1V1OA

Staphylococcal superantigen-like protein 7
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
196
structure length
196
Chain Sequence
b'RVQHLHDIRDLHRYYSSESFEYSNVSGKVENYNGSNVVRFNPKDQNHQLFLLGKDKEQYKEGLQGQNVFVVQELIDPNGRLSTVGGVTKKNNKTSETNTPLFVNKVNGEDLDASIDSFLIQKEEISLKELDFKIRQQLVNNYGLYKGTSKYGKIIINLKDENKVEIDLGDKLQFERMGDVLNSKDIRGISVTINQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOTOXIN 1
publication title Structural Relationships and Cellular Tropism of Staphylococcal Superantigen-Like Proteins
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Virulence factor
total genus 53
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1v1oA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1v1oA01
1EEFD 3OWEB 1YN4A 2QEJC 1LTRD 2R61A 1S5ED 1XTCD 1D5ZC 1TY2A 1I4XA 2QILA 1I4HA 1RCVD 3EFXD 1ESFA 1HXYD 1LTGD 1EWCA 1T5XD 3DWPA 3BVGA 1BXTA 2ICIA 1I4GA 1LT4D 3R2IA 4L63B 5ELEA 1L0XB 1EU4A 3BVZA 1JCKB 4RHRA 3R8BA 1D5MC 1LTID 1KLGD 1I4RA 1HTLD 2AQ1B 3BYTB 1LO5D 3MC0B 5D3IB 1YN3A 5FK9C 1SE3A 1LTSD 4RGNA 1SJED 4ZYSA 4RGMA 1UNSA 1EU3A 1CK1A 1CHPD 1V1OA 1SBBB 4NZLB 1B1ZA 1XXGA 1PTOC 1PZJD 1FNVA 1D5XC 1LTAD 2XNAC 5FKAC 1ET6A 1AW7A 1LT3D 1M4VA 1GOZA 1HA5A 5D3DA 1TY0A 3TSSA 2NTTA 1S5BD 1G8ZD 2TSSA 2G9HD 4RGOS 1JQYD 2AQ3B 1CHQD 2XRQD 3DWQA 3BZDB 4RH6A 2RDHA 1FNWA 1FGBD 4Z9CB 1EEID 1RDPD 1TS4A 1CQVA 1KTKA 4RGTA 4BWGB 2XRSD 2IPKD 3W2DA 1LLRD 1PTOB 1FD7D 5ELCA 4L6TB 1FNUA 1JWMD 1AN8A 1V1PB 2Z8LA 1CT1D 4RHSA 3MFGA 1DYQA 1PZID 3O13A 1LT5D 1PRTC 1SXTA 3DWAA 1TS5A 1B44D 1MD2D 2XN9C 1JWSD 1ET9A 1PTOD 1JWUD 1PRTD 1D6EC 4C56C 3EA6A 1SEBD 3KLSX 3URYA 3V05A 1V1PA 5ELBA 1QILA 1PTOF 1DJRD 1SJHD 1PRTF 5ELDA 1F77A 1ENFA 4RFBA 4DXGA 5TSSA 2RDGA 1LT6D 1JR0D 1I4PA 3BYYB 4RCOA 1PRTB 1S5DD 1SE2A 1PZKD 1S5FD 3R2TA 1BCPC 1UUPA 1PTOH 2AQ2B 4TSSA 3CHBD 1LTTD 2J4XA 4K6LA 4OHJA 1YN5A 2NTSA 1KLUD 4DXFA 1EFID 5ELFA 1STEA 4O1NA 1BCPD 1RF2D 2O2LD 1SE4A 1TS2A 5I4DA 2SEBD 2WV6D 2CHBD 3BVMA 4UDUC 1BCPF 1S5CD 1TS3A 1PYWD 1HQRD 3GP7A 1LTBD 1RD9D 1L0YB 1I4QA 3SEBA 2IJ0A 1BCPB
chains in the Genus database with same CATH superfamily
1SR3A 3CCLA 3QA8A 3ZIMA 5E6OA 1UELA 4IDIA 2PI2E 2LASA 1WGRA 1CTMA 2WDQB 1V2YA 4XQJA 3W5VB 2NZ1D 2E2IB 3NUCA 4WWMA 3SHQA 4DR1L 1BUVT 3F2CA 4HEDA 4LNQA 1F2LA 3F8TA 4A3FH 1BXTA 4BFRA 1MPEA 3RZWC 1LUZA 1K8RB 2MBQA 3ICEA 2RF4A 3CCQA 3H7PA 1E8XA 1WWTA 3E5SA 1ENCA 2ON8A 1WR1A 4FLHA 2WU5B 1IBMQ 5K36G 1SE8A 1O7ZA 1YN3A 5FK9C 4GMVA 1KNAA 1UEAB 1XLOA 1EU3A 3K6OA 2MRPA 2WKCA 3ERSX 5EKIA 5A2QL 1FNVA 2K9XA 3AM9A 5LLIA 3NZUA 3DVNV 3CCJA 5DPRA 1GNUA 2WDVB 3G48A 2VS1A 5C4ZA 4DN4M 2ZCCA 4WRDA 3IAYA 2QGQA 4K5VA 2B2WC 1WD0A 3Q14C 4L23A 3F2BA 2XRQD 4X64Q 3WOFA 2YTXA 3H3VH 2KXJA 2FCSA 2EYMA 4DAYB 4Z9CB 3L9AX 5GAGC 2D9UA 2JEBI 1LABA 2EY1A 5H1SE 1K8AC 2B63H 1L4DB 3AXCA 3LB8C 3D4DA 5IGCA 4A3FG 1YJIA 3I4MB 3S1NB 2QDBA 4XQNA 3U30A 2A68C 4DPGA 4JI0Q 2A69D 3FEWX 4JIOU 3R3MA 1KRTA 3AEAB 3HK0A 1NUCA 2HTHA 1DYQA 4NKLA 1LT5D 1SNOA 2EMSA 4DKAC 4A8XC 4W9HA 4HJ9A 3UDGA 1TS5A 4ZK9B 1B44D 3HOVH 1T0QC 3UF8A 1ET9A 1PH5A 3A1QB 4N9TA 2MP1A 4UY8C 4URKA 1PH7A 3J7AV 2XWBB 3URYA 2JE6I 3NBIA 3VYUA 1J7BA 3ZJVA 3DHHC 1PLFA 4EKUA 5G2NA 1RYJA 4Q5VA 5E1FA 4B9WA 4DXGA 3ML8A 4KI0A 4A4IA 4DV5Q 5LXHA 1C4PA 2A73B 1N63A 1NYRA 5C0XH 2KBNA 1EFWA 4FF4A 4DR7Q 3BDCA 1S5FD 4OWXB 4PMCA 3CC2A 1SROA 3I3TB 4FN2A 3S16H 2J4XA 1DOYA 4IM2A 3OW2A 1H9MA 2VB3X 3MXNA 5EBDA 1WTXA 3C46A 2K0PA 4NAMA 4PT5A 2B63G 2B2VC 4YWMA 4FF1A 1HNXQ 4YL8A 1N34Q 1RM6C 2ZT9C 3I4LA 4RF0A 3TL5A 1B9MA 4LUOA 4BBRB 4LF4Q 1FEHA 1HZBA 4R4OA 4BY1H 3QX1A 4J3OD 1E2VA 1M94A 4OELB 4LNOA 5LL6X 3N1ZC 4P1BC 3X3NA 4JWUC 3ZLZA 1S40A 1EEFD 2OHFA 3NVZA 3S1QH 1LTRD 3HOVG 1ZP0B 3ZUNA 2HQEA 2BOSA 2YYZA 2NBUA 1D5ZC 1VQ5A 3H6NA 2CJOA 3RZDH 3Q3MC 2A8VA 2VB2X 5D7GA 1QE6A 2W3RA 5HURA 4FO2A 2B8FA 4JK1C 4LWCA 1HCZA 4O42A 4NXNQ 2ZJDA 1HUNA 1IKMA 1PA6A 1QVFA 1N5XA 3ETRA 2ZJRA 1I6VC 3F1ZA 3QWNA 4W9CA 3T53B 1GKHA 4HIKA 4JI4Q 2OTJA 1VDZA 3BVZA 1STNA 3S1MB 5C0XG 2KDBA 2F0HA 2B39A 3P4QB 4IUMB 1ZXTA 5EE0A 1YIJA 1YNXA 1DGJA 3MHZA 4OX9L 4USAA 3E56A 2JVCA 3MC0B 3WAMA 3BY4B 2WQYB 3UINB 1EYGA 1QG7A 2LKVA 3D4WA 3OHXC 4HN7A 4EQPA 3QK0A 3J81L 3U9SA 2WXLA 1SBBB 2PMZE 3DM1A 1VJKA 3HRDD 2F0WA 1L2FA 4BY1G 3EGRA 3IVFA 1FMAD 2L83A 4FA6A 3S17B 3Q0AA 3A9KA 4IZ8A 5J2RA 4C3JH 1XJVA 1F2RC 2E2JH 1FO4A 2WXOA 1E0ZA 3QWZB 2LGDA 5G5GA 1V9JA 3U4ZA 1J9OA 5HGTA 2HHHQ 2GN5A 1DM0B 4G4KA 4BS9A 3DBLB 1BO0A 3QOLA 3VTVA 5IN7A 2B2YA 1XLPA 4NPSA 1NE3A 1PGBA 3TEHB 3C2PA 1EWHA 3RZOB 1WGHA 2LUEA 1YHQA 2BS3B 1Z6HA 4CO7A 5I9OA 2WDRB 1TS4A 3H6MA 4R8NA 5BN3A 1KTKA 4HCSA 5CTRC 4WH4A 3SDLC 1HPCA 1TWGH 5GROA 1PTOB 5ELCA 4R4IA 2GOWA 1C9FA 1FNUA 1HZAA 2A1AA 2JZZA 1VLBA 3ULLA 4P1CC 2FUHB 1K28A 5T1IA 2J0TD 3NXWA 1K8OA 1F52A 3AECB 3F2UA 4AIMA 4F87A 2CKZB 2KENA 2AKWB 2O5JC 2I07B 4DBGA 3B6YA 2VXWA 3QB3A 5IGDA 1WJNA 4C7ZA 1E90A 3CD6A 4MN3A 5FR6A 3KJPA 1IYVA 3PVLA 3ZRCA 4C80A 2PQEA 1ZYRD 2KC1A 3KYHC 1WY8A 2Y3AA 3GZNB 5J39A 1SYEA 1Q10A 3GTOB 1PH3A 1IW7D 4C3JG 3AE3B 4MM3A 3UGBB 4CDFC 3OMGA 5M5WB 2UXDQ 5AZFA 1YEZA 2QHOA 4FHJA 4EZKA 1JE5A 1I50H 4ALPA 4TSSA 