA 4DR1L 2XRQD 2RGFA 1PTOF 1N5XA 3NZ3A 5CHWA 4DXFA 2VNUD 4QMGA 4A55A 3HKZE 3PO2B 2F0HA 3NHHA 4ZRQA 2N4FA 1CJEA 3ZW3A 1FXIA 1HJPA 2N49A 4DV6L 3N52A 3PUWA 2J0MA 3SK4A 4BBNF 1PYWD 3K7UC 3MWYW 1TYGB 1VDVA 1EOVA 2BT6A 2BKRB 5DEHA 3S15B 3IT6B 4B08A 1Y8OB 4LJPB 1L0VB 3KYHC 2EPBA 2EJFC 1WVLA 5C4HA 3PVLA 2FUHB 3HM3A 2ZTCA 1VQ9A 4C4VA 4KV2A 1DOLA 3K59A 3AB9A 1BUVT 2OWOA 4KDLB 3VR5A 3NENA 1EWIA 1I4GA 1WXVA 2XWBB 2EY6A 2Y5CA 1PTOC 2UU9Q 5CBAE 1F2RC 2WXKA 1J7AA 2PQEA 2Z6BA 3AQQA 4JI5L 1E2WA 1E7UA 3MA2B 1LTGD 1LTLA 1HZCA 4LFAL 4K0KQ 1MJCA 2OJRA 2JY6A 3E9HA 5EBDA 5FJ8H 4FA6A 3TUOA 5DPSA 1GD7A 4JI2Q 2H4OA 5FOBB 1BCPD 1EY7A 4UPAA 2A1AA 1KL9A 2KCNA 2EYLA 4JI2L 4P6VF 4LK1C 4JI4L 4H7BA 5C5LA 1GB4A 3S1NH 1N33Q 3Q8DA 1TZ1A 3A4RA 1KABA 4JK1C 4EQ5A 4II3B 2LASA 1FNVA 2O6VB 3NSWA 4BY1G 1E7ZA 4GOPC 3M4YA 1SMXA 3RZOH 1DXMA 1I35A 3KUCB 3RNFC 4KGTA 1YZ6A 1Q12A 2VZAA 1FXAA 2UWQA 3UQAA 3ZDTA 2F1MA 4IOAA 3M4OH 2NS5A 2EKIA 3E9IA 4A9AA 3P63A 3B1LX 3WA0A 3PF5A 3BINA 4QQBX 4DR3L 3OIQA 2D2CC 2PJHA 3KF8A 4JI7L 3CSFA 1WMHA 3CRLC 4FXCA 2B8FA 4BBSG 1A3UA 2D3CA 1RAXA 2PI2A 1ISNA 3Q8EA 4FJVB 3ZUNA 4WJWA 3M85A 1N5WA 2PO4A 4CKBA 2R7FA 3CPWA 5C5MA 5KHQA 2E74C 1WTPA 1PFDA 1UBQA 1N9WA 4BS9A 4K7WA 3W1SC 2WXOA 4KN4C 1FJGQ 2EMTA 4U673 1C48A 1WTXA 4LF4L 3S2DH 3GTJH 5C44B 4HPPA 2JA6G 1RIPA 4C2MH 4W9LA 3D32A 4BBSB 5BO4B 3VRAB 3BVMA 3MFGA 5LL6S 2BGFA 2JRHA 4GS3A 4G50A 4IURA 4N9F4 3KYCD 1Q46A 2XSCA 2WDRB 3V62A 3J81L 2N1WA 2A6HD 2SOBA 1LTAD 2V3PA 2N9LA 2NBVB 4RF1A 1YEZA 4KY5A 1WCMG 1FRRA 2JPHA 1H9JA 3AEGB 1FL0A 4C3IH 2KCTA 2DYOA 1EIGA 1L0WA 1QG7A 1T5EA 4C3IB 1WXMA 2EYHA 2EJMA 2MNAA 2MW5A 4I6LB 3H3VH 1Q0WB 2HJ8A 2Y3AA 5DPTA 3ZXRA 2OJWA 1FD7D 2VQEL 1ZKHA 3T9LA 1IYFA 1WFYA 3J80i 4II2B 3A74A 3Q8AA 5M3MG 3Q8CA 1PDXA 4KLKA 1MBYA 3CMAA 4OVVA 3L3OC 1PZKD 5EAYA 1PQSA 4OXPA 1EIHA 2RVLA 3HKSA 4C3IG 3S15H 1Z2MA 4XQNA 5FLMH 4C4VB 2EJGC 5D7GA 3A54A 5CGKA 1K50A 2FNJB 1S4ZA 5D3DA 2FIDA 4C3HH 3ONAB 2K05A 1PV4A 4JI6Q 2L4NA 1A70A 1LYLA 4R3DA 3SHQA 4IWPA 3QR8A 5DM73 3S2AA 4EGVA 4HTHA 1XWEA 3I70A 2IX1A 5EKKA 5AEKB 4AQ7A 4LJZC 2K1BA 4YIJA 1G2TA 4A3LH 4A3EH 1C0AA 2JA8H 1N32Q 4DAPA 1IYVA 2LI5A 4B0MA 3ULJA 3MC9A 4N8FA 3URYA 5M3FB 1XD3B 1JWUD 1XF5L 2JUOA 2LXCA 4RWSC 4S0RA 1BKBA 3DHHC 4GB9A 4O1NA 3FKIH 1Y1VH 4KKIA 2RHQB 3I8ZA 2B2TC 4R4CA 5AFWA 1G91A 2C9WB 2ONQA 2YEPB 2DGYA 3FKIB 2Q5WD 1MD2D 4CHKA 2KDMA 3KWVA 4KKSA 4B9KA 4EQPA 1B9MA 1N33L 1RRBA 3QO2A 5D2MB 3NZUA 1TWFB 3QQ8B 5J18A 3ZLZA 2IJ0A 4PZ6A 5CORA 2JA8B 4HCEA 1B53A 2PZUA 1YJWA 2N9EB 5C4XG 1VQMA 1IGDA 1WGGA 1S5CD 2K52A 2QGQA 3G71A 4ZYNA 2KC1A 2QEJC 4KIKA 1KLVA 3K5NA 2K4KA 2QKIC 3P4PB 2G45B 2VH1A 2KWVB 4WQOB 2KEDA 4LMQD 3T56B 4WFN3 2RA4A 3AE2B 2D10A 4X65Q 2A68D 5KRUA 5K5PA 2LS01 1P0RA 1S1QB 4JI3L 3SEBA 3V60A 3M3JA 2J42A 3Q14C 4B3TQ 2DZJA 1D1IA 4A75A 4KGRA 1SDFA 4MGKE 4JW0A 3MXGA 1VQIA 3UE1A 5C3WA 1CTMA 4JI5Q 1YBYA 2MJEA 3VTUA 2VW9A 3APCA 2N78A 3OIPA 4FNFA 3GS2A 2CQOA 2UU9L 3AM9A 4XQJA 4NXMQ 1C4QA 2ZNVB 4KJNA 3KDFB 5CHFA 2HHHQ 4IC7B 2IO2B 4LF7L 4ME5A 1V6EA 2NN6H 3TJPA 3J81i 4DXAB 2F52A 4DUYL 3DBSA 4C7YA 4IPHA 2ZNVC 2B63G 2OF1A 2Y0SG 3ML8A 1P7FA 1K28A 1A8VA 1Z7TA 2F0DA 1AFPA 4HMJA 1X9NA 1YX6B 2O4XA 3CF6E 1CHPD 4I7AA 4RCNA 2E6XA 2MSED 2XBBC 3E0JA 2W82A 2G1EA 1AE2A 2O2VA 4A3OA 3G6JB 3MHBA 1YI2A 4P74A 4P72A 1MJEA 4RKBA 4ZUIA 1C8CA 1GUTA 3RULA 2XNAC 4B3RQ 1E8XA 1E22A 4DV6Q 1B50A 1SE9A 1AZPA 