1V1QA

Crystal structure of prib- a primosomal dna replication protein of escherichia coli
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
110
structure length
110
Chain Sequence
PNSLMTNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDSVDKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRIMOSOMAL REPLICATION PROTEIN N
publication title Crystal Structure of Prib- a Primosomal DNA Replication Protein of Escherichia Coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding
total genus 15
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1v1qA00
1X56A 2JA6H 3TRZA 1ASZA 1VQNA 4BBSG 3CMEA 3HOYG 1I50H 3KYHC 3NENA 3HOVG 3PUVA 4LF7Q 4JI5Q 2K4KA 4PMWA 1IBKQ 1CKMA 3S1NH 3HKZG 4HJ9A 4IPCA 2ZJQA 1K8AC 2JE6I 5FJ8H 5AJ3L 1SR3A 3CMAA 2E2JH 3CCLA 3JAMi 4DR2L 5C44H 2R7ZH 1Q46A 1UE5A 2GN5A 1G291 1NMFA 2UUCQ 4JCVE 1XMOL 4HIKA 3F2BA 4AQYQ 1Q7YC 4L5SA 4AH6A 3GTGH 3IRBA 3TEHB 4OX9L 4WJ4A 2MNAA 3RZDH 1HZAA 3FP9A 4YHHL 2F3IA 1X6OA 3T1YL 1PV4A 1KD1C 4LF6L 2AKWB 2VUMG 1JT8A 2R7FA 4DKAC 2CWPA 3DM3A 3HOXG 2UXCL 3WWVA 4DNIA 4DR7Q 2HIXA 1IZ6A 2Z6KC 4X62Q 1X55A 2B29A 4X6AH 4A76A 2K50A 2MQHA 1YHAA 3CCJA 1AE3A 2QA4A 4HJ5A 4JYAL 1XNQQ 3A5UA 4QGUA 1Q1EA 2PQAA 1B7YB 3ULJA 2KCTA 4JI0Q 5ELOA 4K0KL 1WI5A 2AWNA 3G4SA 3CCUA 2E5LL 1BBUA 2OCEA 1CSPA 1NMGA 4LWCA 1OTCA 1HR0Q 2WFWA 4HIDA 3EIVA 1YBYA 2FXQA 1WOCA 2NN6G 3MEFA 4BA1I 4A3KH 1PH7A 1VQBA 4KHPQ 1VQDA 3CC7A 2E2IH 4DK3C 1EQQA 3PCOB 2BA1A 2YTYA 1K8GA 2NZHA 3GTQH 2R6GA 1VQ5A 2YTXA 4B3SL 4IFDI 2V1CC 1Q1BA 3T1HL 1A62A 1V9PA 1MJCA 2PNHA 1IBLL 2RF4A 2I5LX 5LMNW 1M1KC 1VQPA 5C0XJ 1Z47A 3S17H 4IPHA 4XTCS 3G71A 1C7YA 1U5KA 1C0AA 4H02A 1EOVA 2JJQA 4POGA 1XPUA 3JC66 3GTPH 1EUJA 1PH2A 4JI3Q 1YVCA 3PO3H 3CAMA 4EX5A 4OO1I 1AE2A 2UXBQ 4JI1Q 1YHQA 1S3OA 3U4VA 1JE5A 1XTDA 4A3KG 4NXNQ 3ZJYC 3I4MH 2ZJPA 2DGYA 3PSIA 4LF4L 3OTOL 4GOPB 4A3JH 1VQIA 1WYDA 1VQLA 4B3RQ 5FLXc 3GTOH 5FLMG 4QY7A 1H95A 4LFAL 2KCMA 3NELA 3K7AH 2MFIA 1EWIA 4JI4Q 5M3MH 3CCSA 4JOIC 5JEAG 2R92H 4JV5L 2OTLA 4B3TQ 4C3JH 4LF5L 4YWKA 1J5EQ 3HOUH 3MXNB 1PA6A 4DV1L 4A3IH 1N33L 1WCMH 2KBNA 2UU9Q 4C2MH 3W5OA 3H0GH 2VQEL 1I3QH 1EIFA 3ERSX 5JJKA 4LF8L 2Z6KA 2WP8J 2LSSA 1KIXA 1QZHA 5C4XH 1Y1WH 3PV0A 1CUKA 4X66Q 3L2PA 2UXDQ 3KDFA 1E1OA 3I56A 1TWHH 3RNUA 2MO0A 5M5YH 2BH8A 1XPRA 3UDFA 4JI6L 1XNRQ 2R93G 1NY4A 3U50C 4ME3A 4DR4L 1K83H 3S2HH 4OONA 1EQRA 4LF9Q 4DV7Q 1E7ZA 3SGIA 3J81j 4HIMA 1YEZA 2K5VA 1KRSA 3I7FA 3STBD 1CKOA 1FJGQ 1EIYB 2VL6A 3HOVH 4AIMA 4IOCA 1XMQL 2JA5H 5LMNL 3GTLH 5JJLA 1K73C 1PHJA 1I94L 1TWFH 1KHIA 1QUQB 3S1RH 4DAMA 1K3RA 5C4JH 1UE7A 2PMZE 3KFUA 4Y52H 1DGSA 1QVCA 4X64L 4DR1L 4OWXB 2XGTA 1SFOH 2HHHL 2B63G 4POFA 1UE6A 4GOPC 3RR5A 3ER0A 1Q81C 1N36L 1HNZL 1X3GA 3PF5A 4YWMA 1K0RA 1OXTA 1VQFA 2IHFA 1PH6A 2VUMH 3AYHB 3KJPA 4DUZL 1VQOA 1TXYA 4P71A 3HOXH 2JA5G 1BVSA 3KJOA 3KOJA 1IL2A 2OTJA 3J80i 1TWCH 1IBML 5AJ3Q 3HOWH 2B3GA 3ULPA 4RMFA 5IYDG 2JA9A 4DR2Q 4JOIA 4A3LH 4JI7L 4DUYL 5BR8L 2H5XA 2K5HA 1RIPA 1XMOQ 1E22A 3PUYA 3HOYH 1HR0W 1RL2A 3K81C 3G6EA 3K80C 4A3EG 1VQ9A 4OX9Q 3PF4A 2WB1E 1OXXK 1VCIA 1VQAA 4J15A 4APVA 1SROA 1VS0A 4YHHQ 3T1YQ 3KLWA 1HZ9A 2CCZA 4LF6Q 1VQMA 2JA7H 3H3VH 2NN6I 4A3DG 1AH9A 2UXCQ 4UP9A 2E8GA 1HZCA 1O7IA 4DAYB 2A1AA 2GVAA 4JI2L 1L1OB 4IPDA 4DR3L 1YJNA 5ELNA 1L0WA 1PH8A 2Q2TA 2LXKA 3CC2A 3HOWG 1W2BA 2C35B 3GD7A 2AWOA 3I4OA 1X9NA 1VQHA 2DUDA 1MJEA 4JYAQ 4GN3B 5J3BA 1Q82C 4A3LG 4GLVB 1GO3E 2ZTCA 3CF5A 1X3FA 1K9MC 5GAEC 4K0KQ 2OWOA 2RCNA 2BA0A 3CCVA 4R1JA 3UDGA 1L2FA 5IE8A 4A4IA 2E5LQ 1YJ9A 1SRUA 1PYBA 1S72A 2JA7G 1KXLA 5C0XG 1I6HH 1B8AA 4A3FG 1KAWA 3K8AA 1EYGA 5IYBG 4PG3A 4B3SQ 1I5FA 4LUOA 3T1HQ 3UDIA 5FLMH 3PO2G 4ALPA 5C3EG 2L15A 4BY1G 1IBLQ 4L5TA 3HOZG 3J81c 2VNUD 3CPFA 4PZ8A 4GOPA 4BY7H 4DV6L 5LMUL 3GDEA 4JBJA 4EQ5A 3PIPA 4YY3L 1PH9A 3KF8B 4QJFA 4JI8L 3F8TA 3E9HA 1JMCA 3CCQA 1GM5A 3KF6B 1JJGA 1HNWL 2F52A 3PUXA 4C3IH 4MNOA 4B3MQ 1N32L 1E24A 4DV3L 4R4IA 1U0LA 4LF4Q 1GD7A 1QVFA 4A93G 3OTOQ 3RZOH 4P72A 1Y1VG 4NB3A 1WJJA 1BBWA 3EN2A 4LFAQ 2N49A 2KHJA 4IO9A 1CKNA 2EIFA 1PH3A 1A63A 5M5WH 2R93H 5M3FG 3E0EA 3M3YH 4JV5Q 4X65L 5IP7G 1L1OC 4BY7G 3M85A 4LF5Q 3CCMA 1VQ8A 1N33Q 4DV0L 4DV1Q 4MZ9A 4LFBL 1SLJA 3J7ZC 1GVPA 2VQEQ 2Q2UA 4OXPA 2EQSA 2ZTDA 1LUZA 4TQUS 4GLAC 1PH5A 4LF8Q 3M4OH 2ZM6L 3G48A 4R4CA 5IYCG 1CKNB 1Y14B 1XJVA 2VS1A 1PH4A 3PGZA 4L5RC 2JEAI 4BXXG 2VY3A 4LUVA 4R4QA 4JI6Q 4GKJL 1SMXA 1QUQA 4YCWA 4IJLA 5GAHC 1FL0A 4DR4Q 5M5XH 1UE1A 1VQEA 2D0PA 1KC8C 1WFQA 3I4NG 3Q8DA 5EAYA 1P8LA 2B63H 2XTIA 2Y0SG 3UE1A 2NVYH 1D8LA 1NE3A 3S15H 1FVIA 3ICEA 2UUBL 3M7NA 1XMQQ 5LMNQ 4QL5A 3AFPA 1N34L 2UUAL 4NXML 1I94Q 4JC0A 2NZOA 1UWVA 3TS2A 4IFDJ 4IPGA 2KENA 2Z0SA 3S2DH 2ATWA 3F1ZA 3RN2A 4DV5L 2Y0SE 5IYDH 3S1QH 1A8VA 2YTVA 2VQFL 1A0IA 1Z9FA 3OYYA 4A3GH 2UXDL 4DV2L 1HZBA 2K75A 4X64Q 3M4PA 3JAMc 4DR1Q 5IY0A 1YJWA 2AHOB 2HHHQ 1GKHA 5GADC 3D31A 4BBRG 4DPGA 5IP9G 1N36Q 2IHEA 1P16A 1HNZQ 4LFCL 4A3EH 3W1BA 3FHWA 2PI2E 2F4VL 3NBHB 4DUZQ 4DR6L 5K36G 2JQOA 2A8VA 4A3DH 4LW1A 4IJHA 2CKZB 1IBMQ 3CW2C 4JBMA 4KHZA 4HJ8A 3S16H 4GNXB 3TREA 3I55A 2WB1G 3A74A 3GO5A 3PUZA 5IWAL 4GKKL 4JI7Q 4DUYQ 1L1OA 1E1TA 2WAQE 5BR8Q 1X65A 1SN8A 2HIVA 4DV4L 1SE8A 4A3GG 4DR5L 2JK8A 4O2DA 4PZ7A 3RLNA 1HNXL 3OW2A 2HT1A 1OXUA 4NPSA 4AYBE 2I5MX 1Q8KA 3H3VI 1KQSA 5C0XI 1X54A 4JI2Q 2A19A 4DR3Q 4A3FH 1G6PA 1NTGA 4YWLA 3TS0A 1NBWA 2N3SA 2ASBA 4A3CG 5IYBH 1R9TH 1OXVA 2I0QA 4TVAB 4LF7L 1V43A 4JI5L 4P75A 4MTNA 3PO2H 1CSQA 4GLXA 1IBKL 5C3EH 3M9BA 4BY1H 3HOZH 3AFQA 2JA8G 3H15A 2NVXH 1JB7A 3CD6A 1OXSC 3U58A 3BZCA 1PVOA 1KRTA 4HIOA 1X3EA 3J7A5 4OWTB 2Q2HA 3RLOA 3VDYA 4P74A 3HKZE 1YZ6A 2UUCL 1QVGA 3CCRA 3A5ZB 2JA6G 4AQYL 2YU9H 3UE0A 2PI2A 3EBEA 3CXCA 1VQJA 4L5QA 2OQ0A 3KF6A 4A93H 1T9HA 1Y1VH 3BU2A 3CQZH 1Q12A 1LYLA 1MIUA 2YYZA 3S1MH 2Q2IA 2I5HA 4R4TA 2QEXA 1TWAH 5LMUQ 2CFMA 5FJ8G 4DV6Q 5M3FH 4A75A 4DR7L 4X62L 4YY3Q 1VQKA 2OQKA 2LXJA 5GROA 5IP7H 4JI8Q 3B6YA 2D0OA 5C44G 2R7ZG 4FDBA 4GNXC 2IX1A 2ALYB 1HNWQ 1HJPA 1XNQL 3ULLA 1N32Q 4DV3Q 4JI0L 4QQBX 2CWAA 3GTKH 3STBC 3L0OA 2ID0A 3FKIH 2VZAA 3A0JA 2D62A 1VQGA 1ASYA 5IYCH 3L7ZC 4QIWE 2ZTEA 4RG1A 5H1SE 1HR0L 4BXXH 3RN5A 1YNXA 4JG2A 2ES2A 2JEBI 1E3PA 4KHPL 1JJCB 1VQ4A 4X65Q 2HQLA 2N8NA 2PQAB 2NVTH 3S24A 1C9OA 3K7UC 4PZ6A 3HKSA 1NJIC 3I4NH 4LFBQ 3E9IA 4O0AA 5HY6A 4DV0Q 4WJ3M 3CC4A 1D7QA 5GQOA 2NVQH 4P73A 3CP0A 3S14H 4IOAA 1VQCA 3F2DA 2R7DA 2BH2A 2ZM6Q 5JJIA 4UPAA 3DLLA 3AQQA 2N78A 5IT9c 3UDXA 3LGJA 1PH1A 2YV5A 3FKIG 3M4QA 3PUWA 4JI3L 4B3ML 1VQ6A 1N8RC 4YCVA 1HH2P 3HFZB 5DLQE 4JI1L 4LUZA 4GKJQ 2UXBL 1LM0A 4R4OA 1J6QA 4NXNL 3GTMH 3BJUA 1VQ7A 3J81i 1YI2A 4B3RL 3CPWA 4IFDG 3D0FA 2IY5B 4BBRH 3U4ZA 5IP9H 4Y7NH 3NEMA 4YCUA 2UUBQ 4JI4L 1EFWA 2RHSB 1FGUA 1N34Q 4A3MH 4KI0A 2UUAQ 4NXMQ 1UEBA 3GTJH 4A3BH 4B3TL 1N9WA 1J5EL 4BA2I 2EXDA 3PO3G 4UY8C 4XIGS 4OO1G 2KHIA 3TQYA 2UU9L 3AEVA 5HGQA 4DV5Q 1YITA 1S40A 1W3SA 3J80c 2VQFQ 4DK6C 4HJ7A 1M90C 3I4MG 5JEAJ 2AMCB 3F2CA 2IT1A 5GAGC 4DV2Q 1IXRA 4A3JG 2ZJRA 4X66L 4GNXA 3CCEA 1LTLA 2IX0A 5E7NA 4LFCQ 2E2HH 1YIJA 1B70B 1XNRL 2F4VQ 1IYJB 1V1QA 5M3MG 4OWWB 4DR6Q 3RLFA 2R92G 3K0XA 2WAQG 3W1GA 4GS3A 4A3MG 4DV7L 4LF9L 3HOUG 4C3HH 4BBSH 1JJ2A 4A3BG 3BZKA 4GN5A 4A3IG 1WCMG 3H0GG 1G51A 4AYBG 1FJGL 4A3CH 3KDFB 4KLKA 1YHBA 1MKHA 5IWAQ 4GKKQ 1PYSB 2MO1A 4HJAA 1XPOA 2K5NA 1Y1WG 4DV4Q 5C4XG 3I2ZA 2JA8H 4DR5Q 2CQOA 1TWGH 4JBWA 4GN4B 3PIOA 1QZGA 1HNXQ 2RHQB 1BKBA 4LNQA 4UP7A 1PFSA 2K14A 1KL9A 1Q86C 2VW9A 2GVBA 4UP8A 2K52A 4JBKA 2QGQA
chains in the Genus database with same CATH superfamily
1X56A 1R9TB 5CV5A 4N9PA 3TRZA 2B2YC 2E2DC 2JN4A 3KYHC 2A68D 4LF7Q 4JI5Q 2K4KA 4N8X1 3HKZG 4KY6A 5EPLA 4HJ9A 4IPCA 1L0XB 2F0IA 2RDGA 2JE6I 1SR3A 2WKDA 1JWUD 2O4XA 5C44H 1Q46A 5EBCA 5FO9B 4K8IA 1BXTA 4HIKA 4AQYQ 3IRBA 4G7ZC 4OX9L 4WJ4A 3DEOA 1D5ZC 2F0HA 3FP9A 4YHHL 3TN2A 1X6OA 3T1YL 3T16A 1PV4A 4LF6L 2AKWB 4BY7B 2R7FA 3HOXG 5EQ0A 2UXCL 2B29A 4A76A 4R8IA 3U9SA 4UAIA 2MQHA 1YHAA 2QDBA 3K59A 3CCJA 2QA4A 1A3VA 4HJ5A 4C1NK 3CU7A 5TSSA 1YNNC 3G4SA 4EVOA 1KDBA 1II3A 2KOLA 2OCEA 2E5LL 4LWCA 1JORA 4HIDA 3EIVA 1CA6A 2NN6G 2OT2A 3VR6A 1K8GA 2NZHA 1JR0D 1NNXA 2A73B 2K03A 1VQ5A 2V1CC 2B2TC 2F0GA 3T1HL 4TKOB 1IBLL 5EJWA 2KECA 1Z47A 3S17H 4IPHA 1C7YA 1QB5D 3MFGA 1C0AA 3A7LA 4H02A 5CV8A 2JJQA 2BE5D 1EUJA 3MFYA 1AE2A 4JI1Q 1YHQA 3C1FA 4NXNQ 1LTID 1JQYD 3OTOL 1VQLA 1SNDA 5FLXc 5FLMG 1G2TA 1F9SA 3R2TA 1F2YA 1ENAA 1B1ZA 4LF5L 1RDPD 3MXNB 4XQNA 4DV1L 3W5OA 4C3IG 2VQEL 1I3QH 1RD9D 3H94A 5IGBA 2LSSA 3GV6A 1QZHA 5C4XH 2UXDQ 1E1OA 1EEID 2M2LA 3K6OA 3RNUA 4KKTA 5M5YH 2FHTA 5I9PA 3UDFA 2R93G 1FR3A 1BBXC 1EY5A 3S2HH 3K57A 4RGMA 1EQRA 2IL8A 3SGIA 3J81j 1GUWA 1ENFA 3HOYH 4RCNA 5KYIA 5IGCA 2VL6A 3NTKA 4KHVA 4AIMA 1XMQL 3GTLH 1TWFH 1I4QA 2N55A 1QUQB 3NBIA 3S1RH 1TIID 5C4JH 5A35A 1UE7A 3KFUA 1STBA 1BOSA 4DGZA 3NSWA 1EU4A 2MPMA 4POFA 3IAYA 1Q81C 1X3GA 4I65A 1ZXTA 2IHFA 1S5DD 5I2YA 3GQBA 2VUMH 3KJPA 4P71A 2JA5G 4NDXA 3KJOA 1GHJA 2R7ZB 4YIJA 1IBML 5AJ3Q 1O78A 2F0TA 2B39A 1TS2A 3QG1A 4DR2Q 1A6XA 4ZCKA 5T1IA 2NB0A 1YNJD 2H5XA 3E0JA 2ICIA 2IJ0A 3HZXA 1QOHA 1SSOA 3FDTA 5JPNC 3Q6SA 2CQAA 4A3EG 1VQ9A 2HCCA 1XYIA 1STYA 1VCIA 1VQAA 2CCZA 2JA7H 3NK9A 1HZCA 4DAYB 2GVAA 1L0WA 1FYCA 2LXKA 3CC2A 3HOWG 3SK6A 2C35B 1W2BA 3I4OA 3GTKB 4FVMA 1X3FA 1CFMA 2OWOA 2RCNA 1RJTA 1L2FA 2KQ3A 2SEBD 1WTRA 5CR3A 4IURA 2NVTB 3DM1A 1D1IA 2F3VA 3EROA 4PG3A 4ABNA 2KCCA 3PO2G 1V1PB 2KUMA 4BY1G 