1LTTD 1RL2A 4K6LA 1F9QA 4FHKA 4MTKA 2PVOD 2DZIA 3MP9A 3QIAA 4DUYL 2Q2UA 2MJ8A 1HE8A 3RLFA 1RRBA 2LRWA 4US8A 3C1FA 3UI2A 5EKKA 1NYQA 3GTQB 4J6IA 3KLRA 1GUAB 4EQOA 3DXJC 4XT3B 3V3XA 5J17A 2L05A 4DV6Q 5IP9H 3H3VC 3GTLB 2Z9HA 1MJCA 5LMNQ 3VH4B 3TQYA 1CSPA 1OXSC 2Z4HA 2KEEA 1IYJB 1N6ZA 2L5TA 2K5QA 1YN4A 3NUHB 2YTVA 2R61A 5BR8L 3MTNB 1C9OA 4RA8A 1TY2A 4GKJQ 4IG7B 1WM3A 5E7NA 1I4XA 2JA7B 4OONA 4DR6L 1IUEA 3AEBB 2Z0DB 3NEMA 2W55A 3CP0A 2E6XA 2N3SA 1K8MA 1EY8A 3VRAB 5HFYA 4EOYA 1KJTA 2PYKA 2MP2B 2JXTA 2F0MA 4WAAA 1BUIC 1EOVA 1R9TB 4OVUA 3C8YA 3QAQA 4ZOHC 4ZRQA 1TKYA 3ZKJC 3W1GA 3SK8A 4MZ9A 5AFWA 2QEXA 3BZKA 1QOAA 5D3IB 1HNWQ 3L17A 3JW0X 3K0XA 2MQJA 2M17A 2C7MB 4B0MA 3IHPC 1CHPD 3Q6BA 4KDLB 1LQBA 5CV5A 4DR1Q 3GTOH 2EY2A 1WZ0A 3K7UC 5FO7B 3PIP3 5FOBB 3K9OB 2EYHA 1QUQB 5IP9G 5M5WH 2C7NB 2Y5PA 1HR0W 3CXCA 3AE9B 2Z0SA 1HH2P 5JPMC 1UE7A 3APDA 4BVUC 2N9KA 2K4KA 3N30A 1K50A 2X38A 5H92C 4AP4C 4M8MA 5KGUA 2CKHB 5DM63 1SYFA 1FYCA 1CKOA 3I70A 3TCAA 2AHOB 4XDCA 2WB1G 1C79A 1WM2A 1VQHA 3EHVA 4G0NB 1E2WA 1B8AA 1U0LA 3M85A 2UXBQ 2KYWA 1K83H 1C4CA 3DDCB 2HJ8A 2AWNA 2UU7A 2KTFA 3KFUA 3NWTA 3U8ZA 3DEOA 4A3BB 1Y8NB 3JC66 2LJ5A 1OXVA 4JI1Q 2HD3A 1JE4A 1P98A 1DOXA 2DLBA 1B70B 3TP7A 2L52A 3W1BA 4GN4B 3CQZB 1L0WA 5M5XH 1MG4A 1OFFA 4FP5D 3M3JA 1VZ8A 3GZNI 3HZXA 1CKNA 1L1OC 1U5KA 1VCIA 4GS3A 1NENB 2KWUB 3CMMB 3DVNU 1T0YA 3S2HH 2NN6I 1IBLQ 3Q8AA 3VH3B 1I6HH 1DZ1A 1I94Q 1EQVA 5BYQA 2RSOA 4B3SL 1DJRD 4JL9A 1R9TH 2Q2TA 2NVQB 3I5JC 3AU7A 4R4CA 3Q3FA 1XTDA 2JWZA 1W6KA 5FJ8H 2UXCL 3NZ3A 4GN1A 5IOIA 5BMGA 4IWOA 2QDLA 3HOYH 2NVXH 1ONLA 3VYTA 1L5PA 3DBHI 1XEEA 4S3SA 2J42A 2CWPA 3PT2B 2ZPYA 4R8IA 4OO1I 2AWOA 5CBEE 1X9NA 4A3PA 1EFID 4JV5L 4RCNA 1EM7A 1FCCC 1STEA 1JWBD 2JA8H 1QWYA 1N5WA 4C1NK 4K5XA 4II2B 3HKSA 1TS2A 3OTOL 2NPTB 1V80A 3J9CA 4GLXA 4KN7C 3J7AF 2DHZA 4QY7A 1C48A 1WJJA 5CV4A 4AYBG 1GUOA 1WYDA 4UDUC 2CU1A 3IFTA 1HQRD 4ARIA 1F9JA 3Q8EA 1WXVA 1A63A 3EFCA 1QNKA 5IAAC 1Y1VB 2GVAA 2FMMA 5EPJA 2WXPA 4FF2A 3FMCA 2ZJPA 4IUTA 3PZDA 2WX0A 5HKHA 3D31A 3A5ZB 5JAVA 2IX1A 3PLUA 4IPHA 4KVGB 4R3DA 3EFXD 4UPAA 1Q86C 1I3QB 2CH4A 1OGWA 1SE9A 3W1YA 4NXMQ 2J0KA 3AH7A 2VW9A 3S1RH 4B3MQ 3AE2B 1WD1A 1BF4A 4J6HA 2PCFB 3KVFB 1CKMA 1BBUA 1A2UA 4IUPA 5FJ8G 3KQ4A 2M19A 3HOYG 3NBHA 3MEFA 1JALA 4EZJA 2KFJA 1IGDA 1EYCA 2N7EA 2WXHA 5EGTA 1FRDA 3DBRI 3BYTB 3RMKC 3GTKH 1QKZA 2JA8G 3OIPA 3A7AB 3SR1A 1K73C 1IBML 2SAKA 3APFA 3D6CA 2RSNA 2GBJA 1GB4A 1WIAA 4JOIA 1YJWA 2MNAA 3G71A 4TQ0A 4JBWA 4W9EA 1KF6B 1X3GA 1TWCB 3GTMB 2I38A 1HA6A 2WP9B 4MTNA 4QCLA 4IUUA 1X3PA 4DV2Q 1WX8A 1R7SA 4H0LC 2DENB 2JSOA 4US9A 2VUMH 4OX9Q 1JOKA 3T4AC 2D5GA 3VUWA 1IHZA 5C3WA 3WA0A 5CYUA 5CMDA 3KLWA 1GG3A 4X64L 2RCFA 1SMYC 2XRSD 3QJYA 4DHJB 1J6QA 1QT9A 2K6QA 4LK1C 4M01A 2PW9A 1LYLA 2ZXOA 2BB6A 2B2UC 2LHEA 5E6NA 2NYZD 1F1HA 4PMBA 1GUWA 4YWLA 1OXUA 4FJZA 2XWJB 1DD2A 3TEYA 4A3OA 3L16A 4GDLB 1VD2A 1C3TA 3V96A 3D32A 2ZM6Q 2GRIA 4KIKA 3V6CB 2E2DC 2JA9A 5J3BA 5LNK1 2BA0A 2IT1A 4J8QA 4NMZA 1X6OA 2ZTCA 1ML0D 2GBRA 1PDQA 1D6EC 4L1BA 2K01A 2N9PC 1KAWA 3K58A 1BQQT 2MHVA 4JBKA 2R7ZB 2ZW1A 3AE8B 4S0RA 3HEJA 3S2DH 3P4RB 2NMQA 4IUVA 2D3AA 1PFMA 3STBC 3VR5A 1WI0A 1BOSA 2EKIA 2OQKA 1OEYJ 1YQ3B 3RN9C 2IW3A 4DV5L 4HJKA 3VA5A 1JT8A 1JRUA 2MBBB 2AQ2B 2KCMA 4B08A 4DR7L 1E8WA 3L10B 4FADA 1BBWA 4A76A 2N49A 2YV5A 4Y7NH 4C3HB 2R92B 2G4SA 1RF2D 2MBHA 2PPHA 2D5DA 3I4OA 4JYAL 2WXMA 4LJPB 3IAM1 4LW1A 2JXXA 4YWGG 4G7OC 4PS8A 1N34L 2H5XA 2Z4IA 3PIOA 3VTWA 3C0RB 1A3VA 2GVBA 4H2AA 3W3AA 2WB1E 4IPDA 4EVOA 4QAYA 1RFAA 4YY3L 4X6AH 1XPUA 2BTEA 2WXQA 3I3CA 2JP1A 3T16A 1C1YB 4KN4C 2F0NA 1W3SA 2PMZB 3W1SC 1LM8B 2H88B 4HCPB 4DUYQ 1K3BC 2KCNA 3A8IE 5FO9B 4FXKC 3VA7A 2D0OA 1PUTA 3BIID 2RMMA 3V60A 1SYGA 4S17A 1CMXB 2EVBA 5IGGA 2L8JA 2QCZA 4JI4L 4LDTD 1MKHA 2CQOA 4NPNA 4ANUA 3V2TA 1OXXK 1HTLD 2CHWA 1LO5D 4BBNC 2QDFA 1NBFC 5BR8Q 2O2VB 1ZDVA 1UNSA 4A75A 4WORA 2Q8IB 5HY6A 1SRUA 4IOCA 4NB3A 4GZYC 2GBKA 4M8AA 4GGQA 3TP6A 4X3TA 5IGBA 3QCAA 4TKNA 1UF0A 1VQKA 3A55A 4D2KA 4YIJA 3WAPA 4AUQC 3MC9A 2W54A 5JEAJ 2K25A 2MGSA 1XNRL 2NBWB 5FKAC 4DR4L 4MELA 4PK1A 5EPLA 1M4VA 1TJEA 4EGVA 5C2TB 4DHJD 2CWAA 3KF8B 1G91A 1P0RA 3KDFB 3Q23A 4OVZA 4V0BA 1H95A 2JX5A 2YVCA 5DPTA 4AJWA 2LVQA 4RGOS 2FAZA 3MTSA 1A15A 4AYBE 1HTOA 1HFGA 1VF5C 4CKCA 1RDPD 1RAXA 1XLNA 1MGSA 1M90C 2KQSA 2QKIC 4P6VF 4L5TA 1DOKA 3BDOA 3HUIA 1G51A 1NDDA 3K5LA 4GDKA 4KGSA 2KNBA 3KYCD 2F3VA 2Z8LA 3U52E 3UIPB 1L7YA 1AWDA 1HUMA 3HFZB 1F9RA 4KK7A 1OO9B 4HPMB 1XPRA 2JA5H 1QB5D 1PMRA 1T0SC 2EY5A 2A68D 2PNRC 4I7AA 1RWSA 3N1XC 2J52A 4UP7A 2VH2A 3P1MA 4DAYA 4DR2L 1MSGA 4LCDE 3G6JB 1Y69U 3K0YA 2MJ3A 4WQOB 1MSHA 2V1CC 5DM73 2Q2HA 3B1LX 2DJFC 2IHEA 3K5NA 4K0KQ 3KLSX 2MUYA 1BR9A 4IO9A 1EQQA 1SIJA 4FBJB 1B3QA 4PG3A 2GBNA 1ZDXA 1IGCA 1R4NB 4DV1Q 1XCQL 4R9WA 2KC2A 4H7BA 1K8GA 3R2TA 2UXDL 3KYDD 4IN3A 4A3FB 4DV4L 4V190 1ZUD2 2CW0C 1SN8A 5DEHA 2MPMA 1YI2A 3H91A 2ZTDA 3ERQA 1PFSA 4JG2A 2Z6BA 3CCUA 3DCGA 4JLCA 3PIO3 2LXJA 1IBXB 3S15H 2KOLA 2AX5A 1H9RA 1H4RA 4ZHOA 4ZLTF 4CKBA 2SNMA 3AEEB 4HWIB 3ITPA 3K59A 1CJEA 3UDFA 2JA5G 2FJ2A 4DV6L 2Q2IA 3D0FA 2L0TA 3OWEB 3FC4A 1SNMA 4ILWA 