3MTNB 1TJEA 3BK2A 2RBMA 2OT2A 3SGIA 2ZVNA 3PLUA 4GN1A 3DEOA 2EKEC 1UWVA 4AYBE 1PH3A 1BQQT 4MGYE 3EROA 2D3AA 4GDKA 1VQ8A 1TKEA 3FKYA 1J5EQ 3M3YB 3S1RB 3VR3A 2A74C 2I1JA 2KOXA 4N59A 5I9OA 2B8GA 2NUCA 1SNQA 2FHTA 2J7ZA 1GHKA 4NQLB 3HOYB 4JI8L 2J0JA 1EQTA 2LD9A 3V6EB 1JORA 1R4MB 4FHJA 4EOYA 1K0RA 3E5SA 4GOCA 3ZGZA 4HEA1 2LUMA 4LUZA 5HI1A 4CKEA 2JZ3B 2BWES 2OEOA 4B0EA 4OO1I 3W3AA 2QIEB 5D3IB 3NWSA 3PO3H 3EFXD 1I6HH 3Q2AC 3AI5A 4QUCA 4K2KA 5C4XB 1K53A 1CK1A 4RKLA 4QGUA 4A3CH 3Q6SA 2VRRB 3KLSX 4IJLA 1XNQQ 3AMUA 1E5WA 2C60A 3NVVA 1JB3A 3X3NA 3K58A 4FF1A 2F0JA 2OQ0A 1GUSA 1JWMD 3HRDD 3E0EA 2CHXA 1SGHA 3KLWA 4L2YA 3GQBA 3JAML 1HQMC 4YSYB 3E9SA 2F0EA 2QDLA 4DAVA 1WGRA 3WANA 1TS4A 5LL6X 4YY3Q 1Y1WH 3HOYH 2K5QA 3DWPA 1E9MA 4NJCA 5I2XA 2MO1A 3TP5A 4HVBA 2F0IA 5M5YB 2HCCA 1AH9A 5DNFA 2DX5B 2UXBL 4A3JH 1SNMA 1Q81C 2RSOA 2IX3A 1STAA 3K7AH 4JCVE 4RA8A 1PHJA 4US9A 1FFUA 2AQ2B 1QJOA 2C9OA 1WGHA 4R4QA 2LGIA 2IHFA 3CMMB 1I3QH 4KX6B 3JW0X 1V9PA 4LDTD 4LF5L 3HOUH 4LFCL 2FCSA 2GRIA 1HUNA 2DZIA 2JSVX 2ACZB 4P2CB 4F88A 3IFDA 2KZRA 4BKGA 4IM0A 1HA5A 3TMPB 1PFBA 2KTRA 1N6ZA 1XYIA 1V9JA 1E1TA 4L1BA 4X64Q 5C4JH 2LSSA 3X0WA 1DOXA 2DJFC 3WAPA 4NQKE 1LQBA 4PS7A 2MHVA 3AE7B 1XMQQ 1DCZA 5BYQA 2JN4A 3BJUA 4FLHA 4W9GA 1LABA 3R7RA 1G6JA 3I4NH 1PH4A 3H09A 1RM6C 4C1NI 2DJGC 2MP1A 4BBNC 2WACA 1KNEA 3NBIA 1KQSA 3I4MH 1AP0A 2ZTEA 5DPWA 4B3MQ 1WM2A 3L9AX 3KLRA 1I4HA 3DHIC 4KY7A 2QHOA 2UXCL 1XTDA 1RCVD 4JWSC 1Q3LA 4M01A 1B70B 1SE4A 4IQZA 1FNWA 3AFQA 4ZCKA 1UUPA 2JYTA 4RHSA 3A8JE 4IFDG 1Y1WG 4K5VA 4QUFA 4JV5L 2HIXA 3OPOA 4F8MA 3T1HQ 3U8ZA 5IP7G 1HQRD 1FCCC 1NYRA 3NS1A 3R93A 2EE1A 3UDXA 1HNZQ 1IBML 1KOTA 1Q8IA 3S2DB 3APFA 2CQAA 5T1IA 2EYOA 2R92H 1T0QC 2D2QA 3NJTA 2R7ZB 5LMUL 1PFNA 2WWZA 2K32A 3R2IA 2WB1B 1V2YA 3STBD 3T53B 2JXTA 4HJAA 3CQZB 2ALYB 3F8TA 3RN9C 5CX3A 1YHAA 3KK7A 2PNHA 1VQNA 4C7ZA 4DK6C 5IIFA 1G6ZA 2Z8LA 3H91A 4A6QA 3RMHA 3HOWB 4DR6Q 3NUHB 3EHVA 3KBXA 5TR5A 2O2VB 5LNK1 1CI3M 1QVGA 3WALA 1NCVA 1A5RA 3U50C 3P1HA 5IGFA 1PH1A 1LXDA 1WXSA 2KVRA 3PUVA 1E0ZA 1YITA 4BY7B 1WZ0A 1SNOA 4XYOA 4LTUA 2G4SA 1VQJA 1MIUA 2AUJD 3RLNA 2PCFB 1QOGA 3PUYA 1HHVA 1V49A 2K39A 2L11A 4GOPA 1BDOA 2DNFA 4OIKA 4L63B 4DR4L 2XTIA 4ZOHC 4BWGB 3I4MB 3WOFA 3JVZX 5JJLA 1GKHA 2XVSA 4X3TA 3AE4B 1V8QA 4HJ5A 3ETRA 4J6IA 4AIMA 2K0PA 3OTOL 1HA6A 2RPVA 3DVGY 1LM8B 5H92C 1TVXA 1IZ6A 3S16H 2JXXA 1GNUA 2Z59B 4HROA 1SROA 1O7LA 3R3OA 1J8CA 2EOTA 4A3GH 1I4RA 1IXRA 1G51A 3DMUA 3WWVA 2I2YA 3GTJB 2UXDL 2IY0B 4TKOB 3EUB2 3W1GA 1F77A 2IO3B 5JPMC 5IA7A 3Q3MC 3HP3A 4OWWB 1R9TH 2MH7A 4IOIE 4HN7A 1CA6A 4PS8A 3BDLA 3RNCC 4EZKA 3I5JC 1IYJB 3KJOA 4M8MA 2NCNA 1WR1A 1X3PA 2C7HA 2I38A 4JGHB 3PZ7A 1RJTA 3V96A 5AUKA 2V0GA 1RD9D 2N9XA 1LTRD 2F0LA 5EKIA 3CD6A 3BG3A 2WKDA 4MZ9A 1HZ6A 5C3XA 4F7XA 1VQOA 1TT2A 2Q2IA 4GSWA 3H15A 3T51B 4RMFA 1F2YA 4U68A 1CT1D 4KGSA 1AEXA 2O5JC 4MIUA 2WDQB 2B2WA 4JVZA 2AQ3B 3AB5A 1PYBA 2G4DB 2LJ5A 2E2HB 1TGZB 2K14A 2MBEA 4BA2I 1XPOA 3GE3C 4FJZA 1Y1VB 1X1MA 2R7ZH 1Y8NB 5A2QE 1V43A 1GC7A 1YNND 1F0ZA 4XX5A 2I07B 5C0XH 2C7MB 2LXJA 3PIO3 4PNYA 2YTYA 2JRIB 1IBMQ 1IBLQ 3H9DA 5C3EH 1KRHA 3I72A 4HAEA 3TCAA 2NZ1D 1X54A 1T6BX 3IBEA 3T1YQ 3ZJVA 3PIPA 5IP9G 3D6WA 4KKJA 2C5CA 4W9FA 1M90C 3Q22A 4YWLA 4CGYB 1BBWA 4BZAA 1UE6A 4R4OA 1K73C 1HRJA 2WXGA 1VRAB 3NVZA 2MGSA 3EQLC 4TKNA 2R92B 2CR5A 3NE5B 1EM7A 3GOEA 1OXUA 2V1CC 3BU2A 3OG5A 3CC4A 1XEEA 2FFKB 