3J81c 2B2WC 3KK7A 4PZ8A 4BY7H 5LMUL 3GDEA 3PIPA 3KF8B 4JI8L 3GP7A 2AQ2B 3CCQA 2NYZD 4ZUJA 4A3JB 5A2QE 1N32L 4RHSA 1GD7A 2B8GA 4A93G 4IUUA 5ELEA 1Y1VG 2F1MA 2Z4IA 5G3LF 4LFAQ 2N49A 5KEEA 5M3FG 4X65L 1L1OC 3TBIB 3CCMA 3V2TA 1SLJA 2VB2X 2Q2UA 2ZTDA 1LUZA 4GLAC 4IN3A 1SNMA 4U673 1SYBA 2Q8RE 2FMMA 1CKNB 1SDFA 4BXXG 2VY3A 4LUVA 4JI6Q 5GAHC 4CKBA 1KC8C 3I4NG 2M9VA 3Q8DA 5EAYA 1I4GA 4PMBA 3UE1A 1F2ZA 1SNQA 4HN7A 4E6IA 1PRTB 1S5ED 2UUBL 1N34L 2JA8B 1I94Q 4FXGC 2NZOA 2Z0SA 1I4RA 2XRSD 4V0BA 3S1QH 1TKWB 1TQOA 1A8VA 2YTVA 1A0IA 1ML0D 1HZBA 4RCOA 1I50B 4DPGA 4BBRG 1WTVA 2JXMB 1TWCB 3S1NB 3NBHB 2JQOA 3VR5A 3JAML 2EYHA 3S16H 5IWAL 4ZRZA 1QWYA 4JI7Q 1UAPA 4DUYQ 1CTMA 1B3QA 4O2DA 4PZ7A 3RLNA 1HNXL 3OW2A 4K6DA 2HT1A 3AMUA 4ZKBB 1E2WA 1QCBD 4RGTA 4FYDA 3IL8A 5JJZA 1JWMD 2L1BA 2A19A 1IW7C 5IYBH 3K5NA 2I0QA 4LF7L 4JI5L 3M4YA 4GLXA 3H09A 1EY9A 2Z9HA 1AN8A 3AFQA 1JB7A 4DFAA 1HA6A 1OXSC 3U58A 1CHQD 3IKJA 1KRTA 3D6CA 4A3KB 3VDYA 4P74A 3HKZE 1EY6A 2F0KA 1A3TA 2MUYA 3NTIA 4AQYL 3CXCA 1SE2A 1EZ6A 2OQ0A 3KF6A 1T9HA 1Q12A 2KEEA 4H13C 2I5HA 1VQKA 3BYYB 2D0OA 5C44G 2ALYB 2X6GA 1T5EA 1O7YA 1UEAB 1WTXA 1SMYC 4QQBX 3GTKH 3STBC 3L0OA 1ICWA 2EYLA 2VZAA 3A0JA 1ASYA 3L7ZC 4RG1A 4N9TA 1XWEA 4CKCA 3R3OA 4J6HA 1GUOA 2WAQB 4C3JB 2NVTH 3S24A 1C9OA 3HKSA 4LFBQ 3E9IA 3H0GB 4M8AA 4O42A 1D7QA 5GQOA 2EJFC 2NBFA 4IOAA 2R61A 4EQPA 4J1MA 2SNMA 3Q22A 3BDLA 5JJIA 1HFNA 3AQQA 5IT9c 3FKIG 5M5XB 1ET6A 4HSVA 1CM9A 4JI1L 4LUZA 1K83B 4NXNL 3GTMH 4FXKC 2K1BA 1VQ7A 3U4ZA 1BUVT 2RHSB 4NXMQ 5K36H 1RF2D 2E76C 2K5QA 5IGEA 1N9WA 4BA2I 2O5JC 2XIWA 2R3ZA 4IUPA 3AEVA 3D3RA 2NWGA 2EYJA 2VQFQ 3RMHA 2PZWA 2K28A 2Q8TA 2F0JA 2RBMA 4GNXA 4DAVA 2IX0A 4A3DB 4K5WA 3E5SA 1WTHA 2F4VQ 3RUZA 1IYJB 4DR6Q 4RGNA 4PV1C 4A3MG 1HQRD 4C3HH 1JICA 1M8AA 4RGOS 2OXPA 4EQNA 3RD4A 4AYBG 4A3CH 1D2BA 3T13A 4LAAA 1XPOA 4HJAA 5D3DA 5C4XG 1B2TA 4DV4Q 2JA8H 3NHHA 2DNCA 1PYWD 2CQOA 3NE5B 4JBWA 5IGGA 1QZGA 3PIOA 3PMFA 1MGSA 4LNQA 2F0PA 1NCVA 4UP7A 4ZAIA 1VF5C 1KNEA 3WOEA 4OEMB 4XDXA 3P7JA 5LL6S 3PIP3 2Z1CA 2F0EA 5FOBB 3MXGA 1ASZA 1VQNA 3HOYG 1I50H 3NENA 3BDCA 3PUVA 4PMWA 1CKMA 1PFBA 3S1NH 4X3SA 4X3KA 4ID6A 3OOCA 1LTAD 4ODGA 2ZJQA 1K8AC 5AJ3L 3CMAA 1QE6A 4FNFA 3JAMi 4DR2L 3SK8A 2WINB 1RCVD 1G291 1NMFA 1I6HB 2UUCQ 2A5HA 1LT6D 1Q7YC 2EZVA 1PFMA 1PDQA 1MSHA 4PQXA 2VUMG 1JT8A 4ZUIA 4DKAC 1RODA 4MTKA 5DNFA 3WWVA 4DNIA 2L11A 1IZ6A 1FD7D 2KCNA 2Z6KC 1X55A 1V1OA 3E3XA 4XQQA 1E0BA 2K50A 2PQEA 4GZYC 2L0CA 1Y8OB 1Q1EA 1ILPA 2PQAA 1B7YB 1F77A 2NUCA 4JI0Q 1HRJA 3CCUA 3NQTA 1STEA 3SHLA 1FNUA 3MEFA 4A3KH 1EY8A 3I3CA 3M3YB 2BA1A 4HR7B 5CGKA 1ET9A 1Q1BA 1V9PA 2H1EA 5DAUA 1W6KA 3QO2A 3DWQA 5JVG3 2BOSA 1UUPA 1YVCA 4EX5A 2PW7A 4DK0A 1XTDA 2ZJPA 1QILA 1WYDA 4WORA 1H95A 4LFAL 2XRQD 2MFIA 3VA5A 2J4XA 2IWHA 1S5BD 4RHRA 2BDOA 1KDCA 2OTLA 1DM0B 4C3JH 3FRPB 4KD3A 1PA6A 4A3IH 2EDGA 2UU9Q 3E6ZX 4C2MH 3H0GH 1O7ZA 1HCZA 1EIFA 2F0LA 5JJKA 2DY7A 5BN4A 3EJIA 4G7OC 1CZGA 3PV0A 2VB3X 2PYKA 3KDFA 5D14A 3I56A 3P20A 1ICFB 2BH8A 1XPRA 4JI6L 3U50C 1K83H 4HCEA 4OONA 4LF9Q 1E7ZA 4B9WA 4HIMA 4FP5D 2K5VA 1KRSA 4G7HC 3HOVH 2EJMA 2V4DA 1K73C 1I94L 1KHIA 4TRDA 1KLGD 2RKSA 2PMZE 2G9HD 3TMEA 5EPKA 4BS9A 1UE6A 1UNSA 4L63B 4JK1C 1GOZA 1K0RA 1OXTA 1PH6A 3HOZB 1SYFA 3SR1A 1VQOA 2NVXB 1TXYA 3FEWX 3KOJA 1VDZA 2XNAC 4G57A 3Q0AA 5COYA 4JOIA 4A3LH 3GTGB 4JI7L 4DUYL 1DD2A 1MD2D 2K5HA 3PUYA 5BN3A 1HR0W 3G6JB 3I91A 3G6EA 5IOCA 3CHBD 4J15A 4APVA 3KLWA 2Q8IB 3O13A 2A6HD 4KJNA 4IPDA 1PH8A 2Q2TA 2CW0C 1V8QA 2AWOA 4JYAQ 4GN3B 3MEHA 1Q82C 3TZDA 3I8ZA 4HAEA 2LMCB 2ZTCA 4K0KQ 1JOOA 3CCVA 2F0UA 5IE8A 4X3TA 1HUMA 1PYBA 1KXLA 1LT3D 1I6HH 1U4PA 1KAWA 5IYBG 1DOMA 4B3SQ 4HTHA 3UDIA 2L15A 2ENBA 1TVXA 1AZQA 4GOPA 1EZ8A 2L4NA 2PO4A 4EQ5A 1XXGA 1K8MA 4K2KA 1LO5D 3R93A 2C5CA 3KF6B 2OF1A 2TMPA 4QUFA 5I9OA 3VR4A 5F2DA 1TY2A 2DN8A 4MN3A 1QVFA 3K7AB 1GUSA 2X6LA 1TS4A 1A63A 2NZ1D 3E0EA 5JVH3 3M3YH 1QNUA 5BN5A 2SOBA 1N33Q 4LFBL 4XT3B 2WB1B 1Y69U 2EQSA 3EFXD 1H9MA 4TQUS 4LF8Q 3WDNA 1CT1D 3G48A 2EYPA 3HEJA 1XJVA 1PH4A 1SNCA 1FL0A 4DR4Q 2LFNA 2B8FA 1SXTA 5CBAE 3AU7A 4LK1C 5CV7A 2NVYH 3U9OA 1NE3A 3M7NA 4NXML 2F0NA 2X69A 4IFDJ 2PNRC 3F1ZA 2Y0SE 5IYDH 1E2VA 3A8JE 1FNVA 2BDNA 3SEBA 4EGVA 2VQFL 1Z9FA 3L9AX 3OMGA 2Z4HA 2K75A 3JAMc 2JA6B 3M4PA 3NPPA 1YJWA 4KKSA 1GKHA 4ZLTF 3MHBA 2HHHQ 3D31A 2IHEA 3HOXB 4B9XA 2IPKD 1LTRD 2F4VL 4DUZQ 4DR6L 5K36G 1PTOD 2CKZB 3CW2C 4JBMA 2LY7A 3WOFA 4KHZA 4HJ8A 4GNXB 3GO5A 3A74A 3PUZA 1DONA 5BR8Q 4DV4L 4A3GG 1BQQT 4NPSA 4AYBE 3LNNA 1ESRA 1ESFA 1Q8KA 3D8GA 2WKCA 4C3HG 1SNPA 3N52A 5C6AA 4LMQD 4A3FH 2ASBA 4A3CG 1LTBD 1R9TH 4P75A 4MHEA 1PRTC 5C5MA 3HOZH 2JA8G 2B2VC 3H15A 2NVXH 3BZCA 1STNA 4HIOA 2D9UA 2Q2HA 1G2SA 3R8BA 4FF2A 1Q3LA 2FINB 2E2IB 2UUCL 3CCRA 3DEPA 5C3WA 4KY5A 5EKKA 1VQJA 2RSOA 3AB9A 5FO8B 4KY7A 1BCPD 2WV6D 2YYZA 5KGUA 4A75A 2HQEA 3GTPB 5IGFA 1DXMA 4YY3Q 4KD4A 5GROA 3PO3B 4HMIA 1ILQA 3OPOA 1HNWQ 1AW7A 3NUCA 4JI0L 2F0FA 4ME5A 2ID0A 2D62A 1VQGA 2R93B 5IYCH 1JWSD 4QIWE 1U4RA 5CORA 3TP5A 1YNXA 4IQZA 4JG2A 1CK1A 1H9RA 4CDEC 3HOUB 1VQ4A 2HQLA 2N8NA 2PQAB 1AP0A 1WCMB 4PZ6A 1NJIC 4DV0Q 3M4OB 4H7BA 5EGTA 3CP0A 4IUQA 5C5LA 3J80E 1Y1WB 3F2DA 1I4PA 2R7DA 2ZM6Q 1LTGD 1TWHB 2EYMA 2N78A 3UDXA 2YV5A 1BNZA 1IW7D 1HH2P 3SXHA 1J6QA 2IY5B 1HHVA 4P2CB 4KN7C 2JA5B 3H91A 1FGUA 3SK4A 5A2QL 1HXYD 2MGSA 1SAPA 4XIGS 2KHIA 2UU9L 5HGQA 1PZJD 4DV5Q 1S40A 1ENCA 2WIIB 3BG3A 1F2MA 1M90C 5JEAJ 2AMCB 1SFOB 2G9DA 3ERQA 4A3EB 3PQIA 3MZ5A 5E7NA 1U9RA 3I72A 1HPCA 3RLFA 3J80L 2WAQG 4C3JG 4GS3A 4LF9L 3HOWB 1IYUA 4A3BG 5KIXA 4A3IG 2A69C 3H0GG 1G51A 1DZ1A 3KDFB 4GKKQ 1MKHA 1U4LA 1Y8PB 5DM73 3I2ZA 1C4QA 3BS1A 4DU9A 1FNWA 3QR8A 4GN4B 2GA4B 2TSSA 4UP8A 1J9OA 2NTTA 5EBDA 2JA6H 4BBSG 4BY1B 3HOVG 2XWJB 2CVRA 4NKLA 1IBKQ 2B2UA 3T56B 4CGYB 1SJHD 1GHKA 5FJ8H 4G4KA 2A74C 2I46A 1CQFA 1PTOB 2R7ZH 2NTSA 3NTHA 2GN5A 1LT4D 3QIAA 1Y1VB 4JCVE 3X3MA 3F2BA 4L5SA 3BVMA 4AH6A 1HA5A 3HP3A 5IGDA 2MNAA 1HZAA 5M3FB 2OEOA 1KD1C 5ELBA 2CWPA 1IL8A 3DM3A 3VYSA 4X62Q 3T53B 4JYAL 3FPPA 1XNQQ 3A5UA 4QGUA 1HTLD 3BDOA 3ULJA 4QCLA 2KCTA 1A2TA 2KEDA 2QCPX 4K2LA 1WI5A 4ZK9B 4K0KL 2AWNA 3RZOB 2F0MA 1BBUA 1CSPA 1OTCA 1HR0Q 2FXQA 1WOCA 1PH7A 3I4NB 5LHY1 4FF3A 4KHPQ 5CV6A 2E2IH 1EQQA 3PCOB 2YTYA 5FKAC 2R6GA 2YTXA 4B3SL 4IFDI 4IFDH 1JE4A 2PNHA 1MJCA 2RF4A 2I5LX 1VQPA 5C0XJ 1MI2A 2B2YA 4WJWA 4POGA 1BCPB 3GTPH 4IUNA 5KNCA 4CBVA 3PO3H 3CAMA 4OO1I 4OO1H 1PLFA 1S3OA 3J7YW 4XQJA 3QOJA 3ZJYC 4Y7NB 2DGYA 3PSIA 2B63B 4GOPB 4A3JH 5I4DA 4QY7A 3GTJB 1Z7TA 2KCMA 3SE0A 1L0YB 1EWIA 4JI4Q 3CCSA 4DXFA 4B3TQ 5C4ZA 3HOUH 4FO2A 1Z6HA 1N33L 1PZKD 1WCMH 1D6EC 3BZDB 3KLSA 1SYGA 3ERSX 4LF8L 2KVMA 5JOBA 1GUNA 2PCFB 4HEDA 1Y1WH 1BO0A 4R8NA 5ISRA 1TWHH 4QMGA 1NY4A 4DR4L 1VMPA 3J7AF 1EFID 4HMJA 4DV7Q 1EQVA 1KAAA 4HSPA 3TSSA 1YEZA 1FJGQ 1CKOA 1EIYB 2JA5H 5JJLA 1PHJA 5G3LD 2B2TA 3VR2A 4DA2A 1B53A 4HCSA 1DYQA 2EE1A 1H9KA 4Y52H 1DGSA 4OWXB 2XGTA 3VYUA 5KRUA 1SFOH 2HHHL 3ER0A 5EPJA 5CBEE 1WVLA 4YWMA 1S5FD 1VQFA 1LTSD 4ZQ3A 4C1NI 5C3EB 3K5OA 5J22A 3P75A 4DUZL 4PMCA 2C9OA 3NQIA 4O1NA 1IL2A 2OTJA 3J80i 1TWCH 1AZPA 1EWHA 4K5XA 3HOWH 2B3GA 3ULPA 5IYDG 2JA9A 3MTSA 1ZKOA 5I2XA 5BR8L 2YU9B 1XMOQ 1PZID 1K28A 3K81C 2EYOA 3K80C 2LKVA 4QUCA 1OXXK 3OW7A 5CMDA 3PF4A 3KLRA 1SROA 3S1MB 3BVGA 3H3VH 1ZYRD 1IYVA 2QILA 2LS01 1AH9A 1TWAB 2E8GA 1O7IA 4UDUC 1YJNA 2M00A 2EY2A 1PRTF 5DM63 2DUDA 1MJEA 2I07B 3NP8A 3BVZA 4NW2A 3FKIB 2BA0A 4R1JA 2E75C 3UDGA 1YJ9A 2P5ZX 2JA7G 3R2IA 1B8AA 2K32A 4A3FG 3K8AA 4JVZA 2Y0SB 3C2PA 1SJED 2NVQB 3S14B 4ALPA 1EEFD 2VXWA 3HOZG 5LL6X 3CPFA 5NUCA 3QJYA 5IT9E 5JEAH 4YY3L 1PH9A 3HG9A 4QJFA 5ELDA 2HDLA 3F8TA 1DOKA 1JMCA 2K01A 1GM5A 1JJGA 2EY1A 1HNWL 5CYUA 2F52A 3PUXA 5KNBA 4MNOA 1E24A 1STHA 4R4IA 4LF4Q 4RWSC 3RZOH 3OIQA 4XYOA 1WJJA 4CDDC 3C1EA 4LJZC 3KBGA 1K0SA 4IO9A 1CKNA 2EIFA 4A3MB 2DNEA 1E2ZA 4JV5Q 4BY7G 3D4DA 4AYBB 3M85A 1I3QB 4DV0L 4MZ9A 3EVQA 3K5LA 1GVPA 3A55A 1IHZA 1NR4A 4OXPA 1EU3A 1GUTA 1EIGA 1PH5A 2ZM6L 4NMZA 4R4CA 5IYCG 1CI3M 4OELB 1Y14B 3PGZA 1QJOA 1JCKB 4R4QA 5CV9A 3LX0A 2L9HA 5M5XH 1CQVA 1RTOA 2D0PA 3D4WA 1MHWC 1WFQA 1WD1A 2B63H 1P8LA 2XTIA 1VF7A 1KNAA 1YNND 1D8LA 2F0SA 2HCIA 1I4HA 3ICEA 5LMNQ 4QL5A 2DJFC 4CJ0B 3TS2A 1PFNA 2KENA 1LABA 2ATWA 3RN2A 2B2WA 2MP1A 4DV5L 1A3UA 1EY7A 4JPBW 1SNOA 1ZEQX 3OYYA 4X64Q 4DR1Q 2AHOB 2VUMB 1N36Q 3HS0C 5CC4A 1HNZQ 4KMUC 3W1BA 3H6MA 4A3DH 4LW1A 3M7GA 2E2JB 4KV6A 3URYA 3IFTA 3V05A 1TR5A 2FMCA 3ZYYX 3TREA 3I55A 2WB1G 4GKKL 4V190 1L1OA 1E1TA 2WAQE 1SN8A 1KTKA 4OIKA 1B9MA 3SDZA 3RZDB 1OXUA 3A54A 1S4ZA 1G91A 1TS5A 1JB3A 1O80A 4N8FA 2QEJC 1KQSA 5C0XI 4L6TB 5C0XH 2RA4A 1X54A 4JI2Q 1AFPA 4DR3Q 1G6PA 4YWLA 3TS0A 1MSGA 2N3SA 5CV4A 2A6EC 4TVAB 4MTNA 1IBKL 2F0VA 2F0DA 2QF7A 3M9BA 2QDLA 5C3EH 3CD6A 2G5DA 2IX3A 1EYCA 3MXUA 2PZTA 2K6AA 3J7A5 3MVVA 1YZ6A 2DJGC 3A5ZB 2JA6G 2YU9H 3GTQB 1LV9A 1W6JA 3BU2A 1LYLA 3T51B 2EXZA 1PMRA 1MIUA 3MA2B 3K5MA 1AEXA 3S1MH 2Q2IA 2QEXA 4DV6Q 1TWAH 3F2UA 2CFMA 5FJ8G 4X62L 4PNYA 5IP7H 2LXJA 3W3AA 3B6YA 2R7ZG 4FDBA 4GNXC 2IX1A 3MC0B 1HJPA 1XNQL 3I4MB 4DV3Q 3MXPA 3TP7A 2J0TD 3GTOB 1MBYA 3FKIH 2F03A 1BR9A 4DN4M 5H1SE 2ZTEA 1HR0L 4BWGB 5M3MB 4CHTB 2R92B 3VYTA 2JEBI 1E3PA 4KHPL 1JJCB 4K5VA 1G8ZD 3SVMA 3K7UC 2RDFA 3T4AC 3PIO3 2NVQH 3S14H 3OWEB 1VQCA 4DNTB 3TZUA 1EYDA 1T5XD 2XN9C 2PPBC 2AQ1B 3LGJA 2A68C 4B3ML 1RTNA 2F0QA 1N8RC 2O2LD 3HFZB 3I4LA 5DLQE 3HRZC 4GKJQ 1LM0A 1PRTD 4ULLA 3S9WA 3BJUA 3D6WA 