1V1SA

2-keto-3-deoxygluconate kinase from thermus thermophilus (crystal form 2)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
301
structure length
301
Chain Sequence
MLEVVTAGEPLVALVPQEPGHLRGKRLLEVYVGGAEVNVAVALARLGVKVGFVGRVGEDELGAMVEERLRAEGVDLTHFRRAPGFTGLYLREYLPLGQGRVFYYRKGSAGSALAPGAFDPDYLEGVRFLHLSGITPALSPEARAFSLWAMEEAKRRGVRVSLDVNYRQTLWSPEEARGFLERALPGVDLLFLSEEEAELLFGRVEEALRALSAPEVVLKRGAKGAWAFVDGRRVEGSAFAVEAVDPVGAGDAFAAGYLAGAVWGLPVEERLRLANLLGASVAASRGDHEGAPYREDLEVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Thermus thermophilus 2-Keto-3-deoxygluconate kinase: evidence for recognition of an open chain substrate.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords 2-KETO-3-DEOXYGLUCONATE KINASE
total genus 90
structure length 301
sequence length 301
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.45: 2-dehydro-3-deoxygluconokinase.
pdb deposition date 2004-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 1v1sA00
2PKKA 3NCAA 1KYHA 3IKHA 4E8WA 4JKSA 4LBXA 5F11A 3QAIA 4XF7A 1LIOA 3LHXA 4X8FA 1EKKA 4S1HA 3HYOA 1TD2A 2PKFA 3UQ9A 4YL5A 1RKSA 1C3QA 1TZ6A 2F02A 3I3YA 2NWHA 2PKNA 2Q5RA 1YGJA 3GO7A 3OTXA 4KBEA 4O1LA 5TQIA 3UMPA 5BYDA 3RTCA 3RQ2A 3B3LA 1RK2A 3FHXA 3RTBA 4S1IA 4K8CA 3RS9A 3Q92A 1LHPA 3KEUA 4JKUA 1GC5A 4LBGA 3LJSA 4E3AA 1BX4A 2A9YA 2HW1A 3RTEA 4B8SA 3K5WA 2XTBA 4N09A 4WJMA 4EOHA 2HQQA 4U7XA 4K8KA 2HLZA 4XF6A 3RQXA 1U2XA 1RFUA 4K9IA 3RQHA 3NC2A 2DDMA 3NL6A 2F7KA 3RRFA 3RY7A 3N1CA 4KANA 1VI9A 1YHJA 2QHPA 1ESJA 5F0ZA 3EWMA 3IQ0A 4B8RA 2A9ZA 3NL5A 4YWRA 2JGVA 5BYFA 2JG5A 3UQ6A 3IN1A 5COJA 3B1OA 3RO4A 3NM3A 4K8PA 1EKQA 1UB0A 2QCVA 4C5KA 4O1GA 4E69A 1DGMA 4KAHA 5C40A 3RQ6A 3RRBA 3KZHA 4E84A 5CGEA 1VM7A 3B1NA 3MBJA 3NL3A 3MBHA 3IBQA 3KTNA 2VARA 4S1MA 3RU2A 4DU5A 1RKDA 2AA0A 2ABSA 5CM5A 1V1AA 2AX3A 4E8YA 2DDOA 3Q1YA 2DCNA 2RBCA 3LOOA 3UBOA 4DC3A 4N08A 3RQ8A 1V19A 4C5MA 5B6AA 4JJPA 5EYNA 3IE7A 1LIKA 3B1PA 5C3ZA 2I5BA 3PL2A 3RTDA 3H74A 3RPHA 3NC9A 3RSFA 1LIJA 3BF5A 4XCKA 3B1QA 3NL2A 3RQQA 3RS8A 4E8ZA 5CGAA 4K93A 3RREA 3RSGA 5C41A 3UQDA 2R3EA 4XDAA 1LHRA 2FV7A 3IH0A 5C3YA 1JXIA 3BGKA 2AB8A 3NBWA 4LC4A 3RU3A 