1EY6A 4L5RC 4V0BA 2L8JA 3I56A 3VR2A 4OHJA 3OLMD 1QUQB 3NTHA 5CV5A 1BBXC 1I4PA 1X65A 5HG2A 1VQGA 4FYDA 2XIWA 2UXCQ 1I4XA 1QOFA 1L1OC 3U4ZA 2KN4A 3C19A 3FILA 3N1XC 3ZO5B 4RCOA 3HRZC 5EJWA 4FXGC 4O42A 1N34Q 2D5GA 4A3BG 3K0YA 3CP0A 2WXRA 4IDIA 2K5HA 1F9JA 4GNXB 1RYJA 1Q1BA 1QE6A 1K0SA 4EFOA 4N9PA 2CW0C 3F2CA 3B2FA 4IWQA 4J8QA 5IT9c 2AMCB 1LT6D 1II3A 1D5MC 2JA7G 1HTQA 2FJ2A 2ZW0A 3STBC 3C2PA 1H9MA 5AZFA 1L2FA 3HOUG 2IL8A 2UUBL 1XNRL 1SMYD 5IGGA 4K14A 3ZRFA 1SIJA 4HCSA 4W9KA 1WI0A 2BPSA 1LV9A 1FYCA 4YY3L 1H8CA 2D0OA 1VQ4A 3ZXVA 3M4QA 4GLSC 2VUMH 4J15A 4GZYC 4UP8A 3IVFA 1Y8RC 3ML9A 3D4RA 3J80L 2FAZA 1LTTD 2NR2A 3J80c 1WGKA 4DV7L 1TQOA 2A69C 3A9JA 2NYZD 2CFMA 4FF3A 2N55A 1M4VA 5JEAJ 4KHVA 4V190 2K22A 1EIFA 5FLXE 2QMTA 3K8AA 1EYDA 5KNBA 3MEHA 1MJDA 2CU1A 1PH6A 2LVOA 3V2TA 3H6NA 4W9DA 1SYCA 2KVMA 3A9KB 3GTQB 2I46A 3BS1A 3OYYA 4JX1C 4DFAA 1E10A 3M7NA 3M3YH 1LFDA 1VLBA 2CKHB 2UXDQ 1S3OA 2KO3A 5JAVA 3B6YA 1D1KA 5KGUA 3K80C 3W1BA 4NNJB 3FAHA 2XEWA 4DUZL 2DWQA 2QF7A 1K8AC 3T3NA 2EYPA 3VHTC 2FCMA 2KK8A 4OIJA 2N7EA 2JP1A 1P16A 1YNTE 3N20C 2VB3X 2ZXOA 1ZOYB 2W3SA 4GXBA 4OVZA 3PMFA 2N0SB 2PZWA 2RDFA 2HTHA 4LNKA 4YL8A 1VQCA 4A3MG 4PMBA 1WD0A 2R92G 1JQ4A 5C3EB 1CZWA 3TZUA 2H1EA 5LHY1 3M62B 1TWHB 3HFZB 3UDIA 2JX5A 3QC8B 5IN7A 3EIVA 4MNOA 3QG1A 4IN3A 1OQRA 3RT3B 1WM3A 2LGDA 4BBRH 3LXFA 1Q10A 3TP8A 1S3SG 4I6NB 1EY0A 3NZSA 1JMCA 4P75A 3CCQA 1Q5WB 2IGHA 3IT4B 2FXQA 1MGSA 4EUTA 1Z47A 4DV2Q 1STNA 3TSSA 2QSDA 4O0AA 5JH5C 2R93B 4CJ0B 4A8XC 1AW7A 2BCOA 1EQVA 3CU7A 1GOZA 2LVQA 4K7SA 1NENB 3ULLA 1V1QA 3RZDB 1S5BD 4XDXA 2BKFA 2CH4W 1CKNA 5FO9B 4JQWC 1L4ZB 4B3TL 2KWUB 5G5HA 2WFWA 5BN3A 4L23A 2K1FA 2KENA 1XT9B 4X3UA 4A3KB 1HNWQ 5ELCA 1CZPA 3ALBA 3LYYA 3BYYB 4K81A 4HLEA 1FCLA 3I4LA 5JHAA 2JXMB 4C2MB 1E2VA 1HXYD 2QDBA 3F2UA 2GA4B 2BE5D 2NWGA 4NXML 1JALA 2BQQA 3LNNA 2OOBB 3IXSA 1CKMA 3A8IE 1LO5D 4FJYA 3J81c 3JSVA 3L16A 2XN9C 4KIKB 1HFGA 1P9DU 1E1OA 2W9NA 3G6EA 2BA0A 1HFNA 1HE8A 2BOSA 2Z0DB 1BF4A 2I5MX 2PW7A 2VL6A 1V1OA 3CHBD 3OSOA 1DOIA 5EE9A 3AH7A 1EWHA 1WTWA 1LT3D 3MXUA 3NHEB 3AU7A 4K5XA 2V4IB 1VQBA 4RF0A 1K83H 3K6OA 2CWAA 4IUVA 4PZ7A 4ZYSA 3HOXH 4A3FG 1V97A 4A93H 4FHKA 2DENB 2D62A 2JSOA 2JA6B 2FIFA 5KIXA 1JOOA 3DHQA 4A93B 1C1YB 1IW7D 3HOXG 4A3FH 4WAAA 4KI0A 3JYUA 4PS3A 2RCNA 4E6IA 4LF5Q 5AJ3Q 1O80A 2B2YA 3GB1A 1SLJA 1N32L 2KT7A 3TN2A 2WDTB 3VAWA 1IBXB 3D8GA 3OHXC 4UAIA 4DWFA 3IKJA 2SEBD 1GG3A 5FKAC 4DAYA 2NVUI 4ZKBB 1SYGA 1H9RA 1YNJD 2JA8G 1IGCA 3D31A 2K75A 3HOXB 2NVQB 4XYCA 1R9TB 2F03A 1HTPA 3TS0A 3CCUA 4D2KA 4E74A 3VQIA 4IW0A 2M2LA 4FXKC 1HTLD 1SAPA 5CV7A 2RQXA 4X57B 1VQFA 1S40A 1L1OB 1NNXA 4P73A 1R7SA 2Z6KA 2HUGA 2MBQA 1VR9A 1FRDA 1ACCA 4HSPA 3CC2A 2CVRA 1V5OA 3GTKB 4UHVA 2KTFA 4DV4Q 4BOSC 1XLPA 1J7BA 4A3IG 2HCIA 3HS0C 3RNBC 2N7JA 4RNAA 2MCNB 4JI6L 4JWUC 3MHSD 3NXWA 1RFAA 4LJOB 4DV3L 1UAPA 2RSUA 1WTVA 5DCNA 3KOJA 1UZXB 2L0CA 3A1QA 2OTJA 3AE8B 2ID0A 3E56A 2RSNA 3NVYA 1VQDA 3CWIA 2ENBA 1EIYB 1KM7A 1J19A 3HKZB 4OZAA 3M4PA 3NQTA 2VB2X 3I90A 1L7YA 2QJLA 2WS3B 5MPOA 3L4PA 3PIOA 2K8HA 1FD6A 1UEBA 4N6EB 1SFOH 2Y0SB 1MKHA 1DM0B 4AUQC 4JPSA 2IW3A 2NVYH 3ZJYC 4WJNA 1JJCB 1EEID 3TP7A 3N1ZC 4LAAA 4YHHL 3GD7A 1F2LA 3SD5A 3DBLI 4PYZA 1QNUA 1ZP0B 3DOWA 2Z6KC 2J0TD 3A33B 1XCTL 1C77A 5G2NA 4NDXA 2NBWB 5JHBA 2WAQE 1RF2D 2CW0D 2CHZA 4CKCA 2MO0A 2KJ6A 4DV4L 3A7LA 1LT4D 2V1YA 2BB6A 3PSEB 1MFWA 2UU7A 4APVA 2XGTA 