5JVH3 5LMNL 3CSFA 1Q3LA 3QQ8B 3GE3C 3ND9A 2JT4B 3J80E 1CA5A 1L0VB 1TIID 1ISNA 2K39A 1J19A 2LRUA 2EYJA 4IFDH 1EY7A 4C2MH 1MHWC 3N52A 2A6HC 1SYCA 4GKJL 4IJHA 4GKKL 2D62A 3PRMB 2D10A 3I57A 4C4VA 3BVGA 4MH0E 1GUTA 2YTYA 5C44H 1OQRA 3OOCA 4KHZA 1PYSB 1RODA 1T9HA 4C1NI 1P9DU 1MIUA 4RKBA 1V49A 2WS3B 2B63B 4JX1C 4EX5A 3TEZA 4PQXA 4M02A 2E74C 1Y8PB 1I5FA 4QF4A 4HK2A 4GLVB 4JI7Q 2OJWA 3NENA 1CZPA 2D3GA 4KSKC 2BA1A 1Q81C 2H89B 3GS2A 3RN5A 4JE3B 4K7UA 5J22A 5BMIA 1IYFA 3M3YH 3KUZA 1PXUA 4XDXA 3H09A 1HFNA 1EO6A 4FNFA 3NHHA 1D7QA 3A33B 1SNCA 1YHBA 3L3OC 1R4QB 4KKSA 1N33Q 3HOVB 2K1BA 3NK9A 3NQTA 4XXEA 3HM6X 1LTAD 3RNEC 1C7YA 4BBSH 3QO2A 5ISRA 2J53A 4XIGS 1NNXA 1G2SA 2NVTB 5E6PA 3MXPA 1LGRA 1GPXA 4JPBW 2SDFA 3NY5A 3P20A 2KQ7A 1E1OA 1N36Q 1GD7A 2PPBC 2ZVNA 1XO3A 2JRIB 4REZA 5CORA 4IFDG 4FULA 1HJPA 1CA6A 1CQVA 4QUCA 1ZPSA 1SSNA 1F2RI 2DZMA 3A54A 1WMHA 2KN4A 1IKLA 5C44G 3S16B 2NUCA 2Z1CA 2DWQA 2VNUD 3NHEB 4C3IB 2ZNVC 4LUVA 2M1MA 4AWJA 3WIMA 1FL0A 1TGZB 1TXYA 3RUZA 2XGTA 2ASBA 1FJGQ 1YNND 3MFGA 2UXBL 2DZKA 3GB1A 1FXAA 4B9KA 2HCCA 2E2HH 4GOPA 4L2YA 4A90A 2K75A 1WX7A 4U68A 3WWVA 3I91A 3PQIA 3GTJH 4JI1L 3QG1A 5IODA 2OQ0A 4BY1B 1QZEA 1DONA 4WWOA 4WAFA 1AE3A 2E3TA 3APCA 1EY0A 1KRHA 2KFKA 4BKTA 1D4BA 1TYGB 3EA6A 4LAAA 4JI3Q 2RHQB 1SNQA 2RHSB 2JK8A 2L1AA 3I4NH 4QUFA 2ZCBA 4E71A 3S1QB 1BDOA 2J7QB 2R6GA 2ACZB 4RF1A 1WXAA 2VZKB 1J8CA 1IBLL 2K5PA 4GB9A 2C7HA 2FBWB 1I94L 4PYZA 3E9SA 3RZDB 2RGFA 3TEWA 4BBSG 4FXCA 1Q8IA 1SLJA 1JICA 5EE1A 1X32A 1B4OA 1TWFB 3IT6B 4DK3C 1EZ8A 4N59A 1BCPC 5LXIB 2LXKA 2N0SB 2KWCA 1TT2A 1L1OB 2WKDA 4DXFA 2F0LA 1Q8KA 1YX6B 1IP9A 3DHGC 1HQMC 3A8JE 3UI3A 3PUXA 1WVLA 1Q5WB 4NJ7A 2HE7A 4XWTA 5CV6A 1WSPA 4M1UB 2LEKA 4OZAA 4APVA 4XYQA 5KYLA 1V6EA 2K33A 4LNKA 1IBKQ 3BZCA 5KEEA 1TZ1A 3CMAA 3ZJTA 2NVTH 3Q8CA 3QIJA 3ND8A 4BA2I 2C9WB 2EOTA 1L0YB 3EBEA 2DYOA 3DBSA 2I2YA 2IJ0A 1WYWB 4BKSD 1WCMH 3I56A 2ZXRA 2WU2B 4PYUA 3R7RA 4AQ7A 2PJHA 4MSQB 1TWHB 4E6IA 4HR7B 4L5RC 5AZGA 3TIXA 4C3JB 2OWOA 2E2JB 3AEFB 3N9YC 1I4HA 3H3VI 3I4NG 1D1KA 1RKNA 1E2ZA 1LTGD 4A3GH 2KMMA 4C3IH 1N60A 3FILB 1JC7A 3PCOB 4JYAQ 3S9WA 4ZRZA 3HOZH 4A55A 3T1YL 4L5QA 1TU2B 1OQYA 3RUIB 4NXML 4B3ML 4F7XA 4A3KH 4FYDA 3RLOA 4RM8A 3E0JA 4NP5A 1JQ4A 1TWGB 2NZOA 1Z47A 3ZDMC 4NNJB 4RMFA 1WGYA 2D11A 4C00A 2YLMA 4CHKA 1VQ8A 2LVOA 1X65A 1STGA 2JYOA 3NVYA 3J80c 1MJDA 3R7QA 2N9LA 1B9RA 4YY3Q 1FXTB 2JA6H 3ZNID 3FKIH 5KNBA 4LFCQ 4OGQC 1PYBA 3T3OA 1NMFA 2EJFC 4P2CB 5LHY1 1LFDA 2F52A 4P7IA 2LGXA 5AJ3Q 4A3CH 1XXGA 4MDKE 3AEGB 3M7NA 3NOBA 2XNAC 3HOWH 4XDDA 1GOZA 3KF6B 5D3DA 3WANA 1TWFH 2KTRB 1X56A 1WCMG 2EPBA 2IO2B 4K1RB 2MJEA 3MZ5A 5C0XI 3CWIA 4HJGE 1SIFA 1KAAA 2BWFA 4H02A 3DWQA 3JAMc 4DUZL 4DV2L 1E6EB 2NS5A 1N32Q 3ZNZB 5I6YA 2IGGA 4ITKA 3TS2A 2DAFA 2OEOA 4G7HC 4BWGB 4A3GG 3K9PB 4C3IG 3E0EA 1I50B 1QUQA 4JW0A 1LLRD 3HOZG 2EKEC 2KAJA 2AUJD 3NPPA 1GHKA 1NVID 3AE7B 2N8NA 2RPVA 4A3KG 2R2QA 4ZRIA 2PMVA 4XC2A 1XNRQ 3GTPH 1PZID 4DR4Q 2G1EA 3DMUA 3L4PA 3MA2B 1PRTC 1TWHH 2INCC 1C78A 3E6ZX 1WTQA 1UWVA 3DWAA 2PNHA 3K81C 3WCQA 4B0EA 1IYUA 3A8KE 1KIXA 1S3OA 4N6EB 2JA6G 2ZM6L 3FKIG 1XYIA 1JW9D 3PIPA 3DQVA 3AFQA 1LTLA 3MHBA 4CYEA 4TQUS 3PV1A 3ZNHB 1HNZQ 1Y56A 2F0UA 2CHXA 2O4XA 1PTOF 4JOIC 1SJHD 2ICEC 2VY3A 1HZ5A 5L37A 4IJLA 3HOWG 3B2FA 3L13A 4MGIE 4ZRPA 3PHXB 3EIVA 4WWPA 3UE1A 4QL5A 1PV4A 2R3ZA 2W82A 3H7PB 1CQFA 5AEKB 2WB1B 4ZUJA 1B3AA 2BF8B 1NI2A 1E9MA 5E4XA 1VR9A 1O7YA 1U4RA 5DPSA 2QF7A 5BN5A 1EYAA 4MH8A 2CH4W 3RFZB 3GV3A 2HIXA 2VL6A 4G7ZC 5ELFA 5I2XA 4DR2Q 1VCBA 1IZ6A 4AS1A 4XT1B 3H94A 2SOBA 1E8YA 5I2YA 2EELA 3EN2A 2G3QB 2XBBC 1B53A 2L9HA 4I6PA 4N9F4 2WV6D 2KO3A 4OL7A 1U9RA 3RCZA 4LFAL 3AE6B 4GNXA 3HRZC 4LFBL 2OT2A 2F3WA 4GN3B 2MBOA 4AOFA 3SEBA 3Q6SA 2IY1B 1Y1WB 5KHQA 4A6QA 1EWYC 2VZAA 2C35B 4N8X1 3U4VA 4J1MA 2CFMA 4O0AA 2FIFA 2RPQA 2NPTA 2EXZA 4DV4Q 4KTAA 3DM3A 3WAOA 3GOEA 3J7A5 3VR8B 3AYHB 3SK5A 5HI1A 1H9SB 2X6LA 3OPOA 2I5LX 4ZUIA 1S4ZA 2KANA 1SMXA 4IKGA 2QW7A 3FHWA 1I4GA 1LT4D 3ECIA 1SNPA 1YQBA 3X23A 1X3QA 2PW7A 3PS6A 3LWUA 4AYBB 1K83B 3N20C 4PNYA 4CBVA 4HIOA 2I5MX 4HDQA 2KQ3A 4DK6C 4KD4A 5I6WA 4G50A 3EJIA 3A56A 3V61A 1FVIA 1V1OA 2SNSA 2L15A 3KUCB 1DOIA 5M5XB 4NZLB 2VQFQ 1VQ6A 4K8IA 4GKKQ 1V97A 5DCNA 2JUOA 4ZQ3A 1VF7A 1GHJA 1WOCA 2KJ6A 3PLVA 3S2HB 3IRBA 3KK7A 5F2DA 3S14H 1I6HB 3EUB2 4LJOB 2DGYA 1C4AA 4XX5A 3I63C 2F1MA 5CHWA 4X66L 3MXNB 2CHZA 3SFDB 1UD7A 3BZDB 4PV1C 1O78A 1O80A 1SSOA 3Q8DA 2ATWA 3PGEA 3HOYB 2NVXB 3AMUA 1E7PB 4I65A 5CV9A 4HKQA 4IWQA 2IDYA 1UWMA 2N9XA 2HUGA 4DV3Q 3Q22A 2NZHA 2JZPA 4ZRJA 2JA8B 2L1BA 3H9DA 1WE6A 1Y1WH 1PH1A 5JEAH 3DBLI 4K7WA 2F0KA 4MJSA 1RHPA 1CZWA 1JWSD 3AQQA 4OIKA 5E3FA 3RNGC 1FCLA 2FCNA 1PTOD 3VRBB 3ZO5B 2JWUA 4KJOA 4RAUC 1UGJA 2AL6A 3J80L 4LF6L 3LYYA 3CRLC 1F0ZA 1WXQA 1EWIA 1WJ4A 4RFBA 4K0KL 4YTPB 4CDCC 4GDLA 1I4PA 1JR0D 2B2WA 3CCSA 1FM0D 4OWWB 5LMNW 1CUKA 2B8GA 4DV1L 3STBD 3S1RB 2Z59B 4F8CB 1YJNA 2WXJA 1GAQB 3KOJA 1KLVA 2FCMA 3M4YA 2K1FA 5GADC 4BOZB 4HKZE 2BB5A 2OCEA 3QJZA 4POGA 1PGAA 1YNJC 3JAML 4XWWA 1F2YA 3PRZA 4QGUA 1Y8RC 3Q3NC 4HRSA 4E74A 3GTKB 1EY4A 2KHJA 3A9KB 1KABA 4N9PA 4OO1H 4DGZA 1IPGA 4FDBA 