1V1QA

Crystal structure of prib- a primosomal dna replication protein of escherichia coli
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
110
structure length
110
Chain Sequence
PNSLMTNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDSVDKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRIMOSOMAL REPLICATION PROTEIN N
publication title Crystal Structure of Prib- a Primosomal DNA Replication Protein of Escherichia Coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding
total genus 15
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1v1qA00
4A3LH 4JI1Q 1PFSA 1OXSC 2Q2HA 4DV3Q 2PMZE 1SFOH 3J80i 1PH9A 3HOYG 1M90C 1L0WA 1YITA 1S3OA 4R4CA 2KCMA 1VQ4A 1N8RC 4A3DH 1PH2A 3KYHC 4QL5A 3CCVA 1XPRA 1KXLA 2OCEA 4JI6Q 4X64L 4UP7A 2R7ZG 4IOAA 4LF5Q 2R93G 1A63A 4X65Q 3I4MH 1PH6A 3S24A 3GTGH 1UEBA 4HIMA 2AHOB 3AYHB 1EQQA 1VQ5A 2R92G 3A0JA 3M7NA 3PUXA 4JG2A 3CCEA 5JJIA 4IPDA 1L1OB 3PCOB 4OX9Q 1PH8A 3NBHB 1PH4A 3U4VA 3ER0A 1TWAH 5IY0A 2QEXA 1UE1A 1CSPA 1CKOA 3L2PA 5LMUQ 3CPWA 2NVQH 3H3VI 2VUMH 2F4VL 3BZKA 1VQ8A 1KRTA 5M3FH 4LWCA 2D62A 4RG1A 4DV0Q 3PUWA 3T1YQ 1C0AA 1WCMG 2HQLA 2E5LQ 3H15A 3NENA 2JA5G 3HOWH 3J81j 3STBD 1YJNA 3JAMc 4DV6Q 3Q8DA 3HOXG 1VQCA 3F2DA 2NZHA 3PIOA 3OTOQ 1YHQA 1W2BA 2OTLA 4A3GG 1PYBA 2Z0SA 5GAHC 1CKMA 3HOVH 3JAMi 3I55A 1TWFH 4GOPB 3E9IA 1N36Q 2IX1A 4JYAL 3RZDH 3TREA 5LMNQ 1I50H 1X9NA 1VQIA 3HKSA 4DR1Q 1QVGA 2ZTCA 5IP7G 3BJUA 3KF6B 3F1ZA 1MJCA 4A3JG 5JJLA 1HZCA 2UXDQ 3HOUG 1H95A 1PH7A 2KENA 2ALYB 3KDFB 5C3EG 1DGSA 3CCRA 4DUYQ 5M5XH 2PNHA 4JI3Q 3PO3H 4DPGA 4L5RC 1WYDA 1NMFA 4DNIA 4GNXA 1IBLL 5IYDG 1Y1WG 3S2DH 1HNWQ 4GN3B 4YCWA 5JJKA 1HZAA 1YHBA 3K7UC 2OQ0A 4DR3L 1E1TA 4JI5L 1PH1A 2WAQG 3S17H 4A3KG 3FKIH 4BXXH 4LNQA 3OYYA 4JI4Q 5IYCH 3PO2H 3GTMH 1OXXK 5AJ3Q 1R9TH 4X66L 1X3EA 4JI2Q 2OTJA 1KHIA 4LF8L 1G51A 4UY8C 5LMNW 1VQ6A 5C4XH 3K0XA 1EQRA 4QJFA 1HZ9A 2MFIA 1JJGA 1IBKQ 4IFDG 3EN2A 4GLAC 4YHHQ 2NVYH 1YJWA 2B29A 4A3IG 3A5UA 2KHIA 4LFBL 4DV2L 4IPHA 3ERSX 2PI2E 1HNXQ 4GNXC 4GN5A 4LF4Q 4L5QA 1YVCA 4AQYL 3CPFA 4LFAQ 2JE6I 2WFWA 2ZTDA 1D8LA 2KHJA 1E1OA 2CQOA 1S40A 1VQMA 2HT1A 2BA1A 1TWGH 3ULPA 1KC8C 1WI5A 4X62Q 1K83H 2RCNA 3MEFA 3CD6A 2CWPA 3RN5A 4LUOA 3TRZA 4JV5Q 4HJAA 4YCUA 1VCIA 4WJ3M 3L0OA 5C44G 5FLMH 4A3MG 3ICEA 2HIVA 4NXNQ 1HNZL 3H0GH 5C4JH 1VQPA 5E7NA 1UE5A 4BBRH 2CCZA 4P75A 2JA9A 2UUCL 2UUAL 4LFCQ 1Y14B 1HH2P 3F2CA 4HIDA 3DLLA 2YYZA 4HJ9A 4IOCA 3PGZA 3RNUA 1XNQL 3S16H 1PHJA 3H3VH 3UDXA 5GADC 2UUBL 4BY7G 4LF7L 2NZOA 4MNOA 3UE0A 2LXJA 4DV5L 4NXMQ 4BA1I 1Y1VH 5ELOA 1FJGQ 1A8VA 2VQEL 2CFMA 3G48A 3A5ZB 3CXCA 1XNRL 1FGUA 1Q86C 4KHZA 1EYGA 3CC4A 4DV1Q 1IYJB 4DUZL 1IXRA 4HIOA 3J80c 1YBYA 1WFQA 4JI8L 4DK3C 1JB7A 2JA8H 3ULJA 1K73C 2HHHQ 1D7QA 4IFDJ 4GKJL 3B6YA 1AH9A 1JMCA 4IPCA 1P16A 1KD1C 2JA7H 4XTCS 4DV4Q 3HOZG 1QVCA 3RN2A 1N32Q 1VQOA 2K14A 1X65A 2YTXA 5ELNA 1N33L 1Z47A 3LGJA 2K5NA 3K81C 1PVOA 3FHWA 2DUDA 2Q2UA 1S72A 2CWAA 3CC7A 2R7ZH 1XMOL 1HR0W 3GTPH 4C2MH 5M3MH 4DR7L 3PUVA 5BR8L 2XTIA 2ZM6L 5IYBG 4IO9A 4B3SL 5FJ8H 4YY3Q 4KHPL 2JJQA 2JK8A 4QQBX 1X3FA 3J7A5 3GTKH 1XMQL 4AYBE 4GNXB 3PUZA 2F4VQ 4OO1G 4JI1L 3CF5A 4AH6A 1C9OA 2VY3A 1YHAA 3AFPA 2E2HH 4R4TA 4IPGA 2EIFA 4A3LG 4JOIC 3G71A 4JI7Q 1VQAA 2K4KA 4DV7Q 1Q1BA 4GS3A 2ES2A 4GLVB 4LF6L 1Z9FA 1J6QA 4O0AA 5IWAQ 1JJCB 3W1BA 5IT9c 3I2ZA 1UE7A 4A3DG 3I4OA 4AYBG 2IY5B 1YI2A 2JQOA 5FLXc 2I5HA 1SLJA 1BKBA 4WJ4A 4YWLA 3EIVA 2N78A 3HKZE 2UU9L 1XPUA 1ASYA 3I4MG 4PZ7A 4NB3A 4OX9L 2YU9H 1E7ZA 4ALPA 3CCLA 3MXNB 2UXBL 3T1HQ 2QGQA 1PYSB 3GO5A 4J15A 3ULLA 4A3EH 1K8GA 2B63H 4BBSH 2KBNA 2RHSB 3PIPA 4BY1H 1N34Q 1KAWA 5C0XJ 5GAGC 4DV0L 2K50A 1OXTA 3T1YL 2Z6KA 2VUMG 3HKZG 2PQAA 2E5LL 1SRUA 5M3FG 4A3BH 4OO1I 2UXCQ 1Q82C 1V9PA 4DR5Q 3WWVA 1VQJA 2JA6H 2A19A 3HOWG 1TXYA 4QGUA 3J81i 3J7ZC 2K5HA 2QA4A 2EXDA 1NY4A 3OTOL 4K0KQ 4PG3A 3BZCA 1FVIA 1PH5A 4JI0L 4JBWA 4KI0A 3A74A 1N36L 3HOVG 5DLQE 4X66Q 2VQFQ 5LMNL 4B3RL 3F8TA 3CC2A 1N9WA 4RMFA 4JBMA 2I5MX 5K36G 1JE5A 4HJ8A 1EWIA 4APVA 3I4NH 1J5EL 2UXDL 1M1KC 1B70B 3KF8B 1X55A 1NMGA 4A93H 4LUVA 3TS0A 3IRBA 4DUYL 3GTLH 1BBUA 2Z6KC 2BH2A 1SE8A 1VQDA 4O2DA 4DR4Q 1Q8KA 4JI3L 4OWTB 2E2JH 2K75A 2LSSA 1HNWL 3UDIA 4B3ML 3M4OH 4AIMA 3PO3G 1EIYB 1KL9A 2ID0A 4IJHA 2OWOA 2VS1A 1XJVA 1U5KA 4DR2Q 4OWXB 1FL0A 4MTNA 4A3FH 2V1CC 3CP0A 3M4QA 1GKHA 1SN8A 4H02A 4JI4L 5IP9H 2PI2A 4POGA 4BXXG 1VS0A 3FKIG 3PF4A 5M5YH 4LF9Q 1HZBA 4P73A 3PF5A 5IYCG 1CSQA 2N8NA 3OW2A 3GDEA 4KLKA 3PO2G 5GROA 2UUAQ 4UP8A 2YV5A 1IBMQ 1L1OC 5M5WH 1IBKL 2VW9A 2L15A 1PV4A 4DR6Q 5C4XG 1VQLA 4P71A 1A0IA 1I94L 4GN4B 4LF7Q 4YCVA 3AEVA 4A3CH 2DGYA 1HNXL 4LF4L 1VQFA 2I5LX 4A75A 4IFDI 1VQKA 4L5SA 1CKNA 2H5XA 1MJEA 4R4IA 4R4QA 1LYLA 1GD7A 4B3TQ 4GKKL 4JI8Q 4JV5L 2WB1E 2ATWA 1TWHH 1I5FA 4HJ7A 1JJ2A 3HOYH 1WJJA 4NXNL 2NN6G 2A1AA 1UWVA 1VQBA 2GVAA 3DM3A 4GLXA 2NVTH 4GOPC 2VNUD 4JOIA 5FLMG 3H0GG 4LFCL 3NELA 3KJPA 5C0XG 2F52A 1NE3A 4BBRG 3RR5A 1PH3A 1IZ6A 1RIPA 2R93H 1E24A 1HR0L 4X64Q 1LTLA 2WB1G 1NJIC 2R92H 3M3YH 1K0RA 1AE3A 1QUQA 4L5TA 4ME3A 5IE8A 2AMCB 3PSIA 1VQEA 4XIGS 4EQ5A 2ZM6Q 1FJGL 2XGTA 4B3SQ 1WOCA 1XTDA 4UPAA 1Y1VG 3UDFA 2PQAB 3U4ZA 3S1RH 3S15H 1G291 4DV1L 3GTOH 4JI6L 4TVAB 1SMXA 4JCVE 2YTYA 1WCMH 4LUZA 3CQZH 1B8AA 1YEZA 2HHHL 2JA5H 4A3CG 1Q1EA 4DV4L 2JA8G 4DV3L 1O7IA 3NEMA 1N32L 3HOXH 5JEAJ 1L2FA 4LF6Q 3CMEA 2E2IH 2JA7G 2JEBI 2OQKA 4A3GH 1A62A 1CUKA 2NN6I 3G6EA 1X56A 4IJLA 2K52A 2AWNA 3E0EA 1MKHA 3JC66 3GTQH 4LF5L 1VQ7A 4X65L 2UU9Q 2ASBA 1Q46A 5C0XI 4OONA 5IP7H 1X3GA 4JYAQ 1BVSA 4YWKA 3RLFA 2GVBA 4YY3L 5M3MG 4A3JH 3HOUH 2UXBQ 1SR3A 1QZHA 2Y0SE 2N49A 2HIXA 5C3EH 2RHQB 3K8AA 5FJ8G 1AE2A 5LMUL 4HJ5A 5HY6A 2IHFA 4MZ9A 1T9HA 2R7DA 4HIKA 4JI7L 5IYDH 4DK6C 1Y1WH 4C3IH 1MIUA 3J81c 4DV7L 3D31A 3KLWA 1IBLQ 4DAMA 5HGQA 4BA2I 1ASZA 1RL2A 5IWAL 4A3KH 2Y0SG 4DV6L 4DR3Q 4JI5Q 1GO3E 3W1GA 4JI0Q 2MQHA 3VDYA 3CCUA 2D0PA 2IHEA 1VQHA 3CCJA 3CW2C 2NVXH 1E22A 3W5OA 4Y7NH 3STBC 1C7YA 4B3RQ 2R7FA 1UE6A 1EFWA 4JC0A 2C35B 3FP9A 3I56A 1J5EQ 2ZJQA 4LF8Q 4DR1L 3T1HL 2E8GA 2WAQE 1TWCH 4YWMA 4A3IH 1GVPA 3M9BA 3TS2A 2IX0A 1N34L 3CMAA 1L1OA 2MO1A 4A3EG 3GD7A 1CKNB 2B63G 4BBSG 4LFBQ 4BY1G 4DV2Q 1G6PA 4PMWA 2B3GA 4QY7A 4B3MQ 4A4IA 1VQNA 2UXCL 4FDBA 1EIFA 2AWOA 1OXUA 4DR5L 1YIJA 2VZAA 4A3BG 1BBWA 1Q12A 4AQYQ 4Y52H 3K80C 3M4PA 2ZJRA 1YJ9A 4K0KL 3I7FA 1IL2A 3E9HA 3SGIA 2JA6G 2JEAI 3CCSA 2FXQA 3G4SA 5C44H 4A3MH 4DKAC 5H1SE 3M85A 2ZTEA 4JBKA 4OWWB 1X54A 1I3QH 4QIWE 2VQFL 3CCQA 1Q7YC 5AJ3L 1QVFA 3S1QH 1U0LA 1YZ6A 4C3JH 1HNZQ 1Q81C 1OTCA 2Q2TA 4JI2L 1PA6A 3S14H 1QUQB 4GOPA 1VQGA 2UUCQ 3L7ZC 1JT8A 4BY7H 3I4NG 1I94Q 2N3SA 1K3RA 2BA0A 3CAMA 1XNQQ 4YHHL 3TEHB 4DR4L 2R6GA 1I6HH 2UUBQ 4A93G 3KF6A 4P74A 1V43A 3CCMA 4R4OA 4EX5A 4OXPA 3UDGA 5JEAG 2MNAA 1YNXA 4DV5Q 1K8AC 3RZOH 5EAYA 3S2HH 1NBWA 2CKZB 3KOJA 2GN5A 3KDFA 1K9MC 1B7YB 2F3IA 2VQEQ 4DR2L 1XPOA 2D0OA 1OXVA 4LFAL 2BH8A 1V1QA 3U58A 1KIXA 1XNRQ 4GKKQ 2A8VA 3ZJYC 2EQSA 1QZGA 4R1JA 5GQOA 4X62L 3TQYA 3PUYA 4DAYB 2ZJPA 4DUZQ 1NTGA 4A3FG 4LW1A 3HOZH 2LXKA 3K7AH 4LF9L 3U50C 3GTJH 1EUJA 4A76A 5IP9G 3AFQA 1SROA 4PZ8A 4POFA 2I0QA 3D0FA 3BU2A 2Q2IA 4GKJQ 1P8LA 2IT1A 2K5VA 3S1NH 1IBML 1X6OA 2WP8J 3RLOA 1KQSA 4JBJA 1N33Q 4DR6L 3HFZB 4UP9A 3KJOA 1HR0Q 3S1MH 3RLNA 4NPSA 1EOVA 3EBEA 1LM0A 1HJPA 4PZ6A 2AKWB 3AQQA 5IYBH 1XMOQ 1GM5A 2MO0A 4C3HH 3PV0A 2KCTA 4NXML 2VL6A 4DR7Q 4X6AH 5BR8Q 1E3PA 3UE1A 2RF4A 4P72A 1LUZA 4KHPQ 5GAEC 1VQ9A 2YTVA 4B3TL 1KRSA 3KFUA 1W3SA 3F2BA 4TQUS 5J3BA 1XMQQ
chains in the Genus database with same CATH superfamily
3C3LA 5JAVA 4E6IA 1PFSA 1OXSC 2EDGA 5F2DA 2PMZE 3J7AF 3SK5A 2IWHA 1M90C 3HOYG 1F2MA 4R4CA 2A6ED 4A3DH 4MIUA 4QL5A 2BE5D 1LLRD 3I8ZA 1YNJD 4LF5Q 4X65Q 4ME5A 3GTGH 1BCPB 3AYHB 1EQQA 2B63B 5CR3A 4JG2A 3T53B 3CCEA 5KEEA 4OX9Q 2EJFC 2O2LD 1WTPA 3U4VA 1CT1D 5IY0A 1UE1A 3CPWA 4LWCA 2JA6B 5FOBB 3PUWA 3URYA 1TS2A 2RVLA 1Z6HA 3J81j 2K5WA 1WTRA 1FNWA 3Q8DA 3QOLA 1HTLD 1YHQA 4X3SA 2OTLA 1PYBA 2Z0SA 1Y8PB 4FF3A 3HOVH 3JAMi 1SYEA 5C4ZA 5C4XB 4N9TA 3RZDH 1VQIA 3HKSA 1GOZA 3F1ZA 4A3JG 1TIID 2UXDQ 5CBEE 3M4OB 2IL8A 5C3EG 3QB3A 3DHQA 1ZXTA 3HGBA 4XDXA 3LWUA 3H6MA 1WYDA 4A3FB 1NMFA 1IBLL 5ELBA 4DU9A 2SNSA 2TMPA 3K7UC 2OQ0A 1K3BC 2RDHA 1PH1A 4V0BA 1YNND 5HGTA 1QNUA 2NB0A 1O80A 4LNQA 2DY7A 3GTMH 4G4KA 5BN4A 4X66L 4KD3A 1ZKOA 1PRTF 5DEHA 3K0XA 1EQRA 1JJGA 2N55A 5JVG3 3EN2A 4GLAC 3I90A 2NVYH 3GV3A 3MWYW 2K28A 4XT1B 2LKVA 2L0CA 1HNXQ 4H44C 1ILQA 4FO2A 4LF4Q 3S2DB 1E1OA 3HOYB 1VQMA 4KY7A 1KC8C 1WI5A 1XXGA 3E3XA 4LUOA 1MSGA 4MTKA 1D5ZC 1KABA 5C44G 2F0MA 5EKLA 4A3MG 2HIVA 3ICEA 1HNZL 1Y8OB 4OIJA 1VQPA 1L0YB 2CCZA 4P75A 3PO2G 2JA9A 4C1NI 4HJ9A 4FXKC 1PHJA 3H3VH 3HP3A 5GADC 3CRLC 2NZOA 1RF2D 3S1RB 3U9OA 4NXMQ 3KF8A 1F2LA 2K32A 1FJGQ 1A8VA 3GP7A 2VQEL 3MXGA 3G48A 4L6TB 1ESRA 1PTOB 1EYGA 2CH4A 4DV1Q 1IXRA 1YBYA 5A2QL 4DK3C 1JB7A 3ULJA 1C48A 1D7QA 2IX3A 1P16A 1KD1C 1CQVA 3RN2A 5I2XA 1VQOA 1LTTD 1R4QB 1X65A 1TS5A 1N33L 1NAPA 2ZXPA 2K5NA 1PVOA 2CWAA 4A3JB 5C4HA 4CDCC 5C3EB 3PUVA 4J6HA 5FJ8H 4C3HG 3VYSA 2JJQA 4G7OC 3A8IE 4MHEA 4QQBX 3M7GA 4OO1G 4AH6A 1YHAA 1DCZA 2VB2X 4G57A 4R4TA 2EVBA 2K4KA 1BNZA 1SNQA 4GZYC 2CW0C 4DV7Q 1SJHD 4LF6L 4O0AA 3VR5A 2HDLA 3LWEA 5EJWA 3I4OA 1QE6A 4XYOA 4HMIA 4YWLA 2N78A 1ASYA 1F9PA 1Y69U 4OX9L 4RAUC 2F3WA 3CCLA 3WDNA 3GO5A 1K8GA 4A3EH 2B63H 3SEBA 2KBNA 2E2JB 3PIPA 2B2YC 5C0XJ 2K05A 4R8IA 1DYQA 2Z6KA 5EKKA 4FF4A 2NWGA 2VUMG 3SVMA 