4CJ1B 1YI2A 5IIFA 4H44C 4IFDG 3D0FA 1A15A 5IP9H 1NAPA 4XYQA 4YCUA 3HKZB 1GUGA 1EFWA 4JI4L 3C46A 4A3MH 2UUAQ 3DWPA 1UEBA 4B3TL 3S1QB 2EXDA 1NSNS 3PO3G 4OGQC 4OO1G 1HTPA 2A6HC 1YITA 1W3SA 3J80c 4DK6C 4CDCC 4HJ7A 2IT1A 4DV2Q 1IXRA 4A3JG 4F87A 2ZJRA 2JSOA 4LFCQ 2FJ2A 1V1QA 5J39A 2F0WA 3S16B 3W1GA 3HOUG 4DV7L 3BZKA 4GN5A 4RKBA 1WCMG 4WRDA 1FJGL 2SDFA 4K8JA 1PYSB 2K33A 2K5NA 1Y1WG 1B9NA 4DR5Q 2EY6A 3A56A 1WTPA 2HDMA 2QKIC 2RQXA 3NXWA 4FXDA 2RHQB 1BKBA 4DK1A 2K14A 1KL9A 2RDHA 2VW9A 4JBKA 4P73A 4YWKA 2AUKA 1JOQA 2BE5C 3SK5A 3CMEA 2J7ZA 1S5CD 2HD3A 4EQOA 1EY4A 2EOTA 2KA7A 2E2JH 3CCLA 3CRKC 2CH4W 2JYOA 1KABA 2K7VA 1UE5A 3J7AV 1XMOL 1TS3A 1EY0A 3QWNA 3GTGH 3TEHB 1J8IA 3FMCA 3RZDH 3VA7A 1H9SA 2F3IA 4OHJA 4DR7Q 2HIXA 4X6AH 2D2CC 1TT2A 4C3IB 1AE3A 2RCFA 3OSOA 1LACA 5ELOA 3KBXA 1K3BC 4RA8A 5FLXE 1NMGA 3H3VC 2A69D 2F3WA 1CHPD 1KDAA 2WFWA 5M5WB 1YBYA 4BA1I 4C56C 3NWTA 1VQBA 1VQDA 3CC7A 4DK3C 3OMCA 4I7AA 3GTQH 1A62A 1A2UA 1STAA 4I7ZC 5LMNW 2XWBB 2D5DA 1M1KC 5E3FA 4XTCS 3G71A 1U5KA 1EOVA 2RVLA 4OIJA 1XPUA 3JC66 1PH2A 4M1UB 3GTMB 4JI3Q 2ZXOA 1PTOC 3I90A 4B08A 2UXBQ 2K05A 3W2DA 3U4VA 1JE5A 2CH4A 4A3KG 3I4MH 4LF4L 1Q8IA 5C3XA 4B3RQ 1VQIA 2PZUA 3GTOH 3QB3A 3S15B 4X3UA 1BDOA 3NELA 3K7AH 1YNJC 3OHXC 1DOLA 5ELCA 2AUJD 5M3MH 1WTOA 2EPBA 4JOIC 5JEAG 2R92H 4JV5L 3S2DB 1XX8A 1J5EQ 3A8IE 2KBNA 5FLXL 5E1FA 4A3GB 1NUCA 3JAME 2Z6KA 2WP8J 1B3AA 3ND8A 1KIXA 1CZWA 1CUKA 1X3PA 5AFWA 4X66Q 3L2PA 5I6YA 1SYDA 4IZ8A 4QF4A 2MO0A 1QG7A 1FGBD 4C3HB 1F9QA 1XNRQ 4KJOA 4ME3A 3ITPA 1SMYD 3BYTB 5ELFA 3STBD 3I7FA 1EYAA 4IOCA 1SYCA 5LMNL 1PXUA 5JAVA 1D5XC 1RKNA 4DAMA 1BCPC 1K3RA 1EWCA 2JP1A 1RHPA 4Q5VA 1QVCA 4X64L 4DR1L 2K04A 2B63G 4GOPC 3FPUB 3EA6A 3RR5A 1N36L 1HNZL 3PF5A 3PO2B 1SBBB 2XVSA 5J1ZA 1SEBD 5JPMC 3TP8A 3AYHB 2FFKB 3HOXH 2KHSA 1BVSA 1CA5A 1I4XA 5FK9C 1Q90A 1WTQA 2AQ3B 4RMFA 1GJXA 1F9PA 2E74C 2ZT9C 5IODA 1RIPA 1E22A 4A93B 1RL2A 3CQZB 4RH6A 4WFN3 4OX9Q 2WB1E 1VS0A 4YHHQ 3T1YQ 3KLSX 1HZ9A 4LF6Q 1VQMA 1XTCD 2NN6I 2NN6H 3UI2A 3J81E 4UP9A 4A3DG 2UXCQ 2A1AA 4JI2L 1L1OB 4DR3L 5ELNA 4K6LA 3KUPA 1IKMA 3GD7A 5KYLA 1X9NA 1VQHA 4JW0A 5J3BA 4A3LG 4GLVB 1GO3E 3CF5A 1K9MC 5GAEC 5D3IB 1C8CA 1DCZA 3LWEA 2E5LQ 4A4IA 1SRUA 5T1GA 5K5PA 2L55A 1S72A 5C0XG 1EYGA 1HQMC 3ONAB 1I5FA 4LUOA 3N6RA 3T1HQ 5FLMH 5C3EG 2PMZB 1IBLQ 4L5TA 2VNUD 4IUVA 4DV6L 4JBJA 3E9HA 4CKEA 4RAUC 4C3IH 4B3MQ 1QNKA 2EVBA 4DXGA 4DV3L 3J81L 3MXNA 1U0LA 3L3OC 3OTOQ 4BBRB 1NR2A 4P72A 2PW5A 4NB3A 1B4OA 1BBWA 3EN2A 3X3NA 3Q23A 2L5TA 4DNRB 2KHJA 1PH3A 4DAPA 2WACA 5M5WH 2R93H 4A3BB 1SYEA 4A3IB 2IW3A 4C2MB 5IP7G 4LF5Q 1VQ8A 4DV1Q 4K14A 1SE3A 3CRLC 3J7ZC 1HUNA 4Z9CB 2VQEQ 4J8QA 3M4OH 2KJXA 4IALA 4U68A 1GXDC 2E2HB 2VS1A 4L5RC 2JEAI 2F0OA 4IUTA 3OIPA 4GKJL 1M4VA 1SMXA 1QUQA 4R9WA 4IJLA 4YCWA 4BBSB 1I6VC 1UE1A 2XSCA 5KNDA 1VQEA 4CJ2C 3HOVB 5M9OA 2Y0SG 3OWFA 3I73A 3QOLA 3S15H 1FVIA 1R4QB 1XMQQ 3AFPA 3ND9A 2UUAL 4JC0A 4RKLA 2RSNA 1UWVA 1TWGB 5EKLA 4IPGA 5E4WC 1EOTA 3S2DH 4A3GH 2UXDL 4DV2L 5IY0A 1LTTD 2EY5A 5GADC 5IP9G 3VYRA 4KKUA 1P16A 4LFCL 4A3EH 3DUZA 3FHWA 2PI2E 1STGA 2A8VA 4IJHA 4XT1B 3MAQA 1IBMQ 5C44B 4Q0FA 3FVQA 1H9JA 4DAYA 4ZYSA 4FF1A 1X65A 4FF4A 3G7LA 2HIVA 1R4PB 1SE8A 4DR5L 2JK8A 1JOKA 2EYFA 1WTWA 3A7AB 4F7XA 4ZKCB 2I5MX 4ILWA 5E4XA 1D1KA 2F4IA 2ZXPA 1X3QA 4TSSA 3H3VI 2BCOA 2ZXRA 3HGBA 1NTGA 4L8JA 1NBWA 3C3LA 1TY0A 1OXVA 1V43A 4RFBA 3PO2H 1CSQA 4BY1H 4DF7A 1PVOA 1HFGA 1V1PA 1X3EA 4OWTB 3RLOA 1VMCA 3A8KE 4NP5A 1IKLA 2N88A 3KF8A 1QVGA 1PTOH 3UE0A 1X32A 2PI2A 3EBEA 5D65A 2K5WA 4F8MA 4L5QA 4A93H 5FO7B 1Y1VH 3CQZH 1EIHA 1OO9B 2QW7A 3S17B 1DJRD 1F9RA 4R4TA 5HURA 4DR7L 5LMUQ 5C4HA 5M3FH 2OQKA 4XXEA 1ONLA 4JI8Q 2Z8LA 4KN4C 1BF4A 1LLRD 3Q24A 3ULLA 1N32Q 1H9SB 2CWAA 3V96A 3DHQA 1EL0A 3K0YA 4KTAA 5L37A 3GV3A 4BXXH 4UHVA 3RN5A 2O5IC 1WD0A 2HUGA 2ES2A 2MJ8A 4OL7A 4X65Q 3I4NH 4WJ3M 4O0AA 3NWSA 3P1HA 5HY6A 3CC4A 3D4RA 3CKIB 5C4XB 1G6ZA 3DMUA 2BH2A 1B44D 1PTOF 4UPAA 3DLLA 5M5YB 1K8OA 1PH1A 3M4QA 4JI3L 3PUWA 1VQ6A 4KK7A 2A6ED 4H0LC 4YCVA 2B2VA 2Z6BA 2UXBL 3S2HB 4R4OA 2CW0D 2K5DA 2NVYB 3I70A 2B2UC 3J81i 4B3RL 3CPWA 5I6WA 3HOYB 4BBRH 4Y7NH 3NEMA 5IT9L 4QB4A 5EKIA 1Y8NB 3GTLB 2UUBQ 4F88A 1TWFB 1N34Q 4KI0A 3S1RB 2CHBD 3GTJH 4A3BH 5DEHA 5C4JB 1J5EL 1ZYRC 3MWYW 4UY8C 4S3SA 3TQYA 2EJGC 3NBHA 3DXJC 3TP6A 3TDQA 1B50A 1U4MA 3I4MG 3IFDA 3F2CA 5GAGC 2H4OA 3K58A 1D5MC 4X66L 3CCEA 1LTLA 1C48A 2DY8A 2E2HH 1YIJA 1B70B 1XNRL 4MIUA 5M3MG 5HGTA 4OWWB 2R92G 2L12A 3K0XA 3VR3A 4BBSH 1JJ2A 4CDFC 1O7LA 4KLKA 1F2LA 4QIWB 1KLUD 1YHBA 2ICEC 5IWAQ 3LWUA 2MO1A 1BCPF 1LT5D 1TU2B 3EQLC 1TWGH 1HNXQ 2SNSA 1EQTA 3DWAA 2JA7B 1SE4A 1PFSA 1Q86C 1JC7A 4A3FB 2GVBA 2K52A 2QGQA 2MHVA
chains in the Genus database with same CATH topology
1X56A 2JA6H 3TRZA 1ASZA 1VQNA 4BBSG 3CMEA 3HOYG 1I50H 3KYHC 3NENA 3HOVG 3PUVA 4LF7Q 4JI5Q 2K4KA 4PMWA 1IBKQ 1CKMA 3S1NH 3HKZG 4HJ9A 4IPCA 2ZJQA 1K8AC 2JE6I 5FJ8H 5AJ3L 1SR3A 3CMAA 2E2JH 3CCLA 3JAMi 4DR2L 5C44H 2R7ZH 1Q46A 1UE5A 2GN5A 1G291 1NMFA 2UUCQ 4JCVE 1XMOL 4HIKA 3F2BA 4AQYQ 1Q7YC 4L5SA 4AH6A 3GTGH 3IRBA 3TEHB 4OX9L 4WJ4A 2MNAA 3RZDH 1HZAA 3FP9A 4YHHL 2F3IA 1X6OA 3T1YL 1PV4A 1KD1C 4LF6L 2AKWB 2VUMG 1JT8A 2R7FA 4DKAC 2CWPA 3DM3A 3HOXG 2UXCL 3WWVA 4DNIA 4DR7Q 2HIXA 1IZ6A 2Z6KC 4X62Q 1X55A 2B29A 4X6AH 4A76A 2K50A 2MQHA 1YHAA 3CCJA 1AE3A 2QA4A 4HJ5A 4JYAL 1XNQQ 3A5UA 4QGUA 1Q1EA 2PQAA 1B7YB 3ULJA 2KCTA 4JI0Q 5ELOA 4K0KL 1WI5A 2AWNA 3G4SA 3CCUA 2E5LL 1BBUA 2OCEA 1CSPA 1NMGA 4LWCA 1OTCA 1HR0Q 2WFWA 4HIDA 3EIVA 1YBYA 2FXQA 1WOCA 2NN6G 3MEFA 4BA1I 4A3KH 1PH7A 1VQBA 4KHPQ 1VQDA 3CC7A 2E2IH 4DK3C 1EQQA 3PCOB 2BA1A 2YTYA 1K8GA 2NZHA 3GTQH 2R6GA 1VQ5A 2YTXA 4B3SL 4IFDI 2V1CC 1Q1BA 3T1HL 1A62A 1V9PA 1MJCA 2PNHA 1IBLL 2RF4A 2I5LX 5LMNW 1M1KC 1VQPA 5C0XJ 1Z47A 3S17H 4IPHA 4XTCS 3G71A 1C7YA 1U5KA 1C0AA 4H02A 1EOVA 2JJQA 4POGA 1XPUA 3JC66 3GTPH 1EUJA 1PH2A 4JI3Q 1YVCA 3PO3H 3CAMA 4EX5A 4OO1I 1AE2A 2UXBQ 4JI1Q 1YHQA 1S3OA 3U4VA 1JE5A 1XTDA 4A3KG 4NXNQ 3ZJYC 3I4MH 2ZJPA 2DGYA 3PSIA 4LF4L 3OTOL 4GOPB 4A3JH 1VQIA 1WYDA 1VQLA 4B3RQ 5FLXc 3GTOH 5FLMG 4QY7A 1H95A 4LFAL 2KCMA 3NELA 3K7AH 2MFIA 1EWIA 4JI4Q 5M3MH 3CCSA 4JOIC 5JEAG 2R92H 4JV5L 2OTLA 4B3TQ 4C3JH 4LF5L 4YWKA 1J5EQ 3HOUH 3MXNB 1PA6A 4DV1L 4A3IH 1N33L 1WCMH 2KBNA 2UU9Q 4C2MH 3W5OA 3H0GH 2VQEL 1I3QH 1EIFA 3ERSX 5JJKA 4LF8L 2Z6KA 2WP8J 2LSSA 1KIXA 1QZHA 5C4XH 1Y1WH 3PV0A 1CUKA 4X66Q 3L2PA 2UXDQ 3KDFA 1E1OA 3I56A 1TWHH 3RNUA 2MO0A 5M5YH 2BH8A 1XPRA 3UDFA 4JI6L 1XNRQ 2R93G 1NY4A 3U50C 4ME3A 4DR4L 1K83H 3S2HH 4OONA 1EQRA 4LF9Q 4DV7Q 1E7ZA 3SGIA 3J81j 4HIMA 1YEZA 2K5VA 1KRSA 3I7FA 3STBD 1CKOA 1FJGQ 1EIYB 2VL6A 3HOVH 4AIMA 4IOCA 1XMQL 2JA5H 5LMNL 3GTLH 5JJLA 1K73C 1PHJA 1I94L 1TWFH 1KHIA 1QUQB 3S1RH 4DAMA 1K3RA 5C4JH 1UE7A 2PMZE 3KFUA 4Y52H 1DGSA 1QVCA 4X64L 4DR1L 4OWXB 2XGTA 1SFOH 2HHHL 2B63G 4POFA 1UE6A 4GOPC 3RR5A 3ER0A 1Q81C 1N36L 1HNZL 1X3GA 3PF5A 4YWMA 1K0RA 1OXTA 1VQFA 2IHFA 1PH6A 2VUMH 3AYHB 3KJPA 4DUZL 1VQOA 1TXYA 4P71A 3HOXH 2JA5G 1BVSA 3KJOA 3KOJA 1IL2A 2OTJA 3J80i 1TWCH 1IBML 5AJ3Q 3HOWH 2B3GA 3ULPA 4RMFA 5IYDG 2JA9A 4DR2Q 4JOIA 4A3LH 4JI7L 4DUYL 5BR8L 2H5XA 2K5HA 1RIPA 1XMOQ 1E22A 3PUYA 3HOYH 1HR0W 1RL2A 3K81C 3G6EA 3K80C 4A3EG 1VQ9A 4OX9Q 3PF4A 2WB1E 1OXXK 1VCIA 1VQAA 4J15A 4APVA 1SROA 1VS0A 4YHHQ 3T1YQ 3KLWA 1HZ9A 2CCZA 4LF6Q 1VQMA 2JA7H 3H3VH 2NN6I 4A3DG 1AH9A 2UXCQ 4UP9A 2E8GA 1HZCA 1O7IA 4DAYB 2A1AA 2GVAA 4JI2L 1L1OB 4IPDA 4DR3L 1YJNA 5ELNA 1L0WA 1PH8A 2Q2TA 2LXKA 3CC2A 3HOWG 1W2BA 2C35B 3GD7A 2AWOA 3I4OA 1X9NA 1VQHA 2DUDA 1MJEA 4JYAQ 4GN3B 5J3BA 1Q82C 4A3LG 4GLVB 1GO3E 2ZTCA 3CF5A 1X3FA 1K9MC 5GAEC 4K0KQ 2OWOA 2RCNA 2BA0A 3CCVA 4R1JA 3UDGA 1L2FA 5IE8A 4A4IA 2E5LQ 1YJ9A 1SRUA 1PYBA 1S72A 2JA7G 1KXLA 5C0XG 1I6HH 1B8AA 4A3FG 1KAWA 3K8AA 1EYGA 5IYBG 4PG3A 4B3SQ 1I5FA 4LUOA 3T1HQ 3UDIA 5FLMH 3PO2G 4ALPA 5C3EG 2L15A 4BY1G 1IBLQ 4L5TA 3HOZG 3J81c 2VNUD 3CPFA 4PZ8A 4GOPA 4BY7H 4DV6L 5LMUL 3GDEA 4JBJA 4EQ5A 3PIPA 4YY3L 1PH9A 3KF8B 4QJFA 4JI8L 3F8TA 3E9HA 1JMCA 3CCQA 1GM5A 3KF6B 1JJGA 1HNWL 2F52A 3PUXA 4C3IH 4MNOA 4B3MQ 1N32L 1E24A 4DV3L 4R4IA 1U0LA 4LF4Q 1GD7A 1QVFA 4A93G 3OTOQ 3RZOH 4P72A 1Y1VG 4NB3A 1WJJA 1BBWA 3EN2A 4LFAQ 2N49A 2KHJA 4IO9A 1CKNA 2EIFA 1PH3A 1A63A 5M5WH 2R93H 5M3FG 3E0EA 3M3YH 4JV5Q 4X65L 5IP7G 1L1OC 4BY7G 3M85A 4LF5Q 3CCMA 1VQ8A 1N33Q 4DV0L 4DV1Q 4MZ9A 4LFBL 1SLJA 3J7ZC 1GVPA 2VQEQ 2Q2UA 4OXPA 2EQSA 2ZTDA 1LUZA 4TQUS 4GLAC 1PH5A 4LF8Q 3M4OH 2ZM6L 3G48A 4R4CA 5IYCG 1CKNB 1Y14B 1XJVA 2VS1A 1PH4A 3PGZA 4L5RC 2JEAI 4BXXG 2VY3A 4LUVA 4R4QA 4JI6Q 4GKJL 1SMXA 1QUQA 4YCWA 4IJLA 5GAHC 1FL0A 4DR4Q 5M5XH 1UE1A 1VQEA 2D0PA 1KC8C 1WFQA 3I4NG 3Q8DA 5EAYA 1P8LA 2B63H 2XTIA 2Y0SG 3UE1A 2NVYH 1D8LA 1NE3A 3S15H 1FVIA 3ICEA 2UUBL 3M7NA 1XMQQ 5LMNQ 4QL5A 3AFPA 1N34L 2UUAL 4NXML 1I94Q 4JC0A 2NZOA 1UWVA 3TS2A 4IFDJ 4IPGA 2KENA 2Z0SA 3S2DH 2ATWA 3F1ZA 3RN2A 4DV5L 2Y0SE 5IYDH 3S1QH 1A8VA 2YTVA 2VQFL 1A0IA 1Z9FA 3OYYA 4A3GH 2UXDL 4DV2L 1HZBA 2K75A 4X64Q 3M4PA 3JAMc 4DR1Q 5IY0A 1YJWA 2AHOB 2HHHQ 1GKHA 5GADC 3D31A 4BBRG 4DPGA 5IP9G 1N36Q 2IHEA 1P16A 1HNZQ 4LFCL 4A3EH 3W1BA 3FHWA 2PI2E 2F4VL 3NBHB 4DUZQ 4DR6L 5K36G 2JQOA 2A8VA 4A3DH 4LW1A 4IJHA 2CKZB 1IBMQ 3CW2C 4JBMA 4KHZA 4HJ8A 3S16H 4GNXB 3TREA 3I55A 2WB1G 3A74A 3GO5A 3PUZA 5IWAL 4GKKL 4JI7Q 4DUYQ 1L1OA 1E1TA 2WAQE 5BR8Q 1X65A 1SN8A 2HIVA 4DV4L 1SE8A 4A3GG 4DR5L 2JK8A 4O2DA 4PZ7A 3RLNA 1HNXL 3OW2A 2HT1A 