1CFMA 2KJHB 4R4IA 2K3UA 2A19A 4DPGA 4USAA 1QB5D 4XT3B 4A3FB 2K6DB 3AU4A 2ZJPA 3R8BA 4DUYQ 2GBNA 4IUNA 1UH6A 2EMSA 4MT5A 2BH8A 2O6VD 1NDDA 1ASZA 3DEPA 1VQHA 2L76A 1UWMA 2DAFA 1WE6A 4ANWA 1PGBA 2EY5A 1HNXL 3K5OA 4UP9A 4GIVA 4Q2JA 2BS2B 5AZHA 3LDZE 5I9PA 4B9WA 3K9PB 2LXAA 4IWOA 3KF6B 4JI3Q 2INDC 2INPE 3ZJTA 4FDBA 1D2BA 1FFVA 1XLNA 3OAWA 2W55A 3RYTA 3CPFA 4DDGD 3TDQA 1J9OA 3FKIG 4A3MB 2WX0A 3SXHA 1E24A 4CDDC 3CSTA 4ACFA 4IO9A 1VZ7A 3MFYA 2KMCA 1OEYA 2HJ1A 4ILWA 1GB1A 1VS0A 3QJZA 2QW7A 2GVAA 5EPLA 2NTTA 2JYOA 1JOQA 4IPGA 1XLOA 1KXLA 3C3LA 3IL8A 1N60A 4K6DA 3FHWA 1ZXTA 3PGZA 5KNCA 4YWKA 1TKWB 2F0GA 3KYDD 5CR3A 4I65A 3EVQA 4KMUC 3NRZA 1FGUA 3JSVB 1YOVB 3PO3B 1GUWA 4YTMB 3L7ZC 2ON8A 1IUEA 2CKZB 2J4XA 2JT4B 4OZBA 2WDVB 5G3LD 4DK3C 3HIZA 1BBUA 3RI7C 3C46A 3A7AB 3Q3OC 5EDSA 5IGBA 2HT1A 2EDGA 4DA2A 3NTKA 3VR6A 2NBUA 2H88B 1DONA 5ELNA 4C56C 3S14B 4JI0L 4IOCA 2JYEA 1ET9A 1O78A 1OXTA 4ANXA 3ONSA 1X3EA 3TQYA 2N7DA 3GTOH 2YVCA 3UGBB 3U4EG 5EE1A 2E2DC 3K9OB 3B9JA 3H8HA 5IKCM 4O2DA 2BS4B 3HOYG 1B1ZA 2KBNA 2MRPA 2BDOA 1SE8A 2MUYA 2O2LD 1XMOL 3V3XA 1Q82C 3KUZA 1ENFA 4YSZB 3HEJA 4ALPA 2D5DA 2WAQG 4DV0Q 4BY1B 3MC8A 2RDHA 2KDIA 1WI5A 2MJ3A 4LW1A 3B0AA 1IBKL 3FMCA 5CC4A 1HTOA 1WYWB 4IG7B 1AZQA 3GTGH 2ZPNA 5C3EG 1YN5A 2L12A 2B3AA 3IFWB 2AKWB 1IL8A 2DN8A 3S1MH 3ZRCA 2JF5A 2PEAA 5I6WA 1Q7YC 4WQMA 2O6VA 2BS3B 2KJXA 1X3QA 3CAMA 2RD0A 1V80A 4XQQA 3H1UA 4DGZA 4ZLTF 1HR0Q 1OQQA 4DNRB 3M4OB 4I6PA 4EZLA 2GBJA 5J39A 1J7CA 1FM0D 3VVWB 2WU5B 2MP2A 1MHXA 5BYRA 2AX5A 2LHDA 5FO8B 5DAUA 1C9OA 3I4NB 1OXSC 4OONA 2EYMA 2KQ3A 3DLLA 1VQPA 1TTNA 2DZMA 3DPDA 3ITPA 4JBWA 4POGA 1B3QA 1S5ED 4ID6A 2F0QA 1LM0A 3Q8BA 2F0TA 2WXHA 5J2RA 1RDPD 5J1ZA 4RGMA 5I4DA 1RTNA 4LNQA 1ZXIA 5GAEC 4DNTB 2PKOA 3P4QB 3HUIA 4HWIB 3HVDA 2K28A 2F0OA 1B7YB 1G2SA 4PT5A 4MGZE 1FNUA 4XTCS 3VR4A 5C4JB 4A3KG 3TBIB 1UNSA 1FJGL 1KFYB 2L32A 1C4CA 4XC2A 1EUJA 2KN5A 1EY9A 1P3QU 1ZEQX 3J7YW 5M5WB 1YN4A 4M8AA 3EN2A 3D0FA 3SK8A 4EQOA 2JA5H 1IL2A 2EZVA 2OCEA 3K57A 2C7NB 2EIFA 1WTQA 2V4DA 5C0XJ 1HEZE 4H2AA 5IAAC 1SNPA 3RUZA 3L13A 4KZ0A 4CBVA 3G7LA 4QY7A 1ZUD2 4G7OC 4RGTA 4LF9L 4NXNQ 2Z9HA 2INNE 2F0VA 4ZRKA 3P42A 4ZRZA 3SK6A 1NMGA 1XJVA 1K9MC 3P4RB 1PH8A 1KRSA 4XE0A 4CO7A 4X62L 1Y1WB 3DUZA 4JOIA 1YQBA 5GAGC 2NVQH 2KMMA 4WWNA 5IOIA 1IHZA 1K8RB 5LXIB 3S17H 1E90A 1UE5A 1A15A 2CU3A 2B3GA 4IUUA 3T4AC 3RD2A 3S16B 1J8IA 2E3TA 3C0RB 2WP9B 4WJOA 5BMGA 2DY8A 2RCFA 4QIWB 5CTRC 2JEAI 4WWOA 5IT9E 4K6LA 3B2GA 4NW2A 4K0KL 2Z0EB 2C5LC 1XTCD 2DYMA 3VRBB 5A2QL 1XO3A 4LDTB 1BOSA 2F0WA 1NR4A 3CXCA 2A6EC 1SYEA 3F1ZA 1R4PB 1MI0A 3EC8A 1I7HA 4M8NA 3CCLA 3H3VI 3GTMB 1X32A 1MVKA 2KEEA 2ZVOA 1PGXA 1TIID 5JJZA 5EE0A 2R3ZA 2H5XA 4DK1A 3Q3FA 2K04A 4ZQ3A 1PA6A 1IPGA 4PMCA 3H7PA 2D3GA 1DGSA 4TVAB 1WJ6A 4A3DB 2IGGA 3TL5A 4P16A 2WXIA 3CIRB 2EY1A 1PGAA 2IZVB 5LMNW 3KWLA 1WWTA 4QIWE 2DBYA 5IWAL 4NKLA 2KFJA 2K5VA 1I4QA 4QCLA 2IDYA 2KYWA 4I7ZC 5IOCA 1V1PB 1HZ5A 3VH3B 2R7ZG 4A4IA 2RMMA 1HCZA 3GTMH 1P98A 2RPQA 4A3DG 4HJKA 3FEWX 4A3EG 1JJ2A 4DR1Q 4GKKL 1JOKA 3K5MA 2K5DA 2GBRA 2PE9A 3NS8A 3NK9A 4DR7L 2M0AA 4W9CA 3RZFA 4DXGA 2YU9B 1C4AA 1SBBB 5IYBG 3HOWG 2A6ED 3UI3A 1EOTA 5JJIA 5IYDG 1WX7A 1KDBA 4ZAIA 5ELFA 1OEYJ 1EQQA 2JJQA 4FF4A 3J7AV 1UEAB 3RPFC 2E2JH 3W2DA 1OTRB 1B4OA 4ODGA 1EYAA 4DR2L 5KEEA 3CKIB 3DCGA 4MSMB 1D6EC 1H9KA 1BNZA 3IAYA 3VTVA 3GTLH 2F4VL 2LHEA 1WGDA 3L0WB 1TWAB 1PTOD 