3GBUA 4C5JA 3H49A 3VAQA 1V1SA 1ESQA 3NBVA 5BYCA 4PVVA 4KALA 3UMOA 3RPZA 1TZ3A 3RT9A 4UBEA 3K9EA 5TRWA 3QA2A 3W4SA 3ZS7A 2R3BA 5BYEA 3RTGA 3RM5A 2ABQA 1RFTA 1UA4A 2AWDA 2JG1A 2C49A 1JXHA 1LIIA 4LCAA 2I6BA 3RSSA 1RKAA 3B1RA 2AFBA 3JULA 3LKIA 4K8TA 2PKMA 3RRJA 2DDWA 3PZSA 1V1BA 1WYEA 3HICA 4EUMA 3GO6A 2V78A 3CQDA 3DZVA 3UQEA 1L2LA 4GM6A 3RTAA 2YXTA 3NM1A 3RT7A 1RFVA 4KADA 2YXUA 3RQ5A 4C5NA 2AJRA 4EBUA 3HPDA 3DRWA 2I6AA 4S1IB 4C5LA 1VK4A 2C4EA 1GQTA 2AJPA 1YGKA 3RSQA 5EY7A 3FHYA 4K9CA 3VASA 3KD6A 1TYYA 4EN4A
chains in the Genus database with same CATH superfamily
2PKKA 3NCAA 1KYHA 2UAGA 3IKHA 4E8WA 1GQQA 4JKSA 4LBXA 1E0DA 3ZM5A 3QAIA 4XF7A 1LIOA 3LHXA 4X8FA 1EKKA 4S1HA 5A5EA 5F11A 3HYOA 1TD2A 2PKFA 3UQ9A 4YL5A 1RKSA 1C3QA 1TZ6A 2F02A 1EEHA 3I3YA 2NWHA 2PKNA 2Q5RA 1YGJA 3GO7A 3OTXA 4KBEA 4O1LA 5TQIA 3UMPA 5BYDA 3RTCA 2AM2A 3RQ2A 3B3LA 1RK2A 3FHXA 1UAGA 3RTBA 4S1IA 4K8CA 3RS9A 3Q92A 1LHPA 3KEUA 4JKUA 1GC5A 4LBGA 3LJSA 4CVKA 1P31A 4E3AA 1BX4A 2A9YA 2HW1A 3RTEA 4B8SA 3K5WA 4CVLA 2XTBA 4N09A 4WJMA 4EOHA 2JFFA 2Y67A 2HQQA 4U7XA 1GG4A 2HLZA 4K8KA 4XF6A 3RQXA 1U2XA 2VORA 1RFUA 4K9IA 4BUBA 3RQHA 2VOSA 3NC2A 2DDMA 3NL6A 2F7KA 3RRFA 3RY7A 3N1CA 4KANA 1VI9A 1YHJA 2QHPA 1ESJA 5F0ZA 3EWMA 3IQ0A 4B8RA 2A9ZA 2WJPA 3NL5A 2JGVA 4YWRA 2JG5A 4HV4A 3IN1A 5COJA 5BYFA 3B1OA 3UQ6A 1J6UA 2WTZA 3QCZA 3RO4A 1JBVA 3NM3A 4K8PA 1EKQA 1UB0A 2QCVA 4C5KA 4O1GA 4E69A 1DGMA 4KAHA 5C40A 3RQ6A 3RRBA 3ZM6A 3KZHA 4E84A 3LK7A 5CGEA 1VM7A 3B1NA 3MBJA 3NL3A 2JFGA 3IBQA 3KTNA 3MBHA 2VARA 4S1MA 3RU2A 4C12A 4C13A 1RKDA 4DU5A 2AA0A 2ABSA 2UUOA 1V1AA 2AX3A 3EAGA 5CM5A 4E8YA 2DDOA 3Q1YA 2XJAA 2DCNA 2RBCA 3LOOA 3UBOA 4DC3A 4N08A 1P3DA 1V19A 3RQ8A 2VTEA 4C5MA 5B6AA 4JJPA 5EYNA 3IE7A 1LIKA 3HJ6A 3B1PA 1W7KA 5C3ZA 2I5BA 3PL2A 3RTDA 2VTDA 3H74A 3RPHA 3NC9A 3RSFA 4EUMA 1LIJA 3BF5A 4XCKA 3B1QA 3NL2A 4ZIYA 3HN7A 3RQQA 3RS8A 4E8ZA 5CGAA 4K93A 3RREA 3RSGA 5C41A 1GQYA 4BUCA 3UQDA 2R3EA 4XDAA 2UUPA 1LHRA 4UAGA 2FV7A 3IH0A 2Y66A 1JXIA 3BGKA 2AB8A 3NBWA 4LC4A 3RU3A 3GBUA 2X5OA 4C5JA 3H49A 4QDIA 3VAQA 1JBWA 3PYZA 1V1SA 1ESQA 3NBVA 2GCAA 4PVVA 4KALA 3UMOA 5BYCA 3RPZA 1TZ3A 3RT9A 4UBEA 3K9EA 5TRWA 