1OXUA 4NPSA 4AYBE 2I5MX 1Q8KA 3H3VI 1KQSA 5C0XI 1X54A 4JI2Q 2A19A 4DR3Q 4A3FH 1G6PA 1NTGA 4YWLA 3TS0A 1NBWA 2N3SA 2ASBA 4A3CG 5IYBH 1R9TH 1OXVA 2I0QA 4TVAB 4LF7L 1V43A 4JI5L 4P75A 4MTNA 3PO2H 1CSQA 4GLXA 1IBKL 5C3EH 3M9BA 4BY1H 3HOZH 3AFQA 2JA8G 3H15A 2NVXH 1JB7A 3CD6A 1OXSC 3U58A 3BZCA 1PVOA 1KRTA 4HIOA 1X3EA 3J7A5 4OWTB 2Q2HA 3RLOA 3VDYA 4P74A 3HKZE 1YZ6A 2UUCL 1QVGA 3CCRA 3A5ZB 2JA6G 4AQYL 2YU9H 3UE0A 2PI2A 3EBEA 3CXCA 1VQJA 4L5QA 2OQ0A 3KF6A 4A93H 1T9HA 1Y1VH 3BU2A 3CQZH 1Q12A 1LYLA 1MIUA 2YYZA 3S1MH 2Q2IA 2I5HA 4R4TA 2QEXA 1TWAH 5LMUQ 2CFMA 5FJ8G 4DV6Q 5M3FH 4A75A 4DR7L 4X62L 4YY3Q 1VQKA 2OQKA 2LXJA 5GROA 5IP7H 4JI8Q 3B6YA 2D0OA 5C44G 2R7ZG 4FDBA 4GNXC 2IX1A 2ALYB 1HNWQ 1HJPA 1XNQL 3ULLA 1N32Q 4DV3Q 4JI0L 4QQBX 2CWAA 3GTKH 3STBC 3L0OA 2ID0A 3FKIH 2VZAA 3A0JA 2D62A 1VQGA 1ASYA 5IYCH 3L7ZC 4QIWE 2ZTEA 4RG1A 5H1SE 1HR0L 4BXXH 3RN5A 1YNXA 4JG2A 2ES2A 2JEBI 1E3PA 4KHPL 1JJCB 1VQ4A 4X65Q 2HQLA 2N8NA 2PQAB 2NVTH 3S24A 1C9OA 3K7UC 4PZ6A 3HKSA 1NJIC 3I4NH 4LFBQ 3E9IA 4O0AA 5HY6A 4DV0Q 4WJ3M 3CC4A 1D7QA 5GQOA 2NVQH 4P73A 3CP0A 3S14H 4IOAA 1VQCA 3F2DA 2R7DA 2BH2A 2ZM6Q 5JJIA 4UPAA 3DLLA 3AQQA 2N78A 5IT9c 3UDXA 3LGJA 1PH1A 2YV5A 3FKIG 3M4QA 3PUWA 4JI3L 4B3ML 1VQ6A 1N8RC 4YCVA 1HH2P 3HFZB 5DLQE 4JI1L 4LUZA 4GKJQ 2UXBL 1LM0A 4R4OA 1J6QA 4NXNL 3GTMH 3BJUA 1VQ7A 3J81i 1YI2A 4B3RL 3CPWA 4IFDG 3D0FA 2IY5B 4BBRH 3U4ZA 5IP9H 4Y7NH 3NEMA 4YCUA 2UUBQ 4JI4L 1EFWA 2RHSB 1FGUA 1N34Q 4A3MH 4KI0A 2UUAQ 4NXMQ 1UEBA 3GTJH 4A3BH 4B3TL 1N9WA 1J5EL 4BA2I 2EXDA 3PO3G 4UY8C 4XIGS 4OO1G 2KHIA 3TQYA 2UU9L 3AEVA 5HGQA 4DV5Q 1YITA 1S40A 1W3SA 3J80c 2VQFQ 4DK6C 4HJ7A 1M90C 3I4MG 5JEAJ 2AMCB 3F2CA 2IT1A 5GAGC 4DV2Q 1IXRA 4A3JG 2ZJRA 4X66L 4GNXA 3CCEA 1LTLA 2IX0A 5E7NA 4LFCQ 2E2HH 1YIJA 1B70B 1XNRL 2F4VQ 1IYJB 1V1QA 5M3MG 4OWWB 4DR6Q 3RLFA 2R92G 3K0XA 2WAQG 3W1GA 4GS3A 4A3MG 4DV7L 4LF9L 3HOUG 4C3HH 4BBSH 1JJ2A 4A3BG 3BZKA 4GN5A 4A3IG 1WCMG 3H0GG 1G51A 4AYBG 1FJGL 4A3CH 3KDFB 4KLKA 1YHBA 1MKHA 5IWAQ 4GKKQ 1PYSB 2MO1A 4HJAA 1XPOA 2K5NA 1Y1WG 4DV4Q 5C4XG 3I2ZA 2JA8H 4DR5Q 2CQOA 1TWGH 4JBWA 4GN4B 3PIOA 1QZGA 1HNXQ 2RHQB 1BKBA 4LNQA 4UP7A 1PFSA 2K14A 1KL9A 1Q86C 2VW9A 2GVBA 4UP8A 2K52A 4JBKA 2QGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X56 A;  2JA6 H;  3TRZ A;  1ASZ A;  1VQN A;  4BBS G;  3CME A;  3HOY G;  1I50 H;  3KYH C;  3NEN A;  3HOV G;  3PUV A;  4LF7 Q;  4JI5 Q;  2K4K A;  4PMW A;  1IBK Q;  1CKM A;  3S1N H;  3HKZ G;  4HJ9 A;  4IPC A;  2ZJQ A;  1K8A C;  2JE6 I;  5FJ8 H;  5AJ3 L;  1SR3 A;  3CMA A;  2E2J H;  3CCL A;  3JAM i;  4DR2 L;  5C44 H;  2R7Z H;  1Q46 A;  1UE5 A;  2GN5 A;  1G29 1;  1NMF A;  2UUC Q;  4JCV E;  1XMO L;  4HIK A;  3F2B A;  4AQY Q;  1Q7Y C;  4L5S A;  4AH6 A;  3GTG H;  3IRB A;  3TEH B;  4OX9 L;  4WJ4 A;  2MNA A;  3RZD H;  1HZA A;  3FP9 A;  4YHH L;  2F3I A;  1X6O A;  3T1Y L;  1PV4 A;  1KD1 C;  4LF6 L;  2AKW B;  2VUM G;  1JT8 A;  2R7F A;  4DKA C;  2CWP A;  3DM3 A;  3HOX G;  2UXC L;  3WWV A;  4DNI A;  4DR7 Q;  2HIX A;  1IZ6 A;  2Z6K C;  4X62 Q;  1X55 A;  2B29 A;  4X6A H;  4A76 A;  2K50 A;  2MQH A;  1YHA A;  3CCJ A;  1AE3 A;  2QA4 A;  4HJ5 A;  4JYA L;  1XNQ Q;  3A5U A;  4QGU A;  1Q1E A;  2PQA A;  1B7Y B;  3ULJ A;  2KCT A;  4JI0 Q;  5ELO A;  4K0K L;  1WI5 A;  2AWN A;  3G4S A;  3CCU A;  2E5L L;  1BBU A;  2OCE A;  1CSP A;  1NMG A;  4LWC A;  1OTC A;  1HR0 Q;  2WFW A;  4HID A;  3EIV A;  1YBY A;  2FXQ A;  1WOC A;  2NN6 G;  3MEF A;  4BA1 I;  4A3K H;  1PH7 A;  1VQB A;  4KHP Q;  1VQD A;  3CC7 A;  2E2I H;  4DK3 C;  1EQQ A;  3PCO B;  2BA1 A;  2YTY A;  1K8G A;  2NZH A;  3GTQ H;  2R6G A;  1VQ5 A;  2YTX A;  4B3S L;  4IFD I;  2V1C C;  1Q1B A;  3T1H L;  1A62 A;  1V9P A;  1MJC A;  2PNH A;  1IBL L;  2RF4 A;  2I5L X;  5LMN W;  1M1K C;  1VQP A;  5C0X J;  1Z47 A;  3S17 H;  4IPH A;  4XTC S;  3G71 A;  1C7Y A;  1U5K A;  1C0A A;  4H02 A;  1EOV A;  2JJQ A;  4POG A;  1XPU A;  3JC6 6;  3GTP H;  1EUJ A;  1PH2 A;  4JI3 Q;  1YVC A;  3PO3 H;  3CAM A;  4EX5 A;  4OO1 I;  1AE2 A;  2UXB Q;  4JI1 Q;  1YHQ A;  1S3O A;  3U4V A;  1JE5 A;  1XTD A;  4A3K G;  4NXN Q;  3ZJY C;  3I4M H;  2ZJP A;  2DGY A;  3PSI A;  4LF4 L;  3OTO L;  4GOP B;  4A3J H;  1VQI A;  1WYD A;  1VQL A;  4B3R Q;  5FLX c;  3GTO H;  5FLM G;  4QY7 A;  1H95 A;  4LFA L;  2KCM A;  3NEL A;  3K7A H;  2MFI A;  1EWI A;  4JI4 Q;  5M3M H;  3CCS A;  4JOI C;  5JEA G;  2R92 H;  4JV5 L;  2OTL A;  4B3T Q;  4C3J H;  4LF5 L;  4YWK A;  1J5E Q;  3HOU H;  3MXN B;  1PA6 A;  4DV1 L;  4A3I H;  1N33 L;  1WCM H;  2KBN A;  2UU9 Q;  4C2M H;  3W5O A;  3H0G H;  2VQE L;  1I3Q H;  1EIF A;  3ERS X;  5JJK A;  4LF8 L;  2Z6K A;  2WP8 J;  2LSS A;  1KIX A;  1QZH A;  5C4X H;  1Y1W H;  3PV0 A;  1CUK A;  4X66 Q;  3L2P A;  2UXD Q;  3KDF A;  1E1O A;  3I56 A;  1TWH H;  3RNU A;  2MO0 A;  5M5Y H;  2BH8 A;  1XPR A;  3UDF A;  4JI6 L;  1XNR Q;  2R93 G;  1NY4 A;  3U50 C;  4ME3 A;  4DR4 L;  1K83 H;  3S2H H;  4OON A;  1EQR A;  4LF9 Q;  4DV7 Q;  1E7Z A;  3SGI A;  3J81 j;  4HIM A;  1YEZ A;  2K5V A;  1KRS A;  3I7F A;  3STB D;  1CKO A;  1FJG Q;  1EIY B;  2VL6 A;  3HOV H;  4AIM A;  4IOC A;  1XMQ L;  2JA5 H;  5LMN L;  3GTL H;  5JJL A;  1K73 C;  1PHJ A;  1I94 L;  1TWF H;  1KHI A;  1QUQ B;  3S1R H;  4DAM A;  1K3R A;  5C4J H;  1UE7 A;  2PMZ E;  3KFU A;  4Y52 H;  1DGS A;  1QVC A;  4X64 L;  4DR1 L;  4OWX B;  2XGT A;  1SFO H;  2HHH L;  2B63 G;  4POF A;  1UE6 A;  4GOP C;  3RR5 A;  3ER0 A;  1Q81 C;  1N36 L;  1HNZ L;  1X3G A;  3PF5 A;  4YWM A;  1K0R A;  1OXT A;  1VQF A;  2IHF A;  1PH6 A;  2VUM H;  3AYH B;  3KJP A;  4DUZ L;  1VQO A;  1TXY A;  4P71 A;  3HOX H;  2JA5 G;  1BVS A;  3KJO A;  3KOJ A;  1IL2 A;  2OTJ A;  3J80 i;  1TWC H;  1IBM L;  5AJ3 Q;  3HOW H;  2B3G A;  3ULP A;  4RMF A;  5IYD G;  2JA9 A;  4DR2 Q;  4JOI A;  4A3L H;  4JI7 L;  4DUY L;  5BR8 L;  2H5X A;  2K5H A;  1RIP A;  1XMO Q;  1E22 A;  3PUY A;  3HOY H;  1HR0 W;  1RL2 A;  3K81 C;  3G6E A;  3K80 C;  4A3E G;  1VQ9 A;  4OX9 Q;  3PF4 A;  2WB1 E;  1OXX K;  1VCI A;  1VQA A;  4J15 A;  4APV A;  1SRO A;  1VS0 A;  4YHH Q;  3T1Y Q;  3KLW A;  1HZ9 A;  2CCZ A;  4LF6 Q;  1VQM A;  2JA7 H;  3H3V H;  2NN6 I;  4A3D G;  1AH9 A;  2UXC Q;  4UP9 A;  2E8G A;  1HZC A;  1O7I A;  4DAY B;  2A1A A;  2GVA A;  4JI2 L;  1L1O B;  4IPD A;  4DR3 L;  1YJN A;  5ELN A;  1L0W A;  1PH8 A;  2Q2T A;  2LXK A;  3CC2 A;  3HOW G;  1W2B A;  2C35 B;  3GD7 A;  2AWO A;  3I4O A;  1X9N A;  1VQH A;  2DUD A;  1MJE A;  4JYA Q;  4GN3 B;  5J3B A;  1Q82 C;  4A3L G;  4GLV B;  1GO3 E;  2ZTC A;  3CF5 A;  1X3F A;  1K9M C;  5GAE C;  4K0K Q;  2OWO A;  2RCN A;  2BA0 A;  3CCV A;  4R1J A;  3UDG A;  1L2F A;  5IE8 A;  4A4I A;  2E5L Q;  1YJ9 A;  1SRU A;  1PYB A;  1S72 A;  2JA7 G;  1KXL A;  5C0X G;  1I6H H;  1B8A A;  4A3F G;  1KAW A;  3K8A A;  1EYG A;  5IYB G;  4PG3 A;  4B3S Q;  1I5F A;  4LUO A;  3T1H Q;  3UDI A;  5FLM H;  3PO2 G;  4ALP A;  5C3E G;  2L15 A;  4BY1 G;  1IBL Q;  4L5T A;  3HOZ G;  3J81 c;  2VNU D;  3CPF A;  4PZ8 A;  4GOP A;  4BY7 H;  4DV6 L;  5LMU L;  3GDE A;  4JBJ A;  4EQ5 A;  3PIP A;  4YY3 L;  1PH9 A;  3KF8 B;  4QJF A;  4JI8 L;  3F8T A;  3E9H A;  1JMC A;  3CCQ A;  1GM5 A;  3KF6 B;  1JJG A;  1HNW L;  2F52 A;  3PUX A;  4C3I H;  4MNO A;  4B3M Q;  1N32 L;  1E24 A;  4DV3 L;  4R4I A;  1U0L A;  4LF4 Q;  1GD7 A;  1QVF A;  4A93 G;  3OTO Q;  3RZO H;  4P72 A;  1Y1V G;  4NB3 A;  1WJJ A;  1BBW A;  3EN2 A;  4LFA Q;  2N49 A;  2KHJ A;  4IO9 A;  1CKN A;  2EIF A;  1PH3 A;  1A63 A;  5M5W H;  2R93 H;  5M3F G;  3E0E A;  3M3Y H;  4JV5 Q;  4X65 L;  5IP7 G;  1L1O C;  4BY7 G;  3M85 A;  4LF5 Q;  3CCM A;  1VQ8 A;  1N33 Q;  4DV0 L;  4DV1 Q;  4MZ9 A;  4LFB L;  1SLJ A;  3J7Z C;  1GVP A;  2VQE Q;  2Q2U A;  4OXP A;  2EQS A;  2ZTD A;  1LUZ A;  4TQU S;  4GLA C;  1PH5 A;  4LF8 Q;  3M4O H;  2ZM6 L;  3G48 A;  4R4C A;  5IYC G;  1CKN B;  1Y14 B;  1XJV A;  2VS1 A;  1PH4 A;  3PGZ A;  4L5R C;  2JEA I;  4BXX G;  2VY3 A;  4LUV A;  4R4Q A;  4JI6 Q;  4GKJ L;  1SMX A;  1QUQ A;  4YCW A;  4IJL A;  5GAH C;  1FL0 A;  4DR4 Q;  5M5X H;  1UE1 A;  1VQE A;  2D0P A;  1KC8 C;  1WFQ A;  3I4N G;  3Q8D A;  5EAY A;  1P8L A;  2B63 H;  2XTI A;  2Y0S G;  3UE1 A;  2NVY H;  1D8L A;  1NE3 A;  3S15 H;  1FVI A;  3ICE A;  2UUB L;  3M7N A;  1XMQ Q;  5LMN Q;  4QL5 A;  3AFP A;  1N34 L;  2UUA L;  4NXM L;  1I94 Q;  4JC0 A;  2NZO A;  1UWV A;  3TS2 A;  4IFD J;  4IPG A;  2KEN A;  2Z0S A;  3S2D H;  2ATW A;  3F1Z A;  3RN2 A;  4DV5 L;  2Y0S E;  5IYD H;  3S1Q H;  1A8V A;  2YTV A;  2VQF L;  1A0I A;  1Z9F A;  3OYY A;  4A3G H;  2UXD L;  4DV2 L;  1HZB A;  2K75 A;  4X64 Q;  3M4P A;  3JAM c;  4DR1 Q;  5IY0 A;  1YJW A;  2AHO B;  2HHH Q;  1GKH A;  5GAD C;  3D31 A;  4BBR G;  4DPG A;  5IP9 G;  1N36 Q;  2IHE A;  1P16 A;  1HNZ Q;  4LFC L;  4A3E H;  3W1B A;  3FHW A;  2PI2 E;  2F4V L;  3NBH B;  4DUZ Q;  4DR6 L;  5K36 G;  2JQO A;  2A8V A;  4A3D H;  4LW1 A;  4IJH A;  2CKZ B;  1IBM Q;  3CW2 C;  4JBM A;  4KHZ A;  4HJ8 A;  3S16 H;  4GNX B;  3TRE A;  3I55 A;  2WB1 G;  3A74 A;  3GO5 A;  3PUZ A;  5IWA L;  4GKK L;  4JI7 Q;  4DUY Q;  1L1O A;  1E1T A;  2WAQ E;  5BR8 Q;  1X65 A;  1SN8 A;  2HIV A;  4DV4 L;  1SE8 A;  4A3G G;  4DR5 L;  2JK8 A;  4O2D A;  4PZ7 A;  3RLN A;  1HNX L;  3OW2 A;  2HT1 A;  1OXU A;  4NPS A;  4AYB E;  2I5M X;  1Q8K A;  3H3V I;  1KQS A;  5C0X I;  1X54 A;  4JI2 Q;  2A19 A;  4DR3 Q;  4A3F H;  1G6P A;  1NTG A;  4YWL