4JG2A 3VYTA 1X3FA 5CV8A 1R4MI 4AQYL 1YJIA 1VD2A 5M9OA 1QKZA 3K5LA 3QAQA 3W5OA 2JU6X 3MEFA 4BXXH 2LUEA 2R2QA 3W1YA 1DJRD 4LWCA 1F9PA 5M5YH 1VQ6A 3F2BA 3QOJA 1BT0A 1SYBA 3FPUB 1LTID 2LKVA 5M5WH 3IRBA 2KDEB 4KZCA 3QOLA 4WRDA 4LUVA 3ZNID 1EF5A 4B6WA 2AUKA 1D8LA 1OGWA 3RZOB 2IY5B 4ABNA 2KCCA 1PFSA 4HEDA 5JVH3 5K36G 3ERSX 2M4NA 4GDKB 2MQHA 4YCWA 1KRTA 3R7QA 1ICWA 3L17A 1TS3A 1M1KC 1X56A 2AQ1B 4XXEA 4Y7NB 1MPEA 1VJKA 1XPUA 4A3CG 2K25A 3CCRA 4MGIE 2F4VQ 2WXQA 4XZ4A 3KW5B 1Z9FA 1TWFH 4DV7Q 4MTNA 1K52A 2JA6H 4DR2Q 4TMAB 4A93G 2CHWA 2D3BA 4DR4Q 3T8MA 5IP7H 3LX0A 5ELBA 2KD0A 3RNEC 2JA9A 4X66Q 4NAWA 3AEVA 3A55A 2Z4IA 1YQ4B 2N1VA 5DPRA 2GN5A 1ZYRD 5IODA 2DLBA 4AS1A 1KNAA 2IT1A 2R61A 2UUBQ 1XNRQ 1IKMA 3BWUD 2HD5B 2HDEA 2WKCA 1TXYA 1A3VA 2PQAA 3BK1A 4HJ9A 1F9RA 4DAYB 4B3SL 4X6AH 1Y56A 2XWJB 3FDTA 5E4XA 1OQYA 1R4QB 2ZT9C 2LVPA 4AJYB 2A5HA 3AEAB 2ICIA 1N61A 1CHQD 3M63B 4DV5Q 3A5ZB 3NTIA 4YWGG 4OL7A 1BVSA
chains in the Genus database with same CATH topology
1GXDC 2NBFA 2JEBI 3OMCA 2CJNA 1Q90A 2M00A 2NTSA 3WOEA 1L6VA 2KWDA 2BA1A 1WCMB 3I3CA 2Q8TA 1YNJC 4GDLB 3MJ5A 2FMMA 4H13C 1IKLA 5T1GA 4CJ2C 1RKNA 1N62A 4OO1G 1PTOH 2WNMA 4WH4A 3ND8A 5COYA 2TMPA 2M19A 2OXPA 2R6GA 1SSNA 4HJGE 2L1AA 2OEDA 3HOVB 2J53A 5G5GA 4HRSA 1EL0A 2KACA 3W1SA 4IFDJ 4ARCA 1ESRA 1EZ6A 1WD1A 1SMYC 2PMZB 3OMGA 4A90A 3HOUB 1XCQL 1DGJA 1L6UA 4MACA 1DZ1A 1OFFA 3BVZA 4IKGA 4ZK9B 2E2IB 1F2MA 1TY0A 3U2SC 5G3LF 2K01A 4C80A 3GV3A 1PDQA 1F9QA 1SF0A 2WV6D 1PUTA 1MI2A 1SXTA 4C3JG 1JQYD 2L55A 1B3AA 2LY7A 2K03A 4KHZA 5CBEE 1GAQB 1K8MA 1DOYA 1BR9A 4XDDA 4ZHOA 1Y8PB 2E2JB 2EXZA 1NI3A 1CQFA 3OWFA 2ZXPA 1SE3A 4C3HG 2L52A 4RHRA 1A2UA 4A3EB 1VCIA 2NB0A 1KTKA 4M0WA 3H3VC 3DWGC 5J22A 1PTOB 2K33A 1TY2A 3ZYYX 4A3IB 4QF4A 5NUCA 2CJOA 2B63B 5BN4A 3RFZB 4BBRB 4KN7C 1V1PA 1LLRD 1NSNS 1YJJA 3UI2A 3SDZA 4J1MA 4R8IA 3U52E 2WIIB 1BUIC 4OW0A 2W3RA 2Z1CA 5E3FA 3PIP3 2WAQB 3X3MA 2JQRB 1MHHE 3AEEB 4N9TA 2KQ4X 3MXPA 4Q0FA 5KYLA 3FILB 3RD4A 2WXMA 3T13A 2SNMA 2EY2A 5C0XG 2OHFA 4H0LC 3D6CA 4FXDA 3PUZA 2F0FA 1ZDXA 3FRPB 2Q8RE 3NTIA 3MXNA 3A56A 1WRIA 1ENCA 1K51A 3AV8A 2B2TA 1C76A 1XX8A 1TWGB 2WXPA 3S1NB 2YEPF 4REZA 4IFDH 5I2YA 2V3NA 5JEAG 2VZKB 5EBCA 4DN4M 4JE3B 1M8AA 4B9XA 2M9VA 5FR3A 5IGDA 3AE9B 2A69D 2DNCA 3AE3B 1JCKB 2PNRC 1TS5A 5DM63 1SB3C 2F0MA 3SVMA 3KBGA 4XWTA 4PQXA 1ET6A 3T3OA 1TKGA 2SDFA 3GV6A 5ISRA 1TU2B 1SJED 3S2HB 1H9SB 3HGBA 1SYFA 3GP7A 3IFTA 3QB3A 1JWBD 2ZXRA 1STHA 1AWDA 1F2ZA 1ENAA 4IUQA 4IUTA 3SR6A 1CZGA 1OO9B 3MTSA 2X6GA 1WSPA 3QJYA 1S5FD 3E6ZX 3NPPA 4K8JA 5IT9L 1QOBA 4C1NK 1EU3A 1NAPA 1LTBD 3C8YA 3P4SB 3Q69A 1W6KA 5AUIA 2KECA 3W5UB 2Q8IB 1E0BA 2EVBA 1U4RA 1OXVA 2WLBA 1BCPB 2KAJA 2WXLA 3RLFA 4KK7A 1EEFD 1H9SA 4C3JB 1TZOA 1JC7A 2K5WA 2XRSD 3AE6B 5HFYA 1JMLA 1NEKB 1O7YA 1KF6B 4WWMA 4RH6A 3TZDA 3LWUA 2LMCB 3MC0B 3PV0A 5HHDG 1RWSA 5EPKA 5GXGB 4R9WA 1ZKOA 1D4BA 1ZPSA 4L8JA 3K7AB 3Q23A 3J80E 1IW7C 4HR7B 1I6HB 1ILPA 4YTPB 4TQ1A 2PYKA 1ZDVA 4MN3A 4KD4A 4KTAA 1QWYA 1GHJA 2K6AA 1FGBD 2GB1A 5BYSA 1YMHE 1FEHA 4M1UB 5TSSA 3AE5B 4NAWB 2X69A 3VYUA 3P1MA 2N9KA 4IUPA 2X38A 1CM9A 3WDNA 2HDMA 4KKTA 1IBXA 2NVTB 1MSGA 1Y69U 3KLSA 4RAUC 1BCPF 2AWOA 3VR8B 1BMLC 4ZRPA 1SYDA 1FMAD 3O13A 4EVOA 2PTLA 1KLUD 2HDLA 4YXDB 5JOBA 3MHZA 4FO2A 3ERQA 1PRTB 1LTSD 4DQOC 1LT5D 1EFID 5M3MB 3WCQA 3NP8A 2QCPX 3MZ5A 3NWTA 4HKQA 1DOKA 3Q8FA 2AWNA 4KD3A 1SNDA 2LMCA 4S3SA 4CHTB 