3QA2A 3W4SA 3ZS7A 2R3BA 5BYEA 3RTGA 3RM5A 2ABQA 1RFTA 2Y1OA 2GC6A 1UA4A 2AWDA 2JG1A 2C49A 3UAGA 1JXHA 1LIIA 4LCAA 5A5FA 2I6BA 3RSSA 1RKAA 1FGSA 3B1RA 2AFBA 2GCBA 3JULA 3LKIA 2PKMA 1W78A 3NRSA 4K8TA 2XPCA 3RRJA 4CVMA 2DDWA 3PZSA 1V1BA 1WYEA 2Y68A 3HICA 3GO6A 2V78A 3CQDA 3DZVA 3UQEA 1L2LA 4GM6A 3RTAA 2YXTA 3NM1A 3RT7A 1RFVA 4KADA 2YXUA 3RQ5A 4C5NA 2AJRA 4EBUA 3N2AA 3HPDA 3DRWA 2I6AA 4S1IB 1E8CA 3ZL8A 4EN4A 4C5LA 1VK4A 2C4EA 1O5ZA 1GQTA 2AJPA 1YGKA 2F00A 5EY7A 3RSQA 3FHYA 5C3YA 4K9CA 2GC5A 3VASA 4QF5A 3KD6A 2JFHA 1TYYA 2AM1A
chains in the Genus database with same CATH topology
2PKKA 3NCAA 1KYHA 3IKHA 4E8WA 4JKSA 4LBXA 5F11A 3QAIA 4XF7A 1LIOA 3LHXA 4X8FA 1EKKA 4S1HA 3HYOA 1TD2A 2PKFA 3UQ9A 4YL5A 1RKSA 1C3QA 1TZ6A 2F02A 3I3YA 2NWHA 2PKNA 2Q5RA 1YGJA 3GO7A 3OTXA 4KBEA 4O1LA 5TQIA 3UMPA 5BYDA 3RTCA 3RQ2A 3B3LA 1RK2A 3FHXA 3RTBA 4S1IA 4K8CA 3RS9A 3Q92A 1LHPA 3KEUA 4JKUA 1GC5A 4LBGA 3LJSA 4E3AA 1BX4A 2A9YA 2HW1A 3RTEA 4B8SA 3K5WA 2XTBA 4N09A 4WJMA 4EOHA 2HQQA 4U7XA 4K8KA 2HLZA 4XF6A 3RQXA 1U2XA 1RFUA 4K9IA 3RQHA 3NC2A 2DDMA 3NL6A 2F7KA 3RRFA 3RY7A 3N1CA 4KANA 1VI9A 1YHJA 2QHPA 1ESJA 5F0ZA 3EWMA 3IQ0A 4B8RA 2A9ZA 3NL5A 4YWRA 2JGVA 5BYFA 2JG5A 3UQ6A 3IN1A 5COJA 3B1OA 3RO4A 3NM3A 4K8PA 1EKQA 1UB0A 2QCVA 4C5KA 4O1GA 4E69A 1DGMA 4KAHA 5C40A 3RQ6A 3RRBA 3KZHA 4E84A 5CGEA 1VM7A 3B1NA 3MBJA 3NL3A 3MBHA 3IBQA 3KTNA 2VARA 4S1MA 3RU2A 4DU5A 1RKDA 2AA0A 2ABSA 5CM5A 1V1AA 2AX3A 4E8YA 2DDOA 3Q1YA 2DCNA 2RBCA 3LOOA 3UBOA 4DC3A 4N08A 3RQ8A 1V19A 4C5MA 5B6AA 4JJPA 5EYNA 3IE7A 1LIKA 3HJ6A 3B1PA 5C3ZA 2I5BA 3PL2A 3RTDA 3H74A 3RPHA 3NC9A 3RSFA 1LIJA 3BF5A 4XCKA 3B1QA 3NL2A 3RQQA 3RS8A 4E8ZA 5CGAA 4K93A 3RREA 3RSGA 5C41A 3UQDA 2R3EA 4XDAA 1LHRA 2FV7A 3IH0A 5C3YA 1JXIA 3BGKA 2AB8A 3NBWA 4LC4A 3RU3A 3GBUA 4C5JA 3H49A 3VAQA 1V1SA 1ESQA 3NBVA 5BYCA 4PVVA 4KALA 3UMOA 3RPZA 1TZ3A 3RT9A 4UBEA 3K9EA 5TRWA 3QA2A 3W4SA 3ZS7A 2R3BA 5BYEA 3RTGA 3RM5A 2ABQA 1RFTA 1UA4A 2AWDA 2JG1A 2C49A 1JXHA 1LIIA 4LCAA 2I6BA 3RSSA 1RKAA 3B1RA 2AFBA 3JULA 3LKIA 4K8TA 2PKMA 3RRJA 2DDWA 3PZSA 1V1BA 1WYEA 3HICA 4EUMA 3GO6A 2V78A 3CQDA 3DZVA 3UQEA 1L2LA 4GM6A 3RTAA 2YXTA 3NM1A 3RT7A 1RFVA 4KADA 