4OO1I 4RGMA 1Q82C 5C44B 4DR5Q 4A3MB 2JA6H 1TXYA 4QGUA 2EXDA 1PDQA 2EY1A 4PG3A 1PH5A 2B2TC 3S14B 2L12A 4JBWA 4KI0A 3T13A 1CFMA 4KY6A 2VQFQ 1CHQD 4B3RL 3CC2A 2PZUA 4RMFA 4JBMA 5K36G 1JE5A 1EWIA 3CHBD 4HSVA 3K5MA 1CK1A 2UXDL 3KF8B 1NMGA 3NWTA 4TKOB 3IRBA 5C6AA 1BBUA 1VQDA 4O2DA 1BOSA 1Q8KA 3HZXA 2HD3A 2ENBA 3M4OH 1EIYB 1KL9A 5I6YA 2DNEA 4BS9A 4IJHA 2VS1A 5COYA 4DR2Q 3GTJB 3EROA 1CA6A 1STYA 4A3FH 1SN8A 4H02A 5IP9H 3WOEA 1JC7A 4P73A 4IZ8A 4C3HB 1A0IA 1I94L 4G7ZC 1GUNA 2EY6A 1HNXL 1TY0A 4LF4L 1VQFA 4IUUA 3K59A 3AU7A 3MFYA 2EXZA 4J1MA 1KAAA 4R4QA 2L55A 4JI8Q 3HS0C 1XX8A 1TWHH 4PQXA 1JJ2A 3HOYH 5CYUA 5FLMG 3H0GG 4DXFA 4RGOS 3KJPA 4F7XA 2E76C 2A5HA 4L5TA 5I2YA 3Q24A 2ZM6Q 2VUMB 4ZCKA 2XGTA 1FJGL 5FO9B 2QCPX 3MHBA 4CBVA 1Y1VG 3U4ZA 3S1RH 4DV1L 3K58A 1KDCA 4LUZA 1F9RA 2PQEA 1PTOH 4A3CG 1B3AA 1Q1EA 4U673 4PV1C 3NEMA 4WORA 2RCFA 1L2FA 2J0TD 4NP5A 5JEAJ 2E2IH 3V2TA 1A62A 4IJLA 1PFBA 3SK6A 2K52A 2AWNA 1H9JA 3E0EA 1MKHA 3JC66 1Q46A 2MP1A 2B8GA 1I6VC 3T4AC 4OONA 2D5DA 1BVSA 3RLFA 1SMYD 1A3TA 2GVBA 3ZYYX 5M3MG 4A3JH 1GUWA 1IKMA 1QZHA 2Y0SE 5C3EH 4KTAA 1AE2A 5LMUL 2QDBA 2Z6BA 4HJ5A 3D6CA 1T9HA 2R7DA 1BQQT 1ML0D 3S17B 1HHVA 4DV7L 1RHPA 3N52A 5ELFA 2A69C 3KLWA 2Y0SG 2K33A 4JI5Q 3W1GA 4JI0Q 3VDYA 2IHEA 4J8QA 4R9WA 1EY4A 1O7ZA 4KJOA 4Y7NH 3W5OA 3STBC 3P75A 2R7FA 2L4NA 1UE6A 4BY7B 3FP9A 2EY5A 2EPBA 2P5ZX 3NTHA 1TWCH 4YWMA 1GVPA 3CMAA 2F0TA 4BBSG 1SYGA 1TT2A 3NBHA 4LFBQ 2NBFA 4BY1G 4DV2Q 1G6PA 4K5VA 3KLSX 3IFDA 4B3MQ 1TWGB 3OHXC 1BCPF 1G6ZA 4DR5L 2AWOA 1YIJA 4A3BG 3K80C 3I7FA 2K7VA 3SGIA 3H0GB 5C4JB 2JEAI 1AZPA 5C44H 4A3MH 4DKAC 3M85A 1CZWA 3CCQA 1Q7YC 2VQFL 1I4RA 1SYCA 1JQYD 4KKSA 3TSSA 3S16B 3DUZA 4EQOA 1U0LA 4K5XA 5NUCA 3S14H 4JI2L 4RCNA 1PA6A 4DFAA 1ILPA 3T56B 4DNTB 3L7ZC 1JT8A 1Y1VB 4DK1A 2F0LA 3CAMA 4YHHL 1XNQQ 4MN3A 4A93G 2PZTA 1V43A 4EX5A 5FKAC 5EPKA 3RZOH 1S5BD 3P7JA 1EY5A 2GN5A 2JYOA 1B7YB 1XPOA 1U4LA 4DR2L 2D0OA 1OXVA 2BH8A 1EU3A 2EQSA 4R1JA 1KNAA 4NKLA 1HPCA 3PUYA 1TVXA 3A8JE 1BO0A 2QILA 5KYLA 2OF1A 3TP8A 3U50C 3GTJH 1EUJA 2I0QA 4GKJQ 3BU2A 2Q2IA 2Q8IB 1SNOA 2IT1A 1GJXA 2KECA 4C2MB 3P1HA 5M3MB 5CV6A 1J8IA 5JJZA 1IKLA 2F0IA 1EOVA 3EBEA 2B39A 4PZ6A 4C3HH 4DNRB 2VL6A 1E3PA 1V1PA 3UE1A 5E3FA 2RF4A 4OO1H 4K6LA 1VQ9A 5CV4A 2K1BA 4JK1C 4FF1A 1W3SA 1FNVA 4TQUS 2Y0SB 4JI1Q 2MHVA 4FP5D 1B9MA 3G7LA 1PH9A 5JVH3 1EYAA 3KYHC 4QUFA 1XPRA 3CCVA 3JAME 1EU4A 1PFNA 1Q3LA 4P2CB 4UP7A 3RZDB 1LO5D 1SE2A 1TY2A 2VXWA 1A63A 3J81L 3S24A 4RKLA 1UEBA 3BVMA 4BBSB 2R92G 3A0JA 4BY1B 3M7NA 1HXYD 3PCOB 5LHY1 3NBHB 3DWQA 4A3BB 3L2PA 3H3VI 2VUMH 2F4VL 3BZKA 1VQ8A 2H4OA 4N9PA 1WCMG 2Z8LA 2HQLA 3X3NA 3H15A 3CRKC 1GUOA 1YJNA 1NNXA 5IODA 3HOXG 3QO2A 3PIOA 1SYFA 3J7YW 1PTOF 3OTOQ 1CA5A 3H09A 1NR4A 1W6KA 4A3GG 5GAHC 1CKMA 5K36H 3E9IA 2Q8RE 1X9NA 4A93B 2SEBD 2ZTCA 2HCIA 1SAPA 5JJLA 1HZCA 1PXUA 3HOUG 3NPPA 1DGSA 2KCNA 3F2UA 1JOQA 1C8CA 5C5MA 1RDPD 4JI3Q 2G5DA 1F9QA 5IGBA 4KV6A 4OELB 4GNXA 4XYQA 4GN3B 4YCWA 4L63B 3PIO3 4JI5L 5M5YB 5FO8B 1EYDA 3I3CA 3S17H 4A3KG 4FVMA 4JI4Q 2EYMA 1R9TH 1X3EA 1ENAA 1G51A 1VQ6A 5LMNW 4EVOA 1HZ9A 2MFIA 1B2TA 1IBKQ 4JW0A 3SXHA 2A6HC 1EQVA 1V1PB 4LFBL 4DV2L 1EIHA 3MXNA 3ERSX 5C5LA 2QKIC 1YVCA 2EJGC 4JPBW 1IW7D 2WFWA 1S40A 2KHJA 1PRTC 2SNMA 2KEEA 1TWGH 2Z4IA 3T51B 4H13C 3RN5A 3TRZA 2HDMA 2A73B 3J80E 5FLMH 3H0GH 5C4JH 4FYDA 3C1EA 1UE5A 4ZLTF 2R92B 1SSOA 3MVVA 1Y14B 1HA6A 3DLLA 4EGVA 4I7AA 1XNQL 3S16H 2L11A 4CKEA 3UDXA 1F77A 3UE0A 2LXJA 4I65A 1B1ZA 1Y1VH 1VDZA 3C1FA 2Q8TA 4CGYB 3D4DA 4F8MA 1FGUA 1LT3D 2M9VA 4A3CH 4HIOA 3HOXB 5J1ZA 1WFQA 3NE5B 5E1FA 1K73C 4A3GB 4IFDJ 4UDUC 4GKJL 1Q90A 1WD1A 1JMCA 4RFBA 4DV4Q 1QVCA 2DNCA 3GTQB 5ELNA 5KGUA 3K81C 2SDFA 1SXTA 2FHTA 5IT9E 3X3MA 3AB9A 5FLXE 1HR0W 4EQPA 4C2MH 5M3MH 2CVRA 1HQMC 4DGZA 4A3EB 3K6OA 4ZKBB 2CW0D 4B3SL 5DM73 2EYHA 4GNXB 3PUZA 4OGQC 4JI1L 2AQ1B 1WTXA 1STBA 4Z9CB 4A3LG 1QG7A 3I91A 2E2DC 1SBBB 2JSOA 2O4XA 4GS3A 2ES2A 5L37A 1BXTA 1Z9FA 5IWAQ 3W1BA 5KYIA 1LTID 1YI2A 2JQOA 5FO7B 1SLJA 3DMUA 3EIVA 4PZ7A 1LABA 1RCVD 2F0NA 1HFGA 4ALPA 3MXNB 2UXBL 3T1HQ 2QGQA 4J15A 4BBSH 3NQTA 2RHSB 4BY1H 5BN5A 3DWAA 1WVLA 2JP1A 1OXTA 3Q23A 2NTSA 4A3BH 1EIGA 2UXCQ 1EZ6A 2AQ3B 3KBGA 2A19A 3OW7A 3HOWG 4IN3A 2K5HA 1ZYRC 2M2LA 3OTOL 2QA4A 3MC0B 5J22A 1FVIA 2LMCB 3BG3A 5DLQE 3TP7A 4CKCA 1F2YA 4RGNA 3VR3A 2PZWA 3SDZA 5JOBA 2DY8A 1ICWA 3QR8A 4F88A 3S2HB 4A93H 4O42A 4LUVA 3TS0A 1SE8A 5D3DA 4JI3L 3V05A 3UDIA 3PO3G 4H7BA 2OWOA 1U5KA 1TWHB 4MTNA 4ZK9B 2QW7A 1GHKA 4JI4L 2LS01 3OPOA 1B4OA 3PF4A 4ZKCB 5M5YH 5IOCA 3PF5A 2KHSA 1CSQA 3NBIA 1HQRD 3QWNA 4KKUA 4KLKA 5CV8A 5IYCG 1A2UA 4IUQA 2UUAQ 1DZ1A 4UP8A 2PMZB 2YV5A 4RCOA 1IBKL 1IBMQ 4DR6Q 4XQQA 1QILA 1KDAA 4LF7Q 1GUTA 4KKTA 2O5IC 1D5MC 1HFNA 1DOMA 4L5SA 2H5XA 1FYCA 4B3TQ 4GKKL 5IGFA 3NQIA 2ZXRA 4HJ7A 2RQXA 2E2IB 2MPMA 1EOTA 1K8MA 3I4LA 2A1AA 1UWVA 2GVAA 3A8KE 3DM3A 4GLXA 2VNUD 4JOIA 3MXUA 4K2KA 2K6AA 3NELA 4G7HC 2F52A 4BBRG 1SYDA 5G3LF 2R92H 3M3YH 1WTQA 3NK9A 3PSIA 3R2IA 5KNDA 3OIPA 4UPAA 3UDFA 3C46A 1EEID 1G291 3GTOH 2PYKA 2RSNA 1EYCA 1JE4A 1SMXA 4TVAB 4JCVE 3HOWB 1TS3A 1WCMH 2YTYA 1B8AA 5IGDA 4IUNA 1E2VA 1MHWC 4DV4L 2JA8G 1SNMA 1WTVA 2D9UA 3HOXH 2K5QA 1TWFB 3CMEA 2JA7G 4A3GH 1D1IA 3BDCA 1X56A 4Y7NB 1EY8A 4CJ2C 2AQ2B 3H3VC 3GTQH 4LF5L 1VQ7A 4X65L 2UU9Q 4ZUIA 3TDQA 1TWCB 4DK0A 1BDOA 1X3GA 2A6EC 4JYAQ 4YWKA 5CMDA 2A69D 5CC4A 3HOUH 1SR3A 3PO3B 4HSPA 3K8AA 3IKJA 2XSCA 4QMGA 5HY6A 1QCBD 2IHFA 1F2ZA 4LAAA 4PMCA 3LNNA 4ZUJA 5IWAL 3PO2B 4A3KH 1IL8A 1A3VA 1GO3E 4X3TA 2D0PA 3CCJA 3CW2C 3HEJA 1MI2A 2NVXH 1J5EQ 3T1HL 2WAQE 1LTBD 3M9BA 2WKCA 3SE0A 3RD4A 3PIP3 3RZOB 2MO1A 2Z9HA 3FVQA 2B3GA 3LX0A 1TQOA 1VQNA 3CU7A 2UXCL 1OXUA 1CM9A 1Q12A 1LTAD 2IJ0A 1YJ9A 1IL2A 3E9HA 3IAYA 2ZT9C 3A7AB 4BBRB 1KNEA 3QJYA 2AUJD 1YZ6A 3PMFA 2DN8A 2Q2TA 1BCPC 4GOPA 2UUCQ 1EWCA 5T1GA 5HURA 1LTRD 1K3RA 2BA0A 2R6GA 4H0LC 1I6HH 3KF6A 4P74A 3UDGA 4R4OA 1X32A 3S2HH 2MNAA 1YNXA 3UI2A 1NBWA 4Q5VA 3EJIA 1K9MC 2JA8B 2F3IA 1XNRQ 5ELDA 2A8VA 2JA7B 3ZJYC 5GQOA 3D3RA 2ZJPA 2OXPA 1ENFA 2LXKA 3K7AH 3SK8A 1EY0A 3EVQA 4A76A 3D0FA 2B2VC 1P8LA 1CTMA 2K5VA 3VYUA 1IBML 3BVGA 3GTPB 4DR6L 4UP9A 1HR0Q 1SNCA 4NPSA 3U9SA 1TKWB 3K5OA 4NXML 4RWSC 3W3AA 4DR7Q 5BR8Q 4KHPQ 5GAEC 3KLSA 2KJXA 2YTVA 4B3TL 3KFUA 5CV5A 4A3LH 2F0DA 1MSHA 3NTKA 1HUMA 3BDLA 1AN8A 2Q2HA 2B2WC 4DV3Q 4ZQ3A 1YITA 1S3OA 2KCMA 4XQNA 2IW3A 1PH2A 1STNA 5IIFA 1KXLA 1I4GA 1G2SA 4IOAA 2R93G 2RDGA 1S5CD 2AHOB 5CV9A 1VQ5A 3O13A 4DA2A 1UAPA 4IUTA 5JJIA 2PW5A 3MXPA 1PH8A 1PH4A 3ER0A 2EYPA 2QEXA 1CKOA 4ID6A 4K8JA 4FF2A 1LACA 2D62A 1C0AA 1QNKA 2K03A 2JA5G 3HOWH 4DAPA 1D6EC 4IALA 4DV6Q 3Q6SA 1JR0D 1VQCA 1HUNA 3F2DA 1W2BA 1R9TB 2LY7A 3BZDB 3FMCA 3D4RA 3N6RA 2EYJA 4KN7C 3I55A 1RKNA 1TWFH 4ZRZA 4GOPB 1A6XA 4JYAL 3TREA 3TP5A 4KK7A 1T5EA 4DR1Q 1QVGA 3BJUA 3KF6B 1MJCA 5C3XA 1G8ZD 2KENA 3TZDA 4QCLA 3V96A 5DAUA 5M5XH 1PTOC 2F0QA 1XYIA 3PO3H 4V190 2L9HA 4L5RC 1HNWQ 5IYDG 1Y1WG 5JJKA 1HZAA 1DOKA 4IUVA 1E1TA 3DEPA 1I4PA 2I07B 1ET9A 4RKBA 4RHSA 2A6HD 2F0VA 3FEWX 5IYCH 3PO2H 1OXXK 5AJ3Q 2E75C 2OTJA 2PCFB 4UY8C 1I4XA 1PRTD 1ET6A 4IFDG 1LTGD 4WJWA 1ONLA 4A3IG 2KHIA 4BWGB 1SE4A 4IPHA 3W2DA 2PI2E 4GN5A 1KTKA 4LFAQ 2ZTDA 1D8LA 2CQOA 3NP8A 2F4IA 3ULPA 4X62Q 2CWPA 4JV5Q 4K6DA 5EGTA 1VCIA 1D2BA 1O7YA 4NXNQ 1DJRD 5E7NA 4BBRH 5LL6S 4C3JG 2UUCL 4LFCQ 2F0SA 4HIDA 1STEA 3F2CA 2YYZA 4IOCA 2K01A 2KA7A 1H9SA 4LK1C 2IPKD 4HTHA 5ELOA 3CQZB 3A5ZB 5D3IB 1XNRL 4U68A 4PMBA 4JI8L 2JA8H 5EKIA 4TRDA 3B6YA 1AH9A 2JA7H 3HOZG 4XTCS 1N32Q 5LL6X 3P20A 1O7LA 2OEOA 2YTXA 3HRZC 1Z47A 1JOOA 2DUDA 2L1BA 4KMUC 1G91A 3CC7A 2F0UA 3GTPH 1JWSD 4DR7L 5BR8L 2XTIA 2ZM6L 5IYBG 4IO9A 2QEJC 4KHPL 2E74C 1Y1WB 2JK8A 4NDXA 1X3FA 3GTKH 3EQLC 1C9OA 2BDNA 3A56A 2B2YA 3AFPA 1MBYA 2EIFA 4JOIC 3G71A 1VQAA 4CDFC 4I7ZC 1H9KA 1Q1BA 1B50A 1MGSA 2IY5B 2GA4B 1WD0A 2B2TA 4WJ4A 1DOLA 4A3IB 1XPUA 3I4MG 4ILWA 4NB3A 1E7ZA 3MFGA 1ZYRD 1EY7A 1N34Q 3SHLA 5GAGC 1S5FD 3H91A 2PQAA 1SRUA 5M3FG 3Q0AA 1TS4A 1V9PA 3G6JB 4DN4M 1ICFB 2NTTA 3J81i 4K0KQ 3E6ZX 3S1QB 3BZCA 3GQBA 4C3JB 2EE1A 4JI0L 3KUPA 5CBAE 1WTHA 4X66Q 1AFPA 3OWFA 5EBCA 1N9WA 3E0JA 3K5NA 1H9SB 4OL7A 1EZ8A 4RA8A 5DNFA 1B70B 3VYTA 2F1MA 4WRDA 3KLRA 1UUPA 2Z6KC 5TSSA 2Z4HA 2K75A 2LSSA 1HNWL 4B3ML 4HR7B 1CI3M 3HOZB 2A74C 1FL0A 1NSNS 3ONAB 2A68C 2I46A 1GKHA 3M4QA 3E5SA 4RH6A 4POGA 1VS0A 3FKIG 4BXXG 4LF9Q 2N8NA 3GDEA 1GUGA 5GROA 1NUCA 3OMCA 3VA5A 3M3YB 1PV4A 5C4XG 1VQLA 4P71A 4GN4B 3R3OA 1BBXC 4OIKA 5K5PA 2F0FA 2G9DA 4B08A 1FR3A 1S5DD 3GTOB 1CKNA 3QOJA 1WCMB 1ZEQX 1VMCA 1SFOB 1LYLA 4JV5L 2X6GA 2WB1E 1QWYA 2XNAC 1I5FA 2EYLA 1E2ZA 4ZAIA 1WJJA 4NXNL 2NN6G 2D2CC 2NVTH 1I4QA 1VQBA 4B9XA 4GOPC 1LT4D 3L9AX 1CZGA 2MJ8A 3NTIA 3VA7A 3IFTA 4LFCL 5C0XG 1PH3A 1NE3A 2R93H 1IZ6A 1RIPA 2B2UA 4X64Q 3R2TA 4ABNA 2WB1G 3MEHA 1AE3A 1TWAB 3HOUB 1VQEA 2NVQB 4EQ5A 3JAML 5A2QE 1WOCA 1HRJA 1KDBA 1XTDA 5M3FB 2PQAB 3WOFA 3CQZH 2JA5H 3TBIB 4PNYA 3A54A 4FXGC 4N8X1 3BVZA 3IL8A 4A3KB 1N32L 1PZKD 4DAYA 4LF6Q 3D8GA 2OQKA 1CUKA 2NN6I 3G6EA 2NVXB 1DONA 1I50B 2QF7A 1W6JA 1ESFA 2ASBA 5C0XI 1PYWD 1NCVA 4IURA 5FK9C 1LT6D 4NMZA 4MZ9A 1AW7A 5IYDH 1Y1WH 1D1KA 3J81c 3D31A 1FD7D 3FKIB 3ERQA 5HGQA 1LTSD 4OEMB 5KIXA 4DR3Q 2X6LA 5D65A 5ISRA 5I9OA 1E22A 4B3RQ 4JC0A 1O78A 2FFKB 4LF8Q 4IFDH 1I6HB 4A3IH 3K57A 3TS2A 2L5TA 2IX0A 1N34L 1L1OA 3GD7A 1CKNB 1LV9A 1U9RA 1JOKA 4A4IA 1K8OA 4FDBA 1EIFA 1K83B 1C4QA 2F0GA 3QIAA 1FGBD 1BBWA 2WACA 4AQYQ 