A;  3TS0 A;  1NBW A;  2N3S A;  2ASB A;  4A3C G;  5IYB H;  1R9T H;  1OXV A;  2I0Q A;  4TVA B;  4LF7 L;  1V43 A;  4JI5 L;  4P75 A;  4MTN A;  3PO2 H;  1CSQ A;  4GLX A;  1IBK L;  5C3E H;  3M9B A;  4BY1 H;  3HOZ H;  3AFQ A;  2JA8 G;  3H15 A;  2NVX H;  1JB7 A;  3CD6 A;  1OXS C;  3U58 A;  3BZC A;  1PVO A;  1KRT A;  4HIO A;  1X3E A;  3J7A 5;  4OWT B;  2Q2H A;  3RLO A;  3VDY A;  4P74 A;  3HKZ E;  1YZ6 A;  2UUC L;  1QVG A;  3CCR A;  3A5Z B;  2JA6 G;  4AQY L;  2YU9 H;  3UE0 A;  2PI2 A;  3EBE A;  3CXC A;  1VQJ A;  4L5Q A;  2OQ0 A;  3KF6 A;  4A93 H;  1T9H A;  1Y1V H;  3BU2 A;  3CQZ H;  1Q12 A;  1LYL A;  1MIU A;  2YYZ A;  3S1M H;  2Q2I A;  2I5H A;  4R4T A;  2QEX A;  1TWA H;  5LMU Q;  2CFM A;  5FJ8 G;  4DV6 Q;  5M3F H;  4A75 A;  4DR7 L;  4X62 L;  4YY3 Q;  1VQK A;  2OQK A;  2LXJ A;  5GRO A;  5IP7 H;  4JI8 Q;  3B6Y A;  2D0O A;  5C44 G;  2R7Z G;  4FDB A;  4GNX C;  2IX1 A;  2ALY B;  1HNW Q;  1HJP A;  1XNQ L;  3ULL A;  1N32 Q;  4DV3 Q;  4JI0 L;  4QQB X;  2CWA A;  3GTK H;  3STB C;  3L0O A;  2ID0 A;  3FKI H;  2VZA A;  3A0J A;  2D62 A;  1VQG A;  1ASY A;  5IYC H;  3L7Z C;  4QIW E;  2ZTE A;  4RG1 A;  5H1S E;  1HR0 L;  4BXX H;  3RN5 A;  1YNX A;  4JG2 A;  2ES2 A;  2JEB I;  1E3P A;  4KHP L;  1JJC B;  1VQ4 A;  4X65 Q;  2HQL A;  2N8N A;  2PQA B;  2NVT H;  3S24 A;  1C9O A;  3K7U C;  4PZ6 A;  3HKS A;  1NJI C;  3I4N H;  4LFB Q;  3E9I A;  4O0A A;  5HY6 A;  4DV0 Q;  4WJ3 M;  3CC4 A;  1D7Q A;  5GQO A;  2NVQ H;  4P73 A;  3CP0 A;  3S14 H;  4IOA A;  1VQC A;  3F2D A;  2R7D A;  2BH2 A;  2ZM6 Q;  5JJI A;  4UPA A;  3DLL A;  3AQQ A;  2N78 A;  5IT9 c;  3UDX A;  3LGJ A;  1PH1 A;  2YV5 A;  3FKI G;  3M4Q A;  3PUW A;  4JI3 L;  4B3M L;  1VQ6 A;  1N8R C;  4YCV A;  1HH2 P;  3HFZ B;  5DLQ E;  4JI1 L;  4LUZ A;  4GKJ Q;  2UXB L;  1LM0 A;  4R4O A;  1J6Q A;  4NXN L;  3GTM H;  3BJU A;  1VQ7 A;  3J81 i;  1YI2 A;  4B3R L;  3CPW A;  4IFD G;  3D0F A;  2IY5 B;  4BBR H;  3U4Z A;  5IP9 H;  4Y7N H;  3NEM A;  4YCU A;  2UUB Q;  4JI4 L;  1EFW A;  2RHS B;  1FGU A;  1N34 Q;  4A3M H;  4KI0 A;  2UUA Q;  4NXM Q;  1UEB A;  3GTJ H;  4A3B H;  4B3T L;  1N9W A;  1J5E L;  4BA2 I;  2EXD A;  3PO3 G;  4UY8 C;  4XIG S;  4OO1 G;  2KHI A;  3TQY A;  2UU9 L;  3AEV A;  5HGQ A;  4DV5 Q;  1YIT A;  1S40 A;  1W3S A;  3J80 c;  2VQF Q;  4DK6 C;  4HJ7 A;  1M90 C;  3I4M G;  5JEA J;  2AMC B;  3F2C A;  2IT1 A;  5GAG C;  4DV2 Q;  1IXR A;  4A3J G;  2ZJR A;  4X66 L;  4GNX A;  3CCE A;  1LTL A;  2IX0 A;  5E7N A;  4LFC Q;  2E2H H;  1YIJ A;  1B70 B;  1XNR L;  2F4V Q;  1IYJ B;  1V1Q A;  5M3M G;  4OWW B;  4DR6 Q;  3RLF A;  2R92 G;  3K0X A;  2WAQ G;  3W1G A;  4GS3 A;  4A3M G;  4DV7 L;  4LF9 L;  3HOU G;  4C3H H;  4BBS H;  1JJ2 A;  4A3B G;  3BZK A;  4GN5 A;  4A3I G;  1WCM G;  3H0G G;  1G51 A;  4AYB G;  1FJG L;  4A3C H;  3KDF B;  4KLK A;  1YHB A;  1MKH A;  5IWA Q;  4GKK Q;  1PYS B;  2MO1 A;  4HJA A;  1XPO A;  2K5N A;  1Y1W G;  4DV4 Q;  5C4X G;  3I2Z A;  2JA8 H;  4DR5 Q;  2CQO A;  1TWG H;  4JBW A;  4GN4 B;  3PIO A;  1QZG A;  1HNX Q;  2RHQ B;  1BKB A;  4LNQ A;  4UP7 A;  1PFS A;  2K14 A;  1KL9 A;  1Q86 C;  2VW9 A;  2GVB A;  4UP8 A;  2K52 A;  4JBK A;  2QGQ A; 
#chains in the Genus database with same CATH topology
 1X56 A;  1R9T B;  5CV5 A;  4N9P A;  3TRZ A;  2B2Y C;  2E2D C;  2JN4 A;  3KYH C;  2A68 D;  4LF7 Q;  4JI5 Q;  2K4K A;  4N8X 1;  3HKZ G;  4KY6 A;  5EPL A;  4HJ9 A;  4IPC A;  1L0X B;  2F0I A;  2RDG A;  2JE6 I;  1SR3 A;  2WKD A;  1JWU D;  2O4X A;  5C44 H;  1Q46 A;  5EBC A;  5FO9 B;  4K8I A;  1BXT A;  4HIK A;  4AQY Q;  3IRB A;  4G7Z C;  4OX9 L;  4WJ4 A;  3DEO A;  1D5Z C;  2F0H A;  3FP9 A;  4YHH L;  3TN2 A;  1X6O A;  3T1Y L;  3T16 A;  1PV4 A;  4LF6 L;  2AKW B;  4BY7 B;  2R7F A;  3HOX G;  5EQ0 A;  2UXC L;  2B29 A;  4A76 A;  4R8I A;  3U9S A;  4UAI A;  2MQH A;  1YHA A;  2QDB A;  3K59 A;  3CCJ A;  2QA4 A;  1A3V A;  4HJ5 A;  4C1N K;  3CU7 A;  5TSS A;  1YNN C;  3G4S A;  4EVO A;  1KDB A;  1II3 A;  2KOL A;  2OCE A;  2E5L L;  4LWC A;  1JOR A;  4HID A;  3EIV A;  1CA6 A;  2NN6 G;  2OT2 A;  3VR6 A;  1K8G A;  2NZH A;  1JR0 D;  1NNX A;  2A73 B;  2K03 A;  1VQ5 A;  2V1C C;  2B2T C;  2F0G A;  3T1H L;  4TKO B;  1IBL L;  5EJW A;  2KEC A;  1Z47 A;  3S17 H;  4IPH A;  1C7Y A;  1QB5 D;  3MFG A;  1C0A A;  3A7L A;  4H02 A;  5CV8 A;  2JJQ A;  2BE5 D;  1EUJ A;  3MFY A;  1AE2 A;  4JI1 Q;  1YHQ A;  3C1F A;  4NXN Q;  1LTI D;  1JQY D;  3OTO L;  1VQL A;  1SND A;  5FLX c;  5FLM G;  1G2T A;  1F9S A;  3R2T A;  1F2Y A;  1ENA A;  1B1Z A;  4LF5 L;  1RDP D;  3MXN B;  4XQN A;  4DV1 L;  3W5O A;  4C3I G;  2VQE L;  1I3Q H;  1RD9 D;  3H94 A;  5IGB A;  2LSS A;  3GV6 A;  1QZH A;  5C4X H;  2UXD Q;  1E1O A;  1EEI D;  2M2L A;  3K6O A;  3RNU A;  4KKT A;  5M5Y H;  2FHT A;  5I9P A;  3UDF A;  2R93 G;  1FR3 A;  1BBX C;  1EY5 A;  3S2H H;  3K57 A;  4RGM A;  1EQR A;  2IL8 A;  3SGI A;  3J81 j;  1GUW A;  1ENF A;  3HOY H;  4RCN A;  5KYI A;  5IGC A;  2VL6 A;  3NTK A;  4KHV A;  4AIM A;  1XMQ L;  3GTL H;  1TWF H;  1I4Q A;  2N55 A;  1QUQ B;  3NBI A;  3S1R H;  1TII D;  5C4J H;  5A35 A;  1UE7 A;  3KFU A;  1STB A;  1BOS A;  4DGZ A;  3NSW A;  1EU4 A;  2MPM A;  4POF A;  3IAY A;  1Q81 C;  1X3G A;  4I65 A;  1ZXT A;  2IHF A;  1S5D D;  5I2Y A;  3GQB A;  2VUM H;  3KJP A;  4P71 A;  2JA5 G;  4NDX A;  3KJO A;  1GHJ A;  2R7Z B;  4YIJ A;  1IBM L;  5AJ3 Q;  1O78 A;  2F0T A;  2B39 A;  1TS2 A;  3QG1 A;  4DR2 Q;  1A6X A;  4ZCK A;  5T1I A;  2NB0 A;  1YNJ D;  2H5X A;  3E0J A;  2ICI A;  2IJ0 A;  3HZX A;  1QOH A;  1SSO A;  3FDT A;  5JPN C;  3Q6S A;  2CQA A;  4A3E G;  1VQ9 A;  2HCC A;  1XYI A;  1STY A;  1VCI A;  1VQA A;  2CCZ A;  2JA7 H;  3NK9 A;  1HZC A;  4DAY B;  2GVA A;  1L0W A;  1FYC A;  2LXK A;  3CC2 A;  3HOW G;  3SK6 A;  2C35 B;  1W2B A;  3I4O A;  3GTK B;  4FVM A;  1X3F A;  1CFM A;  2OWO A;  2RCN A;  1RJT A;  1L2F A;  2KQ3 A;  2SEB D;  1WTR A;  5CR3 A;  4IUR A;  2NVT B;  3DM1 A;  1D1I A;  2F3V A;  3ERO A;  4PG3 A;  4ABN A;  2KCC A;  3PO2 G;  1V1P B;  2KUM A;  4BY1 G;  3J81 c;  2B2W C;  3KK7 A;  4PZ8 A;  4BY7 H;  5LMU L;  3GDE A;  3PIP A;  3KF8 B;  4JI8 L;  3GP7 A;  2AQ2 B;  3CCQ A;  2NYZ D;  4ZUJ A;  4A3J B;  5A2Q E;  1N32 L;  4RHS A;  1GD7 A;  2B8G A;  4A93 G;  4IUU A;  5ELE A;  1Y1V G;  2F1M A;  2Z4I A;  5G3L F;  4LFA Q;  2N49 A;  5KEE A;  5M3F G;  4X65 L;  1L1O C;  3TBI B;  3CCM A;  3V2T A;  1SLJ A;  2VB2 X;  2Q2U A;  2ZTD A;  1LUZ A;  4GLA C;  4IN3 A;  1SNM A;  4U67 3;  1SYB A;  2Q8R E;  2FMM A;  1CKN B;  1SDF A;  4BXX G;  2VY3 A;  4LUV A;  4JI6 Q;  5GAH C;  4CKB A;  1KC8 C;  3I4N G;  2M9V A;  3Q8D A;  5EAY A;  1I4G A;  4PMB A;  3UE1 A;  1F2Z A;  1SNQ A;  4HN7 A;  4E6I A;  1PRT B;  1S5E D;  2UUB L;  1N34 L;  2JA8 B;  1I94 Q;  4FXG C;  2NZO A;  2Z0S A;  1I4R A;  2XRS D;  4V0B A;  3S1Q H;  1TKW B;  1TQO A;  1A8V A;  2YTV A;  1A0I A;  1ML0 D;  1HZB A;  4RCO A;  1I50 B;  4DPG A;  4BBR G;  1WTV A;  2JXM B;  1TWC B;  3S1N B;  3NBH B;  2JQO A;  3VR5 A;  3JAM L;  2EYH A;  3S16 H;  5IWA L;  4ZRZ A;  1QWY A;  4JI7 Q;  1UAP A;  4DUY Q;  1CTM A;  1B3Q A;  4O2D A;  4PZ7 A;  3RLN A;  1HNX L;  3OW2 A;  4K6D A;  2HT1 A;  3AMU A;  4ZKB B;  1E2W A;  1QCB D;  4RGT A;  4FYD A;  3IL8 A;  5JJZ A;  1JWM D;  2L1B A;  2A19 A;  1IW7 C;  5IYB H;  3K5N A;  2I0Q A;  4LF7 L;  4JI5 L;  3M4Y A;  4GLX A;  3H09 A;  1EY9 A;  2Z9H A;  1AN8 A;  3AFQ A;  1JB7 A;  4DFA A;  1HA6 A;  1OXS C;  3U58 A;  1CHQ D;  3IKJ A;  1KRT A;  3D6C A;  4A3K B;  3VDY A;  4P74 A;  3HKZ E;  1EY6 A;  2F0K A;  1A3T A;  2MUY A;  3NTI A;  4AQY L;  3CXC A;  1SE2 A;  1EZ6 A;  2OQ0 A;  3KF6 A;  1T9H A;  1Q12 A;  2KEE A;  4H13 C;  2I5H A;  1VQK A;  3BYY B;  2D0O A;  5C44 G;  2ALY B;  2X6G A;  1T5E A;  1O7Y A;  1UEA B;  1WTX A;  1SMY C;  4QQB X;  3GTK H;  3STB C;  3L0O A;  1ICW A;  2EYL A;  2VZA A;  3A0J A;  1ASY A;  3L7Z C;  4RG1 A;  4N9T A;  1XWE A;  4CKC A;  3R3O A;  4J6H A;  1GUO A;  2WAQ B;  4C3J B;  2NVT H;  3S24 A;  1C9O A;  3HKS A;  4LFB Q;  3E9I A;  3H0G B;  4M8A A;  4O42 A;  1D7Q A;  5GQO A;  2EJF C;  2NBF A;  4IOA A;  2R61 A;  4EQP A;  4J1M A;  2SNM A;  3Q22 A;  3BDL A;  5JJI A;  1HFN A;  3AQQ A;  5IT9 c;  3FKI G;  5M5X B;  1ET6 A;  4HSV A;  1CM9 A;  4JI1 L;  4LUZ A;  1K83 B;  4NXN L;  3GTM H;  4FXK C;  2K1B A;  1VQ7 A;  3U4Z A;  1BUV T;  2RHS B;  4NXM Q;  5K36 H;  1RF2 D;  2E76 C;  2K5Q A;  5IGE A;  1N9W A;  4BA2 I;  2O5J C;  2XIW A;  2R3Z A;  4IUP A;  3AEV A;  3D3R A;  2NWG A;  2EYJ A;  2VQF Q;  3RMH A;  2PZW A;  2K28 A;  2Q8T A;  2F0J A;  2RBM A;  4GNX A;  4DAV A;  2IX0 A;  4A3D B;  4K5W A;  3E5S A;  1WTH A;  2F4V Q;  3RUZ A;  1IYJ B;  4DR6 Q;  4RGN A;  4PV1 C;  4A3M G;  1HQR D;  4C3H H;  1JIC A;  1M8A A;  4RGO S;  2OXP A;  4EQN A;  3RD4 A;  4AYB G;  4A3C H;  1D2B A;  3T13 A;  4LAA A;  1XPO A;  4HJA A;  5D3D A;  5C4X G;  1B2T A;  4DV4 Q;  2JA8 H;  3NHH A;  2DNC A;  1PYW D;  2CQO A;  3NE5 B;  4JBW A;  5IGG A;  1QZG A;  3PIO A;  3PMF A;  1MGS A;  4LNQ A;  2F0P A;  1NCV A;  4UP7 A;  4ZAI A;  1VF5 C;  1KNE A;  3WOE A;  4OEM B;  4XDX A;  3P7J A;  5LL6 S;  3PIP 3;  2Z1C A;  2F0E A;  5FOB B;  3MXG A;  1ASZ A;  1VQN A;  3HOY G;  1I50 H;  3NEN A;  3BDC A;  3PUV A;  4PMW A;  1CKM A;  1PFB A;  3S1N H;  4X3S A;  4X3K A;  4ID6 A;  3OOC A;  1LTA D;  4ODG A;  2ZJQ A;  1K8A C;  5AJ3 L;  3CMA A;  1QE6 A;  4FNF A;  3JAM i;  4DR2 L;  