1TS3A 2PLPA 3J7ZC 1S3SG 1Y1WG 4LF7Q 1WJ6A 3CSTA 3VHTC 2ES2A 1WTOA 1QOHA 2OXPA 2E5LQ 5JOBA 3N3KB 2FUG1 4II3B 1S5ED 4IUNA 2V9HA 3G4SA 1N62A 3I7FA 2K05A 1STHA 1XNQL 2OOBB 1PGXA 4ASWC 2PQAB 1E24A 1A3TA 3DPDA 1L4ZB 1GXDC 1Q1EA 5JJIA 4DU9A 2VUMB 3JVZX 2E75C 2OF1A 2WACA 1UE5A 4ID6A 5T1GA 1C76A 2P5ZX 4OZCA 4RHRA 2QCPX 2F0TA 1UZXB 1M8AA 3ZJUA 3BK2A 3M9BA 2LMCA 1V1QA 4WJNA 1FD6A 1T5EA 2L11A 5EAYA 1JMLA 4ULLA 2B2VA 2I1JA 2FNJB 1WGDA 3Q3OC 4FF3A 1E0BA 2E76C 3LDZE 4RGNA 4ZYSA 4JI7L 4HPLB 3RULA 1WTWA 4FXGC 2NR2A 3BG3A 3FRPB 3HKZB 2D2QA 5E6JA 4OO1G 3KWVA 3PF5A 3EC8A 4MM3B 4HMJA 5CHVC 3T1YQ 1N33L 2HDMA 1U4MA 4KY6A 4M0WA 1OXTA 3TSSA 5C4JH 2NWGA 1KDAA 2B2TC 2PIAA 3HOUB 2RQXA 3TREA 2PVGC 3VAWA 3SK4A 3S2DB 1QOFA 3C3LA 3GV6A 2G9HD 2A4ZA 3BWUD 2MO1A 2AQ3B 1YD8U 5M3MH 2KJXA 3MFYA 4Q0FA 4TMAB 4UP9A 3DHIC 4I6LB 1N36L 4HPPA 1ZW7A 3UQAA 3HOXH 1G6ZA 2L3ZA 2Y5CA 3DOWA 3H8HA 4P71A 4YXDB 2L55A 3A5UA 1WI5A 1VQ9A 4UAIA 5IGFA 2BH2A 3V62A 1AN8A 5EPKA 3S2AA 3MWYW 2NVYH 3KDFA 3MHSD 1YNTE 5EKLA 4Y7NB 1YQ4B 2CS4A 3LNNA 2IY0B 2HIVA 1K0SA 2XK5A 4LF8Q 1D1IA 5CV7A 2WINB 1FJGL 1NAPA 1NTGA 1VQ7A 5JJKA 5H8YE 3RYTA 3ALBA 5CHFA 5G5HA 1SFOH 2IGDA 4DK1A 4TRDA 2KK8A 1KDBA 2LGIA 1AZQA 4DUZQ 1QVGA 4M8NA 2MCNB 3N32A 1EQRA 2QSDA 3VFKA 1BVSA 1J5EL 1WR6E 4JI3L 2ZNVB 3CU7A 2I0QA 3RD4A 1LT6D 2N7JA 1FPYA 2K7VA 3MXUA 3SR6A 4Y52H 2K5WA 1SE2A 3K5OA 4K6DA 2EDGA 4KMUC 4ZRKA 4K3CA 2RA4A 5M3MG 3CIRB 4QQBX 3PUVA 4JI2Q 1NEKB 5M3FH 1WRIA 2PZUA 1BNZA 3HOXG 3P4SB 4A3IH 3M4OH 1JJGA 4NAWB 2EZVA 3I90A 1KM7A 2N7DA 2CW0D 1UAPA 1QZGA 3J81i 2V3PA 3LJ3A 4YHHL 1BCPF 3LX0A 3RNUA 3KWLA 2FINB 3AI5A 3HOUH 3H1UA 1IBKL 4K8JA 4IQZA 1SNDA 2KHIA 2AUKA 2V4DA 2ZXPA 1BCPB 4XYOA 3VYRA 5M5YH 1BMLC 3A9JB 3TDQA 2QEJC 3KUPA 2O5IC 3P7JA 5IYCH 5HHDG 4ZHPA 5G3LD 4KJNA 4HJAA 5JZEB 4P73A 2IX0A 1Q1OA 1WF9A 2F4VL 2KMCA 1ZEQX 3RN2A 4A3MH 2VUMG 3N6RA 2LJIA 3ABVB 3NWSA 2TMPA 1EF5A 1ZXIA 3QC8B 3VYSA 4EFOA 2KUMA 2K3UA 1SYDA 2WX1A 1QOBA 2WXRA 3R2IA 3TMEA 3ZJYC 3OLMD 2A6HD 5FR3A 4LFAQ 4BA1I 3FAHA 4LFBQ 3DHQA 4L8JA 4I7ZC 4JI8Q 1WJUA 1GO3E 5FLXE 1A3UA 4KX6B 4MGZE 5M3FG 4A3EH 1CKNB 1MHHE 2FHTA 4A3IG 1KL9A 1LTSD 1SJED 1CSQA 4GOCA 3HKZG 2JA5B 4BKSA 2EMTA 1CK1A 5IT9E 2JRHA 2RSUA 2C60A 3RNCC 4LFCL 2N1WA 3L54A 3NZSA 4A93H 1N9WA 3L7ZC 5COYA 1KRSA 4LLGM 5AJ3L 3HOUG 2BBCA 4MEMA 5AUKA 5T8IA 1LXDA 2HQLA 4DK0A 1KOTA 2HT1A 3ONAB 3JSVA 3RLNA 5IGEA 1H9KA 2UU9Q 2DNFA 2OJRA 3QR8A 2B3AA 2KD0A 2M0XA 1GUSA 4BY7H 2BGFA 2JXMB 4JC0A 4A3MG 2JEAI 4W9KA 4B3TQ 1SGHA 4RGTA 1XWEA 4LF9Q 1N32L 4HIDA 1VQGA 1JOQA 2K04A 3OMCA 1V86A 4XGAB 1UEBA 4JVZA 1V5TA 3S24A 1V1PB 2EXDA 2LS01 4CKEA 3E3XA 3M62B 1EY6A 2NVUI 1TT5B 2KCTA 3S15B 3RR5A 4A3EG 1QZHA 2KMAA 1ZXHA 4RM9A 3T13A 4A3JH 2X8XX 4ME3A 2G5DA 4X66Q 1TTNA 1NMGA 2A5UA 3W5UB 4YCUA 2Z0EB 3AN1A 1TR5A 4F88A 1GC6A 4QIWE 1CFMA 1VQMA 2UUCL 4A93G 3PREA 1PRTF 3I72A 1HNZL 2GLSA 1GVPA 2M00A 2LSSA 4OEMB 1NJIC 3NVWA 4MSMB 3VTUA 4IM0A 2BE5C 3HS0C 3CF5A 1OQQA 4WFN3 3L2PA 4C2MB 1PRTB 3CF6E 1VDVA 4KLKA 2FIDA 4LMQD 4MT5A 4KY7A 1JROA 5D6JB 4PS3A 5C44B 2QA4A 4BY7G 1J8IA 2WNMA 4K3BA 1GC7A 2NBVB 3NJTA 4H44C 3M63B 4KKUA 4P16A 4KHPQ 1P7EA 1BCPD 3NTHA 1SE4A 1U4LA 5JH5C 2RDFA 3K5MA 4FXDA 2G45B 3BVMA 4LF6Q 2F4IA 1GM5A 1SYBA 1STAA 2J0JA 4GSWA 3H0GH 3M3YB 4DAPA 3CAMA 4X62L 1MJEA 4NJ6A 2LFNA 1B2TA 4TQ1A 4YT0B 4JI6Q 4DNRB 1IXRA 4ZKBB 5C3EH 3EQLC 2L12A 4RCOA 5CC4A 1L1OA 2MBEA 3O65B 1IL8A 4A3JG 2W3SA 5JHBA 4L5SA 4A3DH 4O2DA 5IO9A 1R4PB 2MH7A 4BBSB 3RZFA 3J80i 1IL2A 1L6VA 3IFWB 1RCVD 2RR9A 3A1QA 1PH9A 1E7UA 2B2YC 2JJQA 2WHIA 2EJMA 3SE0A 2KWVB 2LY7A 4KV6A 3ZYYX 2V3NA 4ARCA 4N8FA 2EYPA 3HP3A 4L63B 4UP8A 3U2SC 5ELEA 4RKLA 1K9MC 2X6GA 1OTRB 3M95A 1B9NA 5EDSA 2YEPF 4TKOB 1EUJA 4KDIC 4JCVE 2DYMA 3OJ3A 1K53A 3HG9A 4CQNA 5IKCM 2HCIA 1QLBB 1V8QA 4KKIA 3V6EB 4JQWC 2KJRA 3VUYA 1T6BX 2YEPB 3TJPA 2DNCA 3FPUB 3HHMA 1A2TA 2H4OA 2KA7A 3JAMi 3FILA 1E3PA 5JJLA 3P75A 2L0CA 2E2HB 1XNQQ 3NS8A 3PO3H 3GTJB 1HR0L 4RMAA 3H0GG 1FFVA 4GNXC 1ET6A 2VQFL 1LT3D 2FXQA 1JORA 2WXKA 1WGKA 2Y5BB 1VQAA 5C3EG 4WIPA 3I4NB 5J18A 3NRZA 1OEYA 2IZVB 5FLXc 5TR5A 1VMCA 4A3DG 2RBMA 3T1HL 2JQRB 1JQYD 2WAQB 4KD3A 3CCMA 4DR5L 4DHZE 3SFEB 4DWFA 2UUBQ 1RTNA 2F0IA 2K32A 2JQOA 2B29A 2L4NA 2WXNA 1FGBD 5IT9c 5JVG3 1QCBD 2V4IB 2E8GA 2REXA 5IP4D 1K0RA 4K81A 1WFQA 2A5HA 3RPFC 4K5WA 3MXGA 3SDZA 3KF6A 1HRJA 2BDNA 1A62A 3C1EA 3RNBC 2G4DB 1ACCA 2BYTA 2K28A 4DV7L 4DV3L 4W9DA 1SAPA 2WP8J 1YOVB 2ZTEA 3DVGX 4JGHB 2FCQA 3WOEA 3VUXA 2XN9C 1PRTD 1R4MB 2DN8A 2JPHA 3IXSA 3PO3G 2FE8A 1WCMB 2B3GA 4IFDI 2QMTA 2KHSA 1QILA 4OXPA 2Y0SG 3CKIB 1JMCA 2KN5A 1ZGUB 1UWXA 2OEDA 1C8CA 5M9OA 4CDDC 2F0SA 2NB0A 1GUNA 1TWAB 4W9JA 2WXGA 4EEWA 5IOCA 2XIWA 2KWDA 1S5DD 2HD5B 4A3GB 3HKZE 5E4WC 1PZKD 4GLSC 5GAHC 4W9GA 3HOZB 1WTHA 1KH0A 1UBIA 1GJZA 1BBXC 1YN5A 3ZXVA 5C1ZA 1UE6A 1KLUD 4LNIA 4A3KB 2WYQA 1T0RC 2F0FA 2WGSA 4OW0A 3W9CB 2B2UA 1BT0A 1Z9FA 5EE9A 4KY5A 4LNNA 1PFBA 1SB3C 2N9EB 2VRRB 1H8CA 5ELOA 4BAXA 1J5EQ 2XEWA 2JA6B 4A9AA 2FMCA 3FKIB 1R4NI 2F0PA 3GP7A 2KT7A 3KH0A 2KVRA 4CJ0B 4GIVA 1CI3M 4LF7L 1MVKA 3HVZA 1NI3A 1NY4A 3L0WB 5BYSA 2JZ3B 3SHLA 1XTCD 2K8CA 2E5LL 3HOWB 