1BCPD 4K0KL 4RGTA 1K0SA 3K7AB 2EYFA 5IGGA 3CCSA 3G4SA 2RSOA 1JICA 2ZTEA 1X54A 4QIWE 1QB5D 2WB1B 2MGSA 2ZXOA 1QVFA 3S1QH 4C3JH 1OTCA 1Q81C 1Z7TA 2ICIA 2X69A 4ZYSA 1VQGA 2B8FA 2RKSA 2V4DA 3I4NG 3J80L 1I94Q 3C2PA 2ICEC 4QB4A 3TEHB 2JXMB 4L8JA 4CJ1B 1IYVA 4NW2A 2UUBQ 3CCMA 5JEAG 1K8AC 4DV5Q 5EAYA 3KDFA 4QF4A 2N88A 3TMEA 1V1QA 3U58A 1SE3A 3Q22A 1B9NA 2Z1CA 3TQYA 4DAYB 4DUZQ 3FPUB 4CDEC 1NTGA 3HOZH 2RDFA 4LW1A 4LF9L 3NHHA 4K8IA 4KD4A 4POFA 1SROA 1IW7C 4PZ8A 4K5WA 2HQEA 1AZQA 2M00A 2KOLA 1T5XD 2WP8J 3RLOA 4LJZC 1KQSA 2PW7A 4JBJA 3KJOA 4CKBA 2F3VA 1EFID 2CQAA 3AQQA 2XRQD 5IYBH 1XMOQ 3T16A 2MO0A 2NUCA 3PV0A 2KCTA 3OOCA 2EOTA 5KNBA 2E2HB 5IT9L 1LUZA 4FNFA 2HUGA 5FLXL 1KRSA 3F2BA 5J3BA 1XMQQ 2F0OA 4UAIA 1SFOH 3J80i 1G2TA 1L0WA 1XTCD 1N8RC 1VQ4A 4FXDA 1RD9D 4UHVA 1DD2A 2OCEA 3NXWA 1TR5A 4X64L 2YU9B 2R7ZG 4K14A 2J7ZA 4DXGA 1PH6A 3I4MH 4HIMA 1PLFA 3PUXA 3R8BA 1R4PB 1L1OB 4IPDA 1TWAH 3SR1A 5M5XB 1CSPA 2BE5C 5LMUQ 2NVQH 1GUSA 1YNJC 1JCKB 1KRTA 5M3FH 4RG1A 4DV0Q 3T1YQ 4ULLA 2E5LQ 3NENA 3STBD 2NYZD 2KEDA 3JAMc 2CHBD 2LFNA 2RA4A 2NZHA 5CV7A 4WFN3 3I4NB 1QOHA 1PTOD 2XWJB 2C5CA 1N36Q 2IX1A 3BS1A 5LMNQ 1I50H 4QIWB 3J7AV 3GTLB 5IP7G 2G9HD 3K5LA 1H95A 1PH7A 2ALYB 2EJMA 3KDFB 3CCRA 3VR4A 4DUYQ 4KY5A 1GHJA 2PNHA 2KQ3A 4DPGA 2C9OA 1E2WA 4DNIA 2WIIB 1VMPA 4C3IG 1YHBA 1ENCA 4DR3L 3OWEB 3NUCA 2WAQG 1AP0A 1U4PA 4XXEA 3MZ5A 1Q8IA 2JN4A 3FKIH 4BXXH 5JPNC 3OYYA 4O1NA 1RTNA 3M4YA 4KN4C 5M5WB 1KLGD 1DM0B 1EEFD 3K0YA 2FMMA 4JI2Q 1KHIA 4CHTB 4LF8L 5C4XH 2K04A 4QJFA 1YNNC 3ND9A 3FRPB 1SEBD 1YJWA 4YHHQ 3CKIB 2B29A 3A5UA 3I70A 4GNXC 1A2TA 4L5QA 4HN7A 4JVZA 4AQYL 3CPFA 2JE6I 2NZ1D 1X3PA 2HT1A 2BA1A 1KLUD 1EY9A 1K83H 2RCNA 3MEFA 2PPBC 3CD6A 2NN6H 4HJAA 4YCUA 1EY6A 2R7ZB 3L0OA 4WJ3M 1OO9B 3L3OC 5C0XH 4YIJA 1SNDA 2UUAL 2O5JC 1HH2P 3TP6A 3RNUA 5EPLA 1L0XB 3PGZA 4R8NA 5I4DA 1E0BA 2UUBL 4BY7G 4LF7L 4MNOA 4RHRA 4Q0FA 4DV5L 3S15B 3D6WA 4BA1I 1DXMA 5ELEA 3GTKB 2CFMA 1VF5C 3CXCA 1BR9A 1RODA 1Q86C 4KHZA 2KCCA 3CC4A 3DEOA 3FPPA 4S3SA 1IYJB 2PO4A 3A55A 4N8FA 3J80c 4DUZL 4JI6Q 3S2DH 4CDDC 2HHHQ 1A15A 4IPCA 2K14A 5E4XA 3LGJA 1V1OA 3FHWA 2Q2UA 1S72A 5CGKA 1XMOL 4KHVA 4TSSA 1JWMD 1RJTA 3PQIA 3OIQA 5CORA 4YY3Q 3MA2B 2EZVA 4C3IB 1BF4A 3J7A5 1XMQL 5AFWA 4AYBE 2F4VQ 3CF5A 2VY3A 2WAQB 2E2HH 1EQTA 4IPGA 1S5ED 1PRTB 4HEDA 4JI7Q 3J81E 4GLVB 2B2UC 1J6QA 4X3KA 1CHPD 5EPJA 4F87A 1JJCB 3MAQA 5IT9c 3I2ZA 1UE7A 4A3DG 4AYBG 5FLXc 3HG9A 2I5HA 4HAEA 1BKBA 3HKZE 2UU9L 5D14A 2YU9H 1X3QA 4DF7A 5C3WA 1I4HA 2F0KA 2VB3X 3I72A 4X3UA 1PYSB 3DWPA 3ULLA 3EA6A 1KAWA 4IQZA 4DV0L 1SJED 2K50A 2PNRC 3T1YL 1HCZA 1U4RA 3HKZG 2E5LL 5JPMC 3WWVA 1VQJA 1I3QB 3J7ZC 1NY4A 3D4WA 2KUMA 3A74A 4IUPA 4XT3B 3VYRA 1N36L 3GV6A 3HOVG 5LMNL 3F8TA 2I5MX 4HJ8A 1PZJD 2XN9C 4APVA 3A7LA 3RUZA 3I4NH 1J5EL 1M1KC 1X55A 1M4VA 1RTOA 2MUYA 3GTLH 4DUYL 2A68D 3BYYB 5JEAH 2BH2A 1J9OA 3ITPA 5KRUA 4DR4Q 4OWTB 2E2JH 2F03A 4HCSA 4AIMA 1PMRA 1STGA 2ID0A 5EBDA 1XJVA 4HMJA 2DJFC 4OWXB 2V1CC 3CP0A 2NVTB 3S1NB 2PI2A 1II3A 1UEAB 1HZBA 3S1MB 2R93B 3OW2A 1SYBA 3H94A 5A35A 1L1OC 5M5WH 2VW9A 2L15A 1H9RA 4YCVA 2HCCA 3AEVA 2DGYA 1K28A 2F0PA 2I5LX 4A75A 4IFDI 1VQKA 5KNCA 1MJEA 2AUKA 2R3ZA 4R4IA 2JA5B 3OMGA 1GD7A 3TZUA 2CH4W 2ATWA 2FMCA 4EQNA 4A3DB 4AYBB 2EY2A 2KVMA 2F0EA 1SDFA 3GTGB 5EQ0A 5IGEA 2RBMA 3R93A 2R7ZH 2DJGC 3RR5A 1D5XC 1E24A 1HR0L 1LTLA 1VF7A 1NJIC 1K0RA 1QUQA 2XRSD 4ME3A 2XVSA 5G3LD 5IE8A 2AMCB 1F9SA 5T1IA 4XIGS 3HKZB 4B3SQ 1S4ZA 1A3UA 3S15H 2BDOA 4JI6L 1STHA 1LT5D 1PZID 2HHHL 1YEZA 2WINB 4C56C 1JB3A 2TSSA 5ELCA 4DV3L 1O7IA 3HOVB 3BYTB 2JEBI 5IGCA 5J39A 2OT2A 3VR6A 1TU2B 1JWUD 1M8AA 1STAA 3S9WA 2XWBB 1EL0A 5IP7H 1AEXA 3RMHA 2F0HA 4YY3L 1HTPA 1XWEA 2UXBQ 2N49A 2HIXA 2RHQB 5FJ8G 1H9MA 1PFMA 2EYOA 3TN2A 4HIKA 4JI7L 4DK6C 4C3IH 1MIUA 1SMYC 1IBLQ 4DAMA 4BA2I 1ASZA 1RL2A 4M1UB 3GTMB 5I6WA 4DV6L 2MQHA 3CCUA 1VQHA 4K2LA 5M9OA 1B53A 1EWHA 1C7YA 4QUCA 2NVYB 1EFWA 2C35B 3I56A 2ZJQA 2R61A 4DR1L 2E8GA 2XIWA 2SOBA 4LMQD 2J4XA 2B63G 4A3EG 1B3QA 1B44D 4PMWA 1BUVT 4QY7A 1SNPA 1UNSA 2F0WA 4XQJA 2VZAA 3NSWA 4Y52H 3M4PA 2ZJRA 4KJNA 3EFXD 3AMUA 1WTOA 3QG1A 2JA6G 1IHZA 1QJOA 2FXQA 5H1SE 4JBKA 4OWWB 3ND8A 1NR2A 1I3QH 3MTSA 5AJ3L 3KBXA 1HNZQ 4ODGA 3DM1A 2B2VA 1FNUA 1QUQB 4M8AA 3BDOA 3NWSA 4DAVA 4BY7H 2N3SA 1CQFA 4DR4L 1WTWA 5BN3A 4OXPA 2H1EA 3I73A 1V8QA 2CKZB 2WV6D 3KOJA 3SK4A 3VR2A 1GXDC 2FJ2A 2K5DA 1MD2D 1Y8NB 1HA5A 5E4WC 2VQEQ 4LFAL 1KIXA 4C1NK 4GKKQ 1QZGA 1U4MA 2BOSA 4X62L 4A3FG 2F0JA 2QDLA 3FDTA 1IYUA 2WKDA 4CJ0B 3AFQA 5IP9G 2B2WA 3S1NH 1X6OA 1N33Q 3I4MB 3KK7A 2BCOA 3HFZB 1JORA 3S1MH 3RLNA 4B9WA 5DM63 1LM0A 1HJPA 4OHJA 2AKWB 1GM5A 3DXJC 4X6AH 4HCEA 4P72A 3OSOA 5I9PA 2FINB
chains in the Genus database with same CATH topology
4A3LH 4JI1Q 1PFSA 1OXSC 2Q2HA 4DV3Q 2PMZE 1SFOH 3J80i 1PH9A 3HOYG 1M90C 1L0WA 1YITA 1S3OA 4R4CA 2KCMA 1VQ4A 1N8RC 4A3DH 1PH2A 3KYHC 4QL5A 3CCVA 1XPRA 1KXLA 2OCEA 4JI6Q 4X64L 4UP7A 2R7ZG 4IOAA 4LF5Q 2R93G 1A63A 4X65Q 3I4MH 1PH6A 3S24A 3GTGH 1UEBA 4HIMA 2AHOB 3AYHB 1EQQA 1VQ5A 2R92G 3A0JA 3M7NA 3PUXA 4JG2A 3CCEA 5JJIA 4IPDA 1L1OB 3PCOB 4OX9Q 1PH8A 3NBHB 1PH4A 3U4VA 3ER0A 1TWAH 5IY0A 2QEXA 1UE1A 1CSPA 1CKOA 3L2PA 5LMUQ 3CPWA 2NVQH 3H3VI 2VUMH 2F4VL 3BZKA 1VQ8A 1KRTA 5M3FH 4LWCA 2D62A 4RG1A 4DV0Q 3PUWA 3T1YQ 1C0AA 1WCMG 2HQLA 2E5LQ 3H15A 3NENA 2JA5G 3HOWH 3J81j 3STBD 1YJNA 3JAMc 4DV6Q 3Q8DA 3HOXG 1VQCA 3F2DA 2NZHA 3PIOA 3OTOQ 1YHQA 1W2BA 2OTLA 4A3GG 1PYBA 2Z0SA 5GAHC 1CKMA 3HOVH 3JAMi 3I55A 1TWFH 4GOPB 3E9IA 1N36Q 2IX1A 4JYAL 3RZDH 3TREA 5LMNQ 1I50H 1X9NA 1VQIA 3HKSA 4DR1Q 1QVGA 2ZTCA 5IP7G 3BJUA 3KF6B 3F1ZA 1MJCA 4A3JG 5JJLA 1HZCA 2UXDQ 3HOUG 1H95A 1PH7A 2KENA 2ALYB 3KDFB 5C3EG 1DGSA 3CCRA 4DUYQ 5M5XH 2PNHA 4JI3Q 3PO3H 4DPGA 4L5RC 1WYDA 1NMFA 4DNIA 4GNXA 1IBLL 5IYDG 1Y1WG 3S2DH 1HNWQ 4GN3B 4YCWA 5JJKA 1HZAA 1YHBA 3K7UC 2OQ0A 4DR3L 1E1TA 4JI5L 1PH1A 2WAQG 3S17H 4A3KG 3FKIH 4BXXH 4LNQA 3OYYA 4JI4Q 5IYCH 3PO2H 3GTMH 1OXXK 5AJ3Q 1R9TH 4X66L 1X3EA 4JI2Q 2OTJA 1KHIA 4LF8L 1G51A 4UY8C 5LMNW 1VQ6A 5C4XH 3K0XA 1EQRA 4QJFA 1HZ9A 2MFIA 1JJGA 1IBKQ 4IFDG 3EN2A 4GLAC 4YHHQ 2NVYH 1YJWA 2B29A 4A3IG 3A5UA 2KHIA 4LFBL 4DV2L 4IPHA 3ERSX 2PI2E 1HNXQ 4GNXC 4GN5A 4LF4Q 4L5QA 1YVCA 4AQYL 3CPFA 4LFAQ 2JE6I 2WFWA 2ZTDA 1D8LA 2KHJA 1E1OA 2CQOA 1S40A 1VQMA 2HT1A 2BA1A 1TWGH 3ULPA 1KC8C 1WI5A 4X62Q 1K83H 2RCNA 3MEFA 3CD6A 2CWPA 3RN5A 4LUOA 3TRZA 4JV5Q 4HJAA 4YCUA 1VCIA 4WJ3M 3L0OA 5C44G 5FLMH 4A3MG 3ICEA 2HIVA 4NXNQ 1HNZL 3H0GH 5C4JH 1VQPA 5E7NA 1UE5A 4BBRH 2CCZA 4P75A 2JA9A 2UUCL 2UUAL 4LFCQ 1Y14B 1HH2P 3F2CA 4HIDA 3DLLA 2YYZA 4HJ9A 4IOCA 3PGZA 3RNUA 1XNQL 3S16H 1PHJA 3H3VH 3UDXA 5GADC 2UUBL 4BY7G 4LF7L 2NZOA 4MNOA 3UE0A 2LXJA 4DV5L 4NXMQ 4BA1I 1Y1VH 5ELOA 1FJGQ 1A8VA 2VQEL 2CFMA 3G48A 3A5ZB 3CXCA 1XNRL 1FGUA 1Q86C 4KHZA 1EYGA 3CC4A 4DV1Q 1IYJB 4DUZL 1IXRA 4HIOA 3J80c 1YBYA 1WFQA 4JI8L 4DK3C 1JB7A 2JA8H 3ULJA 1K73C 2HHHQ 1D7QA 4IFDJ 4GKJL 3B6YA 1AH9A 1JMCA 4IPCA 1P16A 1KD1C 2JA7H 4XTCS 4DV4Q 3HOZG 1QVCA 3RN2A 1N32Q 1VQOA 2K14A 1X65A 2YTXA 5ELNA 1N33L 1Z47A 3LGJA 2K5NA 3K81C 1PVOA 3FHWA 2DUDA 2Q2UA 1S72A 2CWAA 3CC7A 2R7ZH 1XMOL 1HR0W 3GTPH 4C2MH 5M3MH 4DR7L 3PUVA 5BR8L 2XTIA 2ZM6L 5IYBG 4IO9A 4B3SL 5FJ8H 4YY3Q 4KHPL 2JJQA 2JK8A 4QQBX 1X3FA 3J7A5 3GTKH 1XMQL 4AYBE 4GNXB 3PUZA 2F4VQ 4OO1G 4JI1L 3CF5A 4AH6A 1C9OA 2VY3A 1YHAA 3AFPA 2E2HH 4R4TA 4IPGA 2EIFA 4A3LG 4JOIC 3G71A 4JI7Q 1VQAA 2K4KA 4DV7Q 1Q1BA 4GS3A 2ES2A 4GLVB 4LF6L 1Z9FA 1J6QA 4O0AA 5IWAQ 1JJCB 3W1BA 5IT9c 3I2ZA 1UE7A 4A3DG 3I4OA 4AYBG 2IY5B 1YI2A 2JQOA 5FLXc 2I5HA 1SLJA 1BKBA 4WJ4A 4YWLA 3EIVA 2N78A 3HKZE 2UU9L 1XPUA 1ASYA 3I4MG 4PZ7A 4NB3A 4OX9L 2YU9H 1E7ZA 4ALPA 3CCLA 3MXNB 2UXBL 3T1HQ 2QGQA 1PYSB 3GO5A 4J15A 3ULLA 4A3EH 1K8GA 2B63H 4BBSH 2KBNA 2RHSB 3PIPA 4BY1H 1N34Q 1KAWA 5C0XJ 5GAGC 4DV0L 2K50A 1OXTA 3T1YL 2Z6KA 2VUMG 3HKZG 2PQAA 2E5LL 1SRUA 5M3FG 4A3BH 4OO1I 2UXCQ 1Q82C 1V9PA 4DR5Q 3WWVA 1VQJA 2JA6H 2A19A 3HOWG 1TXYA 4QGUA 3J81i 3J7ZC 2K5HA 2QA4A 2EXDA 1NY4A 3OTOL 4K0KQ 4PG3A 3BZCA 1FVIA 1PH5A 4JI0L 4JBWA 4KI0A 3A74A 1N36L 3HOVG 5DLQE 4X66Q 2VQFQ 5LMNL 4B3RL 3F8TA 3CC2A 1N9WA 4RMFA 4JBMA 2I5MX 5K36G 1JE5A 4HJ8A 1EWIA 4APVA 3I4NH 1J5EL 2UXDL 1M1KC 1B70B 3KF8B 1X55A 1NMGA 4A93H 4LUVA 3TS0A 3IRBA 4DUYL 3GTLH 1BBUA 2Z6KC 2BH2A 1SE8A 1VQDA 4O2DA 4DR4Q 1Q8KA 4JI3L 4OWTB 2E2JH 2K75A 2LSSA 1HNWL 3UDIA 4B3ML 3M4OH 4AIMA 3PO3G 1EIYB 1KL9A 2ID0A 4IJHA 2OWOA 2VS1A 1XJVA 1U5KA 4DR2Q 4OWXB 1FL0A 4MTNA 4A3FH 2V1CC 3CP0A 3M4QA 1GKHA 1SN8A 4H02A 4JI4L 5IP9H 2PI2A 4POGA 4BXXG 1VS0A 3FKIG 3PF4A 5M5YH 4LF9Q 1HZBA 4P73A 3PF5A 5IYCG 1CSQA 2N8NA 3OW2A 3GDEA 4KLKA 3PO2G 5GROA 2UUAQ 4UP8A 2YV5A 1IBMQ 1L1OC 5M5WH 1IBKL 2VW9A 2L15A 1PV4A 4DR6Q 5C4XG 1VQLA 4P71A 1A0IA 1I94L 4GN4B 4LF7Q 4YCVA 3AEVA 4A3CH 2DGYA 1HNXL 4LF4L 1VQFA 2I5LX 4A75A 4IFDI 1VQKA 4L5SA 1CKNA 2H5XA 1MJEA 4R4IA 4R4QA 1LYLA 1GD7A 4B3TQ 4GKKL 4JI8Q 4JV5L 2WB1E 2ATWA 1TWHH 1I5FA 4HJ7A 1JJ2A 3HOYH 1WJJA 4NXNL 2NN6G 2A1AA 1UWVA 1VQBA 2GVAA 3DM3A 4GLXA 2NVTH 4GOPC 2VNUD 4JOIA 5FLMG 3H0GG 4LFCL 3NELA 3KJPA 5C0XG 2F52A 1NE3A 4BBRG 3RR5A 1PH3A 1IZ6A 1RIPA 2R93H 1E24A 1HR0L 4X64Q 1LTLA 2WB1G 1NJIC 2R92H 3M3YH 1K0RA 1AE3A 1QUQA 4L5TA 4ME3A 5IE8A 2AMCB 3PSIA 1VQEA 4XIGS 4EQ5A 2ZM6Q 1FJGL 2XGTA 4B3SQ 1WOCA 1XTDA 4UPAA 1Y1VG 3UDFA 2PQAB 3U4ZA 3S1RH 3S15H 1G291 4DV1L 3GTOH 4JI6L 4TVAB 1SMXA 4JCVE 2YTYA 1WCMH 4LUZA 3CQZH 1B8AA 1YEZA 2HHHL 