2K5PA 2LFIA 1WXQA 1JWAD 5KNDA 2SNSA 4UDUC 3BDCA 1F9SA 1GJXA 1HPCA 3DWAA 1LACA 3H94A 4EE2A 2B2VA 4G57A 5F2DA 3NQIA 5C0XI 1I3QB 3HZXA 2MEKA 1SE2A 1D5XC 1L0XB 1STEA 2G9DA 5HURA 4MHEA 2M56B 1UGJA 3DWQA 3I57A 4F87A 1EZ8A 3R2TA 2K7VA 2PIAA 2WQYB 3OOCA 3NUCA 5E6JA 4CJ1B 3AEDB 3TEXA 5IGEA 3TMEA 5CMDA 1Z6HA 1XXGA 4Z9CB 2MJDA 3IAS1 4US8A 1JWSD 4NP5A 1PRTF 5E4WC 1OXXK 2PW5A 1AYFA 1L4DB 2JWUA 5ELDA 1EU4A 3LWEA 4PV1C 3ABVB 3VR9B 1EY8A 2B39A 4J6HA 3N6RA 3QIAA 3DM1A 1KDAA 1EY4A 3J9CA 1ROEA 1RHPA 3FC4A 5E1FA 4XYQA 3CRKC 2SAKA 3OW7A 4N58A 2ICEC 1RFKA 3U9OA 1GPXA 1KLGD 1PRTC 3I73A 5K36H 2J52A 3MP9A 5CV4A 3KQ4A 1SFOB 3W9CB 4LK0M 1B9RA 3BYTB 1TKYA 1NR2A 1STBA 2F0KA 3C1FA 4J3OD 2YYZA 2B2WC 3AEBB 3PUXA 4DK0A 3SE0A 3U7ZA 1IYUA 4HKZE 2RDGA 4CQNA 1BO0A 1VZ8A 4XT1B 1A3TA 4XIGS 4LLGM 1E2ZA 4Q5VA 1JR0D 1PFMA 1C4PA 4FVMA 1PMRA 2RKSA 4X3KA 2F0SA 2E75C 1GUGA 4WAFA 3J81E 3IAM1 3QWNA 1B2TA 1QT9A 4TQUS 2BW2A 1ML0D 2JA5B 3BDOA 4MM3B 5CYUA 2JZPA 4QB4A 3NVWA 5CV9A 2DY7A 3GTOB 3AMZA 1STYA 1W6JA 4ZKCB 3T16A 3N9YC 1PLFA 1WTOA 1RODA 2F0PA 3DWMA 2TSSA 3P75A 2WXNA 3BIID 2L5TA 1FR3A 1FO4A 1NYQA 4FP5D 3SR1A 4TRDA 1V8CA 1SNCA 1I6VC 4OZCA 1U4PA 1EY5A 1CQVA 1K8OA 5C3JB 2BTEA 2BB5A 2HTME 1JROA 1WTRA 4A3BB 2FMCA 4ITKA 5D65A 4G7HC 3D4DA 2NN6G 3PZ8A 3TEWA 5EGTA 3P20A 1JICA 1YQ3B 3Q24A 2LJIA 2B2UA 2Z4HA 1B44D 3VA7A 4G7ZC 1UWXA 4EQNA 4OO1H 1JW9D 1E6EB 1SSOA 3AEFB 1T5XD 2E76C 3GTLB 2N88A 4K2LA 5FO7B 1XLQA 5KYIA 1G291 2NVXB 3SK5A 2G9HD 1YN3A 1SEBD 3LB8C 1AN8A 1QF6A 3HVZA 2B76B 3AE1B 1SJHD 3I91A 1QCBD 4TSSA 1JE4A 5CV6A 1F2RI 4NZLB 2WU2B 2QILA 4RGOS 2F3WA 5A35A 5HGTA 2B2UC 3TEZA 2WXFA 2MJ8A 2IPKD 2PPBC 3S1MB 2KUMA 2W54A 1P7EA 4YSXB 1C9FA 4AYBB 2LFNA 3H6MA 2A6HC 2LEKA 3GTPB 1QILA 1KAAA 5ELEA 5D14A 2BDNA 4KY6A 2BYTA 1RTOA 2F4IA 5C2TB 1ILQA 2K9XA 2NN6I 3W5VB 3EA6A 2ZW1A 2IWHA 1NVID 2B2YC 2WXJA 4YT0B 5FLXL 3C1EA 1QQRA 2L1BA 2F0UA 1JRPA 2KA7A 1VZ6A 2D9UA 2VXWA 4RFBA 2X6LA 1WYGA 1N63A 3S17B 2KHSA 2PW9A 4IFDI 1PRTD 3OWEB 2F3VA 3HG9A 2PMVA 2EYFA 3FVQA 4G4KA 1CA5A 3TEYA 4NMZA 3MAQA 5EPJA 1U4MA 1QOHA 5T8IA 1BCPC 5EE3A 3SHLA 5M5XB 4HSVA 1EWCA 2EYJA 2A68C 4IZ8A 3S9WA 2BE5C 3BVGA 3MVVA 2PZTA 2Y5PA 1MSHA 2FE8A 4ZUJA 1GUOA 1L0YB 2MPMA 1FIQA 4C3HB 5H8YE 3GO5A 1ZXHA 1HUMA 1YNNC 3SFDB 4TQ0A 1VMCA 1ZYRC 1K83B 4BA1I 2JE6I 3J7AF 2BBCA 2FBWB 2FUG1 1VF7A 2IGDA 3AECB 3A8KE 1S5DD 1E7PB 5JEAH 3AN1A 1A2TA 1B9NA 3P7JA 3ND9A 2PVOD 4L6TB 3ZQ4A 1STGA 1T3QA 2WINB 1PZID 5EQ0A 3DXJC 1EYCA 1VDZA 1TS2A 4YTNB 5C6AA 1DOMA 4HMIA 3GTGB 5BMHA 1U9RA 4DU9A 5C4ZA 4WURA 1DD2A 4KKUA 4K8IA 2FINB 4NAMA 1PZJD 4XDCA 2PLPA 3M7GA 5IGCA 4MH8A 1VMPA 3Q0AA 1Q1EA 5FK9C 4ARIA 3JAME 4XWWA 4X3SA 2L9HA 1TWCB 1KDCA 4R8NA 1NUCA 4ULLA 2CHBD 1C79A 2L83A 2VZKD 5I6YA 4IALA 1I50B 1O7ZA 3SFEB 2NMQA 2GI9A 1ESFA 3D3RA 4H44C 1BXTA 4ZHPA 3ZJUA 2A73B 3VYSA 1DYQA 2B2VC 2HQEA 1QLBB 4A3GB 3H0GB 4DF7A 2DNEA 3NBHA 1L5PA 2EELA 4OGQC 3I9V1 1VF5C 1A6XA 3PO0A 4WIPA 2JA7B 4A3JB 2F0NA 2H89B 1QNKA 1TR5A 2WP8J 1PXUA 5BMIA 3BZDB 3VA5A 4KJOA 3VYRA 1G8ZD 3EGRA 3HOZB 1C78A 5EKLA 1ONLA 5JPNC 1ZE3D 1EWYC 3V05A 1KH0A 3TP6A 3S1QB 5JVG3 3D4WA 4FF2A 4K5WA 4RGNA 4PMWA 1D5ZC 1QOAA 3U9SA 2VUMB 2KOLA 4KV6A 4WORA 1GUNA 2IX0A 1U4LA 5BN5A 3FPPA 2NVYB 3EJIA 3KUPA 2XRQD 1PTOF 1N5XA 3NZ3A 4DXFA 2VNUD 4QMGA 4A55A 3PO2B 2F0HA 3NHHA 4ZRQA 1CJEA 1FXIA 3N52A 3PUWA 3SK4A 1PYWD 3MWYW 1TYGB 1VDVA 2BT6A 5DEHA 3S15B 3IT6B 4B08A 