2YXUA 3RQ5A 4C5NA 2AJRA 4EBUA 3HPDA 3DRWA 2I6AA 4S1IB 4C5LA 1VK4A 2C4EA 1GQTA 2AJPA 1YGKA 3RSQA 5EY7A 3FHYA 4K9CA 3VASA 3KD6A 1TYYA 4EN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PKK A;  3NCA A;  1KYH A;  3IKH A;  4E8W A;  4JKS A;  4LBX A;  5F11 A;  3QAI A;  4XF7 A;  1LIO A;  3LHX A;  4X8F A;  1EKK A;  4S1H A;  3HYO A;  1TD2 A;  2PKF A;  3UQ9 A;  4YL5 A;  1RKS A;  1C3Q A;  1TZ6 A;  2F02 A;  3I3Y A;  2NWH A;  2PKN A;  2Q5R A;  1YGJ A;  3GO7 A;  3OTX A;  4KBE A;  4O1L A;  5TQI A;  3UMP A;  5BYD A;  3RTC A;  3RQ2 A;  3B3L A;  1RK2 A;  3FHX A;  3RTB A;  4S1I A;  4K8C A;  3RS9 A;  3Q92 A;  1LHP A;  3KEU A;  4JKU A;  1GC5 A;  4LBG A;  3LJS A;  4E3A A;  1BX4 A;  2A9Y A;  2HW1 A;  3RTE A;  4B8S A;  3K5W A;  2XTB A;  4N09 A;  4WJM A;  4EOH A;  2HQQ A;  4U7X A;  4K8K A;  2HLZ A;  4XF6 A;  3RQX A;  1U2X A;  1RFU A;  4K9I A;  3RQH A;  3NC2 A;  2DDM A;  3NL6 A;  2F7K A;  3RRF A;  3RY7 A;  3N1C A;  4KAN A;  1VI9 A;  1YHJ A;  2QHP A;  1ESJ A;  5F0Z A;  3EWM A;  3IQ0 A;  4B8R A;  2A9Z A;  3NL5 A;  4YWR A;  2JGV A;  5BYF A;  2JG5 A;  3UQ6 A;  3IN1 A;  5COJ A;  3B1O A;  3RO4 A;  3NM3 A;  4K8P A;  1EKQ A;  1UB0 A;  2QCV A;  4C5K A;  4O1G A;  4E69 A;  1DGM A;  4KAH A;  5C40 A;  3RQ6 A;  3RRB A;  3KZH A;  4E84 A;  5CGE A;  1VM7 A;  3B1N A;  3MBJ A;  3NL3 A;  3MBH A;  3IBQ A;  3KTN A;  2VAR A;  4S1M A;  3RU2 A;  4DU5 A;  1RKD A;  2AA0 A;  2ABS A;  5CM5 A;  1V1A A;  2AX3 A;  4E8Y A;  2DDO A;  3Q1Y A;  2DCN A;  2RBC A;  3LOO A;  3UBO A;  4DC3 A;  4N08 A;  3RQ8 A;  1V19 A;  4C5M A;  5B6A A;  4JJP A;  5EYN A;  3IE7 A;  1LIK A;  3B1P A;  5C3Z A;  2I5B A;  3PL2 A;  3RTD A;  3H74 A;  3RPH A;  3NC9 A;  3RSF A;  1LIJ A;  3BF5 A;  4XCK A;  3B1Q A;  3NL2 A;  3RQQ A;  3RS8 A;  4E8Z A;  5CGA A;  4K93 A;  3RRE A;  3RSG A;  5C41 A;  3UQD A;  2R3E A;  4XDA A;  1LHR A;  2FV7 A;  3IH0 A;  5C3Y A;  1JXI A;  3BGK A;  2AB8 A;  3NBW A;  4LC4 A;  3RU3 A;  3GBU A;  4C5J A;  3H49 A;  3VAQ A;  1V1S A;  1ESQ A;  3NBV A;  5BYC A;  4PVV A;  4KAL A;  3UMO A;  3RPZ A;  1TZ3 A;  3RT9 A;  4UBE A;  3K9E A;  5TRW A;  3QA2 A;  3W4S A;  3ZS7 A;  2R3B A;  5BYE A;  3RTG A;  3RM5 