2JA5H 4A3CG 1Q1EA 4DV4L 2JA8G 4DV3L 1O7IA 3NEMA 1N32L 3HOXH 5JEAJ 1L2FA 4LF6Q 3CMEA 2E2IH 2JA7G 2JEBI 2OQKA 4A3GH 1A62A 1CUKA 2NN6I 3G6EA 1X56A 4IJLA 2K52A 2AWNA 3E0EA 1MKHA 3JC66 3GTQH 4LF5L 1VQ7A 4X65L 2UU9Q 2ASBA 1Q46A 5C0XI 4OONA 5IP7H 1X3GA 4JYAQ 1BVSA 4YWKA 3RLFA 2GVBA 4YY3L 5M3MG 4A3JH 3HOUH 2UXBQ 1SR3A 1QZHA 2Y0SE 2N49A 2HIXA 5C3EH 2RHQB 3K8AA 5FJ8G 1AE2A 5LMUL 4HJ5A 5HY6A 2IHFA 4MZ9A 1T9HA 2R7DA 4HIKA 4JI7L 5IYDH 4DK6C 1Y1WH 4C3IH 1MIUA 3J81c 4DV7L 3D31A 3KLWA 1IBLQ 4DAMA 5HGQA 4BA2I 1ASZA 1RL2A 5IWAL 4A3KH 2Y0SG 4DV6L 4DR3Q 4JI5Q 1GO3E 3W1GA 4JI0Q 2MQHA 3VDYA 3CCUA 2D0PA 2IHEA 1VQHA 3CCJA 3CW2C 2NVXH 1E22A 3W5OA 4Y7NH 3STBC 1C7YA 4B3RQ 2R7FA 1UE6A 1EFWA 4JC0A 2C35B 3FP9A 3I56A 1J5EQ 2ZJQA 4LF8Q 4DR1L 3T1HL 2E8GA 2WAQE 1TWCH 4YWMA 4A3IH 1GVPA 3M9BA 3TS2A 2IX0A 1N34L 3CMAA 1L1OA 2MO1A 4A3EG 3GD7A 1CKNB 2B63G 4BBSG 4LFBQ 4BY1G 4DV2Q 1G6PA 4PMWA 2B3GA 4QY7A 4B3MQ 4A4IA 1VQNA 2UXCL 4FDBA 1EIFA 2AWOA 1OXUA 4DR5L 1YIJA 2VZAA 4A3BG 1BBWA 1Q12A 4AQYQ 4Y52H 3K80C 3M4PA 2ZJRA 1YJ9A 4K0KL 3I7FA 1IL2A 3E9HA 3SGIA 2JA6G 2JEAI 3CCSA 2FXQA 3G4SA 5C44H 4A3MH 4DKAC 5H1SE 3M85A 2ZTEA 4JBKA 4OWWB 1X54A 1I3QH 4QIWE 2VQFL 3CCQA 1Q7YC 5AJ3L 1QVFA 3S1QH 1U0LA 1YZ6A 4C3JH 1HNZQ 1Q81C 1OTCA 2Q2TA 4JI2L 1PA6A 3S14H 1QUQB 4GOPA 1VQGA 2UUCQ 3L7ZC 1JT8A 4BY7H 3I4NG 1I94Q 2N3SA 1K3RA 2BA0A 3CAMA 1XNQQ 4YHHL 3TEHB 4DR4L 2R6GA 1I6HH 2UUBQ 4A93G 3KF6A 4P74A 1V43A 3CCMA 4R4OA 4EX5A 4OXPA 3UDGA 5JEAG 2MNAA 1YNXA 4DV5Q 1K8AC 3RZOH 5EAYA 3S2HH 1NBWA 2CKZB 3KOJA 2GN5A 3KDFA 1K9MC 1B7YB 2F3IA 2VQEQ 4DR2L 1XPOA 2D0OA 1OXVA 4LFAL 2BH8A 1V1QA 3U58A 1KIXA 1XNRQ 4GKKQ 2A8VA 3ZJYC 2EQSA 1QZGA 4R1JA 5GQOA 4X62L 3TQYA 3PUYA 4DAYB 2ZJPA 4DUZQ 1NTGA 4A3FG 4LW1A 3HOZH 2LXKA 3K7AH 4LF9L 3U50C 3GTJH 1EUJA 4A76A 5IP9G 3AFQA 1SROA 4PZ8A 4POFA 2I0QA 3D0FA 3BU2A 2Q2IA 4GKJQ 1P8LA 2IT1A 2K5VA 3S1NH 1IBML 1X6OA 2WP8J 3RLOA 1KQSA 4JBJA 1N33Q 4DR6L 3HFZB 4UP9A 3KJOA 1HR0Q 3S1MH 3RLNA 4NPSA 1EOVA 3EBEA 1LM0A 1HJPA 4PZ6A 2AKWB 3AQQA 5IYBH 1XMOQ 1GM5A 2MO0A 4C3HH 3PV0A 2KCTA 4NXML 2VL6A 4DR7Q 4X6AH 5BR8Q 1E3PA 3UE1A 2RF4A 4P72A 1LUZA 4KHPQ 5GAEC 1VQ9A 2YTVA 4B3TL 1KRSA 3KFUA 1W3SA 3F2BA 4TQUS 5J3BA 1XMQQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3L H;  4JI1 Q;  1PFS A;  1OXS C;  2Q2H A;  4DV3 Q;  2PMZ E;  1SFO H;  3J80 i;  1PH9 A;  3HOY G;  1M90 C;  1L0W A;  1YIT A;  1S3O A;  4R4C A;  2KCM A;  1VQ4 A;  1N8R C;  4A3D H;  1PH2 A;  3KYH C;  4QL5 A;  3CCV A;  1XPR A;  1KXL A;  2OCE A;  4JI6 Q;  4X64 L;  4UP7 A;  2R7Z G;  4IOA A;  4LF5 Q;  2R93 G;  1A63 A;  4X65 Q;  3I4M H;  1PH6 A;  3S24 A;  3GTG H;  1UEB A;  4HIM A;  2AHO B;  3AYH B;  1EQQ A;  1VQ5 A;  2R92 G;  3A0J A;  3M7N A;  3PUX A;  4JG2 A;  3CCE A;  5JJI A;  4IPD A;  1L1O B;  3PCO B;  4OX9 Q;  1PH8 A;  3NBH B;  1PH4 A;  3U4V A;  3ER0 A;  1TWA H;  5IY0 A;  2QEX A;  1UE1 A;  1CSP A;  1CKO A;  3L2P A;  5LMU Q;  3CPW A;  2NVQ H;  3H3V I;  2VUM H;  2F4V L;  3BZK A;  1VQ8 A;  1KRT A;  5M3F H;  4LWC A;  2D62 A;  4RG1 A;  4DV0 Q;  3PUW A;  3T1Y Q;  1C0A A;  1WCM G;  2HQL A;  2E5L Q;  3H15 A;  3NEN A;  2JA5 G;  3HOW H;  3J81 j;  3STB D;  1YJN A;  3JAM c;  4DV6 Q;  3Q8D A;  3HOX G;  1VQC A;  3F2D A;  2NZH A;  3PIO A;  3OTO Q;  1YHQ A;  1W2B A;  2OTL A;  4A3G G;  1PYB A;  2Z0S A;  5GAH C;  1CKM A;  3HOV H;  3JAM i;  3I55 A;  1TWF H;  4GOP B;  3E9I A;  1N36 Q;  2IX1 A;  4JYA L;  3RZD H;  3TRE A;  5LMN Q;  1I50 H;  1X9N A;  1VQI A;  3HKS A;  4DR1 Q;  1QVG A;  2ZTC A;  5IP7 G;  3BJU A;  3KF6 B;  3F1Z A;  1MJC A;  4A3J G;  5JJL A;  1HZC A;  2UXD Q;  3HOU G;  1H95 A;  1PH7 A;  2KEN A;  2ALY B;  3KDF B;  5C3E G;  1DGS A;  3CCR A;  4DUY Q;  5M5X H;  2PNH A;  4JI3 Q;  3PO3 H;  4DPG A;  4L5R C;  1WYD A;  1NMF A;  4DNI A;  4GNX A;  1IBL L;  5IYD G;  1Y1W G;  3S2D H;  1HNW Q;  4GN3 B;  4YCW A;  5JJK A;  1HZA A;  1YHB A;  3K7U C;  2OQ0 A;  4DR3 L;  1E1T A;  4JI5 L;  1PH1 A;  2WAQ G;  3S17 H;  4A3K G;  3FKI H;  4BXX H;  4LNQ A;  3OYY A;  4JI4 Q;  5IYC H;  3PO2 H;  3GTM H;  1OXX K;  5AJ3 Q;  1R9T H;  4X66 L;  1X3E A;  4JI2 Q;  2OTJ A;  1KHI A;  4LF8 L;  1G51 A;  4UY8 C;  5LMN W;  1VQ6 A;  5C4X H;  3K0X A;  1EQR A;  4QJF A;  1HZ9 A;  2MFI A;  1JJG A;  1IBK Q;  4IFD G;  3EN2 A;  4GLA C;  4YHH Q;  2NVY H;  1YJW A;  2B29 A;  4A3I G;  3A5U A;  2KHI A;  4LFB L;  4DV2 L;  4IPH A;  3ERS X;  2PI2 E;  1HNX Q;  4GNX C;  4GN5 A;  4LF4 Q;  4L5Q A;  1YVC A;  4AQY L;  3CPF A;  4LFA Q;  2JE6 I;  2WFW A;  2ZTD A;  1D8L A;  2KHJ A;  1E1O A;  2CQO A;  1S40 A;  1VQM A;  2HT1 A;  2BA1 A;  1TWG H;  3ULP A;  1KC8 C;  1WI5 A;  4X62 Q;  1K83 H;  2RCN A;  3MEF A;  3CD6 A;  2CWP A;  3RN5 A;  4LUO A;  3TRZ A;  4JV5 Q;  4HJA A;  4YCU A;  1VCI A;  4WJ3 M;  3L0O A;  5C44 G;  5FLM H;  4A3M G;  3ICE A;  2HIV A;  4NXN Q;  1HNZ L;  3H0G H;  5C4J H;  1VQP A;  5E7N A;  1UE5 A;  4BBR H;  2CCZ A;  4P75 A;  2JA9 A;  2UUC L;  2UUA L;  4LFC Q;  1Y14 B;  1HH2 P;  3F2C A;  4HID A;  3DLL A;  2YYZ A;  4HJ9 A;  4IOC A;  3PGZ A;  3RNU A;  1XNQ L;  3S16 H;  1PHJ A;  3H3V H;  3UDX A;  5GAD C;  2UUB L;  4BY7 G;  4LF7 L;  2NZO A;  4MNO A;  3UE0 A;  2LXJ A;  4DV5 L;  4NXM Q;  4BA1 I;  1Y1V H;  5ELO A;  1FJG Q;  1A8V A;  2VQE L;  2CFM A;  3G48 A;  3A5Z B;  3CXC A;  1XNR L;  1FGU A;  1Q86 C;  4KHZ A;  1EYG A;  3CC4 A;  4DV1 Q;  1IYJ B;  4DUZ L;  1IXR A;  4HIO A;  3J80 c;  1YBY A;  1WFQ A;  4JI8 L;  4DK3 C;  1JB7 A;  2JA8 H;  3ULJ A;  1K73 C;  2HHH Q;  1D7Q A;  4IFD J;  4GKJ L;  3B6Y A;  1AH9 A;  1JMC A;  4IPC A;  1P16 A;  1KD1 C;  2JA7 H;  4XTC S;  4DV4 Q;  3HOZ G;  1QVC A;  3RN2 A;  1N32 Q;  1VQO A;  2K14 A;  1X65 A;  2YTX A;  5ELN A;  1N33 L;  1Z47 A;  3LGJ A;  2K5N A;  3K81 C;  1PVO A;  3FHW A;  2DUD A;  2Q2U A;  1S72 A;  2CWA A;  3CC7 A;  2R7Z H;  1XMO L;  1HR0 W;  3GTP H;  4C2M H;  5M3M H;  4DR7 L;  3PUV A;  5BR8 L;  2XTI A;  2ZM6 L;  5IYB G;  4IO9 A;  4B3S L;  5FJ8 H;  4YY3 Q;  4KHP L;  2JJQ A;  2JK8 A;  4QQB X;  1X3F A;  3J7A 5;  3GTK H;  1XMQ L;  4AYB E;  4GNX B;  3PUZ A;  2F4V Q;  4OO1 G;  4JI1 L;  3CF5 A;  4AH6 A;  1C9O A;  2VY3 A;  1YHA A;  3AFP A;  2E2H H;  4R4T A;  4IPG A;  2EIF A;  4A3L G;  4JOI C;  3G71 A;  4JI7 Q;  1VQA A;  2K4K A;  4DV7 Q;  1Q1B A;  4GS3 A;  2ES2 A;  4GLV B;  4LF6 L;  1Z9F A;  1J6Q A;  4O0A A;  5IWA Q;  1JJC B;  3W1B A;  5IT9 c;  3I2Z A;  1UE7 A;  4A3D G;  3I4O A;  4AYB G;  2IY5 B;  1YI2 A;  2JQO A;  5FLX c;  2I5H A;  1SLJ A;  1BKB A;  4WJ4 A;  4YWL A;  3EIV A;  2N78 A;  3HKZ E;  2UU9 L;  1XPU A;  1ASY A;  3I4M G;  4PZ7 A;  4NB3 A;  4OX9 L;  2YU9 H;  1E7Z A;  4ALP A;  3CCL A;  3MXN B;  2UXB L;  3T1H Q;  2QGQ A;  1PYS B;  3GO5 A;  4J15 A;  3ULL A;  4A3E H;  1K8G A;  2B63 H;  4BBS H;  2KBN A;  2RHS B;  3PIP A;  4BY1 H;  1N34 Q;  1KAW A;  5C0X J;  5GAG C;  4DV0 L;  2K50 A;  1OXT A;  3T1Y L;  2Z6K A;  2VUM G;  3HKZ G;  2PQA A;  2E5L L;  1SRU A;  5M3F G;  4A3B H;  4OO1 I;  2UXC Q;  1Q82 C;  1V9P A;  4DR5 Q;  3WWV A;  1VQJ A;  2JA6 H;  2A19 A;  3HOW G;  1TXY A;  4QGU A;  3J81 i;  3J7Z C;  2K5H A;  2QA4 A;  2EXD A;  1NY4 A;  3OTO L;  4K0K Q;  4PG3 A;  3BZC A;  1FVI A;  1PH5 A;  4JI0 L;  4JBW A;  4KI0 A;  3A74 A;  1N36 L;  3HOV G;  5DLQ E;  4X66 Q;  2VQF Q;  5LMN L;  4B3R L;  3F8T A;  3CC2 A;  1N9W A;  4RMF A;  4JBM A;  2I5M X;  5K36 G;  1JE5 A;  4HJ8 A;  1EWI A;  4APV A;  3I4N H;  1J5E L;  2UXD L;  1M1K C;  1B70 B;  3KF8 B;  1X55 A;  1NMG A;  4A93 H;  4LUV A;  3TS0 A;  3IRB A;  4DUY L;  3GTL H;  1BBU A;  2Z6K C;  2BH2 A;  1SE8 A;  1VQD A;  4O2D A;  4DR4 Q;  1Q8K A;  4JI3 L;  4OWT B;  2E2J H;  2K75 A;  2LSS A;  1HNW L;  3UDI A;  4B3M L;  3M4O H;  4AIM A;  3PO3 G;  1EIY B;  1KL9 A;  2ID0 A;  4IJH A;  2OWO A;  2VS1 A;  1XJV A;  1U5K A;  4DR2 Q;  4OWX B;  1FL0 A;  4MTN A;  4A3F H;  2V1C C;  3CP0 A;  3M4Q A;  1GKH A;  1SN8 A;  4H02 A;  4JI4 L;  5IP9 H;  2PI2 A;  4POG A;  4BXX G;  1VS0 A;  3FKI G;  3PF4 A;  5M5Y H;  4LF9 Q;  1HZB A;  4P73 A;  3PF5 A;  5IYC G;  1CSQ A;  2N8N A;  3OW2 A;  3GDE A;  4KLK A;  3PO2 G;  5GRO A;  2UUA Q;  4UP8 A;  2YV5 A;  1IBM Q;  1L1O C;  5M5W H;  1IBK L;  2VW9 A;  2L15 A;  1PV4 A;  4DR6 Q;  5C4X G;  1VQL A;  4P71 A;  1A0I A;  1I94 L;  4GN4 B;  4LF7 Q;  4YCV A;  3AEV A;  4A3C H;  2DGY A;  1HNX L;  4LF4 L;  1VQF A;  2I5L X;  4A75 A;  4IFD I;  1VQK A;  4L5S A;  1CKN A;  2H5X A;  1MJE A;  4R4I A;  4R4Q A;  1LYL A;  1GD7 A;  4B3T Q;  4GKK L;  4JI8 Q;  4JV5 L;  2WB1 E;  2ATW A;  1TWH H;  1I5F A;  4HJ7 A;  1JJ2 A;  3HOY H;  1WJJ A;  4NXN L;  2NN6 G;  2A1A A;  1UWV A;  1VQB A;  2GVA A;  3DM3 A;  4GLX A;  2NVT H;  4GOP C;  2VNU D;  4JOI A;  5FLM G;  3H0G G;  4LFC L;  3NEL A;  3KJP A;  5C0X G;  2F52 A;  1NE3 A;  4BBR G;  3RR5 A;  1PH3 A;  1IZ6 A;  1RIP A;  2R93 H;  1E24 A;  1HR0 L;  4X64 Q;  1LTL A;  2WB1 G;  1NJI C;  2R92 H;  3M3Y H;  1K0R A;  1AE3 A;  1QUQ A;  4L5T A;  4ME3 A;  5IE8 A;  2AMC B;  3PSI A;  1VQE A;  4XIG S;  4EQ5 A;  2ZM6 Q;  1FJG L;  2XGT A;  4B3S Q;  1WOC A;  1XTD A;  4UPA A;  1Y1V G;  3UDF A;  2PQA B;  3U4Z A;  3S1R H;  3S15 H;  1G29 1;  4DV1 L;  3GTO H;  4JI6 L;  4TVA B;  1SMX A;  4JCV E;  2YTY A;  1WCM H;  4LUZ A;  3CQZ H;  1B8A A;  1YEZ A;  2HHH L;  2JA5 H;  4A3C G;  1Q1E A;  4DV4 L;  2JA8 G;  4DV3 L;  1O7I A;  3NEM A;  1N32 L;  3HOX H;  5JEA J;  1L2F A;  4LF6 Q;  3CME A;  2E2I