2KDMA 3Q2AC 4R1JA 5EQ0A 1ESRA 3A4SC 2INPE 3K7AH 4KKTA 4FJVB 1HTQA 4RG1A 3PO2H 2QILA 2MJDA 1VZ7A 3B0AA 2PTLA 5IY0A 3MVVA 4MNOA 1HXYD 2FFKB 2Z6KA 2IWHA 4GDKB 1YITA 2D0PA 4XTCS 1ROEA 3RD2A 1ILPA 1VQPA 4KZCA 4N58A 3AU4A 4YHHQ 4EZLA 1HZCA 1JCKB 1AFPA 2WXFA 4KSLC 4WJWA 1C0AA 1YMHE 2JN4A 4G57A 3G6EA 3ONSA 4CHTB 3RNAC 4AH6A 5AZHA 3CCRA 4IALA 3ENEA 1X3EA 5DNFA 4DR3Q 1JB7A 1C77A 2O6VB 3CRKC 1H9SA 3GTPB 4RGMA 5HGQA 5IP7H 2HDLA 1W6JA 1Y14B 4PMWA 2F4VQ 3PF4A 1MFWA 2R7FA 3D6WA 3PV0A 4GU2A 4HROA 5JXVA 1KHIA 1XF5L 1TWAH 4JPSA 4DAMA 5BYRA 3VR4A 2QJLA 5LMUL 1U4AA 1CZGA 4ANWA 4P75A 1TZOA 4HJ7A 3NVVA 1EZ6A 5CBAE 2E2IH 1EIFA 3R66C 4PS7A 2WAQG 1G8ZD 5C3XA 3DLLA 5NUCA 2I1KA 1DXMA 4HIMA 3MJWA 4A20A 2K50A 1V8CA 3W1SA 3OW7A 4RH6A 4G11A 1QF6A 3VR2A 3PO2G 3L0OA 1Q82C 1FNWA 3DVGY 1X3FA 1Y8OB 3PUYA 5KNDA 1VRAB 2IPKD 4IOAA 3Q8FA 1G2TA 3NTKA 1D2BA 3NP8A 5IWAQ 2F0DA 4JI5L 1E22A 3SVMA 2JF5A 4WJOA 1RIPA 2MP2A 1FR3A 3NTIA 2KJHB 2A6EC 4QJFA 2INDC 1P8LA 3IFDA 1R4MI 1SXTA 3K8AA 2M8SA 3KBGA 2RDBC 2MLBA 1PH6A 3SU8X 4LF8L 3TZUA 1QOGA 2LGSA 3BK1A 1G6PA 2PZTA 2I46A 2WWZA 5IP7G 4KGRA 3T3NA 1SEBD 3TP5A 1XMOL 4C4VB 1WYGA 1WX9A 1AH9A 4X3KA 5KNCA 2KDFB 2KX3A 4QMGA 3VDYA 1VZ6A 3UQBA 4BXXH 2IX3A 2CCZA 1ASYA 4CJ1B 5KRUA 3TRZA 2M56B 3NS1A 3I55A 1WTPA 4WJ4A 2I5HA 3RMHA 2KOXA 4KV2A 1VQ4A 5C5MA 1X1MA 3I4MH 3S1NH 1AYFA 1ZOYB 2LGYA 2ZZPB 4TUUA 1QVCA 5FLXL 4DV0L 5KYIA 1N8RC 4JI2L 1PFDA 2VZKD 3B2GA 5D65A 4G3XB 1UE1A 5DLQE 1STYA 1G6JA 3QOJA 1WTRA 5MPOA 3U4EG 5FO8B 1V81A 2CHBD 1P1AA 2UUCQ 3DWMA 5IT9L 2H1EA 1WE7A 4F8MA 1YNJD 2ALYB 4A3CG 2C9OA 1D3ZA 1QJOA 2UUAQ 3I9V1 5D2MB 1I4QA 1XPOA 1FFUA 2F0VA 3TBIB 2F0GA 2LWPA 1E1TA 2DZJA 1EOTA 3T51B 2PO4A 4X65L 3B08A 4ABNA 2MQHA 1C4QA 4X3UA 3S14B 4WJPA 3KLSA 1NR4A 4LF5L 3PUWA 4K14A 1Z7TA 1WMHB 3GDEA 1ESFA 4P74A 1W2BA 1E5WA 1EF1A 4BXXG 2CU3A 2O6VD 1VQDA 3IBEA 2EIFA 4NY0A 4GOPB 3PUZA 2MX2A 2BCOA 4IUQA 5J1ZA 4X62Q 2ZJQA 3ZRFA 2PE9A 2MWSB 1TIFA 3I4MG 3U9OA 3ZQ4A 2PQAA 2Y0SE 1YNNC 2PI2A 3LGJA 4JI8L 4BBRH 1TVXA 2KFKB 3MC8A 3HIZA 4DAVA 1EIGA 3FPPA 3SGIA 4HJ5A 1VQLA 2ONQA 4KKJA 2K03A 2K22A 1I42A 1A0IA 2RVLA 2DUDA 1RFKA 3IT4B 3AB5A 4NJCA 4ACFA 3PSEB 2F0QA 4PZ8A 1WZ3A 3FKYA 2QIEB 1TY0A 1P7FA 4BOSC 5GQOA 2NTTA 2BT6A 4OZBA 3M4PA 1V9PA 3TP8A 2BW2A 1X55A 1JJ2A 2KX0A 2LVPA 2DY7A 2TSSA 2XTIA 1LM0A 2BDOA 1CHQD 4B6WA 2UU9L 3EECA 4LJZC 3M7GA 3H15A 2A69C 2AEHA 1JRPA 3S1MH 4QIWB 1FIQA 1N61A 4LNFA 4XYCA 1GB1A 4MACA 1Q46A 1FD7D 4B3TL 4YSYB 1WRDB 4LF9L 1JWMD 4HDOA 4CDEC 1HR0Q 3AU5A 3Q3JA 2VQEL 4B95A 4IFDJ 1CT1D 4W9IA 4F7ZA 3OAWA 1LACA 2LXCA 2BS2B 3Q69A 1YJJA 1ENAA 1HHVA 1KQSA 2D3BA 3DBHB 3SXHA 4BBNF 4BBRG 2KCCA 3BJUA 1VQFA 3T1HQ 1MI0A 3AE1B 4OWTB 3BU2A 3S17H 1F9SA 4DR5Q 1RLFA 1XD3B 2UYZB 5JJZA 4EUTA 3V05A 4UHVA 3A7LA 5ELBA 3P4PB 4HEA1 2LD9A 4WURA 4B3RL 1ENFA 3I73A 4AQYQ 1RJTA 3NSWA 4A3LH 3PHWB 1GJXA 3AEDB 1EY5A 2F0OA 3BYYB 1KD1C 2ZPNA 3MJ5A 3RZOH 2ASQA 4ZCKA 1F2ZA 3PMFA 2KDIA 4DV7Q 2HJ1A 3AEVA 2EYLA 1PTOH 1SMYD 3ZVVA 2M2LA 3CHBD 2L76A 3PPAA 4OHJA 1KC8C 2NTSA 1M1KC 4Q2JA 4HSVA 4POFA 1XCTL 2V0GA 4K2KA 1TQOA 4MIUA 4O1NA 2PKOA 2ZW0A 2DBYA 4KHPL 2CQAA 2SEBD 4DDGD 2K5NA 2WAQE 3AB9A 3GQBA 3VR6A 4WJQA 2BKRB 2HDEA 1S5CD 5C4HA 3DWGC 2LI5A 1A5RA 2BWES 1CM9A 3U58A 1XMQQ 4ANVA 4JBJA 4YSZB 3CC7A 1BKBA 1RD9D 5IA7A 2WXIA 1E10A 3OJ4B 1J0GA 3DBRB 4JI6L 1HZ9A 2KKCA 1FGUA 5JHAA 3AE4B 2K52A 4NAWA 1PFNA 3U50C 4IURA 3UDXA 2NN6H 3BDLA 5C4JB 3P63A 5LL6S 2KEDA 1V5OA 2EQSA 2AMCB 2K14A 1EWCA 3GTGB 4A3LG 5M3MB 3ER0A 2KZRA 1NR2A 2G9DA 3A9JA 1L0XB 1JJCB 3HOXB 3R8BA 2ZEQA 3VQIA 5EBCA 2L7RA 1LTID 1KLGD 2XSCA 1OTCA 4HLEA 2IL8A 4HSPA 1Q90A 3ZTCA 1EYDA 2RKSA 1VQOA 2IGHA 5FLMH 1U4PA 2AQ1B 3GTQH 4DHZB 1PHJA 3ZGZA 2NVYB 3B9JA 5JEAG 3FVQA 1ICFB 1E7VA 1WTVA 2IY5B 1ASZA 3R93A 2JYTA 4DQOC 3GTLH 4TV3A 2Q8TA 2EE1A 2PE6B 4HTHA 4FVMA 1SFOB 4RNAA 5CX3A 2L00B 3EFUA 3TBLD 5G3LF 1EIHA 2IHFA 2LUMA 3KUDB 5C6AA 2JA7H 2GMIC 3VVWB 4HVBA 1S5BD 2MW5A 1XT9B 5KHOA 4XQQA 1KDCA 3WDNA 4YCWA 4OVVA 1Q7YC 4ICVA 1E7ZA 2Q8RE 3G7LA 4EQ5A 2NN6G 4I6NB 4HMIA 4XE0A 4M00A 1VMPA 3FP9A 1P3QU 2DYBA 2V4LA 4K7SA 3OG5A 4NDXA 2N78A 2UUBL 3AV8A 3X3MA 1Z5SB 1JB3A 4JWSC 1VQNA 5C0XJ 5M3FB 2PZWA 4GNXB 1XQQA 1NSNS 2RCNA 1KFYB 1KNEA 4A3IB 3M4OB 3JYUA 3PZ7A 4RHSA 4B9XA 3OYYA 5HG2A 5LMUQ 3O13A 2XVSA 4H13C 2JU6X 5IYDH 2EYFA 1ZYRC 5FLMG 4NQLB 3L08A 1VQBA 2MEKA 2MA9B 1B7YB 3R3OA 5C3JB 4IW0A 1YVCA 4C56C 1IW7C 5M5YB 2EJGC 2O2VA 5A2QE 2MFIA 3GTGH 4WJ3M 1J7AA 4PZ7A 2LFIA 1V1PA 3EVQA 4EQNA 3J7YW 5IYBH 2GI9A 3AE5B 4MGYE 3U7ZA 3E9HA 5TSSA 2RDGA 2K5DA 1PH2A 3D8GA 2DY8A 2JSVX 4A3MB 5K5PA 4JI5Q 2JA7G 1RTOA 1MI2A 5IE8A 1WFYA 3ULJA 3TZDA 3CW2C 1SF0A 4AJYB 3KF8A 1YX5B 1AE2A 2BE5D 2J7ZA 3IKJA 3DUZA 3GO5A 3KJOA 1NCVA 3HM3A 4CJ2C 3QARA 3TUOA 3I8ZA 3N1YC 1MBYA 3BINA 5BO4B 4DA2A 3A0JA 5I4DA 1STBA 4A3BH 4KGTA 5EE3A 4A3EB 4OIJA 4ZYNA 1XMOQ 2R93B 5ELNA 1F2MA 1JOOA 1QNUA 1UBQA 2BYFA 1V43A 4HCNB 3CQZH 3C19A 1EY9A 3CCVA 1PYWD 4HCEA 5IYDG 1LTBD 1F9PA 2VH1A 4WQMA 2ZVOA 4A93B 3ZDTA 4C7YA 3IL8A 1AEXA 4ZKCB 4LDTB 4KZ0A 1DGSA 2DJGC 1HZ6A 2NVQH 1DCZA 1H9JA 2N4FA 1E8ZA 1O7LA 3U7DA 2BQQA 2YU9B 4EE2A 4DV0Q 2INNE 5IYBG 1Q0WB 