1Y8OB 1L0VB 2EPBA 2EJFC 1WVLA 5C4HA 1DOLA 3K59A 3AB9A 1BUVT 3VR5A 1I4GA 2XWBB 2EY6A 2Y5CA 1PTOC 1F2RC 5CBAE 2WXKA 1J7AA 2PQEA 1E2WA 3MA2B 1LTGD 5EBDA 3TUOA 2H4OA 5FOBB 1BCPD 1EY7A 2KCNA 2EYLA 4P6VF 4LK1C 4H7BA 5C5LA 1GB4A 1KABA 4JK1C 1FNVA 3NSWA 3M4YA 1DXMA 4KGTA 1Q12A 1FXAA 2F1MA 2EKIA 4A9AA 3P63A 3OIQA 2D2CC 3KF8A 3CRLC 4FXCA 2B8FA 1A3UA 3Q8EA 4WJWA 3M85A 1N5WA 2PO4A 4CKBA 5C5MA 2E74C 1WTPA 1PFDA 4BS9A 2WXOA 4KN4C 4U673 1C48A 1WTXA 5C44B 4BBSB 3VRAB 3BVMA 3MFGA 5LL6S 4IURA 2XSCA 2WDRB 3J81L 2A6HD 2SOBA 1LTAD 2V3PA 2N9LA 4RF1A 4KY5A 1FRRA 1H9JA 3AEGB 2DYOA 1EIGA 1QG7A 1T5EA 4C3IB 2EYHA 2EJMA 2Y3AA 1FD7D 3Q8AA 3Q8CA 1PDXA 1MBYA 3L3OC 1PZKD 1EIHA 2RVLA 4C3IG 4XQNA 2EJGC 5D7GA 3A54A 5CGKA 1K50A 1S4ZA 5D3DA 3ONAB 2K05A 2L4NA 1A70A 4R3DA 5DM73 4EGVA 4HTHA 1XWEA 3I70A 2IX1A 5EKKA 4AQ7A 4LJZC 2K1BA 4YIJA 1G2TA 4DAPA 1IYVA 4B0MA 5M3FB 3URYA 1JWUD 1XF5L 4RWSC 4O1NA 4KKIA 3I8ZA 2B2TC 5AFWA 2ONQA 1G91A 2YEPB 3FKIB 2Q5WD 1MD2D 2KDMA 3KWVA 4KKSA 4EQPA 1B9MA 3QO2A 1TWFB 2IJ0A 5CORA 2JA8B 4HCEA 1B53A 2PZUA 1IGDA 1S5CD 2QEJC 3K5NA 2QKIC 3P4PB 2KEDA 4LMQD 3T56B 4WFN3 2RA4A 3AE2B 2A68D 5KRUA 5K5PA 2LS01 3SEBA 2J42A 1D1IA 4KGRA 1SDFA 3MXGA 5C3WA 1CTMA 2MJEA 3OIPA 4FNFA 3GS2A 3AM9A 4XQJA 1C4QA 4KJNA 4ME5A 2NN6H 4C7YA 2OF1A 1P7FA 1AFPA 1Z7TA 2F0DA 4HMJA 2O4XA 1CHPD 4RCNA 2E6XA 3E0JA 2W82A 2G1EA 3G6JB 3MHBA 4RKBA 4ZUIA 1C8CA 1GUTA 2XNAC 1B50A 1AZPA 1TJEA 3BK2A 2RBMA 2OT2A 3DEOA 1BQQT 3EROA 1TKEA 3M3YB 3S1RB 3VR3A 2A74C 4N59A 5I9OA 2B8GA 2NUCA 1SNQA 2FHTA 2J7ZA 1GHKA 3HOYB 1EQTA 1JORA 3E5SA 4HEA1 2LUMA 5HI1A 4CKEA 2OEOA 4B0EA 4OO1I 3W3AA 2QIEB 5D3IB 3NWSA 3EFXD 4QUCA 4K2KA 5C4XB 1K53A 1CK1A 4RKLA 3Q6SA 3KLSX 3AMUA 3NVVA 1JB3A 3X3NA 3K58A 4FF1A 2F0JA 1GUSA 1JWMD 3HRDD 4L2YA 3GQBA 3JAML 1HQMC 4YSYB 3E9SA 2F0EA 4DAVA 1TS4A 5LL6X 1E9MA 4NJCA 2K5QA 3DWPA 5I2XA 3TP5A 2F0IA 5M5YB 2HCCA 3ZGZA 5DNFA 2PVGC 1SNMA 2RSOA 2IX3A 1STAA 4RA8A 4US9A 1FFUA 2AQ2B 1QJOA 2C9OA 2LGIA 4KX6B 2GRIA 1HUNA 2JSVX 2ACZB 4P2CB 4F88A 3IFDA 1HA5A 1PFBA 1XYIA 4L1BA 1DOXA 2MHVA 3AE7B 1DCZA 5BYQA 1LABA 3H09A 1RM6C 4C1NI 2MP1A 2WACA 1KNEA 3NBIA 1AP0A 3L9AX 3KLRA 1I4HA 4KY7A 4JWSC 1RCVD 1Q3LA 2JYTA 1SE4A 4IQZA 1FNWA 1UUPA 4RHSA 3A8JE 4IFDG 4K5VA 4QUFA 3OPOA 4F8MA 1HQRD 1FCCC 1NYRA 3NS1A 3R93A 2EE1A 1Q8IA 3S2DB 2CQAA 5T1IA 2EYOA 2R7ZB 1PFNA 2K32A 3R2IA 2WB1B 4A8XC 3T53B 2JXTA 3CQZB 3KK7A 4C7ZA 5IIFA 1G6ZA 2Z8LA 3H91A 4A6QA 3RMHA 3HOWB 3NUHB 3KBXA 5LNK1 1CI3M 1NCVA 5IGFA 3P1HA 3PUVA 1E0ZA 4BY7B 1SNOA 4XYOA 4LTUA 2AUJD 2PCFB 1QOGA 3PUYA 1HHVA 2L11A 1BDOA 4OIKA 4L63B 4ZOHC 4BWGB 3I4MB 3WOFA 2XVSA 4X3TA 3AE4B 1V8QA 3ETRA 2K0PA 1HA6A 2RPVA 5H92C 1TVXA 4HROA 1O7LA 3R3OA 2EOTA 1I4RA 3DMUA 2I2YA 3GTJB 4TKOB 3EUB2 1F77A 5JPMC 3HP3A 2MH7A 4IOIE 4HN7A 1CA6A 3BDLA 2I38A 1X3PA 3PZ7A 1RJTA 3V96A 5AUKA 2V0GA 1RD9D 1LTRD 2F0LA 5EKIA 3BG3A 2WKDA 1HZ6A 5C3XA 4F7XA 1TT2A 3T51B 1F2YA 4U68A 1CT1D 4KGSA 1AEXA 2O5JC 4MIUA 2WDQB 2B2WA 2AQ3B 3AB5A 2E2HB 4BA2I 1Y1VB 1Y8NB 5A2QE 1V43A 1YNND 1F0ZA 2I07B 5C0XH 3PIO3 4PNYA 1KRHA 3I72A 4HAEA 2NZ1D 1T6BX 3ZJVA 3D6WA 4KKJA 2C5CA 3Q22A 4CGYB 2WXGA 1HRJA 1VRAB 3NVZA 2MGSA 3EQLC 2R92B 3NE5B 1EM7A 1OXUA 1XEEA 2FFKB 1EY6A 4V0BA 3VR2A 4OHJA 3NTHA 5CV5A 1BBXC 1I4PA 5HG2A 4FYDA 2XIWA 1QOFA 1I4XA 2KN4A 3FILA 4RCOA 3HRZC 5EJWA 4FXGC 4O42A 2D5GA 3K0YA 4IDIA 2WXRA 1RYJA 1Q1BA 1QE6A 4N9PA 2CW0C 3B2FA 4J8QA 