H;  2JA7 G;  2JEB I;  2OQK A;  4A3G H;  1A62 A;  1CUK A;  2NN6 I;  3G6E A;  1X56 A;  4IJL A;  2K52 A;  2AWN A;  3E0E A;  1MKH A;  3JC6 6;  3GTQ H;  4LF5 L;  1VQ7 A;  4X65 L;  2UU9 Q;  2ASB A;  1Q46 A;  5C0X I;  4OON A;  5IP7 H;  1X3G A;  4JYA Q;  1BVS A;  4YWK A;  3RLF A;  2GVB A;  4YY3 L;  5M3M G;  4A3J H;  3HOU H;  2UXB Q;  1SR3 A;  1QZH A;  2Y0S E;  2N49 A;  2HIX A;  5C3E H;  2RHQ B;  3K8A A;  5FJ8 G;  1AE2 A;  5LMU L;  4HJ5 A;  5HY6 A;  2IHF A;  4MZ9 A;  1T9H A;  2R7D A;  4HIK A;  4JI7 L;  5IYD H;  4DK6 C;  1Y1W H;  4C3I H;  1MIU A;  3J81 c;  4DV7 L;  3D31 A;  3KLW A;  1IBL Q;  4DAM A;  5HGQ A;  4BA2 I;  1ASZ A;  1RL2 A;  5IWA L;  4A3K H;  2Y0S G;  4DV6 L;  4DR3 Q;  4JI5 Q;  1GO3 E;  3W1G A;  4JI0 Q;  2MQH A;  3VDY A;  3CCU A;  2D0P A;  2IHE A;  1VQH A;  3CCJ A;  3CW2 C;  2NVX H;  1E22 A;  3W5O A;  4Y7N H;  3STB C;  1C7Y A;  4B3R Q;  2R7F A;  1UE6 A;  1EFW A;  4JC0 A;  2C35 B;  3FP9 A;  3I56 A;  1J5E Q;  2ZJQ A;  4LF8 Q;  4DR1 L;  3T1H L;  2E8G A;  2WAQ E;  1TWC H;  4YWM A;  4A3I H;  1GVP A;  3M9B A;  3TS2 A;  2IX0 A;  1N34 L;  3CMA A;  1L1O A;  2MO1 A;  4A3E G;  3GD7 A;  1CKN B;  2B63 G;  4BBS G;  4LFB Q;  4BY1 G;  4DV2 Q;  1G6P A;  4PMW A;  2B3G A;  4QY7 A;  4B3M Q;  4A4I A;  1VQN A;  2UXC L;  4FDB A;  1EIF A;  2AWO A;  1OXU A;  4DR5 L;  1YIJ A;  2VZA A;  4A3B G;  1BBW A;  1Q12 A;  4AQY Q;  4Y52 H;  3K80 C;  3M4P A;  2ZJR A;  1YJ9 A;  4K0K L;  3I7F A;  1IL2 A;  3E9H A;  3SGI A;  2JA6 G;  2JEA I;  3CCS A;  2FXQ A;  3G4S A;  5C44 H;  4A3M H;  4DKA C;  5H1S E;  3M85 A;  2ZTE A;  4JBK A;  4OWW B;  1X54 A;  1I3Q H;  4QIW E;  2VQF L;  3CCQ A;  1Q7Y C;  5AJ3 L;  1QVF A;  3S1Q H;  1U0L A;  1YZ6 A;  4C3J H;  1HNZ Q;  1Q81 C;  1OTC A;  2Q2T A;  4JI2 L;  1PA6 A;  3S14 H;  1QUQ B;  4GOP A;  1VQG A;  2UUC Q;  3L7Z C;  1JT8 A;  4BY7 H;  3I4N G;  1I94 Q;  2N3S A;  1K3R A;  2BA0 A;  3CAM A;  1XNQ Q;  4YHH L;  3TEH B;  4DR4 L;  2R6G A;  1I6H H;  2UUB Q;  4A93 G;  3KF6 A;  4P74 A;  1V43 A;  3CCM A;  4R4O A;  4EX5 A;  4OXP A;  3UDG A;  5JEA G;  2MNA A;  1YNX A;  4DV5 Q;  1K8A C;  3RZO H;  5EAY A;  3S2H H;  1NBW A;  2CKZ B;  3KOJ A;  2GN5 A;  3KDF A;  1K9M C;  1B7Y B;  2F3I A;  2VQE Q;  4DR2 L;  1XPO A;  2D0O A;  1OXV A;  4LFA L;  2BH8 A;  1V1Q A;  3U58 A;  1KIX A;  1XNR Q;  4GKK Q;  2A8V A;  3ZJY C;  2EQS A;  1QZG A;  4R1J A;  5GQO A;  4X62 L;  3TQY A;  3PUY A;  4DAY B;  2ZJP A;  4DUZ Q;  1NTG A;  4A3F G;  4LW1 A;  3HOZ H;  2LXK A;  3K7A H;  4LF9 L;  3U50 C;  3GTJ H;  1EUJ A;  4A76 A;  5IP9 G;  3AFQ A;  1SRO A;  4PZ8 A;  4POF A;  2I0Q A;  3D0F A;  3BU2 A;  2Q2I A;  4GKJ Q;  1P8L A;  2IT1 A;  2K5V A;  3S1N H;  1IBM L;  1X6O A;  2WP8 J;  3RLO A;  1KQS A;  4JBJ A;  1N33 Q;  4DR6 L;  3HFZ B;  4UP9 A;  3KJO A;  1HR0 Q;  3S1M H;  3RLN A;  4NPS A;  1EOV A;  3EBE A;  1LM0 A;  1HJP A;  4PZ6 A;  2AKW B;  3AQQ A;  5IYB H;  1XMO Q;  1GM5 A;  2MO0 A;  4C3H H;  3PV0 A;  2KCT A;  4NXM L;  2VL6 A;  4DR7 Q;  4X6A H;  5BR8 Q;  1E3P A;  3UE1 A;  2RF4 A;  4P72 A;  1LUZ A;  4KHP Q;  5GAE C;  1VQ9 A;  2YTV A;  4B3T L;  1KRS A;  3KFU A;  1W3S A;  3F2B A;  4TQU S;  5J3B A;  1XMQ Q; 
#chains in the Genus database with same CATH topology
 3C3L A;  5JAV A;  4E6I A;  1PFS A;  1OXS C;  2EDG A;  5F2D A;  2PMZ E;  3J7A F;  3SK5 A;  2IWH A;  1M90 C;  3HOY G;  1F2M A;  4R4C A;  2A6E D;  4A3D H;  4MIU A;  4QL5 A;  2BE5 D;  1LLR D;  3I8Z A;  1YNJ D;  4LF5 Q;  4X65 Q;  4ME5 A;  3GTG H;  1BCP B;  3AYH B;  1EQQ A;  2B63 B;  5CR3 A;  4JG2 A;  3T53 B;  3CCE A;  5KEE A;  4OX9 Q;  2EJF C;  2O2L D;  1WTP A;  3U4V A;  1CT1 D;  5IY0 A;  1UE1 A;  3CPW A;  4LWC A;  2JA6 B;  5FOB B;  3PUW A;  3URY A;  1TS2 A;  2RVL A;  1Z6H A;  3J81 j;  2K5W A;  1WTR A;  1FNW A;  3Q8D A;  3QOL A;  1HTL D;  1YHQ A;  4X3S A;  2OTL A;  1PYB A;  2Z0S A;  1Y8P B;  4FF3 A;  3HOV H;  3JAM i;  1SYE A;  5C4Z A;  5C4X B;  4N9T A;  3RZD H;  1VQI A;  3HKS A;  1GOZ A;  3F1Z A;  4A3J G;  1TII D;  2UXD Q;  5CBE E;  3M4O B;  2IL8 A;  5C3E G;  3QB3 A;  3DHQ A;  1ZXT A;  3HGB A;  4XDX A;  3LWU A;  3H6M A;  1WYD A;  4A3F B;  1NMF A;  1IBL L;  5ELB A;  4DU9 A;  2SNS A;  2TMP A;  3K7U C;  2OQ0 A;  1K3B C;  2RDH A;  1PH1 A;  4V0B A;  1YNN D;  5HGT A;  1QNU A;  2NB0 A;  1O80 A;  4LNQ A;  2DY7 A;  3GTM H;  4G4K A;  5BN4 A;  4X66 L;  4KD3 A;  1ZKO A;  1PRT F;  5DEH A;  3K0X A;  1EQR A;  1JJG A;  2N55 A;  5JVG 3;  3EN2 A;  4GLA C;  3I90 A;  2NVY H;  3GV3 A;  3MWY W;  2K28 A;  4XT1 B;  2LKV A;  2L0C A;  1HNX Q;  4H44 C;  1ILQ A;  4FO2 A;  4LF4 Q;  3S2D B;  1E1O A;  3HOY B;  1VQM A;  4KY7 A;  1KC8 C;  1WI5 A;  1XXG A;  3E3X A;  4LUO A;  1MSG A;  4MTK A;  1D5Z C;  1KAB A;  5C44 G;  2F0M A;  5EKL A;  4A3M G;  2HIV A;  3ICE A;  1HNZ L;  1Y8O B;  4OIJ A;  1VQP A;  1L0Y B;  2CCZ A;  4P75 A;  3PO2 G;  2JA9 A;  4C1N I;  4HJ9 A;  4FXK C;  1PHJ A;  3H3V H;  3HP3 A;  5GAD C;  3CRL C;  2NZO A;  1RF2 D;  3S1R B;  3U9O A;  4NXM Q;  3KF8 A;  1F2L A;  2K32 A;  1FJG Q;  1A8V A;  3GP7 A;  2VQE L;  3MXG A;  3G48 A;  4L6T B;  1ESR A;  1PTO B;  1EYG A;  2CH4 A;  4DV1 Q;  1IXR A;  1YBY A;  5A2Q L;  4DK3 C;  1JB7 A;  3ULJ A;  1C48 A;  1D7Q A;  2IX3 A;  1P16 A;  1KD1 C;  1CQV A;  3RN2 A;  5I2X A;  1VQO A;  1LTT D;  1R4Q B;  1X65 A;  1TS5 A;  1N33 L;  1NAP A;  2ZXP A;  2K5N A;  1PVO A;  2CWA A;  4A3J B;  5C4H A;  4CDC C;  5C3E B;  3PUV A;  4J6H A;  5FJ8 H;  4C3H G;  3VYS A;  2JJQ A;  4G7O C;  3A8I E;  4MHE A;  4QQB X;  3M7G A;  4OO1 G;  4AH6 A;  1YHA A;  1DCZ A;  2VB2 X;  4G57 A;  4R4T A;  2EVB A;  2K4K A;  1BNZ A;  1SNQ A;  4GZY C;  2CW0 C;  4DV7 Q;  1SJH D;  4LF6 L;  4O0A A;  3VR5 A;  2HDL A;  3LWE A;  5EJW A;  3I4O A;  1QE6 A;  4XYO A;  4HMI A;  4YWL A;  2N78 A;  1ASY A;  1F9P A;  1Y69 U;  4OX9 L;  4RAU C;  2F3W A;  3CCL A;  3WDN A;  3GO5 A;  1K8G A;  4A3E H;  2B63 H;  3SEB A;  2KBN A;  2E2J B;  3PIP A;  2B2Y C;  5C0X J;  2K05 A;  4R8I A;  1DYQ A;  2Z6K A;  5EKK A;  4FF4 A;  2NWG A;  2VUM G;  3SVM A;  4OO1 I;  4RGM A;  1Q82 C;  5C44 B;  4DR5 Q;  4A3M B;  2JA6 H;  1TXY A;  4QGU A;  2EXD A;  1PDQ A;  2EY1 A;  4PG3 A;  1PH5 A;  2B2T C;  3S14 B;  2L12 A;  4JBW A;  4KI0 A;  3T13 A;  1CFM A;  4KY6 A;  2VQF Q;  1CHQ D;  4B3R L;  3CC2 A;  2PZU A;  4RMF A;  4JBM A;  5K36 G;  1JE5 A;  1EWI A;  3CHB D;  4HSV A;  3K5M A;  1CK1 A;  2UXD L;  3KF8 B;  1NMG A;  3NWT A;  4TKO B;  3IRB A;  5C6A A;  1BBU A;  1VQD A;  4O2D A;  1BOS A;  1Q8K A;  3HZX A;  2HD3 A;  2ENB A;  3M4O H;  1EIY B;  1KL9 A;  5I6Y A;  2DNE A;  4BS9 A;  4IJH A;  2VS1 A;  5COY A;  4DR2 Q;  3GTJ B;  3ERO A;  1CA6 A;  1STY A;  4A3F H;  1SN8 A;  4H02 A;  5IP9 H;  3WOE A;  1JC7 A;  4P73 A;  4IZ8 A;  4C3H B;  1A0I A;  1I94 L;  4G7Z C;  1GUN A;  2EY6 A;  1HNX L;  1TY0 A;  4LF4 L;  1VQF A;  4IUU A;  3K59 A;  3AU7 A;  3MFY A;  2EXZ A;  4J1M A;  1KAA A;  4R4Q A;  2L55 A;  4JI8 Q;  3HS0 C;  1XX8 A;  1TWH H;  4PQX A;  1JJ2 A;  3HOY H;  5CYU A;  5FLM G;  3H0G G;  4DXF A;  4RGO S;  3KJP A;  4F7X A;  2E76 C;  2A5H A;  4L5T A;  5I2Y A;  3Q24 A;  2ZM6 Q;  2VUM B;  4ZCK A;  2XGT A;  1FJG L;  5FO9 B;  2QCP X;  3MHB A;  4CBV A;  1Y1V G;  3U4Z A;  3S1R H;  4DV1 L;  3K58 A;  1KDC A;  4LUZ A;  1F9R A;  2PQE A;  1PTO H;  4A3C G;  1B3A A;  1Q1E A;  4U67 3;  4PV1 C;  3NEM A;  4WOR A;  2RCF A;  1L2F A;  2J0T D;  4NP5 A;  5JEA J;  2E2I H;  3V2T A;  1A62 A;  4IJL A;  1PFB A;  3SK6 A;  2K52 A;  2AWN A;  1H9J A;  3E0E A;  1MKH A;  3JC6 6;  1Q46 A;  2MP1 A;  2B8G A;  1I6V C;  3T4A C;  4OON A;  2D5D A;  1BVS A;  3RLF A;  1SMY D;  1A3T A;  2GVB A;  3ZYY X;  5M3M G;  4A3J H;  1GUW A;  1IKM A;  1QZH A;  2Y0S E;  5C3E H;  4KTA A;  1AE2 A;  5LMU L;  2QDB A;  2Z6B A;  4HJ5 A;  3D6C A;  1T9H A;  2R7D A;  1BQQ T;  1ML0 D;  3S17 B;  1HHV A;  4DV7 L;  1RHP A;  3N52 A;  5ELF A;  2A69 C;  3KLW A;  2Y0S G;  2K33 A;  4JI5 Q;  3W1G A;  4JI0 Q;  3VDY A;  2IHE A;  4J8Q A;  4R9W A;  1EY4 A;  1O7Z A;  4KJO A;  4Y7N H;  3W5O A;  3STB C;  3P75 A;  2R7F A;  2L4N A;  1UE6 A;  4BY7 B;  3FP9 A;  2EY5 A;  2EPB A;  2P5Z X;  3NTH A;  1TWC H;  4YWM A;  1GVP A;  3CMA A;  2F0T A;  4BBS G;  1SYG A;  1TT2 A;  3NBH A;  4LFB Q;  2NBF A;  4BY1 G;  4DV2 Q;  1G6P A;  4K5V A;  3KLS X;  3IFD A;  4B3M Q;  1TWG B;  3OHX C;  1BCP F;  1G6Z A;  4DR5 L;  2AWO A;  1YIJ A;  4A3B G;  3K80 C;  3I7F A;  2K7V A;  3SGI A;  3H0G B;  5C4J B;  2JEA I;  1AZP A;  5C44 H;  4A3M H;  4DKA C;  3M85 A;  1CZW A;  3CCQ A;  1Q7Y C;  2VQF L;  1I4R A;  1SYC A;  1JQY D;  4KKS A;  3TSS A;  3S16 B;  3DUZ A;  4EQO A;  1U0L A;  4K5X A;  5NUC A;  3S14 H;  4JI2 L;  4RCN A;  1PA6 A;  4DFA A;  1ILP A;  3T56 B;  4DNT B;  3L7Z C;  1JT8 A;  1Y1V B;  4DK1 A;  2F0L A;  3CAM A;  4YHH L;  1XNQ Q;  4MN3 A;  4A93 G;  2PZT A;  1V43 A;  4EX5 A;  5FKA C;  5EPK A;  3RZO H;  1S5B D;  3P7J A;  1EY5 A;  2GN5 A;  2JYO A;  1B7Y B;  1XPO A;  1U4L A;  4DR2 L;  2D0O A;  1OXV A;  2BH8 A;  1EU3 A;  2EQS A;  4R1J A;  1KNA A;  4NKL A;  1HPC A;  3PUY A;  1TVX A;  3A8J E;  1BO0 A;  2QIL A;  5KYL A;  2OF1 A;  3TP8 A;  3U50 C;  3GTJ H;  1EUJ A;  2I0Q A;  4GKJ Q;  3BU2 A;  2Q2I A;  2Q8I B;  1SNO A;  2IT1 A;  1GJX A;  2KEC A;  4C2M B;  3P1H A;  5M3M B;  5CV6 A;  1J8I A;  5JJZ A;  1IKL A;  2F0I A;  1EOV A;  3EBE A;  2B39 A;  4PZ6 A;  4C3H H;  4DNR B;  2VL6 A;  1E3P A;  1V1P A;  3UE1 A;  