A;  2ABQ A;  1RFT A;  1UA4 A;  2AWD A;  2JG1 A;  2C49 A;  1JXH A;  1LII A;  4LCA A;  2I6B A;  3RSS A;  1RKA A;  3B1R A;  2AFB A;  3JUL A;  3LKI A;  4K8T A;  2PKM A;  3RRJ A;  2DDW A;  3PZS A;  1V1B A;  1WYE A;  3HIC A;  4EUM A;  3GO6 A;  2V78 A;  3CQD A;  3DZV A;  3UQE A;  1L2L A;  4GM6 A;  3RTA A;  2YXT A;  3NM1 A;  3RT7 A;  1RFV A;  4KAD A;  2YXU A;  3RQ5 A;  4C5N A;  2AJR A;  4EBU A;  3HPD A;  3DRW A;  2I6A A;  4S1I B;  4C5L A;  1VK4 A;  2C4E A;  1GQT A;  2AJP A;  1YGK A;  3RSQ A;  5EY7 A;  3FHY A;  4K9C A;  3VAS A;  3KD6 A;  1TYY A;  4EN4 A; 
#chains in the Genus database with same CATH topology
 2PKK A;  3NCA A;  1KYH A;  2UAG A;  3IKH A;  4E8W A;  1GQQ A;  4JKS A;  4LBX A;  1E0D A;  3ZM5 A;  3QAI A;  4XF7 A;  1LIO A;  3LHX A;  4X8F A;  1EKK A;  4S1H A;  5A5E A;  5F11 A;  3HYO A;  1TD2 A;  2PKF A;  3UQ9 A;  4YL5 A;  1RKS A;  1C3Q A;  1TZ6 A;  2F02 A;  1EEH A;  3I3Y A;  2NWH A;  2PKN A;  2Q5R A;  1YGJ A;  3GO7 A;  3OTX A;  4KBE A;  4O1L A;  5TQI A;  3UMP A;  5BYD A;  3RTC A;  2AM2 A;  3RQ2 A;  3B3L A;  1RK2 A;  3FHX A;  1UAG A;  3RTB A;  4S1I A;  4K8C A;  3RS9 A;  3Q92 A;  1LHP A;  3KEU A;  4JKU A;  1GC5 A;  4LBG A;  3LJS A;  4CVK A;  1P31 A;  4E3A A;  1BX4 A;  2A9Y A;  2HW1 A;  3RTE A;  4B8S A;  3K5W A;  4CVL A;  2XTB A;  4N09 A;  4WJM A;  4EOH A;  2JFF A;  2Y67 A;  2HQQ A;  4U7X A;  1GG4 A;  2HLZ A;  4K8K A;  4XF6 A;  3RQX A;  1U2X A;  2VOR A;  1RFU A;  4K9I A;  4BUB A;  3RQH A;  2VOS A;  3NC2 A;  2DDM A;  3NL6 A;  2F7K A;  3RRF A;  3RY7 A;  3N1C A;  4KAN A;  1VI9 A;  1YHJ A;  2QHP A;  1ESJ A;  5F0Z A;  3EWM A;  3IQ0 A;  4B8R A;  2A9Z A;  2WJP A;  3NL5 A;  2JGV A;  4YWR A;  2JG5 A;  4HV4 A;  3IN1 A;  5COJ A;  5BYF A;  3B1O A;  3UQ6 A;  1J6U A;  2WTZ A;  3QCZ A;  3RO4 A;  1JBV A;  3NM3 A;  4K8P A;  1EKQ A;  1UB0 A;  2QCV A;  4C5K A;  4O1G A;  4E69 A;  1DGM A;  4KAH A;  5C40 A;  3RQ6 A;  3RRB A;  3ZM6 A;  3KZH A;  4E84 A;  3LK7 A;  5CGE A;  1VM7 A;  3B1N A;  3MBJ A;  3NL3 A;  2JFG A;  3IBQ A;  3KTN A;  3MBH A;  2VAR A;  4S1M A;  3RU2 A;  4C12 A;  4C13 A;  1RKD A;  4DU5 A;  2AA0 A;  2ABS A;  2UUO A;  1V1A A;  2AX3 A;  3EAG