3SK8 A;  2WIN B;  1RCV D;  1G29 1;  1NMF A;  1I6H B;  2UUC Q;  2A5H A;  1LT6 D;  1Q7Y C;  2EZV A;  1PFM A;  1PDQ A;  1MSH A;  4PQX A;  2VUM G;  1JT8 A;  4ZUI A;  4DKA C;  1ROD A;  4MTK A;  5DNF A;  3WWV A;  4DNI A;  2L11 A;  1IZ6 A;  1FD7 D;  2KCN A;  2Z6K C;  1X55 A;  1V1O A;  3E3X A;  4XQQ A;  1E0B A;  2K50 A;  2PQE A;  4GZY C;  2L0C A;  1Y8O B;  1Q1E A;  1ILP A;  2PQA A;  1B7Y B;  1F77 A;  2NUC A;  4JI0 Q;  1HRJ A;  3CCU A;  3NQT A;  1STE A;  3SHL A;  1FNU A;  3MEF A;  4A3K H;  1EY8 A;  3I3C A;  3M3Y B;  2BA1 A;  4HR7 B;  5CGK A;  1ET9 A;  1Q1B A;  1V9P A;  2H1E A;  5DAU A;  1W6K A;  3QO2 A;  3DWQ A;  5JVG 3;  2BOS A;  1UUP A;  1YVC A;  4EX5 A;  2PW7 A;  4DK0 A;  1XTD A;  2ZJP A;  1QIL A;  1WYD A;  4WOR A;  1H95 A;  4LFA L;  2XRQ D;  2MFI A;  3VA5 A;  2J4X A;  2IWH A;  1S5B D;  4RHR A;  2BDO A;  1KDC A;  2OTL A;  1DM0 B;  4C3J H;  3FRP B;  4KD3 A;  1PA6 A;  4A3I H;  2EDG A;  2UU9 Q;  3E6Z X;  4C2M H;  3H0G H;  1O7Z A;  1HCZ A;  1EIF A;  2F0L A;  5JJK A;  2DY7 A;  5BN4 A;  3EJI A;  4G7O C;  1CZG A;  3PV0 A;  2VB3 X;  2PYK A;  3KDF A;  5D14 A;  3I56 A;  3P20 A;  1ICF B;  2BH8 A;  1XPR A;  4JI6 L;  3U50 C;  1K83 H;  4HCE A;  4OON A;  4LF9 Q;  1E7Z A;  4B9W A;  4HIM A;  4FP5 D;  2K5V A;  1KRS A;  4G7H C;  3HOV H;  2EJM A;  2V4D A;  1K73 C;  1I94 L;  1KHI A;  4TRD A;  1KLG D;  2RKS A;  2PMZ E;  2G9H D;  3TME A;  5EPK A;  4BS9 A;  1UE6 A;  1UNS A;  4L63 B;  4JK1 C;  1GOZ A;  1K0R A;  1OXT A;  1PH6 A;  3HOZ B;  1SYF A;  3SR1 A;  1VQO A;  2NVX B;  1TXY A;  3FEW X;  3KOJ A;  1VDZ A;  2XNA C;  4G57 A;  3Q0A A;  5COY A;  4JOI A;  4A3L H;  3GTG B;  4JI7 L;  4DUY L;  1DD2 A;  1MD2 D;  2K5H A;  3PUY A;  5BN3 A;  1HR0 W;  3G6J B;  3I91 A;  3G6E A;  5IOC A;  3CHB D;  4J15 A;  4APV A;  3KLW A;  2Q8I B;  3O13 A;  2A6H D;  4KJN A;  4IPD A;  1PH8 A;  2Q2T A;  2CW0 C;  1V8Q A;  2AWO A;  4JYA Q;  4GN3 B;  3MEH A;  1Q82 C;  3TZD A;  3I8Z A;  4HAE A;  2LMC B;  2ZTC A;  4K0K Q;  1JOO A;  3CCV A;  2F0U A;  5IE8 A;  4X3T A;  1HUM A;  1PYB A;  1KXL A;  1LT3 D;  1I6H H;  1U4P A;  1KAW A;  5IYB G;  1DOM A;  4B3S Q;  4HTH A;  3UDI A;  2L15 A;  2ENB A;  1TVX A;  1AZQ A;  4GOP A;  1EZ8 A;  2L4N A;  2PO4 A;  4EQ5 A;  1XXG A;  1K8M A;  4K2K A;  1LO5 D;  3R93 A;  2C5C A;  3KF6 B;  2OF1 A;  2TMP A;  4QUF A;  5I9O A;  3VR4 A;  5F2D A;  1TY2 A;  2DN8 A;  4MN3 A;  1QVF A;  3K7A B;  1GUS A;  2X6L A;  1TS4 A;  1A63 A;  2NZ1 D;  3E0E A;  5JVH 3;  3M3Y H;  1QNU A;  5BN5 A;  2SOB A;  1N33 Q;  4LFB L;  4XT3 B;  2WB1 B;  1Y69 U;  2EQS A;  3EFX D;  1H9M A;  4TQU S;  4LF8 Q;  3WDN A;  1CT1 D;  3G48 A;  2EYP A;  3HEJ A;  1XJV A;  1PH4 A;  1SNC A;  1FL0 A;  4DR4 Q;  2LFN A;  2B8F A;  1SXT A;  5CBA E;  3AU7 A;  4LK1 C;  5CV7 A;  2NVY H;  3U9O A;  1NE3 A;  3M7N A;  4NXM L;  2F0N A;  2X69 A;  4IFD J;  2PNR C;  3F1Z A;  2Y0S E;  5IYD H;  1E2V A;  3A8J E;  1FNV A;  2BDN A;  3SEB A;  4EGV A;  2VQF L;  1Z9F A;  3L9A X;  3OMG A;  2Z4H A;  2K75 A;  3JAM c;  2JA6 B;  3M4P A;  3NPP A;  1YJW A;  4KKS A;  1GKH A;  4ZLT F;  3MHB A;  2HHH Q;  3D31 A;  2IHE A;  3HOX B;  4B9X A;  2IPK D;  1LTR D;  2F4V L;  4DUZ Q;  4DR6 L;  5K36 G;  1PTO D;  2CKZ B;  3CW2 C;  4JBM A;  2LY7 A;  3WOF A;  4KHZ A;  4HJ8 A;  4GNX B;  3GO5 A;  3A74 A;  3PUZ A;  1DON A;  5BR8 Q;  4DV4 L;  4A3G G;  1BQQ T;  4NPS A;  4AYB E;  3LNN A;  1ESR A;  1ESF A;  1Q8K A;  3D8G A;  2WKC A;  4C3H G;  1SNP A;  3N52 A;  5C6A A;  4LMQ D;  4A3F H;  2ASB A;  4A3C G;  1LTB D;  1R9T H;  4P75 A;  4MHE A;  1PRT C;  5C5M A;  3HOZ H;  2JA8 G;  2B2V C;  3H15 A;  2NVX H;  3BZC A;  1STN A;  4HIO A;  2D9U A;  2Q2H A;  1G2S A;  3R8B A;  4FF2 A;  1Q3L A;  2FIN B;  2E2I B;  2UUC L;  3CCR A;  3DEP A;  5C3W A;  4KY5 A;  5EKK A;  1VQJ A;  2RSO A;  3AB9 A;  5FO8 B;  4KY7 A;  1BCP D;  2WV6 D;  2YYZ A;  5KGU A;  4A75 A;  2HQE A;  3GTP B;  5IGF A;  1DXM A;  4YY3 Q;  4KD4 A;  5GRO A;  3PO3 B;  4HMI A;  1ILQ A;  3OPO A;  1HNW Q;  1AW7 A;  3NUC A;  4JI0 L;  2F0F A;  4ME5 A;  2ID0 A;  2D62 A;  1VQG A;  2R93 B;  5IYC H;  1JWS D;  4QIW E;  1U4R A;  5COR A;  3TP5 A;  1YNX A;  4IQZ A;  4JG2 A;  1CK1 A;  1H9R A;  4CDE C;  3HOU B;  1VQ4 A;  2HQL A;  2N8N A;  2PQA B;  1AP0 A;  1WCM B;  4PZ6 A;  1NJI C;  4DV0 Q;  3M4O B;  4H7B A;  5EGT A;  3CP0 A;  4IUQ A;  5C5L A;  3J80 E;  1Y1W B;  3F2D A;  1I4P A;  2R7D A;  2ZM6 Q;  1LTG D;  1TWH B;  2EYM A;  2N78 A;  3UDX A;  2YV5 A;  1BNZ A;  1IW7 D;  1HH2 P;  3SXH A;  1J6Q A;  2IY5 B;  1HHV A;  4P2C B;  4KN7 C;  2JA5 B;  3H91 A;  1FGU A;  3SK4 A;  5A2Q L;  1HXY D;  2MGS A;  1SAP A;  4XIG S;  2KHI A;  2UU9 L;  5HGQ A;  1PZJ D;  4DV5 Q;  1S40 A;  1ENC A;  2WII B;  3BG3 A;  1F2M A;  1M90 C;  5JEA J;  2AMC B;  1SFO B;  2G9D A;  3ERQ A;  4A3E B;  3PQI A;  3MZ5 A;  5E7N A;  1U9R A;  3I72 A;  1HPC A;  3RLF A;  3J80 L;  2WAQ G;  4C3J G;  4GS3 A;  4LF9 L;  3HOW B;  1IYU A;  4A3B G;  5KIX A;  4A3I G;  2A69 C;  3H0G G;  1G51 A;  1DZ1 A;  3KDF B;  4GKK Q;  1MKH A;  1U4L A;  1Y8P B;  5DM7 3;  3I2Z A;  1C4Q A;  3BS1 A;  4DU9 A;  1FNW A;  3QR8 A;  4GN4 B;  2GA4 B;  2TSS A;  4UP8 A;  1J9O A;  2NTT A;  5EBD A;  2JA6 H;  4BBS G;  4BY1 B;  3HOV G;  2XWJ B;  2CVR A;  4NKL A;  1IBK Q;  2B2U A;  3T56 B;  4CGY B;  1SJH D;  1GHK A;  5FJ8 H;  4G4K A;  2A74 C;  2I46 A;  1CQF A;  1PTO B;  2R7Z H;  2NTS A;  3NTH A;  2GN5 A;  1LT4 D;  3QIA A;  1Y1V B;  4JCV E;  3X3M A;  3F2B A;  4L5S A;  3BVM A;  4AH6 A;  1HA5 A;  3HP3 A;  5IGD A;  2MNA A;  1HZA A;  5M3F B;  2OEO A;  1KD1 C;  5ELB A;  2CWP A;  1IL8 A;  3DM3 A;  3VYS A;  4X62 Q;  3T53 B;  4JYA L;  3FPP A;  1XNQ Q;  3A5U A;  4QGU A;  1HTL D;  3BDO A;  3ULJ A;  4QCL A;  2KCT A;  1A2T A;  2KED A;  2QCP X;  4K2L A;  1WI5 A;  4ZK9 B;  4K0K L;  2AWN A;  3RZO B;  2F0M A;  1BBU A;  1CSP A;  1OTC A;  1HR0 Q;  2FXQ A;  1WOC A;  1PH7 A;  3I4N B;  5LHY 1;  4FF3 A;  4KHP Q;  5CV6 A;  2E2I H;  1EQQ A;  3PCO B;  2YTY A;  5FKA C;  2R6G A;  2YTX A;  4B3S L;  4IFD I;  4IFD H;  1JE4 A;  2PNH A;  1MJC A;  2RF4 A;  2I5L X;  1VQP A;  5C0X J;  1MI2 A;  2B2Y A;  4WJW A;  4POG A;  1BCP B;  3GTP H;  4IUN A;  5KNC A;  4CBV A;  3PO3 H;  3CAM A;  4OO1 I;  4OO1 H;  1PLF A;  1S3O A;  3J7Y W;  4XQJ A;  3QOJ A;  3ZJY C;  4Y7N B;  2DGY A;  3PSI A;  2B63 B;  4GOP B;  4A3J H;  5I4D A;  4QY7 A;  3GTJ B;  1Z7T A;  2KCM A;  3SE0 A;  1L0Y B;  1EWI A;  4JI4 Q;  3CCS A;  4DXF A;  4B3T Q;  5C4Z A;  3HOU H;  4FO2 A;  1Z6H A;  1N33 L;  1PZK D;  1WCM H;  1D6E C;  3BZD B;  3KLS A;  1SYG A;  3ERS X;  4LF8 L;  2KVM A;  5JOB A;  1GUN A;  2PCF B;  4HED A;  1Y1W H;  1BO0 A;  4R8N A;  5ISR A;  1TWH H;  4QMG A;  1NY4 A;  4DR4 L;  1VMP A;  3J7A F;  1EFI D;  4HMJ A;  4DV7 Q;  1EQV A;  1KAA A;  4HSP A;  3TSS A;  1YEZ A;  1FJG Q;  1CKO A;  1EIY B;  2JA5 H;  5JJL A;  1PHJ A;  5G3L D;  2B2T A;  3VR2 A;  4DA2 A;  1B53 A;  4HCS A;  1DYQ A;  2EE1 A;  1H9K A;  4Y52 H;  1DGS A;  4OWX B;  2XGT A;  3VYU A;  5KRU A;  1SFO H;  2HHH L;  3ER0 A;  5EPJ A;  5CBE E;  1WVL A;  4YWM A;  1S5F D;  1VQF A;  1LTS D;  4ZQ3 A;  4C1N I;  5C3E B;  3K5O A;  5J22 A;  3P75 A;  4DUZ L;  4PMC A;  2C9O A;  3NQI A;  4O1N A;  1IL2 A;  2OTJ A;  3J80 i;  1TWC H;  1AZP A;  1EWH A;  4K5X A;  3HOW H;  2B3G A;  3ULP A;  5IYD G;  2JA9 A;  3MTS A;  1ZKO A;  5I2X A;  5BR8 L;  2YU9 B;  1XMO Q;  1PZI D;  1K28 A;  3K81 C;  2EYO A;  3K80 C;  2LKV A;  4QUC A;  1OXX K;  3OW7 A;  5CMD A;  3PF4 A;  3KLR A;  1SRO A;  3S1M B;  3BVG A;  3H3V H;  1ZYR D;  1IYV A;  2QIL A;  2LS0 1;  1AH9 A;  1TWA B;  2E8G A;  1O7I A;  4UDU C;  1YJN A;  2M00 A;  2EY2 A;  1PRT F;  5DM6 3;  2DUD A;  1MJE A;  2I07 B;  3NP8 A;  3BVZ A;  4NW2 A;  3FKI B;  2BA0 A;  4R1J A;  2E75 C;  3UDG A;  1YJ9 A;  2P5Z X;  2JA7 G;  3R2I A;  1B8A A;  2K32 A;  4A3F G;  3K8A A;  4JVZ A;  2Y0S B;  3C2P A;  1SJE D;  2NVQ B;  3S14 B;  4ALP A;  1EEF D;  2VXW A;  3HOZ G;  5LL6 X;  3CPF A;  5NUC A;  3QJY A;  5IT9 E;  5JEA H;  4YY3 L;  1PH9 A;  3HG9 A;  4QJF A;  5ELD A;  2HDL A;  3F8T A;  1DOK A;  1JMC A;  2K01 A;  1GM5 A;  1JJG A;  2EY1 A;  1HNW L;  5CYU A;  2F52 A;  3PUX A;  5KNB A;  4MNO A;  1E24 A;  1STH A;  4R4I A;  4LF4 Q;  4RWS C;  3RZO H;  3OIQ A;  4XYO A;  1WJJ A;  4CDD C;  3C1E A;  4LJZ C;  3KBG A;  1K0S A;  4IO9 A;  1CKN A;  2EIF A;  4A3M B;  2DNE A;  1E2Z A;  4JV5 Q;  4BY7 G;  3D4D A;  4AYB B;  3M85 A;  1I3Q B;  4DV0 L;  4MZ9 A;  3EVQ A;  3K5L A;  1GVP A;  3A55 A;  1IHZ A;  1NR4 A;  4OXP A;  1EU3 A;  1GUT A;  1EIG A;  1PH5 A;  2ZM6 L;  4NMZ A;  4R4C A;  5IYC G;  1CI3 M;  4OEL B;  1Y14 B;  3PGZ A;  1QJO A;  1JCK B;  4R4Q A;  5CV9 A;  3LX0 A;  2L9H A;  5M5X H;  1CQV A;  1RTO A;  2D0P A;  3D4W A;  1MHW C;  1WFQ A;  1WD1 A;  2B63 H;  1P8L A;  2XTI A;  1VF7 A;  1KNA A;  1YNN D;  1D8L A;  2F0S A;  2HCI A;  1I4H A;  3ICE A;  5LMN Q;  4QL5 A;  2DJF C;  4CJ0 B;  3TS2 A;  1PFN A;  2KEN A;  1LAB A;  2ATW A;  3RN2 A;  2B2W A;  2MP1 A;  4DV5 L;  1A3U A;  1EY7 A;  4JPB W;  1SNO A;  1ZEQ X;  3OYY A;  4X64 Q;  4DR1 Q;  2AHO B;  2VUM B;  1N36 Q;  3HS0 C;  5CC4 A;  1HNZ Q;  4KMU C;  3W1B A;  3H6M A;  4A3D H;  4LW1 A;  3M7G A;  2E2J B;  4KV6 A;  3URY A;  3IFT A;  3V05 A;  1TR5 A;  2FMC A;  3ZYY X;  3TRE A;  3I55 A;  2WB1 G;  4GKK L;  4V19 0;  1L1O A;  1E1T A;  2WAQ E;  1SN8 A;  1KTK A;  4OIK A;  1B9M A;  3SDZ A;  3RZD B;  1OXU A;  3A54 A;  1S4Z A;  1G91 A;  1TS5 A;  1JB3 A;  1O80 A;  4N8F A;  2QEJ C;  1KQS A;  5C0X I;  4L6T B;  5C0X H;  2RA4 A;  1X54 A;  4JI2 Q;  1AFP A;  4DR3 Q;  1G6P A;  4YWL A;  3TS0 A;  1MSG A;  2N3S A;  5CV4 A;  2A6E C;  4TVA B;  4MTN A;  1IBK L;  2F0V A;  2F0D A;  2QF7 A;  3M9B A;  2QDL A;  5C3E H;  3CD6 A;  2G5D A;  2IX3 A;  1EYC A;  3MXU A;  2PZT A;  2K6A A;  3J7A 5;  3MVV A;  1YZ6 A;  2DJG C;  3A5Z B;  2JA6 G;  2YU9 H;  3GTQ B;  1LV9 A;  1W6J A;  3BU2 A;  1LYL A;  3T51 B;  2EXZ A;  1PMR A;  1MIU A;  3MA2 B;  3K5M A;  1AEX A;  3S1M H;  2Q2I A;  2QEX A;  4DV6 Q;  1TWA H;  3F2U A;  2CFM A;  5FJ8 G;  4X62 L;  4PNY A;  5IP7 H;  2LXJ A;  3W3A A;  3B6Y A;  2R7Z G;  4FDB A;  4GNX C;  2IX1 A;  3MC0 B;  1HJP A;  1XNQ L;  3I4M B;  4DV3 Q;  3MXP A;  3TP7 A;  2J0T D;  3GTO B;  1MBY A;  3FKI H;  2F03 A;  1BR9 A;  4DN4 M;  5H1S E;  2ZTE A;  1HR0 L;  4BWG B;  5M3M B;  4CHT B;  2R92 B;  3VYT A;  2JEB I;  1E3P A;  4KHP L;  1JJC B;  4K5V A;  1G8Z D;  3SVM A;  3K7U C;  2RDF A;  3T4A C;  3PIO 3;  2NVQ H;  3S14 H;  3OWE B;  1VQC A;  4DNT B;  3TZU A;  1EYD A;  1T5X D;  2XN9 C;  2PPB C;  2AQ1 B;  3LGJ A;  2A68 C;  4B3M L;  1RTN A;  2F0Q A;  1N8R C;  2O2L D;  3HFZ B;  3I4L A;  5DLQ E;  3HRZ C;  4GKJ Q;  1LM0 A;  1PRT D;  4ULL A;  3S9W A;  3BJU A;  3D6W A;  4CJ1 B;  1YI2 A;  5IIF A;  4H44 C;  4IFD G;  3D0F A;  1A15 A;  5IP9 H;  1NAP A;  4XYQ A;  4YCU A;  3HKZ B;  1GUG A;  1EFW A;  4JI4 L;  3C46 A;  4A3M H;  2UUA Q;  3DWP A;  1UEB A;  4B3T L;  3S1Q B;  2EXD A;  1NSN S;  3PO3 G;  4OGQ C;  4OO1 G;  1HTP A;  2A6H C;  1YIT A;  1W3S A;  3J80 c;  4DK6 C;  4CDC C;  4HJ7 A;  2IT1 A;  4DV2 Q;  1IXR A;  4A3J G;  4F87 A;  2ZJR A;  2JSO A;  4LFC Q;  2FJ2 A;  1V1Q A;  5J39 A;  2F0W A;  3S16 B;  3W1G A;  3HOU G;  4DV7 L;  3BZK A;  4GN5 A;  4RKB A;  1WCM G;  4WRD A;  1FJG L;  2SDF A;  4K8J A;  1PYS B;  2K33 A;  2K5N A;  1Y1W G;  1B9N A;  4DR5 Q;  2EY6 A;  3A56 A;  1WTP A;  2HDM A;  2QKI C;  2RQX A;  3NXW A;  4FXD A;  2RHQ B;  1BKB A;  4DK1 A;  2K14 A;  1KL9 A;  2RDH A;  2VW9 A;  4JBK A;  4P73 A;  4YWK A;  2AUK A;  1JOQ A;  2BE5 C;  3SK5 A;  3CME A;  2J7Z A;  1S5C D;  2HD3 A;  4EQO A;  1EY4 A;  2EOT A;  2KA7 A;  2E2J H;  3CCL A;  3CRK C;  2CH4 W;  2JYO A;  1KAB A;  2K7V A;  1UE5 A;  3J7A V;  1XMO L;  1TS3 A;  1EY0 A;  3QWN A;  3GTG H;  3TEH B;  1J8I A;  3FMC A;  3RZD H;  3VA7 A;  1H9S A;  2F3I A;  4OHJ A;  4DR7 Q;  2HIX A;  4X6A H;  2D2C C;  1TT2 A;  4C3I B;  1AE3 A;  2RCF A;  3OSO A;  1LAC A;  5ELO A;  3KBX A;  1K3B C;  4RA8 A;  5FLX E;  1NMG A;  3H3V C;  2A69 D;  2F3W A;  1CHP D;  1KDA A;  2WFW A;  5M5W B;  1YBY A;  4BA1 I;  4C56 C;  3NWT A;  1VQB A;  1VQD A;  3CC7 A;  4DK3 C;  3OMC A;  4I7A A;  3GTQ H;  1A62 A;  1A2U A;  1STA A;  4I7Z C;  5LMN W;  2XWB B;  2D5D A;  1M1K C;  5E3F A;  4XTC S;  3G71 A;  1U5K A;  1EOV A;  2RVL A;  4OIJ A;  1XPU A;  3JC6 6;  1PH2 A;  4M1U B;  3GTM B;  4JI3 Q;  2ZXO A;  1PTO C;  3I90 A;  4B08 A;  2UXB Q;  2K05 A;  3W2D A;  3U4V A;  1JE5 A;  2CH4 A;  4A3K G;  3I4M H;  4LF4 L;  1Q8I A;  5C3X A;  4B3R Q;  1VQI A;  2PZU A;  3GTO H;  3QB3 A;  3S15 B;  4X3U A;  1BDO A;  3NEL A;  3K7A H;  1YNJ C;  3OHX C;  1DOL A;  5ELC A;  2AUJ D;  5M3M H;  1WTO A;  2EPB A;  4JOI C;  5JEA G;  2R92 H;  4JV5 L;  3S2D B;  1XX8 A;  1J5E Q;  3A8I E;  2KBN A;  5FLX L;  5E1F A;  4A3G B;  1NUC A;  3JAM E;  2Z6K A;  2WP8 J;  1B3A A;  3ND8 A;  1KIX A;  1CZW A;  1CUK A;  1X3P A;  5AFW A;  4X66 Q;  3L2P A;  5I6Y A;  1SYD A;  4IZ8 A;  4QF4 A;  2MO0 A;  1QG7 A;  1FGB D;  4C3H B;  1F9Q A;  1XNR Q;  4KJO A;  4ME3 A;  3ITP A;  1SMY D;  3BYT B;  5ELF A;  3STB D;  3I7F A;  1EYA A;  4IOC A;  1SYC A;  5LMN L;  1PXU A;  5JAV A;  1D5X C;  1RKN A;  4DAM A;  1BCP C;  1K3R A;  1EWC A;  2JP1 A;  1RHP A;  4Q5V A;  1QVC A;  4X64 L;  4DR1 L;  2K04 A;  2B63 G;  4GOP C;  3FPU B;  3EA6 A;  3RR5 A;  1N36 L;  1HNZ L;  3PF5 A;  3PO2 B;  1SBB B;  2XVS A;  5J1Z A;  1SEB D;  5JPM C;  3TP8 A;  3AYH B;  2FFK B;  3HOX H;  2KHS A;  1BVS A;  1CA5 A;  1I4X A;  5FK9 C;  1Q90 A;  1WTQ A;  2AQ3 B;  4RMF A;  1GJX A;  1F9P A;  2E74 C;  2ZT9 C;  5IOD A;  1RIP A;  1E22 A;  4A93 B;  1RL2 A;  3CQZ B;  4RH6 A;  4WFN 3;  4OX9 Q;  2WB1 E;  1VS0 A;  4YHH Q;  3T1Y Q;  3KLS X;  1HZ9 A;  4LF6 Q;  1VQM A;  1XTC D;  2NN6 I;  2NN6 H;  3UI2 A;  3J81 E;  4UP9 A;  4A3D G;  2UXC Q;  2A1A A;  4JI2 L;  1L1O B;  4DR3 L;  5ELN A;  4K6L A;  3KUP A;  1IKM A;  3GD7 A;  5KYL A;  1X9N A;  1VQH A;  4JW0 A;  5J3B A;  4A3L G;  4GLV B;  1GO3 E;  3CF5 A;  1K9M C;  5GAE C;  5D3I B;  1C8C A;  1DCZ A;  3LWE A;  2E5L Q;  4A4I A;  1SRU A;  5T1G A;  5K5P A;  2L55 A;  1S72 A;  5C0X G;  1EYG A;  1HQM C;  3ONA B;  1I5F A;  4LUO A;  3N6R A;  3T1H Q;  5FLM H;  5C3E G;  2PMZ B;  1IBL Q;  4L5T A;  2VNU D;  4IUV A;  4DV6 L;  4JBJ A;  3E9H A;  4CKE A;  4RAU C;  4C3I H;  4B3M Q;  1QNK A;  2EVB A;  4DXG A;  4DV3 L;  3J81 L;  3MXN A;  1U0L A;  3L3O C;  3OTO Q;  4BBR B;  1NR2 A;  4P72 A;  2PW5 A;  4NB3 A;  1B4O A;  1BBW A;  3EN2 A;  3X3N A;  3Q23 A;  2L5T A;  4DNR B;  2KHJ A;  1PH3 A;  4DAP A;  2WAC A;  5M5W H;  2R93 H;  4A3B B;  1SYE A;  4A3I B;  2IW3 A;  4C2M B;  5IP7 G;  4LF5 Q;  1VQ8 A;  4DV1 Q;  4K14 A;  1SE3 A;  3CRL C;  3J7Z C;  1HUN A;  4Z9C B;  2VQE Q;  4J8Q A;  3M4O H;  2KJX A;  4IAL A;  4U68 A;  1GXD C;  2E2H B;  2VS1 A;  4L5R C;  2JEA I;  2F0O A;  4IUT A;  3OIP A;  4GKJ L;  1M4V A;  1SMX A;  1QUQ A;  4R9W A;  4IJL A;  4YCW A;  4BBS B;  1I6V C;  1UE1 A;  2XSC A;  5KND A;  1VQE A;  4CJ2 C;  3HOV B;  5M9O A;  2Y0S G;  3OWF A;  3I73 A;  3QOL A;  3S15 H;  1FVI A;  1R4Q B;  1XMQ Q;  3AFP A;  3ND9 A;  2UUA L;  4JC0 A;  4RKL A;  2RSN A;  1UWV A;  1TWG B;  5EKL A;  4IPG A;  5E4W C;  1EOT A;  3S2D H;  4A3G H;  2UXD L;  4DV2 L;  5IY0 A;  1LTT D;  2EY5 A;  5GAD C;  5IP9 G;  3VYR A;  4KKU A;  1P16 A;  4LFC L;  4A3E H;  3DUZ A;  3FHW A;  2PI2 E;  1STG A;  2A8V A;  4IJH A;  4XT1 B;  3MAQ A;  1IBM Q;  5C44 B;  4Q0F A;  3FVQ A;  1H9J A;  4DAY A;  4ZYS A;  4FF1 A;  1X65 A;  4FF4 A;  3G7L A;  2HIV A;  1R4P B;  1SE8 A;  4DR5 L;  2JK8 A;  1JOK A;  2EYF A;  1WTW A;  3A7A B;  4F7X A;  4ZKC B;  2I5M X;  4ILW A;  5E4X A;  1D1K A;  2F4I A;  2ZXP A;  1X3Q A;  4TSS A;  3H3V I;  2BCO A;  2ZXR A;  3HGB A;  1NTG A;  4L8J A;  1NBW A;  3C3L A;  1TY0 A;  1OXV A;  1V43 A;  4RFB A;  3PO2 H;  1CSQ A;  4BY1 H;  4DF7 A;  1PVO A;  1HFG A;  1V1P A;  1X3E A;  4OWT B;  3RLO A;  1VMC A;  3A8K E;  4NP5 A;  1IKL A;  2N88 A;  3KF8 A;  1QVG A;  1PTO H;  3UE0 A;  1X32 A;  2PI2 A;  3EBE A;  5D65 A;  2K5W A;  4F8M A;  4L5Q A;  4A93 H;  5FO7 B;  1Y1V H;  3CQZ H;  1EIH A;  1OO9 B;  2QW7 A;  3S17 B;  1DJR D;  1F9R A;  4R4T A;  5HUR A;  4DR7 L;  5LMU Q;  5C4H A;  5M3F H;  2OQK A;  4XXE A;  1ONL A;  4JI8 Q;  2Z8L A;  4KN4 C;  1BF4 A;  1LLR D;  3Q24 A;  3ULL A;  1N32 Q;  1H9S B;  2CWA A;  3V96 A;  3DHQ A;  1EL0 A;  3K0Y A;  4KTA A;  5L37 A;  3GV3 A;  4BXX H;  4UHV A;  3RN5 A;  2O5I C;  1WD0 A;  2HUG A;  2ES2 A;  2MJ8 A;  4OL7 A;  4X65 Q;  3I4N H;  4WJ3 M;  4O0A A;  3NWS A;  3P1H A;  5HY6 A;  3CC4 A;  3D4R A;  3CKI B;  5C4X B;  1G6Z A;  3DMU A;  2BH2 A;  1B44 D;  1PTO F;  4UPA A;  3DLL A;  5M5Y B;  1K8O A;  1PH1 A;  3M4Q A;  4JI3 L;  3PUW A;  1VQ6 A;  4KK7 A;  2A6E D;  4H0L C;  4YCV A;  2B2V A;  2Z6B A;  2UXB L;  3S2H B;  4R4O A;  2CW0 D;  2K5D A;  2NVY B;  3I70 A;  2B2U C;  3J81 i;  4B3R L;  3CPW A;  5I6W A;  3HOY B;  4BBR H;  4Y7N H;  3NEM A;  5IT9 L;  4QB4 A;  5EKI A;  1Y8N B;  3GTL B;  2UUB Q;  4F88 A;  1TWF B;  1N34 Q;  4KI0 A;  3S1R B;  2CHB D;  3GTJ H;  4A3B H;  5DEH A;  5C4J B;  1J5E L;  1ZYR C;  3MWY W;  4UY8 C;  4S3S A;  3TQY A;  2EJG C;  3NBH A;  3DXJ C;  3TP6 A;  3TDQ A;  1B50 A;  1U4M A;  3I4M G;  3IFD A;  3F2C A;  5GAG C;  2H4O A;  3K58 A;  1D5M C;  4X66 L;  3CCE A;  1LTL A;  1C48 A;  2DY8 A;  2E2H H;  1YIJ A;  1B70 B;  1XNR L;  4MIU A;  5M3M G;  5HGT A;  4OWW B;  2R92 G;  2L12 A;  3K0X A;  3VR3 A;  4BBS H;  1JJ2 A;  4CDF C;  1O7L A;  4KLK A;  1F2L A;  4QIW B;  1KLU D;  1YHB A;  2ICE C;  5IWA Q;  3LWU A;  2MO1 A;  1BCP F;  1LT5 D;  1TU2 B;  3EQL C;  1TWG H;  1HNX Q;  2SNS A;  1EQT A;  3DWA A;  2JA7 B;  1SE4 A;  1PFS A;  1Q86 C;  1JC7 A;  4A3F B;  2GVB A;  2K52 A;  2QGQ A;  2MHV A; 
#chains in the Genus database with same CATH homology