5E3F A;  2RF4 A;  4OO1 H;  4K6L A;  1VQ9 A;  5CV4 A;  2K1B A;  4JK1 C;  4FF1 A;  1W3S A;  1FNV A;  4TQU S;  2Y0S B;  4JI1 Q;  2MHV A;  4FP5 D;  1B9M A;  3G7L A;  1PH9 A;  5JVH 3;  1EYA A;  3KYH C;  4QUF A;  1XPR A;  3CCV A;  3JAM E;  1EU4 A;  1PFN A;  1Q3L A;  4P2C B;  4UP7 A;  3RZD B;  1LO5 D;  1SE2 A;  1TY2 A;  2VXW A;  1A63 A;  3J81 L;  3S24 A;  4RKL A;  1UEB A;  3BVM A;  4BBS B;  2R92 G;  3A0J A;  4BY1 B;  3M7N A;  1HXY D;  3PCO B;  5LHY 1;  3NBH B;  3DWQ A;  4A3B B;  3L2P A;  3H3V I;  2VUM H;  2F4V L;  3BZK A;  1VQ8 A;  2H4O A;  4N9P A;  1WCM G;  2Z8L A;  2HQL A;  3X3N A;  3H15 A;  3CRK C;  1GUO A;  1YJN A;  1NNX A;  5IOD A;  3HOX G;  3QO2 A;  3PIO A;  1SYF A;  3J7Y W;  1PTO F;  3OTO Q;  1CA5 A;  3H09 A;  1NR4 A;  1W6K A;  4A3G G;  5GAH C;  1CKM A;  5K36 H;  3E9I A;  2Q8R E;  1X9N A;  4A93 B;  2SEB D;  2ZTC A;  2HCI A;  1SAP A;  5JJL A;  1HZC A;  1PXU A;  3HOU G;  3NPP A;  1DGS A;  2KCN A;  3F2U A;  1JOQ A;  1C8C A;  5C5M A;  1RDP D;  4JI3 Q;  2G5D A;  1F9Q A;  5IGB A;  4KV6 A;  4OEL B;  4GNX A;  4XYQ A;  4GN3 B;  4YCW A;  4L63 B;  3PIO 3;  4JI5 L;  5M5Y B;  5FO8 B;  1EYD A;  3I3C A;  3S17 H;  4A3K G;  4FVM A;  4JI4 Q;  2EYM A;  1R9T H;  1X3E A;  1ENA A;  1G51 A;  1VQ6 A;  5LMN W;  4EVO A;  1HZ9 A;  2MFI A;  1B2T A;  1IBK Q;  4JW0 A;  3SXH A;  2A6H C;  1EQV A;  1V1P B;  4LFB L;  4DV2 L;  1EIH A;  3MXN A;  3ERS X;  5C5L A;  2QKI C;  1YVC A;  2EJG C;  4JPB W;  1IW7 D;  2WFW A;  1S40 A;  2KHJ A;  1PRT C;  2SNM A;  2KEE A;  1TWG H;  2Z4I A;  3T51 B;  4H13 C;  3RN5 A;  3TRZ A;  2HDM A;  2A73 B;  3J80 E;  5FLM H;  3H0G H;  5C4J H;  4FYD A;  3C1E A;  1UE5 A;  4ZLT F;  2R92 B;  1SSO A;  3MVV A;  1Y14 B;  1HA6 A;  3DLL A;  4EGV A;  4I7A A;  1XNQ L;  3S16 H;  2L11 A;  4CKE A;  3UDX A;  1F77 A;  3UE0 A;  2LXJ A;  4I65 A;  1B1Z A;  1Y1V H;  1VDZ A;  3C1F A;  2Q8T A;  4CGY B;  3D4D A;  4F8M A;  1FGU A;  1LT3 D;  2M9V A;  4A3C H;  4HIO A;  3HOX B;  5J1Z A;  1WFQ A;  3NE5 B;  5E1F A;  1K73 C;  4A3G B;  4IFD J;  4UDU C;  4GKJ L;  1Q90 A;  1WD1 A;  1JMC A;  4RFB A;  4DV4 Q;  1QVC A;  2DNC A;  3GTQ B;  5ELN A;  5KGU A;  3K81 C;  2SDF A;  1SXT A;  2FHT A;  5IT9 E;  3X3M A;  3AB9 A;  5FLX E;  1HR0 W;  4EQP A;  4C2M H;  5M3M H;  2CVR A;  1HQM C;  4DGZ A;  4A3E B;  3K6O A;  4ZKB B;  2CW0 D;  4B3S L;  5DM7 3;  2EYH A;  4GNX B;  3PUZ A;  4OGQ C;  4JI1 L;  2AQ1 B;  1WTX A;  1STB A;  4Z9C B;  4A3L G;  1QG7 A;  3I91 A;  2E2D C;  1SBB B;  2JSO A;  2O4X A;  4GS3 A;  2ES2 A;  5L37 A;  1BXT A;  1Z9F A;  5IWA Q;  3W1B A;  5KYI A;  1LTI D;  1YI2 A;  2JQO A;  5FO7 B;  1SLJ A;  3DMU A;  3EIV A;  4PZ7 A;  1LAB A;  1RCV D;  2F0N A;  1HFG A;  4ALP A;  3MXN B;  2UXB L;  3T1H Q;  2QGQ A;  4J15 A;  4BBS H;  3NQT A;  2RHS B;  4BY1 H;  5BN5 A;  3DWA A;  1WVL A;  2JP1 A;  1OXT A;  3Q23 A;  2NTS A;  4A3B H;  1EIG A;  2UXC Q;  1EZ6 A;  2AQ3 B;  3KBG A;  2A19 A;  3OW7 A;  3HOW G;  4IN3 A;  2K5H A;  1ZYR C;  2M2L A;  3OTO L;  2QA4 A;  3MC0 B;  5J22 A;  1FVI A;  2LMC B;  3BG3 A;  5DLQ E;  3TP7 A;  4CKC A;  1F2Y A;  4RGN A;  3VR3 A;  2PZW A;  3SDZ A;  5JOB A;  2DY8 A;  1ICW A;  3QR8 A;  4F88 A;  3S2H B;  4A93 H;  4O42 A;  4LUV A;  3TS0 A;  1SE8 A;  5D3D A;  4JI3 L;  3V05 A;  3UDI A;  3PO3 G;  4H7B A;  2OWO A;  1U5K A;  1TWH B;  4MTN A;  4ZK9 B;  2QW7 A;  1GHK A;  4JI4 L;  2LS0 1;  3OPO A;  1B4O A;  3PF4 A;  4ZKC B;  5M5Y H;  5IOC A;  3PF5 A;  2KHS A;  1CSQ A;  3NBI A;  1HQR D;  3QWN A;  4KKU A;  4KLK A;  5CV8 A;  5IYC G;  1A2U A;  4IUQ A;  2UUA Q;  1DZ1 A;  4UP8 A;  2PMZ B;  2YV5 A;  4RCO A;  1IBK L;  1IBM Q;  4DR6 Q;  4XQQ A;  1QIL A;  1KDA A;  4LF7 Q;  1GUT A;  4KKT A;  2O5I C;  1D5M C;  1HFN A;  1DOM A;  4L5S A;  2H5X A;  1FYC A;  4B3T Q;  4GKK L;  5IGF A;  3NQI A;  2ZXR A;  4HJ7 A;  2RQX A;  2E2I B;  2MPM A;  1EOT A;  1K8M A;  3I4L A;  2A1A A;  1UWV A;  2GVA A;  3A8K E;  3DM3 A;  4GLX A;  2VNU D;  4JOI A;  3MXU A;  4K2K A;  2K6A A;  3NEL A;  4G7H C;  2F52 A;  4BBR G;  1SYD A;  5G3L F;  2R92 H;  3M3Y H;  1WTQ A;  3NK9 A;  3PSI A;  3R2I A;  5KND A;  3OIP A;  4UPA A;  3UDF A;  3C46 A;  1EEI D;  1G29 1;  3GTO H;  2PYK A;  2RSN A;  1EYC A;  1JE4 A;  1SMX A;  4TVA B;  4JCV E;  3HOW B;  1TS3 A;  1WCM H;  2YTY A;  1B8A A;  5IGD A;  4IUN A;  1E2V A;  1MHW C;  4DV4 L;  2JA8 G;  1SNM A;  1WTV A;  2D9U A;  3HOX H;  2K5Q A;  1TWF B;  3CME A;  2JA7 G;  4A3G H;  1D1I A;  3BDC A;  1X56 A;  4Y7N B;  1EY8 A;  4CJ2 C;  2AQ2 B;  3H3V C;  3GTQ H;  4LF5 L;  1VQ7 A;  4X65 L;  2UU9 Q;  4ZUI A;  3TDQ A;  1TWC B;  4DK0 A;  1BDO A;  1X3G A;  2A6E C;  4JYA Q;  4YWK A;  5CMD A;  2A69 D;  5CC4 A;  3HOU H;  1SR3 A;  3PO3 B;  4HSP A;  3K8A A;  3IKJ A;  2XSC A;  4QMG A;  5HY6 A;  1QCB D;  2IHF A;  1F2Z A;  4LAA A;  4PMC A;  3LNN A;  4ZUJ A;  5IWA L;  3PO2 B;  4A3K H;  1IL8 A;  1A3V A;  1GO3 E;  4X3T A;  2D0P A;  3CCJ A;  3CW2 C;  3HEJ A;  1MI2 A;  2NVX H;  1J5E Q;  3T1H L;  2WAQ E;  1LTB D;  3M9B A;  2WKC A;  3SE0 A;  3RD4 A;  3PIP 3;  3RZO B;  2MO1 A;  2Z9H A;  3FVQ A;  2B3G A;  3LX0 A;  1TQO A;  1VQN A;  3CU7 A;  2UXC L;  1OXU A;  1CM9 A;  1Q12 A;  1LTA D;  2IJ0 A;  1YJ9 A;  1IL2 A;  3E9H A;  3IAY A;  2ZT9 C;  3A7A B;  4BBR B;  1KNE A;  3QJY A;  2AUJ D;  1YZ6 A;  3PMF A;  2DN8 A;  2Q2T A;  1BCP C;  4GOP A;  2UUC Q;  1EWC A;  5T1G A;  5HUR A;  1LTR D;  1K3R A;  2BA0 A;  2R6G A;  4H0L C;  1I6H H;  3KF6 A;  4P74 A;  3UDG A;  4R4O A;  1X32 A;  3S2H H;  2MNA A;  1YNX A;  3UI2 A;  1NBW A;  4Q5V A;  3EJI A;  1K9M C;  2JA8 B;  2F3I A;  1XNR Q;  5ELD A;  2A8V A;  2JA7 B;  3ZJY C;  5GQO A;  3D3R A;  2ZJP A;  2OXP A;  1ENF A;  2LXK A;  3K7A H;  3SK8 A;  1EY0 A;  3EVQ A;  4A76 A;  3D0F A;  2B2V C;  1P8L A;  1CTM A;  2K5V A;  3VYU A;  1IBM L;  3BVG A;  3GTP B;  4DR6 L;  4UP9 A;  1HR0 Q;  1SNC A;  4NPS A;  3U9S A;  1TKW B;  3K5O A;  4NXM L;  4RWS C;  3W3A A;  4DR7 Q;  5BR8 Q;  4KHP Q;  5GAE C;  3KLS A;  2KJX A;  2YTV A;  4B3T L;  3KFU A;  5CV5 A;  4A3L H;  2F0D A;  1MSH A;  3NTK A;  1HUM A;  3BDL A;  1AN8 A;  2Q2H A;  2B2W C;  4DV3 Q;  4ZQ3 A;  1YIT A;  1S3O A;  2KCM A;  4XQN A;  2IW3 A;  1PH2 A;  1STN A;  5IIF A;  1KXL A;  1I4G A;  1G2S A;  4IOA A;  2R93 G;  2RDG A;  1S5C D;  2AHO B;  5CV9 A;  1VQ5 A;  3O13 A;  4DA2 A;  1UAP A;  4IUT A;  5JJI A;  2PW5 A;  3MXP A;  1PH8 A;  1PH4 A;  3ER0 A;  2EYP A;  2QEX A;  1CKO A;  4ID6 A;  4K8J A;  4FF2 A;  1LAC A;  2D62 A;  1C0A A;  1QNK A;  2K03 A;  2JA5 G;  3HOW H;  4DAP A;  1D6E C;  4IAL A;  4DV6 Q;  3Q6S A;  1JR0 D;  1VQC A;  1HUN A;  3F2D A;  1W2B A;  1R9T B;  2LY7 A;  3BZD B;  3FMC A;  3D4R A;  3N6R A;  2EYJ A;  4KN7 C;  3I55 A;  1RKN A;  1TWF H;  4ZRZ A;  4GOP B;  1A6X A;  4JYA L;  3TRE A;  3TP5 A;  4KK7 A;  1T5E A;  4DR1 Q;  1QVG A;  3BJU A;  3KF6 B;  1MJC A;  5C3X A;  1G8Z D;  2KEN A;  3TZD A;  4QCL A;  3V96 A;  5DAU A;  5M5X H;  1PTO C;  2F0Q A;  1XYI A;  3PO3 H;  4V19 0;  2L9H A;  4L5R C;  1HNW Q;  5IYD G;  1Y1W G;  5JJK A;  1HZA A;  1DOK A;  4IUV A;  1E1T A;  3DEP A;  1I4P A;  2I07 B;  1ET9 A;  4RKB A;  4RHS A;  2A6H D;  2F0V A;  3FEW X;  5IYC H;  3PO2 H;  1OXX K;  5AJ3 Q;  2E75 C;  2OTJ A;  2PCF B;  4UY8 C;  1I4X A;  1PRT D;  1ET6 A;  4IFD G;  1LTG D;  4WJW A;  1ONL A;  4A3I G;  2KHI A;  4BWG B;  1SE4 A;  4IPH A;  3W2D A;  2PI2 E;  4GN5 A;  1KTK A;  4LFA Q;  2ZTD A;  1D8L A;  2CQO A;  3NP8 A;  2F4I A;  3ULP A;  4X62 Q;  2CWP A;  4JV5 Q;  4K6D A;  5EGT A;  1VCI A;  1D2B A;  1O7Y A;  4NXN Q;  1DJR D;  5E7N A;  4BBR H;  5LL6 S;  4C3J G;  2UUC L;  4LFC Q;  2F0S A;  4HID A;  1STE A;  3F2C A;  2YYZ A;  4IOC A;  2K01 A;  2KA7 A;  1H9S A;  4LK1 C;  2IPK D;  4HTH A;  5ELO A;  3CQZ B;  3A5Z B;  5D3I B;  1XNR L;  4U68 A;  4PMB A;  4JI8 L;  2JA8 H;  5EKI A;  4TRD A;  3B6Y A;  1AH9 A;  2JA7 H;  3HOZ G;  4XTC S;  1N32 Q;  5LL6 X;  3P20 A;  1O7L A;  2OEO A;  2YTX A;  3HRZ C;  1Z47 A;  1JOO A;  2DUD A;  2L1B A;  4KMU C;  1G91 A;  3CC7 A;  2F0U A;  3GTP H;  1JWS D;  4DR7 L;  5BR8 L;  2XTI A;  2ZM6 L;  5IYB G;  4IO9 A;  2QEJ C;  4KHP L;  2E74 C;  1Y1W B;  2JK8 A;  4NDX A;  1X3F A;  3GTK H;  3EQL C;  1C9O A;  2BDN A;  3A56 A;  2B2Y A;  3AFP A;  1MBY A;  2EIF A;  4JOI C;  3G71 A;  1VQA A;  4CDF C;  4I7Z C;  1H9K A;  1Q1B A;  1B50 A;  1MGS A;  2IY5 B;  2GA4 B;  1WD0 A;  2B2T A;  4WJ4 A;  1DOL A;  4A3I B;  1XPU A;  3I4M G;  4ILW A;  4NB3 A;  1E7Z A;  3MFG A;  1ZYR D;  1EY7 A;  1N34 Q;  3SHL A;  5GAG C;  1S5F D;  3H91 A;  2PQA A;  1SRU A;  5M3F G;  3Q0A A;  1TS4 A;  1V9P A;  3G6J B;  4DN4 M;  1ICF B;  2NTT A;  3J81 i;  4K0K Q;  3E6Z X;  3S1Q B;  3BZC A;  3GQB A;  4C3J B;  2EE1 A;  4JI0 L;  3KUP A;  5CBA E;  1WTH A;  4X66 Q;  1AFP A;  3OWF A;  5EBC A;  1N9W A;  3E0J A;  3K5N A;  1H9S B;  4OL7 A;  1EZ8 A;  4RA8 A;  5DNF A;  1B70 B;  3VYT A;  2F1M A;  4WRD A;  3KLR A;  1UUP A;  2Z6K C;  5TSS A;  2Z4H A;  2K75 A;  2LSS A;  1HNW L;  4B3M L;  4HR7 B;  1CI3 M;  3HOZ B;  2A74 C;  1FL0 A;  1NSN S;  3ONA B;  2A68 C;  2I46 A;  1GKH A;  3M4Q A;  3E5S A;  4RH6 A;  4POG A;  1VS0 A;  3FKI G;  4BXX G;  4LF9 Q;  2N8N A;  3GDE A;  1GUG A;  5GRO A;  1NUC A;  3OMC A;  3VA5 A;  3M3Y B;  1PV4 A;  5C4X G;  1VQL A;  4P71 A;  4GN4 B;  3R3O A;  1BBX C;  4OIK A;  5K5P A;  2F0F A;  2G9D A;  4B08 A;  1FR3 A;  1S5D D;  3GTO B;  1CKN A;  3QOJ A;  1WCM B;  1ZEQ X;  1VMC A;  1SFO B;  1LYL A;  4JV5 L;  2X6G A;  2WB1 E;  1QWY A;  2XNA C;  1I5F A;  2EYL A;  1E2Z A;  4ZAI A;  1WJJ A;  4NXN L;  2NN6 G;  2D2C C;  2NVT H;  1I4Q A;  1VQB A;  4B9X A;  4GOP C;  1LT4 D;  3L9A X;  1CZG A;  2MJ8 A;  3NTI A;  3VA7 A;  3IFT A;  4LFC L;  5C0X G;  1PH3 A;  1NE3 A;  2R93 H;  1IZ6 A;  1RIP A;  2B2U A;  4X64 Q;  3R2T A;  4ABN A;  2WB1 G;  3MEH A;  1AE3 A;  1TWA B;  3HOU B;  1VQE A;  2NVQ B;  4EQ5 A;  3JAM L;  5A2Q E;  1WOC A;  1HRJ A;  1KDB A;  1XTD A;  5M3F B;  2PQA B;  3WOF A;  3CQZ H;  2JA5 H;  3TBI B;  4PNY A;  3A54 A;  4FXG C;  4N8X 1;  3BVZ A;  3IL8 A;  4A3K B;  1N32 L;  1PZK D;  4DAY A;  4LF6 Q;  3D8G A;  2OQK A;  1CUK A;  2NN6 I;  3G6E A;  2NVX B;  1DON A;  1I50 B;  2QF7 A;  1W6J A;  1ESF A;  2ASB A;  5C0X I;  1PYW D;  1NCV A;  4IUR A;  5FK9 C;  1LT6 D;  4NMZ A;  4MZ9 A;  1AW7 A;  5IYD H;  1Y1W H;  1D1K A;  3J81 c;  3D31 A;  1FD7 D;  3FKI B;  3ERQ A;  5HGQ A;  1LTS D;  4OEM B;  5KIX A;  4DR3 Q;  2X6L A;  5D65 A;  5ISR A;  5I9O A;  1E22 A;  4B3R Q;  4JC0 A;  1O78 A;  2FFK B;  4LF8 Q;  4IFD H;  1I6H B;  4A3I H;  3K57 A;  3TS2 A;  2L5T A;  2IX0 A;  1N34 L;  1L1O A;  3GD7 A;  1CKN B;  1LV9 A;  1U9R A;  1JOK A;  4A4I A;  1K8O A;  4FDB A;  1EIF A;  1K83 B;  1C4Q A;  2F0G A;  3QIA A;  1FGB D;  1BBW A;  2WAC A;  4AQY Q;  1BCP D;  4K0K L;  4RGT A;  1K0S A;  3K7A B;  2EYF A;  5IGG A;  3CCS A;  3G4S A;  2RSO A;  1JIC A;  2ZTE A;  1X54 A;  4QIW E;  1QB5 D;  2WB1 B;  2MGS A;  2ZXO A;  1QVF A;  3S1Q H;  4C3J H;  1OTC A;  1Q81 C;  1Z7T A;  2ICI A;  2X69 A;  4ZYS A;  1VQG A;  2B8F A;  2RKS A;  2V4D A;  3I4N G;  3J80 L;  1I94 Q;  3C2P A;  2ICE C;  4QB4 A;  3TEH B;  2JXM B;  4L8J A;  4CJ1 B;  1IYV A;  4NW2 A;  2UUB Q;  3CCM A;  5JEA G;  1K8A C;  4DV5 Q;  5EAY A;  3KDF A;  4QF4 A;  2N88 A;  3TME A;  1V1Q A;  3U58 A;  1SE3 A;  3Q22 A;  1B9N A;  2Z1C A;  3TQY A;  4DAY B;  4DUZ Q;  3FPU B;  4CDE C;  1NTG A;  3HOZ H;  2RDF A;  4LW1 A;  4LF9 L;  3NHH A;  4K8I A;  4KD4 A;  4POF A;  1SRO A;  1IW7 C;  4PZ8 A;  4K5W A;  2HQE A;  1AZQ A;  2M00 A;  2KOL A;  1T5X D;  2WP8 J;  3RLO A;  4LJZ C;  1KQS A;  2PW7 A;  4JBJ A;  3KJO A;  4CKB A;  2F3V A;  1EFI D;  2CQA A;  3AQQ A;  2XRQ D;  5IYB H;  1XMO Q;  3T16 A;  2MO0 A;  2NUC A;  3PV0 A;  2KCT A;  3OOC A;  2EOT A;  5KNB A;  2E2H B;  5IT9 L;  1LUZ A;  4FNF A;  2HUG A;  5FLX L;  1KRS A;  3F2B A;  5J3B A;  1XMQ Q;  2F0O A;  4UAI A;  1SFO H;  3J80 i;  1G2T A;  1L0W A;  1XTC D;  1N8R C;  1VQ4 A;  4FXD A;  1RD9 D;  4UHV A;  1DD2 A;  2OCE A;  3NXW A;  1TR5 A;  4X64 L;  2YU9 B;  2R7Z G;  4K14 A;  2J7Z A;  4DXG A;  1PH6 A;  3I4M H;  4HIM A;  1PLF A;  3PUX A;  3R8B A;  1R4P B;  1L1O B;  4IPD A;  1TWA H;  3SR1 A;  5M5X B;  1CSP A;  2BE5 C;  5LMU Q;  2NVQ H;  1GUS A;  1YNJ C;  1JCK B;  1KRT A;  5M3F H;  4RG1 A;  4DV0 Q;  3T1Y Q;  4ULL A;  2E5L Q;  3NEN A;  3STB D;  2NYZ D;  2KED A;  3JAM c;  2CHB D;  2LFN A;  2RA4 A;  2NZH A;  5CV7 A;  4WFN 3;  3I4N B;  1QOH A;  1PTO D;  2XWJ B;  2C5C A;  1N36 Q;  2IX1 A;  3BS1 A;  5LMN Q;  1I50 H;  4QIW B;  3J7A V;  3GTL B;  5IP7 G;  2G9H D;  3K5L A;  1H95 A;  1PH7 A;  2ALY B;  2EJM A;  3KDF B;  3CCR A;  3VR4 A;  4DUY Q;  4KY5 A;  1GHJ A;  2PNH A;  2KQ3 A;  4DPG A;  2C9O A;  1E2W A;  4DNI A;  2WII B;  1VMP A;  4C3I G;  1YHB A;  1ENC A;  4DR3 L;  3OWE B;  3NUC A;  2WAQ G;  1AP0 A;  1U4P A;  4XXE A;  3MZ5 A;  1Q8I A;  2JN4 A;  3FKI H;  4BXX H;  5JPN C;  3OYY A;  4O1N A;  1RTN A;  3M4Y A;  4KN4 C;  5M5W B;  1KLG D;  1DM0 B;  1EEF D;  3K0Y A;  2FMM A;  4JI2 Q;  1KHI A;  4CHT B;  4LF8 L;  5C4X H;  2K04 A;  4QJF A;  1YNN C;  3ND9 A;  3FRP B;  1SEB D;  1YJW A;  4YHH Q;  3CKI B;  2B29 A;  3A5U A;  3I70 A;  4GNX C;  1A2T A;  4L5Q A;  4HN7 A;  4JVZ A;  4AQY L;  3CPF A;  2JE6 I;  2NZ1 D;  1X3P A;  2HT1 A;  2BA1 A;  1KLU D;  1EY9 A;  1K83 H;  2RCN A;  3MEF A;  2PPB C;  3CD6 A;  2NN6 H;  4HJA A;  4YCU A;  1EY6 A;  2R7Z B;  3L0O A;  4WJ3 M;  1OO9 B;  3L3O C;  5C0X H;  4YIJ A;  1SND A;  2UUA L;  2O5J C;  1HH2 P;  3TP6 A;  3RNU A;  5EPL A;  1L0X B;  3PGZ A;  4R8N A;  5I4D A;  1E0B A;  2UUB L;  4BY7 G;  4LF7 L;  4MNO A;  4RHR A;  4Q0F A;  4DV5 L;  3S15 B;  3D6W A;  4BA1 I;  1DXM A;  5ELE A;  3GTK B;  2CFM A;  1VF5 C;  3CXC A;  1BR9 A;  1ROD A;  1Q86 C;  4KHZ A;  2KCC A;  3CC4 A;  3DEO A;  3FPP A;  4S3S A;  1IYJ B;  2PO4 A;  3A55 A;  4N8F A;  3J80 c;  4DUZ L;  4JI6 Q;  3S2D H;  4CDD C;  2HHH Q;  1A15 A;  4IPC A;  2K14 A;  5E4X A;  3LGJ A;  1V1O A;  3FHW A;  2Q2U A;  1S72 A;  5CGK A;  1XMO L;  4KHV A;  4TSS A;  1JWM D;  1RJT A;  3PQI A;  3OIQ A;  5COR A;  4YY3 Q;  3MA2 B;  2EZV A;  4C3I B;  1BF4 A;  3J7A 5;  1XMQ L;  5AFW A;  4AYB E;  2F4V Q;  3CF5 A;  2VY3 A;  2WAQ B;  2E2H H;  1EQT A;  4IPG A;  1S5E D;  1PRT B;  4HED A;  4JI7 Q;  3J81 E;  4GLV B;  2B2U C;  1J6Q A;  4X3K A;  1CHP D;  5EPJ A;  4F87 A;  1JJC B;  3MAQ A;  5IT9 c;  3I2Z A;  1UE7 A;  4A3D G;  4AYB G;  5FLX c;  3HG9 A;  2I5H A;  4HAE A;  1BKB A;  3HKZ E;  2UU9 L;  5D14 A;  2YU9 H;  1X3Q A;  4DF7 A;  5C3W A;  1I4H A;  2F0K A;  2VB3 X;  3I72 A;  4X3U A;  1PYS B;  3DWP A;  3ULL A;  3EA6 A;  1KAW A;  4IQZ A;  4DV0 L;  1SJE D;  2K50 A;  2PNR C;  3T1Y L;  1HCZ A;  1U4R A;  3HKZ G;  2E5L L;  5JPM C;  3WWV A;  1VQJ A;  1I3Q B;  3J7Z C;  1NY4 A;  3D4W A;  2KUM A;  3A74 A;  4IUP A;  4XT3 B;  3VYR A;  1N36 L;  3GV6 A;  3HOV G;  5LMN L;  3F8T A;  2I5M X;  4HJ8 A;  1PZJ D;  2XN9 C;  4APV A;  3A7L A;  3RUZ A;  3I4N H;  1J5E L;  1M1K C;  1X55 A;  1M4V A;  1RTO A;  2MUY A;  3GTL H;  4DUY L;  2A68 D;  3BYY B;  5JEA H;  2BH2 A;  1J9O A;  3ITP A;  5KRU A;  4DR4 Q;  4OWT B;  2E2J H;  2F03 A;  4HCS A;  4AIM A;  1PMR A;  1STG A;  2ID0 A;  5EBD A;  1XJV A;  4HMJ A;  2DJF C;  4OWX B;  2V1C C;  3CP0 A;  2NVT B;  3S1N B;  2PI2 A;  1II3 A;  1UEA B;  1HZB A;  3S1M B;  2R93 B;  3OW2 A;  1SYB A;  3H94 A;  5A35 A;  1L1O C;  5M5W H;  2VW9 A;  2L15 A;  1H9R A;  4YCV A;  2HCC A;  3AEV A;  2DGY A;  1K28 A;  2F0P A;  2I5L X;  4A75 A;  4IFD I;  1VQK A;  5KNC A;  1MJE A;  2AUK A;  2R3Z A;  4R4I A;  2JA5 B;  3OMG A;  1GD7 A;  3TZU A;  2CH4 W;  2ATW A;  2FMC A;  4EQN A;  4A3D B;  4AYB B;  2EY2 A;  2KVM A;  2F0E A;  1SDF A;  3GTG B;  5EQ0 A;  5IGE A;  2RBM A;  3R93 A;  2R7Z H;  2DJG C;  3RR5 A;  1D5X C;  1E24 A;  1HR0 L;  1LTL A;  1VF7 A;  1NJI C;  1K0R A;  1QUQ A;  2XRS D;  4ME3 A;  2XVS A;  5G3L D;  5IE8 A;  2AMC B;  1F9S A;  5T1I A;  4XIG S;  3HKZ B;  4B3S Q;  1S4Z A;  1A3U A;  3S15 H;  2BDO A;  4JI6 L;  1STH A;  1LT5 D;  1PZI D;  2HHH L;  1YEZ A;  2WIN B;  4C56 C;  1JB3 A;  2TSS A;  5ELC A;  4DV3 L;  1O7I A;  3HOV B;  3BYT B;  2JEB I;  5IGC A;  5J39 A;  2OT2 A;  3VR6 A;  1TU2 B;  1JWU D;  1M8A A;  1STA A;  3S9W A;  2XWB B;  1EL0 A;  5IP7 H;  1AEX A;  3RMH A;  2F0H A;  4YY3 L;  1HTP A;  1XWE A;  2UXB Q;  2N49 A;  2HIX A;  2RHQ B;  5FJ8 G;  1H9M A;  1PFM A;  2EYO A;  3TN2 A;  4HIK A;  4JI7 L;  4DK6 C;  4C3I H;  1MIU A;  1SMY C;  1IBL Q;  4DAM A;  4BA2 I;  1ASZ A;  1RL2 A;  4M1U B;  3GTM B;  5I6W A;  4DV6 L;  2MQH A;  3CCU A;  1VQH A;  4K2L A;  5M9O A;  1B53 A;  1EWH A;  1C7Y A;  4QUC A;  2NVY B;  1EFW A;  2C35 B;  3I56 A;  2ZJQ A;  2R61 A;  4DR1 L;  2E8G A;  2XIW A;  2SOB A;  4LMQ D;  2J4X A;  2B63 G;  4A3E G;  1B3Q A;  1B44 D;  4PMW A;  1BUV T;  4QY7 A;  1SNP A;  1UNS A;  2F0W A;  4XQJ A;  2VZA A;  3NSW A;  4Y52 H;  3M4P A;  2ZJR A;  4KJN A;  3EFX D;  3AMU A;  1WTO A;  3QG1 A;  2JA6 G;  1IHZ A;  1QJO A;  2FXQ A;  5H1S E;  4JBK A;  4OWW B;  3ND8 A;  1NR2 A;  1I3Q H;  3MTS A;  5AJ3 L;  3KBX A;  1HNZ Q;  4ODG A;  3DM1 A;  2B2V A;  1FNU A;  1QUQ B;  4M8A A;  3BDO A;  3NWS A;  4DAV A;  4BY7 H;  2N3S A;  1CQF A;  4DR4 L;  1WTW A;  5BN3 A;  4OXP A;  2H1E A;  3I73 A;  1V8Q A;  2CKZ B;  2WV6 D;  3KOJ A;  3SK4 A;  3VR2 A;  1GXD C;  2FJ2 A;  2K5D A;  1MD2 D;  1Y8N B;  1HA5 A;  5E4W C;  2VQE Q;  4LFA L;  1KIX A;  4C1N K;  4GKK Q;  1QZG A;  1U4M A;  2BOS A;  4X62 L;  4A3F G;  2F0J A;  2QDL A;  3FDT A;  1IYU A;  2WKD A;  4CJ0 B;  3AFQ A;  5IP9 G;  2B2W A;  3S1N H;  1X6O A;  1N33 Q;  3I4M B;  3KK7 A;  2BCO A;  3HFZ B;  1JOR A;  3S1M H;  3RLN A;  4B9W A;  5DM6 3;  1LM0 A;  1HJP A;  4OHJ A;  2AKW B;  1GM5 A;  3DXJ C;  4X6A H;  4HCE A;  4P72 A;  3OSO A;  5I9P A;  2FIN B; 
#chains in the Genus database with same CATH homology