A;  5CM5 A;  4E8Y A;  2DDO A;  3Q1Y A;  2XJA A;  2DCN A;  2RBC A;  3LOO A;  3UBO A;  4DC3 A;  4N08 A;  1P3D A;  1V19 A;  3RQ8 A;  2VTE A;  4C5M A;  5B6A A;  4JJP A;  5EYN A;  3IE7 A;  1LIK A;  3HJ6 A;  3B1P A;  1W7K A;  5C3Z A;  2I5B A;  3PL2 A;  3RTD A;  2VTD A;  3H74 A;  3RPH A;  3NC9 A;  3RSF A;  4EUM A;  1LIJ A;  3BF5 A;  4XCK A;  3B1Q A;  3NL2 A;  4ZIY A;  3HN7 A;  3RQQ A;  3RS8 A;  4E8Z A;  5CGA A;  4K93 A;  3RRE A;  3RSG A;  5C41 A;  1GQY A;  4BUC A;  3UQD A;  2R3E A;  4XDA A;  2UUP A;  1LHR A;  4UAG A;  2FV7 A;  3IH0 A;  2Y66 A;  1JXI A;  3BGK A;  2AB8 A;  3NBW A;  4LC4 A;  3RU3 A;  3GBU A;  2X5O A;  4C5J A;  3H49 A;  4QDI A;  3VAQ A;  1JBW A;  3PYZ A;  1V1S A;  1ESQ A;  3NBV A;  2GCA A;  4PVV A;  4KAL A;  3UMO A;  5BYC A;  3RPZ A;  1TZ3 A;  3RT9 A;  4UBE A;  3K9E A;  5TRW A;  3QA2 A;  3W4S A;  3ZS7 A;  2R3B A;  5BYE A;  3RTG A;  3RM5 A;  2ABQ A;  1RFT A;  2Y1O A;  2GC6 A;  1UA4 A;  2AWD A;  2JG1 A;  2C49 A;  3UAG A;  1JXH A;  1LII A;  4LCA A;  5A5F A;  2I6B A;  3RSS A;  1RKA A;  1FGS A;  3B1R A;  2AFB A;  2GCB A;  3JUL A;  3LKI A;  2PKM A;  1W78 A;  3NRS A;  4K8T A;  2XPC A;  3RRJ A;  4CVM A;  2DDW A;  3PZS A;  1V1B A;  1WYE A;  2Y68 A;  3HIC A;  3GO6 A;  2V78 A;  3CQD A;  3DZV A;  3UQE A;  1L2L A;  4GM6 A;  3RTA A;  2YXT A;  3NM1 A;  3RT7 A;  1RFV A;  4KAD A;  2YXU A;  3RQ5 A;  4C5N A;  2AJR A;  4EBU A;  3N2A A;  3HPD A;  3DRW A;  2I6A A;  4S1I B;  1E8C A;  3ZL8 A;  4EN4 A;  4C5L A;  1VK4 A;  2C4E A;  1O5Z A;  1GQT A;  2AJP A;  1YGK A;  2F00 A;  5EY7 A;  3RSQ A;  3FHY A;  5C3Y A;  4K9C A;  2GC5 A;  3VAS A;  4QF5 A;  3KD6 A;  2JFH A;  1TYY A;  2AM1 A; 
#chains in the Genus database with same CATH homology
 2PKK A;  3NCA A;  1KYH A;  3IKH A;  4E8W A;  4JKS A;  4LBX A;  5F11 A;  3QAI A;  4XF7 A;  1LIO A;  3LHX A;  4X8F A;  1EKK A;  4S1H A;  3HYO A;  1TD2 A;  2PKF A;  3UQ9 A;  4YL5 A;  1RKS A;  1C3Q A;  1TZ6 A;  2F02 A;  3I3Y A;  2NWH A;  2PKN A;  2Q5R A;  1YGJ A;  3GO7 A;  3OTX A;  4KBE A;  4O1L A;  5TQI A;  3UMP A;  5BYD A;  3RTC A;  3RQ2 A;  3B3L A;  1RK2 A;  3FHX A;  3RTB A;  4S1I A;  4K8C A;  3RS9 A;  3Q92 A;  1LHP A;  