1T5XD 3DWPA 4WWNA 3Q8BA 2DAJA 4TVAB 4BY7B 2GA4B 2F03A 1T3QA 3AFPA 3CC4A 5C5LA 2BVCA 2F0JA 5CV8A 1D5MC 3T56B 1YJ9A 2KLCA 2KACA 3P1HA 2HTME 5I9PA 3BS1A 2KQ4X 4MJSB 2A74C 4IPGA 4KHVA 1EL0A 4GOPC 3AULA 1SE3A 2EY6A 3IG3A 1LV9A 1XLQA 3NG0A 4A3BG 2NBFA 4X65Q 4DR3L 3PZ8A 1S72A 4IPCA 1UGMA 5G55A 4JI0L 1Y1VH 4LF5Q 4U673 4A3JB 3AMZA 1PTOC 4NW2A 1PZJD 4F1SA 1J7CA 2DX5B 2BYEA 1IBXA 4W9FA 1NBWA 4IC7B 1VQJA 4R4TA 2K5HA 2BPSA 2WFWA 1AW7A 4HAEA 3PRPB 1HA5A 3LWEA 4BZAA 3A4RA 5GMVA 1XX8A 1UH6A 1I3QH 2N88A 3CCEA 1VQIA 1FXIA 3GD7A 2WLBA 3UIOB 4K2LA 4P72A 5A35A 5C4XB 1A6XA 1O7IA 2LXAA 3P42A 5DPWA 2R93H 2Z6KC 5C23A 3VXWA 2IO3B 2PW5A 2C5LC 3VR9B 3ZTDA 1ICWA 1YBYA 2JYEA 3RNFC 2N1VA 5IWAL 3KBXA 3OWFA 2UWQA 3Q24A 2LZ6A 1VS0A 2R7DA 3UDIA 2Q5WD 4HXDA 3H0GB 1MD2D 1YJ1A 1DOLA 3J81E 1GUGA 3HGBA 1HNXL 2YU9H 3EROA 4ZDVA 5IYCG 1TWCH 3GTMH 5C3EB 4GXBA 2AWTA 1ZE3D 3VDZA 1Y1VG 4ZAIA 4LF4L 2QC8A 4A3DB 1F77A 5IIFA 1PQSA 2M0AA 1AARA 3D4RA 4DNTB 2LMCB 2D2CC 2VQEQ 2K8HA 1JWAD 2KLGA 4DK5A 3ZXRA 5CR3A 1D8LA 3W5OA 3TN2A 4XZ4A 2CJNA 2W9NA 3A74A 2C5CA 4NXNL 4IWPA 4ME5A 2R93G 1SDFA 2EYOA 1A8VA 3MAQA 3DEPA 2LHDA 3T8MA 1K52A 5BMHA 4YSXB 4MGKE 3NQIA 4GLAC 1Z2MA 2RD0A 4M0WB 1P16A 1Q12A 4B3RQ 3K57A 3OSOA 3PO3B 5D14A 3PO0A 3WALA 2BH8A 2UUAL 2R7ZH 2Y0SB 1EUVB 1EQTA 5D94A 4YTNB 3NBHB 4YCVA 4MHEA 4DR6Q 5C4XH 1PH8A 1AZPA 2B76B 5JPNC 3PSIA 3ZW3A 1K3RA 1I7HA 4YTMB 3OIQA 1X54A 4J15A 3GE8C 2BYVE 2IO1B 1DOMA 4HJ8A 3ULPA 2ICIA 4QB4A 1HEZE 1EU4A 3I2ZA 2WIIB 2XK5B 3ML9A 2HHHL 4C3HH 2R92H 1QQRA 1YIWA 1PDXA 1I35A 3FDTA 5DAUA 2L32A 1I4RA 5GAEC 5AUIA 4IM3A 3D3RA 3RT3B 2V3SA 3PGZA 3LXFA 2AL3A 4BKGA 1B1ZA 1TBEA 2K8BA 1S1QB 1D5XC 4CGYB 2CR5A 2JY6A 3CPFA 3T9LA 5KIXA 2J0MA 4ICUA 4FJYA 1YZ6A 2KECA 2ENBA 3F2DA 4JBMA 1B50A 2R7ZG 1WXMA 2O6VA 2AYOB 2M9VA 3SK6A 1PVOA 3M4QA 4LUZA 3SD5A 2F3IA 2GBMA 3NELA 5C4XG 1VQEA 3HVDA 3K80C 2KDEB 5GXGB 2IBIB 4YWKA 4KIKB 4X3SA 1YHAA 2RDHA 4ODGA 4W9LA 1EEID 1TKEA 2D3CA 3ZNGC 5L95C 1AP0A 2DNEA 2BS4B 2IO0B 3W2DA 4RWSC 1EIYB 5CGKA 1TKWB 2KHWB 2MSED 1WXSA 4L6TB 1ZKOA 4LTUA 4ANXA 4DDID 1K51A 5EJWA 2IYDB 1WGGA 4C3HG 2R92G 2KVZA 1MG8A 2M4NA 3QHTA 1L6UA 4LK0M 2A19A 1G291 2R2OA 2A6ED 1ZKHA 3E9IA 1L2NA 2GB1A 2D07B 1JWUD 3TEXA 2X69A 2ID0A 3CPWA 3J81j 4B3SQ 3H7SA 4NQKE 3TMPB 3KW5B 1WH3A 5ELDA 1HTPA 3NE5B 2B2TA 2UXCQ 1TKGA 2KVMA 3VR3A 3MEHA 3TS0A 3K7AB 4DF7A 1KXLA 3P2BA 5L83A 3PO2B 4DXAB 4E3CA 4AQYL 1Q1BA 2PEAA 4R4QA 2N55A 2KTRA 2CVRA 1ILQA 1UUPA 4JV5Q 2K5VA 3J81c 1PH4A 2MHJA 2NCNA 4IOIE 3X0WA 5K36H 1II3A 3OTOQ 4DFAA 2BKFA 1MHXA 4X57B 4PZ6A 2O2LD 2K6DB 2WDTB 3IAS1 2L0FA 3RI7C 5BN4A 3UE0A 2V1YA 2MO0A 1VQCA 4GN5A 2F0EA 1A70A 3PTFC 3JSVB 3JAME 4DNIA 2K6AA 2OTLA 1FRRA 3CMEA 1XMQL 1HNWL
chains in the Genus database with same CATH topology
4IDIA 1CTMA 2WDQB 4XQJA 3W5VB 2NZ1D 2E2IB 3NUCA 4WWMA 1BUVT 4HEDA 1F2LA 1BXTA 1MPEA 1WWTA 3E5SA 1ENCA 2ON8A 2WU5B 5K36G 1O7ZA 1YN3A 5FK9C 1KNAA 1UEAB 1XLOA 1EU3A 3K6OA 2WKCA 5EKIA 5A2QL 1FNVA 2K9XA 3AM9A 2WDVB 5C4ZA 4DN4M 4WRDA 3IAYA 4K5VA 2B2WC 1WD0A 4L23A 2XRQD 3WOFA 2EYMA 4Z9CB 3L9AX 2D9UA 2JEBI 1LABA 2EY1A 3LB8C 1L4DB 3D4DA 5IGCA 1YJIA 3I4MB 3S1NB 2QDBA 4XQNA 2A68C 2A69D 3FEWX 3AEAB 1NUCA 1DYQA 4NKLA 1LT5D 1SNOA 4A8XC 1TS5A 4ZK9B 1B44D 1ET9A 4N9TA 2MP1A 3J7AV 2XWBB 3URYA 2JE6I 3NBIA 3VYUA 1J7BA 1PLFA 1RYJA 4Q5VA 5E1FA 4B9WA 4DXGA 4KI0A 1C4PA 2A73B 1N63A 1NYRA 5C0XH 4FF4A 3BDCA 1S5FD 4PMCA 2J4XA 1DOYA 1H9MA 2VB3X 3MXNA 5EBDA 1WTXA 3C46A 2K0PA 4NAMA 4PT5A 2B2VC 4FF1A 1RM6C 2ZT9C 3I4LA 4RF0A 1B9MA 4BBRB 1FEHA 4J3OD 1E2VA 5LL6X 3X3NA 4JWUC 1EEFD 2OHFA 3NVZA 1LTRD 1ZP0B 2HQEA 2BOSA 2YYZA 1D5ZC 2CJOA 2VB2X 5D7GA 1QE6A 2W3RA 5HURA 4FO2A 2B8FA 4JK1C 4O42A 1HCZA 1HUNA 1IKMA 3ETRA 1N5XA 1I6VC 3QWNA 3T53B 1VDZA 3BVZA 1STNA 3S1MB 5C0XG 5EE0A 2F0HA 2B39A 3P4QB 1ZXTA 1DGJA 3MHZA 4USAA 3E56A 3MC0B 2WQYB 1QG7A 2LKVA 3D4WA 3OHXC 4HN7A 4EQPA 3J81L 3U9SA 2WXLA 1SBBB 1VJKA 3DM1A 3HRDD 2F0WA 3EGRA 1FMAD 2L83A 3S17B 3Q0AA 4IZ8A 1F2RC 1FO4A 1E0ZA 2WXOA 5G5GA 5HGTA 1J9OA 4BS9A 1DM0B 4G4KA 1BO0A 3QOLA 2B2YA 1XLPA 1PGBA 3C2PA 1EWHA 3RZOB 2BS3B 1Z6HA 5I9OA 2WDRB 1TS4A 3H6MA 4R8NA 5BN3A 1KTKA 4HCSA 4WH4A 1HPCA 1PTOB 5ELCA 1C9FA 1FNUA 1VLBA 5T1IA 2J0TD 3NXWA 1K8OA 3AECB 3F2UA 4F87A 2O5JC 2I07B 4C7ZA 3QB3A 2VXWA 5IGDA 4MN3A 1IYVA 4C80A 2PQEA 1ZYRD 2Y3AA 5J39A 1SYEA 1Q10A 3GTOB 1IW7D 4C3JG 3AE3B 5M5WB 3OMGA 4TSSA 1LTTD 4K6LA 1F9QA 2PVOD 3MP9A 3QIAA 2MJ8A 3RLFA 4US8A 3C1FA 3UI2A 5EKKA 1NYQA 3GTQB 3KLRA 4EQOA 3DXJC 4XT3B 3V3XA 3H3VC 3GTLB 1OXSC 2Z4HA 2KEEA 2L5TA 2K5QA 1YN4A 3NUHB 2R61A 4RA8A 1TY2A 1I4XA 2JA7B 1IUEA 3AEBB 2W55A 2E6XA 1K8MA 1EY8A 3VRAB 5HFYA 2PYKA 2JXTA 2F0MA 1BUIC 1R9TB 3C8YA 4ZOHC 4ZRQA 1TKYA 3SK8A 5AFWA 1QOAA 5D3IB 4B0MA 1CHPD 5CV5A 2EY2A 5FO7B 3PIP3 5FOBB 2EYHA 2Y5PA 3AE9B 5JPMC 2N9KA 1K50A 2X38A 5H92C 5KGUA 5DM63 1SYFA 1FYCA 3I70A 4XDCA 1C79A 1E2WA 3M85A 1C4CA 2AWNA 3NWTA 3DEOA 4A3BB 1Y8NB 1OXVA 1DOXA 1JE4A 2DLBA 3TP7A 2L52A 3CQZB 1OFFA 4FP5D 1VZ8A 3HZXA 1NENB 1VCIA 2NN6I 3Q8AA 1DZ1A 1EQVA 5BYQA 2RSOA 1DJRD 2NVQB 3AU7A 3NZ3A 1W6KA 5BMGA 1L5PA 1ONLA 3VYTA 1XEEA 4S3SA 2J42A 4R8IA 4OO1I 2AWOA 