 1X56 A;  2JA6 H;  3TRZ A;  1ASZ A;  1VQN A;  4BBS G;  3CME A;  3HOY G;  1I50 H;  3KYH C;  3NEN A;  3HOV G;  3PUV A;  4LF7 Q;  4JI5 Q;  2K4K A;  4PMW A;  1IBK Q;  1CKM A;  3S1N H;  3HKZ G;  4HJ9 A;  4IPC A;  2ZJQ A;  1K8A C;  2JE6 I;  5FJ8 H;  5AJ3 L;  1SR3 A;  3CMA A;  2E2J H;  3CCL A;  3JAM i;  4DR2 L;  5C44 H;  2R7Z H;  1Q46 A;  1UE5 A;  2GN5 A;  1G29 1;  1NMF A;  2UUC Q;  4JCV E;  1XMO L;  4HIK A;  3F2B A;  4AQY Q;  1Q7Y C;  4L5S A;  4AH6 A;  3GTG H;  3IRB A;  3TEH B;  4OX9 L;  4WJ4 A;  2MNA A;  3RZD H;  1HZA A;  3FP9 A;  4YHH L;  2F3I A;  1X6O A;  3T1Y L;  1PV4 A;  1KD1 C;  4LF6 L;  2AKW B;  2VUM G;  1JT8 A;  2R7F A;  4DKA C;  2CWP A;  3DM3 A;  3HOX G;  2UXC L;  3WWV A;  4DNI A;  4DR7 Q;  2HIX A;  1IZ6 A;  2Z6K C;  4X62 Q;  1X55 A;  2B29 A;  4X6A H;  4A76 A;  2K50 A;  2MQH A;  1YHA A;  3CCJ A;  1AE3 A;  2QA4 A;  4HJ5 A;  4JYA L;  1XNQ Q;  3A5U A;  4QGU A;  1Q1E A;  2PQA A;  1B7Y B;  3ULJ A;  2KCT A;  4JI0 Q;  5ELO A;  4K0K L;  1WI5 A;  2AWN A;  3G4S A;  3CCU A;  2E5L L;  1BBU A;  2OCE A;  1CSP A;  1NMG A;  4LWC A;  1OTC A;  1HR0 Q;  2WFW A;  4HID A;  3EIV A;  1YBY A;  2FXQ A;  1WOC A;  2NN6 G;  3MEF A;  4BA1 I;  4A3K H;  1PH7 A;  1VQB A;  4KHP Q;  1VQD A;  3CC7 A;  2E2I H;  4DK3 C;  1EQQ A;  3PCO B;  2BA1 A;  2YTY A;  1K8G A;  2NZH A;  3GTQ H;  2R6G A;  1VQ5 A;  2YTX A;  4B3S L;  4IFD I;  2V1C C;  1Q1B A;  3T1H L;  1A62 A;  1V9P A;  1MJC A;  2PNH A;  1IBL L;  2RF4 A;  2I5L X;  5LMN W;  1M1K C;  1VQP A;  5C0X J;  1Z47 A;  3S17 H;  4IPH A;  4XTC S;  3G71 A;  1C7Y A;  1U5K A;  1C0A A;  4H02 A;  1EOV A;  2JJQ A;  4POG A;  1XPU A;  3JC6 6;  3GTP H;  1EUJ A;  1PH2 A;  4JI3 Q;  1YVC A;  3PO3 H;  3CAM A;  4EX5 A;  4OO1 I;  1AE2 A;  2UXB Q;  4JI1 Q;  1YHQ A;  1S3O A;  3U4V A;  1JE5 A;  1XTD A;  4A3K G;  4NXN Q;  3ZJY C;  3I4M H;  2ZJP A;  2DGY A;  3PSI A;  4LF4 L;  3OTO L;  4GOP B;  4A3J H;  1VQI A;  1WYD A;  1VQL A;  4B3R Q;  5FLX c;  3GTO H;  5FLM G;  4QY7 A;  1H95 A;  4LFA L;  2KCM A;  3NEL A;  3K7A H;  2MFI A;  1EWI A;  4JI4 Q;  5M3M H;  3CCS A;  4JOI C;  5JEA G;  2R92 H;  4JV5 L;  2OTL A;  4B3T Q;  4C3J H;  4LF5 L;  4YWK A;  1J5E Q;  3HOU H;  3MXN B;  1PA6 A;  4DV1 L;  4A3I H;  1N33 L;  1WCM H;  2KBN A;  2UU9 Q;  4C2M H;  3W5O A;  3H0G H;  2VQE L;  1I3Q H;  1EIF A;  3ERS X;  5JJK A;  4LF8 L;  2Z6K A;  2WP8 J;  2LSS A;  1KIX A;  1QZH A;  5C4X H;  1Y1W H;  3PV0 A;  1CUK A;  4X66 Q;  3L2P A;  2UXD Q;  3KDF A;  1E1O A;  3I56 A;  1TWH H;  3RNU A;  2MO0 A;  5M5Y H;  2BH8 A;  1XPR A;  3UDF A;  4JI6 L;  1XNR Q;  2R93 G;  1NY4 A;  3U50 C;  4ME3 A;  4DR4 L;  1K83 H;  3S2H H;  4OON A;  1EQR A;  4LF9 Q;  4DV7 Q;  1E7Z A;  3SGI A;  3J81 j;  4HIM A;  1YEZ A;  2K5V A;  1KRS A;  3I7F A;  3STB D;  1CKO A;  1FJG Q;  1EIY B;  2VL6 A;  3HOV H;  4AIM A;  4IOC A;  1XMQ L;  2JA5 H;  5LMN L;  3GTL H;  5JJL A;  1K73 C;  1PHJ A;  1I94 L;  1TWF H;  1KHI A;  1QUQ B;  3S1R H;  4DAM A;  1K3R A;  5C4J H;  1UE7 A;  2PMZ E;  3KFU A;  4Y52 H;  1DGS A;  1QVC A;  4X64 L;  4DR1 L;  4OWX B;  2XGT A;  1SFO H;  2HHH L;  2B63 G;  4POF A;  1UE6 A;  4GOP C;  3RR5 A;  3ER0 A;  1Q81 C;  1N36 L;  1HNZ L;  1X3G A;  3PF5 A;  4YWM A;  1K0R A;  1OXT A;  1VQF A;  2IHF A;  1PH6 A;  2VUM H;  3AYH B;  3KJP A;  4DUZ L;  1VQO A;  1TXY A;  4P71 A;  3HOX H;  2JA5 G;  1BVS A;  3KJO A;  3KOJ A;  1IL2 A;  2OTJ A;  3J80 i;  1TWC H;  1IBM L;  5AJ3 Q;  3HOW H;  2B3G A;  3ULP A;  4RMF A;  5IYD G;  2JA9 A;  4DR2 Q;  4JOI A;  4A3L H;  4JI7 L;  4DUY L;  5BR8 L;  2H5X A;  2K5H A;  1RIP A;  1XMO Q;  1E22 A;  3PUY A;  3HOY H;  1HR0 W;  1RL2 A;  3K81 C;  3G6E A;  3K80 C;  4A3E G;  1VQ9 A;  4OX9 Q;  3PF4 A;  2WB1 E;  1OXX K;  1VCI A;  1VQA A;  4J15 A;  4APV A;  1SRO A;  1VS0 A;  4YHH Q;  3T1Y Q;  3KLW A;  1HZ9 A;  2CCZ A;  4LF6 Q;  1VQM A;  2JA7 H;  3H3V H;  2NN6 I;  4A3D G;  1AH9 A;  2UXC Q;  4UP9 A;  2E8G A;  1HZC A;  1O7I A;  4DAY B;  2A1A A;  2GVA A;  4JI2 L;  1L1O B;  4IPD A;  4DR3 L;  1YJN A;  5ELN A;  1L0W A;  1PH8 A;  2Q2T A;  2LXK A;  3CC2 A;  3HOW G;  1W2B A;  2C35 B;  3GD7 A;  2AWO A;  3I4O A;  1X9N A;  1VQH A;  2DUD A;  1MJE A;  4JYA Q;  4GN3 B;  5J3B A;  1Q82 C;  4A3L G;  4GLV B;  1GO3 E;  2ZTC A;  3CF5 A;  1X3F A;  1K9M C;  5GAE C;  4K0K Q;  2OWO A;  2RCN A;  2BA0 A;  3CCV A;  4R1J A;  3UDG A;  1L2F A;  5IE8 A;  4A4I A;  2E5L Q;  1YJ9 A;  1SRU A;  1PYB A;  1S72 A;  2JA7 G;  1KXL A;  5C0X G;  1I6H H;  1B8A A;  4A3F G;  1KAW A;  3K8A A;  1EYG A;  5IYB G;  4PG3 A;  4B3S Q;  1I5F A;  4LUO A;  3T1H Q;  3UDI A;  5FLM H;  3PO2 G;  4ALP A;  5C3E G;  2L15 A;  4BY1 G;  1IBL Q;  4L5T A;  3HOZ G;  3J81 c;  2VNU D;  3CPF A;  4PZ8 A;  4GOP A;  4BY7 H;  4DV6 L;  5LMU L;  3GDE A;  4JBJ A;  4EQ5 A;  3PIP A;  4YY3 L;  1PH9 A;  3KF8 B;  4QJF A;  4JI8 L;  3F8T A;  3E9H A;  1JMC A;  3CCQ A;  1GM5 A;  3KF6 B;  1JJG A;  1HNW L;  2F52 A;  3PUX A;  4C3I H;  4MNO A;  4B3M Q;  1N32 L;  1E24 A;  4DV3 L;  4R4I A;  1U0L A;  4LF4 Q;  1GD7 A;  1QVF A;  4A93 G;  3OTO Q;  3RZO H;  4P72 A;  1Y1V G;  4NB3 A;  1WJJ A;  1BBW A;  3EN2 A;  4LFA Q;  2N49 A;  2KHJ A;  4IO9 A;  1CKN A;  2EIF A;  1PH3 A;  1A63 A;  5M5W H;  2R93 H;  5M3F G;  3E0E A;  3M3Y H;  4JV5 Q;  4X65 L;  5IP7 G;  1L1O C;  4BY7 G;  3M85 A;  4LF5 Q;  3CCM A;  1VQ8 A;  1N33 Q;  4DV0 L;  4DV1 Q;  4MZ9 A;  4LFB L;  1SLJ A;  3J7Z C;  1GVP A;  2VQE Q;  2Q2U A;  4OXP A;  2EQS A;  2ZTD A;  1LUZ A;  4TQU S;  4GLA C;  1PH5 A;  4LF8 Q;  3M4O H;  2ZM6 L;  3G48 A;  4R4C A;  5IYC G;  1CKN B;  1Y14 B;  1XJV A;  2VS1 A;  1PH4 A;  3PGZ A;  4L5R C;  2JEA I;  4BXX G;  2VY3 A;  4LUV A;  4R4Q A;  4JI6 Q;  4GKJ L;  1SMX A;  1QUQ A;  4YCW A;  4IJL A;  5GAH C;  1FL0 A;  4DR4 Q;  5M5X H;  1UE1 A;  1VQE A;  2D0P A;  1KC8 C;  1WFQ A;  3I4N G;  3Q8D A;  5EAY A;  1P8L A;  2B63 H;  2XTI A;  2Y0S G;  3UE1 A;  2NVY H;  1D8L A;  1NE3 A;  3S15 H;  1FVI A;  3ICE A;  2UUB L;  3M7N A;  1XMQ Q;  5LMN Q;  4QL5 A;  3AFP A;  1N34 L;  2UUA L;  4NXM L;  1I94 Q;  4JC0 A;  2NZO A;  1UWV A;  3TS2 A;  4IFD J;  4IPG A;  2KEN A;  2Z0S A;  3S2D H;  2ATW A;  3F1Z A;  3RN2 A;  4DV5 L;  2Y0S E;  5IYD H;  3S1Q H;  1A8V A;  2YTV A;  2VQF L;  1A0I A;  1Z9F A;  3OYY A;  4A3G H;  2UXD L;  4DV2 L;  1HZB A;  2K75 A;  4X64 Q;  3M4P A;  3JAM c;  4DR1 Q;  5IY0 A;  1YJW A;  2AHO B;  2HHH Q;  1GKH A;  5GAD C;  3D31 A;  4BBR G;  4DPG A;  5IP9 G;  1N36 Q;  2IHE A;  1P16 A;  1HNZ Q;  4LFC L;  4A3E H;  3W1B A;  3FHW A;  2PI2 E;  2F4V L;  3NBH B;  4DUZ Q;  4DR6 L;  5K36 G;  2JQO A;  2A8V A;  4A3D H;  4LW1 A;  4IJH A;  2CKZ B;  1IBM Q;  3CW2 C;  4JBM A;  4KHZ A;  4HJ8 A;  3S16 H;  4GNX B;  3TRE A;  3I55 A;  2WB1 G;  3A74 A;  3GO5 A;  3PUZ A;  5IWA L;  4GKK L;  4JI7 Q;  4DUY Q;  1L1O A;  1E1T A;  2WAQ E;  5BR8 Q;  1X65 A;  1SN8 A;  2HIV A;  4DV4 L;  1SE8 A;  4A3G G;  4DR5 L;  2JK8 A;  4O2D A;  4PZ7 A;  3RLN A;  1HNX L;  3OW2 A;  2HT1 A;  1OXU A;  4NPS A;  4AYB E;  2I5M X;  1Q8K A;  3H3V I;  1KQS A;  5C0X I;  1X54 A;  4JI2 Q;  2A19 A;  4DR3 Q;  4A3F H;  1G6P A;  1NTG A;  4YWL A;  3TS0 A;  1NBW A;  2N3S A;  2ASB A;  4A3C G;  5IYB H;  1R9T H;  1OXV A;  2I0Q A;  4TVA B;  4LF7 L;  1V43 A;  4JI5 L;  4P75 A;  4MTN A;  3PO2 H;  1CSQ A;  4GLX A;  1IBK L;  5C3E H;  3M9B A;  4BY1 H;  3HOZ H;  3AFQ A;  2JA8 G;  3H15 A;  2NVX H;  1JB7 A;  3CD6 A;  1OXS C;  3U58 A;  3BZC A;  1PVO A;  1KRT A;  4HIO A;  1X3E A;  3J7A 5;  4OWT B;  2Q2H A;  3RLO A;  3VDY A;  4P74 A;  3HKZ E;  1YZ6 A;  2UUC L;  1QVG A;  3CCR A;  3A5Z B;  2JA6 G;  4AQY L;  2YU9 H;  3UE0 A;  2PI2 A;  3EBE A;  3CXC A;  1VQJ A;  4L5Q A;  2OQ0 A;  3KF6 A;  4A93 H;  1T9H A;  1Y1V H;  3BU2 A;  3CQZ H;  1Q12 A;  1LYL A;  1MIU A;  2YYZ A;  3S1M H;  2Q2I A;  2I5H A;  4R4T A;  2QEX A;  1TWA H;  5LMU Q;  2CFM A;  5FJ8 G;  4DV6 Q;  5M3F H;  4A75 A;  4DR7 L;  4X62 L;  4YY3 Q;  1VQK A;  2OQK A;  2LXJ A;  5GRO A;  5IP7 H;  4JI8 Q;  3B6Y A;  2D0O A;  5C44 G;  2R7Z G;  4FDB A;  4GNX C;  2IX1 A;  2ALY B;  1HNW Q;  1HJP A;  1XNQ L;  3ULL A;  1N32 Q;  4DV3 Q;  4JI0 L;  4QQB X;  2CWA A;  3GTK H;  3STB C;  3L0O A;  2ID0 A;  3FKI H;  2VZA A;  3A0J A;  2D62 A;  1VQG A;  1ASY A;  5IYC H;  3L7Z C;  4QIW E;  2ZTE A;  4RG1 A;  5H1S E;  1HR0 L;  4BXX H;  3RN5 A;  1YNX A;  4JG2 A;  2ES2 A;  2JEB I;  1E3P A;  4KHP L;  1JJC B;  1VQ4 A;  4X65 Q;  2HQL A;  2N8N A;  2PQA B;  2NVT H;  3S24 A;  1C9O A;  3K7U C;  4PZ6 A;  3HKS A;  1NJI C;  3I4N H;  4LFB Q;  3E9I A;  4O0A A;  5HY6 A;  4DV0 Q;  4WJ3 M;  3CC4 A;  1D7Q A;  5GQO A;  2NVQ H;  4P73 A;  3CP0 A;  3S14 H;  4IOA A;  1VQC A;  3F2D A;  2R7D A;  2BH2 A;  2ZM6 Q;  5JJI A;  4UPA A;  3DLL A;  3AQQ A;  2N78 A;  5IT9 c;  3UDX A;  3LGJ A;  1PH1 A;  2YV5 A;  3FKI G;  3M4Q A;  3PUW A;  4JI3 L;  4B3M L;  1VQ6 A;  1N8R C;  4YCV A;  1HH2 P;  3HFZ B;  5DLQ E;  4JI1 L;  4LUZ A;  4GKJ Q;  2UXB L;  1LM0 A;  4R4O A;  1J6Q A;  4NXN L;  3GTM H;  3BJU A;  1VQ7 A;  3J81 i;  1YI2 A;  4B3R L;  3CPW A;  4IFD G;  3D0F A;  2IY5 B;  4BBR H;  3U4Z A;  5IP9 H;  4Y7N H;  3NEM A;  4YCU A;  2UUB Q;  4JI4 L;  1EFW A;  2RHS B;  1FGU A;  1N34 Q;  4A3M H;  4KI0 A;  2UUA Q;  4NXM Q;  1UEB A;  3GTJ H;  4A3B H;  4B3T L;  1N9W A;  1J5E L;  4BA2 I;  2EXD A;  3PO3 G;  4UY8 C;  4XIG S;  4OO1 G;  2KHI A;  3TQY A;  2UU9 L;  3AEV A;  5HGQ A;  4DV5 Q;  1YIT A;  1S40 A;  1W3S A;  3J80 c;  2VQF Q;  4DK6 C;  4HJ7 A;  1M90 C;  3I4M G;  5JEA J;  2AMC B;  3F2C A;  2IT1 A;  5GAG C;  4DV2 Q;  1IXR A;  4A3J G;  2ZJR A;  4X66 L;  4GNX A;  3CCE A;  1LTL A;  2IX0 A;  5E7N A;  4LFC Q;  2E2H H;  1YIJ A;  1B70 B;  1XNR L;  2F4V Q;  1IYJ B;  1V1Q A;  5M3M G;  4OWW B;  4DR6 Q;  3RLF A;  2R92 G;  3K0X A;  2WAQ G;  3W1G A;  4GS3 A;  4A3M G;  4DV7 L;  4LF9 L;  3HOU G;  4C3H H;  4BBS H;  1JJ2 A;  4A3B G;  3BZK A;  4GN5 A;  4A3I G;  1WCM G;  3H0G G;  1G51 A;  4AYB G;  1FJG L;  4A3C H;  3KDF B;  4KLK A;  1YHB A;  1MKH A;  5IWA Q;  4GKK Q;  1PYS B;  2MO1 A;  4HJA A;  1XPO A;  2K5N A;  1Y1W G;  4DV4 Q;  5C4X G;  3I2Z A;  2JA8 H;  4DR5 Q;  2CQO A;  1TWG H;  4JBW A;  4GN4 B;  3PIO A;  1QZG A;  1HNX Q;  2RHQ B;  1BKB A;  4LNQ A;  4UP7 A;  1PFS A;  2K14 A;  1KL9 A;  1Q86 C;  2VW9 A;  2GVB A;  4UP8 A;  2K52 A;  4JBK A;  2QGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...