3KEU A;  4JKU A;  1GC5 A;  4LBG A;  3LJS A;  4E3A A;  1BX4 A;  2A9Y A;  2HW1 A;  3RTE A;  4B8S A;  3K5W A;  2XTB A;  4N09 A;  4WJM A;  4EOH A;  2HQQ A;  4U7X A;  4K8K A;  2HLZ A;  4XF6 A;  3RQX A;  1U2X A;  1RFU A;  4K9I A;  3RQH A;  3NC2 A;  2DDM A;  3NL6 A;  2F7K A;  3RRF A;  3RY7 A;  3N1C A;  4KAN A;  1VI9 A;  1YHJ A;  2QHP A;  1ESJ A;  5F0Z A;  3EWM A;  3IQ0 A;  4B8R A;  2A9Z A;  3NL5 A;  4YWR A;  2JGV A;  5BYF A;  2JG5 A;  3UQ6 A;  3IN1 A;  5COJ A;  3B1O A;  3RO4 A;  3NM3 A;  4K8P A;  1EKQ A;  1UB0 A;  2QCV A;  4C5K A;  4O1G A;  4E69 A;  1DGM A;  4KAH A;  5C40 A;  3RQ6 A;  3RRB A;  3KZH A;  4E84 A;  5CGE A;  1VM7 A;  3B1N A;  3MBJ A;  3NL3 A;  3MBH A;  3IBQ A;  3KTN A;  2VAR A;  4S1M A;  3RU2 A;  4DU5 A;  1RKD A;  2AA0 A;  2ABS A;  5CM5 A;  1V1A A;  2AX3 A;  4E8Y A;  2DDO A;  3Q1Y A;  2DCN A;  2RBC A;  3LOO A;  3UBO A;  4DC3 A;  4N08 A;  3RQ8 A;  1V19 A;  4C5M A;  5B6A A;  4JJP A;  5EYN A;  3IE7 A;  1LIK A;  3HJ6 A;  3B1P A;  5C3Z A;  2I5B A;  3PL2 A;  3RTD A;  3H74 A;  3RPH A;  3NC9 A;  3RSF A;  1LIJ A;  3BF5 A;  4XCK A;  3B1Q A;  3NL2 A;  3RQQ A;  3RS8 A;  4E8Z A;  5CGA A;  4K93 A;  3RRE A;  3RSG A;  5C41 A;  3UQD A;  2R3E A;  4XDA A;  1LHR A;  2FV7 A;  3IH0 A;  5C3Y A;  1JXI A;  3BGK A;  2AB8 A;  3NBW A;  4LC4 A;  3RU3 A;  3GBU A;  4C5J A;  3H49 A;  3VAQ A;  1V1S A;  1ESQ A;  3NBV A;  5BYC A;  4PVV A;  4KAL A;  3UMO A;  3RPZ A;  1TZ3 A;  3RT9 A;  4UBE A;  3K9E A;  5TRW A;  3QA2 A;  3W4S A;  3ZS7 A;  2R3B A;  5BYE A;  3RTG A;  3RM5 A;  2ABQ A;  1RFT A;  1UA4 A;  2AWD A;  2JG1 A;  2C49 A;  1JXH A;  1LII A;  4LCA A;  2I6B A;  3RSS A;  1RKA A;  3B1R A;  2AFB A;  3JUL A;  3LKI A;  4K8T A;  2PKM A;  3RRJ A;  2DDW A;  3PZS A;  1V1B A;  1WYE A;  3HIC A;  4EUM A;  3GO6 A;  2V78 A;  3CQD A;  3DZV A;  3UQE A;  1L2L A;  4GM6 A;  3RTA A;  2YXT A;  3NM1 A;  3RT7 A;  1RFV A;  4KAD A;  2YXU A;  3RQ5 A;  4C5N A;  2AJR A;  4EBU A;  3HPD A;  3DRW A;  2I6A A;  4S1I B;  4C5L A;  1VK4 A;  2C4E A;  1GQT A;  2AJP A;  1YGK A;  3RSQ A;  5EY7 A;  3FHY A;  4K9C A;  3VAS A;  3KD6 A;  1TYY A;  4EN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...