5CBEE 1EFID 1EM7A 4RCNA 1FCCC 1JWBD 1STEA 1N5WA 3U52E 1QWYA 4C1NK 4K5XA 1TS2A 3J9CA 4KN7C 3J7AF 1C48A 5CV4A 1GUOA 4UDUC 3IFTA 1HQRD 4ARIA 3Q8EA 1QNKA 1Y1VB 5EPJA 2FMMA 2WXPA 4FF2A 3FMCA 4IUTA 3D31A 2IX1A 5JAVA 4R3DA 3EFXD 1I3QB 3AH7A 3AE2B 1WD1A 1BF4A 4J6HA 2PCFB 4IUPA 3KQ4A 1A2UA 2M19A 3NBHA 1JALA 1IGDA 1EYCA 2WXHA 5EGTA 1FRDA 3BYTB 1QKZA 3OIPA 3A7AB 3SR1A 2SAKA 3D6CA 2RSNA 1GB4A 4TQ0A 4JBWA 1KF6B 1TWCB 3GTMB 2I38A 1HA6A 2WP9B 4QCLA 4IUUA 1X3PA 1R7SA 4H0LC 2JSOA 4US9A 1JOKA 3T4AC 2D5GA 1IHZA 5C3WA 5CYUA 5CMDA 3QJYA 1SMYC 2XRSD 1QT9A 4LK1C 2PW9A 2ZXOA 2BB6A 2B2UC 2LHEA 2NYZD 4PMBA 1GUWA 1OXUA 2XWJB 1DD2A 3TEYA 4GDLB 3V96A 2GRIA 2E2DC 5LNK1 2BA0A 2IT1A 4J8QA 4NMZA 1ML0D 1PDQA 1D6EC 4L1BA 2K01A 3AE8B 3K58A 1BQQT 2MHVA 2R7ZB 2ZW1A 3HEJA 3P4RB 2NMQA 4IUVA 1PFMA 3VR5A 1BOSA 2EKIA 1YQ3B 2IW3A 3VA5A 2AQ2B 4B08A 4C3HB 2R92B 1RF2D 2D5DA 2WXMA 3IAM1 4YWGG 4G7OC 2Z4IA 1A3VA 4H2AA 3W3AA 4EVOA 2BTEA 2WXQA 3I3CA 2JP1A 3T16A 4KN4C 2F0NA 2PMZB 2H88B 2KCNA 3A8IE 5FO9B 4FXKC 3VA7A 1PUTA 3BIID 2RMMA 1SYGA 2EVBA 5IGGA 3V2TA 1OXXK 1HTLD 1LO5D 1ZDVA 1UNSA 4WORA 2Q8IB 4GZYC 4A90A 4M8AA 3TP6A 4X3TA 5IGBA 3A55A 4D2KA 4YIJA 2W54A 5JEAJ 2MGSA 5FKAC 5EPLA 1M4VA 1TJEA 4EGVA 5C2TB 1G91A 3Q23A 4OVZA 4V0BA 2JX5A 4RGOS 3MTSA 1A15A 1HFGA 1VF5C 4CKCA 1RDPD 1XLNA 1MGSA 2QKIC 4P6VF 1DOKA 3BDOA 3HUIA 3K5LA 4KGSA 2F3VA 2Z8LA 1AWDA 1HUMA 1F9RA 4KK7A 1OO9B 1QB5D 1PMRA 2EY5A 2A68D 2PNRC 1RWSA 3P1MA 2J52A 4DAYA 1MSGA 3G6JB 1Y69U 3K0YA 2MJ3A 1MSHA 5DM73 3K5NA 3KLSX 2MUYA 1BR9A 1SIJA 1ZDXA 1IGCA 1XCQL 4R9WA 4H7BA 3R2TA 4IN3A 4A3FB 4V190 1ZUD2 2CW0C 5DEHA 2MPMA 3H91A 3ERQA 3PIO3 1IBXB 2KOLA 2AX5A 1H9RA 4ZHOA 4ZLTF 4CKBA 2SNMA 3AEEB 3ITPA 3K59A 1CJEA 2FJ2A 3OWEB 3FC4A 1SNMA 4ILWA 5JVH3 1Q3LA 3ND9A 3J80E 1CA5A 1L0VB 1TIID 2EYJA 4IFDH 1EY7A 3N52A 2A6HC 1SYCA 2D62A 3I57A 3BVGA 1GUTA 1OQRA 3OOCA 4KHZA 1RODA 4C1NI 4RKBA 2WS3B 2B63B 4JX1C 3TEZA 4PQXA 2E74C 1Y8PB 4QF4A 1CZPA 2BA1A 2H89B 3GS2A 4JE3B 5BMIA 5J22A 1PXUA 4XDXA 3H09A 1HFNA 4FNFA 3NHHA 1SNCA 4KKSA 3L3OC 1R4QB 3HOVB 2K1BA 3NK9A 3NQTA 4XXEA 1LTAD 3QO2A 5ISRA 2J53A 4XIGS 1G2SA 2NVTB 3MXPA 1GPXA 2SDFA 3P20A 2PPBC 1XO3A 4REZA 5CORA 4IFDG 1CA6A 1CQVA 4QUCA 1ZPSA 1SSNA 1F2RI 3A54A 2KN4A 1IKLA 3S16B 2NUCA 2Z1CA 2DWQA 2VNUD 4C3IB 3RUZA 3GB1A 1YNND 3MFGA 1FXAA 2HCCA 4L2YA 4U68A 3I91A 3QG1A 5IODA 4BY1B 1DONA 4WAFA 2E3TA 1EY0A 1KRHA 1D4BA 1TYGB 3EA6A 4LAAA 1SNQA 2L1AA 4QUFA 3S1QB 1BDOA 4RF1A 2R6GA 2ACZB 2VZKB 2K5PA 2FBWB 3E9SA 3RZDB 3TEWA 4FXCA 1Q8IA 1JICA 5EE1A 1X32A 1B4OA 1TWFB 3IT6B 1EZ8A 4N59A 1BCPC 2N0SB 1TT2A 2WKDA 4DXFA 2F0LA 1HQMC 3A8JE 3UI3A 3PUXA 1WVLA 4XWTA 5CV6A 1WSPA 4M1UB 2LEKA 4OZAA 4XYQA 5KYLA 2K33A 5KEEA 3ZJTA 3Q8CA 3ND8A 4BA2I 2EOTA 1L0YB 2DYOA 2I2YA 2IJ0A 2ZXRA 2WU2B 4AQ7A 1TWHB 4E6IA 4HR7B 4C3JB 3AEFB 2E2JB 3N9YC 1I4HA 1D1KA 1RKNA 1E2ZA 1LTGD 2KMMA 1N60A 3FILB 1JC7A 3S9WA 4ZRZA 4A55A 1TU2B 4F7XA 4FYDA 3E0JA 4NP5A 1JQ4A 1TWGB 1Z47A 3NVYA 1STGA 2JYOA 2N9LA 1B9RA 5KNBA 4OGQC 3T3OA 2EJFC 4P2CB 5LHY1 1XXGA 3AEGB 3M7NA 2XNAC 4XDDA 1GOZA 5D3DA 2EPBA 2MJEA 3MZ5A 5C0XI 3CWIA 4HJGE 1KAAA 1E6EB 3DWQA 5I6YA 2IGGA 4ITKA 2OEOA 4G7HC 4BWGB 4C3IG 1I50B 2KAJA 1LLRD 2AUJD 3NPPA 1GHKA 1NVID 3AE7B 2RPVA 2PMVA 1PZID 2G1EA 3DMUA 3L4PA 3MA2B 1PRTC 1C78A 3E6ZX 1WTQA 3DWAA 3WCQA 4B0EA 1IYUA 3A8KE 4N6EB 1XYIA 1JW9D 3MHBA 4TQUS 1Y56A 2F0UA 2O4XA 1PTOF 1SJHD 2ICEC 1HZ5A 4ZRPA 3B2FA 2R3ZA 2W82A 1CQFA 2WB1B 4ZUJA 1B3AA 1E9MA 5E4XA 1VR9A 1O7YA 1U4RA 2QF7A 5BN5A 1EYAA 4MH8A 3RFZB 3GV3A 4G7ZC 5ELFA 5I2XA 4AS1A 4XT1B 3H94A 2SOBA 2EELA 5I2YA 1B53A 2L9HA 2WV6D 4OL7A 1U9RA 3AE6B 3HRZC 2OT2A 2F3WA 3SEBA 3Q6SA 1Y1WB 4A6QA 1EWYC 4J1MA 2EXZA 4KTAA 3VR8B 3SK5A 5HI1A 1H9SB 2X6LA 3OPOA 4ZUIA 1S4ZA 4IKGA 1I4GA 1LT4D 1SNPA 1X3QA 2PW7A 3LWUA 4AYBB 1K83B 4PNYA 4CBVA 2KQ3A 4KD4A 5I6WA 3EJIA 3A56A 1V1OA 2SNSA 1DOIA 5M5XB 4NZLB 1V97A 4K8IA 4ZQ3A 1VF7A 1GHJA 3S2HB 3KK7A 5F2DA 1I6HB 3EUB2 1C4AA 2F1MA 3SFDB 3BZDB 4PV1C 1O78A 1O80A 1SSOA 3HOYB 2NVXB 3AMUA 1E7PB 4I65A 5CV9A 4HKQA 2IDYA 1UWMA 2HUGA 3Q22A 2JZPA 2JA8B 2L1BA 5JEAH 2F0KA 1RHPA 1CZWA 5E3FA 1JWSD 4OIKA 1FCLA 1PTOD 3VRBB 2JWUA 4KJOA 4RAUC 1UGJA 3J80L 3LYYA 3CRLC 1F0ZA 1WXQA 4RFBA 4YTPB 1I4PA 1JR0D 2B2WA 1FM0D 2B8GA 3S1RB 2WXJA 1GAQB 3M4YA 4HKZE 2BB5A 1PGAA 1YNJC 3JAML 4XWWA 1F2YA 4HRSA 3GTKB 1EY4A 1KABA 4N9PA 4OO1H 4DGZA 1TS3A 2PLPA 1WTOA 1QOHA 2OXPA 5JOBA 2FUG1 1S5ED 4IUNA 1N62A 2K05A 1STHA 1PGXA 1A3TA 1L4ZB 1GXDC 1Q1EA 4DU9A 2VUMB 2E75C 2OF1A 2WACA 4ID6A 5T1GA 1C76A 4OZCA 4RHRA 2QCPX 2F0TA 1M8AA 3ZJUA 3BK2A 2LMCA 1FD6A 1T5EA 2L11A 1JMLA 4ULLA 2B2VA 4FF3A 1E0BA 2E76C 4RGNA 4ZYSA 1WTWA 4FXGC 3BG3A 3FRPB 3HKZB 5E6JA 4OO1G 3KWVA 4MM3B 4HMJA 4M0WA 2HDMA 1U4MA 4KY6A 1OXTA 3TSSA 2PIAA 2NWGA 1KDAA 2B2TC 3HOUB 2RQXA 2PVGC 3SK4A 3S2DB 1QOFA 3C3LA 3GV6A 2G9HD 3BWUD 2AQ3B 2KJXA 3MFYA 4Q0FA 4TMAB 1G6ZA 3H8HA 2Y5CA 4YXDB 2L55A 4UAIA 5IGFA 1AN8A 5EPKA 3MWYW 1YNTE 5EKLA 4Y7NB 1YQ4B 3LNNA 1D1IA 5CV7A 2WINB 1NAPA 5H8YE 5G5HA 2IGDA 4DK1A 4TRDA 1KDBA 2LGIA 1AZQA 2QSDA 3CU7A 3RD4A 1LT6D 2N7JA 2K7VA 3MXUA 3SR6A 2K5WA 1SE2A 3K5OA 4K6DA 2EDGA 4KMUC 2RA4A 