1LT6D 1II3A 1D5MC 2FJ2A 2ZW0A 3C2PA 1H9MA 2IL8A 1SMYD 5IGGA 4K14A 1SIJA 4HCSA 1LV9A 1FYCA 4GLSC 4GZYC 3D4RA 3J80L 1LTTD 1WGKA 1TQOA 2A69C 2NYZD 4FF3A 2N55A 1M4VA 5JEAJ 4KHVA 4V190 2K22A 5FLXE 2QMTA 1EYDA 5KNBA 3MEHA 3V2TA 1SYCA 2KVMA 3GTQB 2I46A 3BS1A 4JX1C 4DFAA 1E10A 3M7NA 1VLBA 5JAVA 5KGUA 1D1KA 3FAHA 2DWQA 2QF7A 3T3NA 2EYPA 4OIJA 2JP1A 1YNTE 2VB3X 2ZXOA 1ZOYB 2W3SA 4OVZA 3PMFA 2N0SB 2PZWA 2RDFA 4PMBA 1WD0A 1JQ4A 5C3EB 1CZWA 3TZUA 2H1EA 5LHY1 1TWHB 2JX5A 3QG1A 4IN3A 1OQRA 3LXFA 1Q10A 3TP8A 1EY0A 2IGHA 3IT4B 1MGSA 1Z47A 1STNA 3TSSA 2QSDA 2R93B 4CJ0B 1AW7A 2BCOA 1EQVA 3CU7A 1GOZA 1NENB 3RZDB 1S5BD 4XDXA 5FO9B 1L4ZB 5G5HA 4L23A 5BN3A 4X3UA 4A3KB 1CZPA 5ELCA 1FCLA 3LYYA 3BYYB 3I4LA 2JXMB 4C2MB 1E2VA 1HXYD 2QDBA 3F2UA 2GA4B 2BE5D 2NWGA 1JALA 3LNNA 3IXSA 3A8IE 1LO5D 2XN9C 1HFGA 2BA0A 1HFNA 2BOSA 1BF4A 2PW7A 1V1OA 3CHBD 3OSOA 1DOIA 5EE9A 3AH7A 1EWHA 1WTWA 1LT3D 3MXUA 3AU7A 4K5XA 2V4IB 4RF0A 3K6OA 4IUVA 4ZYSA 1V97A 2D62A 2JSOA 2JA6B 5KIXA 1JOOA 3DHQA 4A93B 1IW7D 4KI0A 4E6IA 3GB1A 1O80A 2B2YA 3TN2A 1IBXB 3D8GA 3OHXC 4UAIA 3IKJA 2SEBD 5FKAC 4DAYA 4ZKBB 1SYGA 1H9RA 1YNJD 1IGCA 3D31A 3HOXB 2NVQB 1R9TB 2F03A 1HTPA 4D2KA 3VQIA 2M2LA 4FXKC 1HTLD 1SAPA 5CV7A 2RQXA 1R7SA 2HUGA 1VR9A 1FRDA 1ACCA 4HSPA 2CVRA 3GTKB 1XLPA 1J7BA 2HCIA 3HS0C 2N7JA 4RNAA 4JWUC 3NXWA 1UAPA 1WTVA 2L0CA 3AE8B 3E56A 2ID0A 2RSNA 3NVYA 3CWIA 2ENBA 3HKZB 4OZAA 3NQTA 2VB2X 3I90A 2QJLA 2WS3B 5MPOA 3L4PA 1FD6A 4N6EB 2Y0SB 1DM0B 4JPSA 2IW3A 1EEID 3TP7A 4LAAA 3GD7A 1F2LA 1QNUA 1ZP0B 2J0TD 1XCTL 1C77A 4NDXA 1RF2D 2CW0D 4CKCA 3A7LA 1LT4D 2BB6A 1CFMA 4USAA 2K3UA 1QB5D 4XT3B 4A3FB 3R8BA 4IUNA 4MT5A 3DEPA 1UWMA 1PGBA 2EY5A 4Q2JA 3K5OA 2BS2B 5I9PA 4B9WA 2INPE 3ZJTA 1D2BA 1FFVA 1XLNA 2W55A 3TDQA 1J9OA 4A3MB 3SXHA 1VZ7A 3MFYA 4ILWA 1GB1A 5EPLA 2NTTA 2JYOA 1JOQA 1XLOA 3C3LA 3IL8A 1N60A 4K6DA 1ZXTA 5KNCA 1TKWB 2F0GA 5CR3A 4I65A 3EVQA 4KMUC 3NRZA 3PO3B 1GUWA 4YTMB 3L7ZC 2ON8A 1IUEA 2J4XA 4OZBA 2WDVB 5G3LD 3C46A 3A7AB 5IGBA 2EDGA 4DA2A 3NTKA 3VR6A 2H88B 1DONA 4C56C 3S14B 2JYEA 1ET9A 1O78A 1OXTA 3U4EG 5EE1A 2E2DC 3B9JA 3H8HA 2BS4B 1B1ZA 2BDOA 2MUYA 2O2LD 3V3XA 1ENFA 4YSZB 3HEJA 4BY1B 2D5DA 2RDHA 2MJ3A 3FMCA 5CC4A 1AZQA 1YN5A 2L12A 1IL8A 2DN8A 5I6WA 4WQMA 2BS3B 2KJXA 1X3QA 4XQQA 4DGZA 4ZLTF 1OQQA 4DNRB 3M4OB 5J39A 1J7CA 1FM0D 2WU5B 1MHXA 5BYRA 2AX5A 2LHDA 5FO8B 5DAUA 3I4NB 1OXSC 2EYMA 2KQ3A 3ITPA 4JBWA 1S5ED 4ID6A 2F0QA 3Q8BA 2F0TA 2WXHA 1RDPD 5J1ZA 4RGMA 5I4DA 1RTNA 2PKOA 1ZXIA 3P4QB 4DNTB 3HUIA 3HVDA 2K28A 2F0OA 1G2SA 4PT5A 1FNUA 4XTCS 3VR4A 5C4JB 1KFYB 3TBIB 1UNSA 2L32A 1C4CA 1EY9A 1ZEQX 3J7YW 5M5WB 1YN4A 4M8AA 3SK8A 4EQOA 2EZVA 3K57A 1WTQA 2V4DA 5C0XJ 1HEZE 4H2AA 1SNPA 3RUZA 4CBVA 3G7LA 1ZUD2 4G7OC 4RGTA 2INNE 2F0VA 3P42A 4ZRZA 3SK6A 3P4RB 4XE0A 1Y1WB 3DUZA 2KMMA 1IHZA 1A15A 2CU3A 4IUUA 3T4AC 3S16B 1J8IA 2E3TA 2WP9B 5BMGA 2DY8A 4QIWB 2JEAI 5IT9E 4K6LA 3B2GA 4NW2A 1XTCD 2DYMA 3VRBB 5A2QL 1XO3A 1BOSA 2F0WA 1NR4A 2A6EC 1SYEA 1R4PB 1MI0A 1I7HA 3GTMB 1X32A 1MVKA 2KEEA 1PGXA 1TIID 5JJZA 5EE0A 2R3ZA 4DK1A 2K04A 4ZQ3A 4PMCA 4A3DB 2IGGA 4P16A 2WXIA 3CIRB 2EY1A 1PGAA 3KWLA 1WWTA 2DBYA 4NKLA 1I4QA 4QCLA 2IDYA 4I7ZC 5IOCA 1V1PB 1HZ5A 2RMMA 1HCZA 3FEWX 1JOKA 3K5MA 2K5DA 3NK9A 2M0AA 4DXGA 2YU9B 1C4AA 1SBBB 2A6ED 3UI3A 1EOTA 1KDBA 4ZAIA 5ELFA 3RPFC 4FF4A 3J7AV 1UEAB 3W2DA 1B4OA 4ODGA 1EYAA 5KEEA 3CKIB 1D6EC 1H9KA 1BNZA 3IAYA 2LHEA