 4A3L H;  4JI1 Q;  1PFS A;  1OXS C;  2Q2H A;  4DV3 Q;  2PMZ E;  1SFO H;  3J80 i;  1PH9 A;  3HOY G;  1M90 C;  1L0W A;  1YIT A;  1S3O A;  4R4C A;  2KCM A;  1VQ4 A;  1N8R C;  4A3D H;  1PH2 A;  3KYH C;  4QL5 A;  3CCV A;  1XPR A;  1KXL A;  2OCE A;  4JI6 Q;  4X64 L;  4UP7 A;  2R7Z G;  4IOA A;  4LF5 Q;  2R93 G;  1A63 A;  4X65 Q;  3I4M H;  1PH6 A;  3S24 A;  3GTG H;  1UEB A;  4HIM A;  2AHO B;  3AYH B;  1EQQ A;  1VQ5 A;  2R92 G;  3A0J A;  3M7N A;  3PUX A;  4JG2 A;  3CCE A;  5JJI A;  4IPD A;  1L1O B;  3PCO B;  4OX9 Q;  1PH8 A;  3NBH B;  1PH4 A;  3U4V A;  3ER0 A;  1TWA H;  5IY0 A;  2QEX A;  1UE1 A;  1CSP A;  1CKO A;  3L2P A;  5LMU Q;  3CPW A;  2NVQ H;  3H3V I;  2VUM H;  2F4V L;  3BZK A;  1VQ8 A;  1KRT A;  5M3F H;  4LWC A;  2D62 A;  4RG1 A;  4DV0 Q;  3PUW A;  3T1Y Q;  1C0A A;  1WCM G;  2HQL A;  2E5L Q;  3H15 A;  3NEN A;  2JA5 G;  3HOW H;  3J81 j;  3STB D;  1YJN A;  3JAM c;  4DV6 Q;  3Q8D A;  3HOX G;  1VQC A;  3F2D A;  2NZH A;  3PIO A;  3OTO Q;  1YHQ A;  1W2B A;  2OTL A;  4A3G G;  1PYB A;  2Z0S A;  5GAH C;  1CKM A;  3HOV H;  3JAM i;  3I55 A;  1TWF H;  4GOP B;  3E9I A;  1N36 Q;  2IX1 A;  4JYA L;  3RZD H;  3TRE A;  5LMN Q;  1I50 H;  1X9N A;  1VQI A;  3HKS A;  4DR1 Q;  1QVG A;  2ZTC A;  5IP7 G;  3BJU A;  3KF6 B;  3F1Z A;  1MJC A;  4A3J G;  5JJL A;  1HZC A;  2UXD Q;  3HOU G;  1H95 A;  1PH7 A;  2KEN A;  2ALY B;  3KDF B;  5C3E G;  1DGS A;  3CCR A;  4DUY Q;  5M5X H;  2PNH A;  4JI3 Q;  3PO3 H;  4DPG A;  4L5R C;  1WYD A;  1NMF A;  4DNI A;  4GNX A;  1IBL L;  5IYD G;  1Y1W G;  3S2D H;  1HNW Q;  4GN3 B;  4YCW A;  5JJK A;  1HZA A;  1YHB A;  3K7U C;  2OQ0 A;  4DR3 L;  1E1T A;  4JI5 L;  1PH1 A;  2WAQ G;  3S17 H;  4A3K G;  3FKI H;  4BXX H;  4LNQ A;  3OYY A;  4JI4 Q;  5IYC H;  3PO2 H;  3GTM H;  1OXX K;  5AJ3 Q;  1R9T H;  4X66 L;  1X3E A;  4JI2 Q;  2OTJ A;  1KHI A;  4LF8 L;  1G51 A;  4UY8 C;  5LMN W;  1VQ6 A;  5C4X H;  3K0X A;  1EQR A;  4QJF A;  1HZ9 A;  2MFI A;  1JJG A;  1IBK Q;  4IFD G;  3EN2 A;  4GLA C;  4YHH Q;  2NVY H;  1YJW A;  2B29 A;  4A3I G;  3A5U A;  2KHI A;  4LFB L;  4DV2 L;  4IPH A;  3ERS X;  2PI2 E;  1HNX Q;  4GNX C;  4GN5 A;  4LF4 Q;  4L5Q A;  1YVC A;  4AQY L;  3CPF A;  4LFA Q;  2JE6 I;  2WFW A;  2ZTD A;  1D8L A;  2KHJ A;  1E1O A;  2CQO A;  1S40 A;  1VQM A;  2HT1 A;  2BA1 A;  1TWG H;  3ULP A;  1KC8 C;  1WI5 A;  4X62 Q;  1K83 H;  2RCN A;  3MEF A;  3CD6 A;  2CWP A;  3RN5 A;  4LUO A;  3TRZ A;  4JV5 Q;  4HJA A;  4YCU A;  1VCI A;  4WJ3 M;  3L0O A;  5C44 G;  5FLM H;  4A3M G;  3ICE A;  2HIV A;  4NXN Q;  1HNZ L;  3H0G H;  5C4J H;  1VQP A;  5E7N A;  1UE5 A;  4BBR H;  2CCZ A;  4P75 A;  2JA9 A;  2UUC L;  2UUA L;  4LFC Q;  1Y14 B;  1HH2 P;  3F2C A;  4HID A;  3DLL A;  2YYZ A;  4HJ9 A;  4IOC A;  3PGZ A;  3RNU A;  1XNQ L;  3S16 H;  1PHJ A;  3H3V H;  3UDX A;  5GAD C;  2UUB L;  4BY7 G;  4LF7 L;  2NZO A;  4MNO A;  3UE0 A;  2LXJ A;  4DV5 L;  4NXM Q;  4BA1 I;  1Y1V H;  5ELO A;  1FJG Q;  1A8V A;  2VQE L;  2CFM A;  3G48 A;  3A5Z B;  3CXC A;  1XNR L;  1FGU A;  1Q86 C;  4KHZ A;  1EYG A;  3CC4 A;  4DV1 Q;  1IYJ B;  4DUZ L;  1IXR A;  4HIO A;  3J80 c;  1YBY A;  1WFQ A;  4JI8 L;  4DK3 C;  1JB7 A;  2JA8 H;  3ULJ A;  1K73 C;  2HHH Q;  1D7Q A;  4IFD J;  4GKJ L;  3B6Y A;  1AH9 A;  1JMC A;  4IPC A;  1P16 A;  1KD1 C;  2JA7 H;  4XTC S;  4DV4 Q;  3HOZ G;  1QVC A;  3RN2 A;  1N32 Q;  1VQO A;  2K14 A;  1X65 A;  2YTX A;  5ELN A;  1N33 L;  1Z47 A;  3LGJ A;  2K5N A;  3K81 C;  1PVO A;  3FHW A;  2DUD A;  2Q2U A;  1S72 A;  2CWA A;  3CC7 A;  2R7Z H;  1XMO L;  1HR0 W;  3GTP H;  4C2M H;  5M3M H;  4DR7 L;  3PUV A;  5BR8 L;  2XTI A;  2ZM6 L;  5IYB G;  4IO9 A;  4B3S L;  5FJ8 H;  4YY3 Q;  4KHP L;  2JJQ A;  2JK8 A;  4QQB X;  1X3F A;  3J7A 5;  3GTK H;  1XMQ L;  4AYB E;  4GNX B;  3PUZ A;  2F4V Q;  4OO1 G;  4JI1 L;  3CF5 A;  4AH6 A;  1C9O A;  2VY3 A;  1YHA A;  3AFP A;  2E2H H;  4R4T A;  4IPG A;  2EIF A;  4A3L G;  4JOI C;  3G71 A;  4JI7 Q;  1VQA A;  2K4K A;  4DV7 Q;  1Q1B A;  4GS3 A;  2ES2 A;  4GLV B;  4LF6 L;  1Z9F A;  1J6Q A;  4O0A A;  5IWA Q;  1JJC B;  3W1B A;  5IT9 c;  3I2Z A;  1UE7 A;  4A3D G;  3I4O A;  4AYB G;  2IY5 B;  1YI2 A;  2JQO A;  5FLX c;  2I5H A;  1SLJ A;  1BKB A;  4WJ4 A;  4YWL A;  3EIV A;  2N78 A;  3HKZ E;  2UU9 L;  1XPU A;  1ASY A;  3I4M G;  4PZ7 A;  4NB3 A;  4OX9 L;  2YU9 H;  1E7Z A;  4ALP A;  3CCL A;  3MXN B;  2UXB L;  3T1H Q;  2QGQ A;  1PYS B;  3GO5 A;  4J15 A;  3ULL A;  4A3E H;  1K8G A;  2B63 H;  4BBS H;  2KBN A;  2RHS B;  3PIP A;  4BY1 H;  1N34 Q;  1KAW A;  5C0X J;  5GAG C;  4DV0 L;  2K50 A;  1OXT A;  3T1Y L;  2Z6K A;  2VUM G;  3HKZ G;  2PQA A;  2E5L L;  1SRU A;  5M3F G;  4A3B H;  4OO1 I;  2UXC Q;  1Q82 C;  1V9P A;  4DR5 Q;  3WWV A;  1VQJ A;  2JA6 H;  2A19 A;  3HOW G;  1TXY A;  4QGU A;  3J81 i;  3J7Z C;  2K5H A;  2QA4 A;  2EXD A;  1NY4 A;  3OTO L;  4K0K Q;  4PG3 A;  3BZC A;  1FVI A;  1PH5 A;  4JI0 L;  4JBW A;  4KI0 A;  3A74 A;  1N36 L;  3HOV G;  5DLQ E;  4X66 Q;  2VQF Q;  5LMN L;  4B3R L;  3F8T A;  3CC2 A;  1N9W A;  4RMF A;  4JBM A;  2I5M X;  5K36 G;  1JE5 A;  4HJ8 A;  1EWI A;  4APV A;  3I4N H;  1J5E L;  2UXD L;  1M1K C;  1B70 B;  3KF8 B;  1X55 A;  1NMG A;  4A93 H;  4LUV A;  3TS0 A;  3IRB A;  4DUY L;  3GTL H;  1BBU A;  2Z6K C;  2BH2 A;  1SE8 A;  1VQD A;  4O2D A;  4DR4 Q;  1Q8K A;  4JI3 L;  4OWT B;  2E2J H;  2K75 A;  2LSS A;  1HNW L;  3UDI A;  4B3M L;  3M4O H;  4AIM A;  3PO3 G;  1EIY B;  1KL9 A;  2ID0 A;  4IJH A;  2OWO A;  2VS1 A;  1XJV A;  1U5K A;  4DR2 Q;  4OWX B;  1FL0 A;  4MTN A;  4A3F H;  2V1C C;  3CP0 A;  3M4Q A;  1GKH A;  1SN8 A;  4H02 A;  4JI4 L;  5IP9 H;  2PI2 A;  4POG A;  4BXX G;  1VS0 A;  3FKI G;  3PF4 A;  5M5Y H;  4LF9 Q;  1HZB A;  4P73 A;  3PF5 A;  5IYC G;  1CSQ A;  2N8N A;  3OW2 A;  3GDE A;  4KLK A;  3PO2 G;  5GRO A;  2UUA Q;  4UP8 A;  2YV5 A;  1IBM Q;  1L1O C;  5M5W H;  1IBK L;  2VW9 A;  2L15 A;  1PV4 A;  4DR6 Q;  5C4X G;  1VQL A;  4P71 A;  1A0I A;  1I94 L;  4GN4 B;  4LF7 Q;  4YCV A;  3AEV A;  4A3C H;  2DGY A;  1HNX L;  4LF4 L;  1VQF A;  2I5L X;  4A75 A;  4IFD I;  1VQK A;  4L5S A;  1CKN A;  2H5X A;  1MJE A;  4R4I A;  4R4Q A;  1LYL A;  1GD7 A;  4B3T Q;  4GKK L;  4JI8 Q;  4JV5 L;  2WB1 E;  2ATW A;  1TWH H;  1I5F A;  4HJ7 A;  1JJ2 A;  3HOY H;  1WJJ A;  4NXN L;  2NN6 G;  2A1A A;  1UWV A;  1VQB A;  2GVA A;  3DM3 A;  4GLX A;  2NVT H;  4GOP C;  2VNU D;  4JOI A;  5FLM G;  3H0G G;  4LFC L;  3NEL A;  3KJP A;  5C0X G;  2F52 A;  1NE3 A;  4BBR G;  3RR5 A;  1PH3 A;  1IZ6 A;  1RIP A;  2R93 H;  1E24 A;  1HR0 L;  4X64 Q;  1LTL A;  2WB1 G;  1NJI C;  2R92 H;  3M3Y H;  1K0R A;  1AE3 A;  1QUQ A;  4L5T A;  4ME3 A;  5IE8 A;  2AMC B;  3PSI A;  1VQE A;  4XIG S;  4EQ5 A;  2ZM6 Q;  1FJG L;  2XGT A;  4B3S Q;  1WOC A;  1XTD A;  4UPA A;  1Y1V G;  3UDF A;  2PQA B;  3U4Z A;  3S1R H;  3S15 H;  1G29 1;  4DV1 L;  3GTO H;  4JI6 L;  4TVA B;  1SMX A;  4JCV E;  2YTY A;  1WCM H;  4LUZ A;  3CQZ H;  1B8A A;  1YEZ A;  2HHH L;  2JA5 H;  4A3C G;  1Q1E A;  4DV4 L;  2JA8 G;  4DV3 L;  1O7I A;  3NEM A;  1N32 L;  3HOX H;  5JEA J;  1L2F A;  4LF6 Q;  3CME A;  2E2I H;  2JA7 G;  2JEB I;  2OQK A;  4A3G H;  1A62 A;  1CUK A;  2NN6 I;  3G6E A;  1X56 A;  4IJL A;  2K52 A;  2AWN A;  3E0E A;  1MKH A;  3JC6 6;  3GTQ H;  4LF5 L;  1VQ7 A;  4X65 L;  2UU9 Q;  2ASB A;  1Q46 A;  5C0X I;  4OON A;  5IP7 H;  1X3G A;  4JYA Q;  1BVS A;  4YWK A;  3RLF A;  2GVB A;  4YY3 L;  5M3M G;  4A3J H;  3HOU H;  2UXB Q;  1SR3 A;  1QZH A;  2Y0S E;  2N49 A;  2HIX A;  5C3E H;  2RHQ B;  3K8A A;  5FJ8 G;  1AE2 A;  5LMU L;  4HJ5 A;  5HY6 A;  2IHF A;  4MZ9 A;  1T9H A;  2R7D A;  4HIK A;  4JI7 L;  5IYD H;  4DK6 C;  1Y1W H;  4C3I H;  1MIU A;  3J81 c;  4DV7 L;  3D31 A;  3KLW A;  1IBL Q;  4DAM A;  5HGQ A;  4BA2 I;  1ASZ A;  1RL2 A;  5IWA L;  4A3K H;  2Y0S G;  4DV6 L;  4DR3 Q;  4JI5 Q;  1GO3 E;  3W1G A;  4JI0 Q;  2MQH A;  3VDY A;  3CCU A;  2D0P A;  2IHE A;  1VQH A;  3CCJ A;  3CW2 C;  2NVX H;  1E22 A;  3W5O A;  4Y7N H;  3STB C;  1C7Y A;  4B3R Q;  2R7F A;  1UE6 A;  1EFW A;  4JC0 A;  2C35 B;  3FP9 A;  3I56 A;  1J5E Q;  2ZJQ A;  4LF8 Q;  4DR1 L;  3T1H L;  2E8G A;  2WAQ E;  1TWC H;  4YWM A;  4A3I H;  1GVP A;  3M9B A;  3TS2 A;  2IX0 A;  1N34 L;  3CMA A;  1L1O A;  2MO1 A;  4A3E G;  3GD7 A;  1CKN B;  2B63 G;  4BBS G;  4LFB Q;  4BY1 G;  4DV2 Q;  1G6P A;  4PMW A;  2B3G A;  4QY7 A;  4B3M Q;  4A4I A;  1VQN A;  2UXC L;  4FDB A;  1EIF A;  2AWO A;  1OXU A;  4DR5 L;  1YIJ A;  2VZA A;  4A3B G;  1BBW A;  1Q12 A;  4AQY Q;  4Y52 H;  3K80 C;  3M4P A;  2ZJR A;  1YJ9 A;  4K0K L;  3I7F A;  1IL2 A;  3E9H A;  3SGI A;  2JA6 G;  2JEA I;  3CCS A;  2FXQ A;  3G4S A;  5C44 H;  4A3M H;  4DKA C;  5H1S E;  3M85 A;  2ZTE A;  4JBK A;  4OWW B;  1X54 A;  1I3Q H;  4QIW E;  2VQF L;  3CCQ A;  1Q7Y C;  5AJ3 L;  1QVF A;  3S1Q H;  1U0L A;  1YZ6 A;  4C3J H;  1HNZ Q;  1Q81 C;  1OTC A;  2Q2T A;  4JI2 L;  1PA6 A;  3S14 H;  1QUQ B;  4GOP A;  1VQG A;  2UUC Q;  3L7Z C;  1JT8 A;  4BY7 H;  3I4N G;  1I94 Q;  2N3S A;  1K3R A;  2BA0 A;  3CAM A;  1XNQ Q;  4YHH L;  3TEH B;  4DR4 L;  2R6G A;  1I6H H;  2UUB Q;  4A93 G;  3KF6 A;  4P74 A;  1V43 A;  3CCM A;  4R4O A;  4EX5 A;  4OXP A;  3UDG A;  5JEA G;  2MNA A;  1YNX A;  4DV5 Q;  1K8A C;  3RZO H;  5EAY A;  3S2H H;  1NBW A;  2CKZ B;  3KOJ A;  2GN5 A;  3KDF A;  1K9M C;  1B7Y B;  2F3I A;  2VQE Q;  4DR2 L;  1XPO A;  2D0O A;  1OXV A;  4LFA L;  2BH8 A;  1V1Q A;  3U58 A;  1KIX A;  1XNR Q;  4GKK Q;  2A8V A;  3ZJY C;  2EQS A;  1QZG A;  4R1J A;  5GQO A;  4X62 L;  3TQY A;  3PUY A;  4DAY B;  2ZJP A;  4DUZ Q;  1NTG A;  4A3F G;  4LW1 A;  3HOZ H;  2LXK A;  3K7A H;  4LF9 L;  3U50 C;  3GTJ H;  1EUJ A;  4A76 A;  5IP9 G;  3AFQ A;  1SRO A;  4PZ8 A;  4POF A;  2I0Q A;  3D0F A;  3BU2 A;  2Q2I A;  4GKJ Q;  1P8L A;  2IT1 A;  2K5V A;  3S1N H;  1IBM L;  1X6O A;  2WP8 J;  3RLO A;  1KQS A;  4JBJ A;  1N33 Q;  4DR6 L;  3HFZ B;  4UP9 A;  3KJO A;  1HR0 Q;  3S1M H;  3RLN A;  4NPS A;  1EOV A;  3EBE A;  1LM0 A;  1HJP A;  4PZ6 A;  2AKW B;  3AQQ A;  5IYB H;  1XMO Q;  1GM5 A;  2MO0 A;  4C3H H;  3PV0 A;  2KCT A;  4NXM L;  2VL6 A;  4DR7 Q;  4X6A H;  5BR8 Q;  1E3P A;  3UE1 A;  2RF4 A;  4P72 A;  1LUZ A;  4KHP Q;  5GAE C;  1VQ9 A;  2YTV A;  4B3T L;  1KRS A;  3KFU A;  1W3S A;  3F2B A;  4TQU S;  5J3B A;  1XMQ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...