3CIRB 3PUVA 1NEKB 1WRIA 2PZUA 1BNZA 3P4SB 4NAWB 2EZVA 3I90A 2CW0D 1UAPA 2V3PA 1BCPF 3LX0A 3KWLA 2FINB 4K8JA 4IQZA 1SNDA 2V4DA 2AUKA 2ZXPA 4XYOA 1BCPB 3VYRA 1BMLC 3ZJVA 3TDQA 2QEJC 3KUPA 2O5IC 3P7JA 5HHDG 4ZHPA 5G3LD 4KJNA 2IX0A 1ZEQX 3N6RA 2LJIA 3ABVB 3NWSA 2TMPA 1ZXIA 3VYSA 2KUMA 2K3UA 1SYDA 1QOBA 2WXRA 3R2IA 3TMEA 2A6HD 5FR3A 4BA1I 3FAHA 3DHQA 4L8JA 4I7ZC 5FLXE 1A3UA 4KX6B 1MHHE 2FHTA 1LTSD 1SJED 2JA5B 1CK1A 5IT9E 3L7ZC 5COYA 4LLGM 5AUKA 5T8IA 2BBCA 4DK0A 3ONAB 5IGEA 1H9KA 1GUSA 2JXMB 2JEAI 4RGTA 1XWEA 1JOQA 2K04A 3OMCA 1V1PB 2LS01 4CKEA 1EY6A 3S15B 1ZXHA 3T13A 3W5UB 3AN1A 1TR5A 4F88A 1CFMA 1PRTF 3I72A 2M00A 3NVWA 2BE5C 3HS0C 1OQQA 4WFN3 4C2MB 1PRTB 1VDVA 4MT5A 4LMQD 4KY7A 1JROA 5C44B 1J8IA 2WNMA 4H44C 4KKUA 4P16A 1P7EA 1BCPD 3NTHA 1SE4A 1U4LA 2RDFA 3K5MA 4FXDA 3BVMA 2F4IA 1SYBA 1STAA 3M3YB 4DAPA 4TQ1A 2LFNA 1B2TA 4YT0B 4DNRB 4ZKBB 2L12A 3EQLC 4RCOA 5CC4A 1IL8A 2W3SA 1R4PB 2MH7A 4BBSB 1L6VA 1RCVD 2B2YC 2EJMA 3SE0A 2LY7A 4KV6A 3ZYYX 2V3NA 4ARCA 2EYPA 3HP3A 4L63B 3U2SC 5ELEA 4RKLA 2X6GA 1B9NA 2YEPF 4TKOB 2DYMA 1K53A 3HG9A 4CQNA 2HCIA 1QLBB 1V8QA 4KKIA 1T6BX 2YEPB 2DNCA 3FPUB 1A2TA 2H4OA 2KA7A 3FILA 3P75A 2L0CA 2E2HB 3GTJB 1FFVA 1ET6A 1JORA 1LT3D 2WXKA 1WGKA 4WIPA 3I4NB 3NRZA 1VMCA 2RBMA 2JQRB 1JQYD 2WAQB 4KD3A 3SFEB 1RTNA 2F0IA 2K32A 2L4NA 2WXNA 1FGBD 5JVG3 1QCBD 2V4IB 2A5HA 3RPFC 4K5WA 3MXGA 3SDZA 1HRJA 2BDNA 3C1EA 1ACCA 2BYTA 2K28A 1SAPA 2WP8J 3WOEA 2XN9C 1PRTD 2DN8A 3IXSA 2FE8A 1WCMB 4IFDI 2QMTA 2KHSA 1QILA 3CKIB 1UWXA 2OEDA 1C8CA 5M9OA 2F0SA 2NB0A 1GUNA 1TWAB 2WXGA 5IOCA 2XIWA 2KWDA 1S5DD 4A3GB 5E4WC 1PZKD 4GLSC 3HOZB 1KH0A 1BBXC 1YN5A 1KLUD 4A3KB 3W9CB 2F0FA 4OW0A 2B2UA 5EE9A 4KY5A 1PFBA 1SB3C 2JA6B 4A9AA 2FMCA 3FKIB 2F0PA 3GP7A 4CJ0B 1CI3M 1MVKA 3HVZA 1NI3A 5BYSA 3SHLA 1XTCD 2KDMA 3HOWB 5EQ0A 1ESRA 2INPE 4KKTA 2QILA 2MJDA 1VZ7A 2PTLA 3MVVA 1HXYD 2FFKB 2IWHA 4GDKB 4XTCS 1ROEA 1ILPA 4N58A 1JCKB 1AFPA 2WXFA 4WJWA 1YMHE 4G57A 4CHTB 4IALA 5DNFA 1C77A 3CRKC 1H9SA 3GTPB 4RGMA 2HDLA 1W6JA 4PMWA 4HROA 3D6WA 3PV0A 5JXVA 1XF5L 4JPSA 5BYRA 3VR4A 2QJLA 1CZGA 1TZOA 3NVVA 1EZ6A 5CBAE 1G8ZD 5C3XA 5NUCA 1DXMA 1V8CA 3W1SA 3OW7A 4RH6A 1QF6A 3VR2A 1FNWA 1Y8OB 3PUYA 5KNDA 1VRAB 2IPKD 3Q8FA 1G2TA 3NTKA 1D2BA 3NP8A 2F0DA 3SVMA 1FR3A 3NTIA 2A6EC 3IFDA 1SXTA 3KBGA 3TZUA 1QOGA 3BK1A 2PZTA 2I46A 4KGRA 3T3NA 1SEBD 3TP5A 1WYGA 4X3KA 5KNCA 4QMGA 1VZ6A 2IX3A 4CJ1B 5KRUA 2M56B 3NS1A 1WTPA 3RMHA 5C5MA 1AYFA 1ZOYB 5FLXL 1PFDA 5KYIA 2VZKD 3B2GA 5D65A 1STYA 3QOJA 1WTRA 5MPOA 3U4EG 5FO8B 2CHBD 3DWMA 5IT9L 2H1EA 4F8MA 1YNJD 2C9OA 1QJOA 3I9V1 1I4QA 1FFUA 2F0VA 3TBIB 2F0GA 1EOTA 3T51B 2PO4A 4ABNA 1C4QA 4X3UA 3S14B 3KLSA 1NR4A 3PUWA 4K14A 1Z7TA 1ESFA 2CU3A 3PUZA 2BCOA 4IUQA 5J1ZA 3U9OA 3ZQ4A 1YNNC 1TVXA 4DAVA 1EIGA 3FPPA 4KKJA 2ONQA 2K03A 2K22A 2RVLA 1RFKA 3IT4B 3AB5A 4NJCA 2F0QA 2QIEB 1TY0A 1P7FA 2BT6A 2NTTA 4OZBA 3TP8A 2BW2A 2DY7A 2TSSA 2BDOA 1CHQD 4LJZC 3M7GA 2A69C 1JRPA 1N61A 4QIWB 1FIQA 1GB1A 4MACA 1FD7D 4YSYB 1JWMD 4IFDJ 1CT1D 1LACA 2BS2B 3Q69A 1YJJA 1ENAA 1HHVA 3SXHA 2KCCA 1MI0A 3AE1B 1F9SA 5JJZA 3V05A 5ELBA 3A7LA 3P4PB 4HEA1 4WURA 1ENFA 3I73A 1RJTA 3NSWA 1GJXA 3AEDB 1EY5A 2F0OA 3BYYB 3MJ5A 1F2ZA 3PMFA 2EYLA 1PTOH 1SMYD 2M2LA 3CHBD 4OHJA 2NTSA 4Q2JA 4HSVA 1XCTL 2V0GA 4K2KA 1TQOA 4MIUA 4O1NA 2PKOA 2ZW0A 2DBYA 2CQAA 2SEBD 3GQBA 3AB9A 3VR6A 2HDEA 1S5CD 5C4HA 3DWGC 1CM9A 4YSZB 1RD9D 2WXIA 1E10A 3AE4B 1PFNA 4IURA 2NN6H 3BDLA 5C4JB 3P63A 5LL6S 2KEDA 1EWCA 3GTGB 5M3MB 1NR2A 2G9DA 1L0XB 3HOXB 3R8BA 3VQIA 5EBCA 1LTID 1KLGD 2XSCA 2IL8A 4HSPA 1Q90A 1EYDA 2RKSA 2IGHA 1U4PA 2AQ1B 3ZGZA 2NVYB 3B9JA 5JEAG 3FVQA 1WTVA 3R93A 2JYTA 4DQOC 2Q8TA 2EE1A 4HTHA 4FVMA 1SFOB 4RNAA 5G3LF 1EIHA 2LUMA 5C6AA 1S5BD 4XQQA 1KDCA 3WDNA 2Q8RE 3G7LA 2NN6G 4HMIA 4XE0A 1VMPA 4NDXA 3AV8A 3X3MA 1JB3A 4JWSC 5C0XJ 5M3FB 2PZWA 1NSNS 1KFYB 1KNEA 4A3IB 3M4OB 3PZ7A 5HG2A 4RHSA 4B9XA 3O13A 2XVSA 4H13C 2JU6X 2EYFA 1ZYRC 2MEKA 3R3OA 5C3JB 4C56C 1IW7C 5M5YB 2EJGC 5A2QE 1J7AA 2LFIA 1V1PA 3EVQA 4EQNA 3J7YW 3U7ZA 2GI9A 3AE5B 5TSSA 2RDGA 2K5DA 3D8GA 2DY8A 2JSVX 4A3MB 5K5PA 1RTOA 1MI2A 3TZDA 1SF0A 3KF8A 2BE5D 2J7ZA 3IKJA 3DUZA 3GO5A 1NCVA 4CJ2C 3TUOA 3I8ZA 1MBYA 4DA2A 5I4DA 4KGTA 1STBA 5EE3A 4A3EB 4OIJA 2R93B 1F2MA 1JOOA 1QNUA 1V43A 1EY9A 1PYWD 4HCEA 1LTBD 1F9PA 4WQMA 4A93B 4C7YA 3IL8A 1AEXA 4ZKCB 1HZ6A 1DCZA 1H9JA 1O7LA 2YU9B 4EE2A 2INNE 1T5XD 3DWPA 3Q8BA 4BY7B 2GA4B 2F03A 1T3QA 5C5LA 2F0JA 5CV8A 1D5MC 3T56B 2KACA 3P1HA 2HTME 5I9PA 3BS1A 2KQ4X 2A74C 4KHVA 1EL0A 1SE3A 2EY6A 1LV9A 1XLQA 2NBFA 3PZ8A 3AMZA 4U673 4A3JB 1PTOC 4NW2A 1PZJD 1J7CA 1IBXA 4HAEA 1AW7A 1HA5A 3LWEA 1XX8A 2N88A 1FXIA 3GD7A 2WLBA 4K2LA 5A35A 5C4XB 1A6XA 3P42A 2PW5A 3VR9B 1ICWA 2JYEA 3KBXA 3OWFA 3Q24A 2Q5WD 3H0GB 1MD2D 1DOLA 3J81E 1GUGA 3HGBA 3EROA 5C3EB 1ZE3D 4ZAIA 4A3DB 1F77A 5IIFA 2M0AA 3D4RA 4DNTB 2LMCB 2D2CC 1JWAD 5CR3A 3TN2A 2CJNA 2C5CA 4ME5A 1SDFA 2EYOA 3MAQA 3DEPA 2LHDA 1K52A 5BMHA 4YSXB 3NQIA 1Q12A 3K57A 3OSOA 3PO3B 5D14A 3PO0A 2Y0SB 1EQTA 4YTNB 4MHEA 1AZPA 2B76B 5JPNC 1I7HA 4YTMB 3OIQA 1DOMA 2ICIA 4QB4A 1HEZE 1EU4A 2WIIB 1QQRA 1PDXA 3FDTA 5DAUA 2L32A 1I4RA