1V2MT

Benzamidine in complex with bovine trypsin variant x(triple.glu)bt.a1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Understanding protein-ligand interactions: the price of protein flexibility
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
molecule keywords Trypsin
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2mT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2mT02
1Z6JH 2Z7FE 1A61H 1FQ3A 2ZGCA 1YCPH 1P3EA 4OGXA 1G2LA 3RMNH 2FOAA 3VGCB 2A4QA 2G5NA 4E06H 2WPKS 3SW2B 2VWNA 1P2JA 3FZZA 1ZSJA 1O2WA 1NM6A 1YCPM 5EG4A 2SGEE 3KQEA 1FN8A 8GCHF 1C2FA 1WAYB 2QGRA 3LT3A 1WBGB 1OWKA 3U8TH 1C1RA 3PMHB 3SU1A 1TGTA 4DY7B 1GMDG 3SUEA 2JH0D 1EP6A 3BG8A 3QDZB 4B2BA 4RKOB 1NU7B 1DVAH 1EX3A 1C5PA 3Q77A 2WINI 3R3GB 1XVMA 3RXTA 1YKTA 3TNTA 3RC4A 5F8ZA 2FOMB 2SGPE 3B23B 3UREA 3ZYDA 2Y81A 1XUHA 3VEQB 4NCYA 5A0CA 1AN1E 3KN2A 2G51A 1W14U 1ELTA 2ZFQH 1Y59T 3PLPA 4X1SU 1KSNA 2JH6D 3M3TA 4X2WA 1GI5A 2F3CE 3MNXA 2VJ1A 2ZPQA 2GT8A 3GYMA 2BTCE 1TBQH 2YOLA 3MU0A 2FODA 1QJ7B 4PROA 2BY8X 1N8OC 4CBOA 1A2CH 4AB9A 2VVUA 4B2CA 4D7GA 5TJXA 1SLXB 1GMHF 5HMAA 4K8BA 5JDUB 3A80A 1V2JT 4NIWA 1S83A 4F4OC 3ZVCA 1W11U 3SUFA 4IS5A 1FMGA 3SZNA 4HTCH 4INLA 1O2NA 1O5AB 4IN2A 4CH8B 1PPFE 1FPCH 5DP8A 2F9VA 1UO6A 2GCTC 3SUGA 3TPIZ 2G52A 1C1SA 1KLTA 1GCTC 5EODA 5GCHF 3UQVA 3D62A 4FUHA 1ZSLA 2AERH 1TWXB 1X7AC 1XXDA 1CO7E 1A0JA 2FOCA 2WUCA 3SU2A 4BXSA 1SHHB 3L3TA 4OS7A 1VJ9U 1XUGA 1E0FD 1NO9H 2BZAA 2WYGA 4JZDH 4NA9H 1BT7A 1GDUA 1ELAA 4Q7YA 1C1PA 4X1RU 2ZP0H 1GG6C 3GCTF 1ANCA 3GY6A 1CBWB 1GBAA 1GI2A 5C5OA 1SGRE 1NFYA 4WF8A 3SI3H 1MH0A 2EA3A 2AMDA 2A2XH 1O5FH 1WOFA 3RU4T 3SJKA 1UVSH 2XWBI 3RXJA 1HAGE 1KXBA 5FAHA 1E34B 2ZDNA 3UNSA 3PV4A 4GPGA 4O9VA 1UHBA 4CR5A 2VIVA 5EQRA 3U98H 1FNIA 1TA6A 2XBVA 1C5MD 1GMCF 3RC5A 2ZI2H 5GXPA 4K8YA 1NC6A 7KMEH 2TGDA 3LC5A 4XE4A 1FJSA 5F8XA 1EOLA 3DT0H 3T62A 4TY7A 1G3DA 1SQOA 1P01A 3SNAA 4D7FA 1CGHA 2VIOA 1TABE 2QC2A 2OTVA 4CRAA 1A46H 4K1EA 2FI3E 1ETTH 2GDEH 1O2IA 1YP9A 1LPGB 2GX4A 3ZVGA 3R0FA 2QCYA 2B9LA 1FAXA 2CF8H 1BMMH 1RGQA 2P94A 1GI3A 3TK9A 1P04A 2BLQA 1Z71A 1OXGA 5C3NA 4MDSA 3M3SA 1GBLA 3DUXH 1NTPA 4DG4A 3OY6U 4ISLA 2BLWA 1ZTKA 1Y5UT 1H4WA 3DD2H 1QL8A 2FEQH 4LOYH 3RXAA 2G4TA 1YF4A 2V35A 1KY9A 4KGAA 1SB1H 1O3HA 4BTTB 1GI9B 1HAZB 2VB0A 3ZV8A 1MKXH 1QHRB 3QO6A 3K2UA 1NFUA 1S84A 1TGBA 2EC9H 2JETB 5CE1A 5HM2A 2BVXH 1AVXA 1XX9A 1EKBB 4NA7A 4BTIB 3QGNB 4FUJA 3SV7A 1P0SH 2XC0A 2A5KA 4FUDA 1O33A 4TWYA 1AFQB 3BIUH 1OYQA 5FX6A 3UPEA 1BJUA 1L2EA 1OP0A 3S9AA 4AORA 3QN7A 1TOCB 2PSYA 3TIUA 3A85A 3KCGH 4DVAU 3A7WA 3BTHE 1TPPA 1D6RA 1ZR0A 1QURH 4CRDA 1BTUA 1O3FA 1KDQA 4X2XA 4NIXA 1NRQH 1CBWC 2RCEA 2Z3CA 1QRZA 1TBRH 3QLPH 1HIAA 4GAWA 3A82A 4WH8A 1UK3A 6LPRA 1XUIA 1UK2A 2ANYA 2W3IA 4U01A 3LGVA 2J94A 4IN1A 1ZGIA 3UWJH 2ZO3H 3U9AH 1IQEA 1GBEA 2Y82A 4UDWH 1DFPA 1NY22 1C5VA 1P05A 1ID5H 5C1UA 1QJ6B 2ZC9H 1PFXC 4I8KA 1EAXA 2ZA5A 2AH4X 2R9PA 1F92A 1LVBA 2Z9GA 3QUMP 1AKSA 2ZHQH 1JXPA 4CHAB 3U69H 1CA0C 1TPAE 3B9FH 1W2KH 4ASHA 4OGYA 3ZZ4A 3LJJA 3RXIA 1TNLA 5FPYA 2YNBA 5L2ZH 3K65B 3TH2H 1KLJH 1SOZA 2V3HH 2TGPZ 2AMPA 1OKXA 1HXFH 1PQ5A 1EPTC 4UE7H 4D9RA 3SV9A 2NU1E 1O34A 1O3CA 6ESTA 2QYIA 1EPTA 3I29A 1O0DH 5EGMA 4ZMAH 1SGNE 1ELGA 1BTYA 1GI7B 1C1MA 2ZU5A 4AFZA 5AFZH 4I31A 3A8BA 3HKIB 1O3PB 1E37B 1ELEE 1W3CA 2HNTE 1YC0A 2CN0H 1GGDB 1O3AA 3STIA 4LZ4B 1TX8A 2Y80A 1YPJH 1PPHE 2DE8A 4I8HA 3UUZA 1F0TA 3IWMA 4H6TA 3V3MA 2UWOA 1BBRH 2BVSH 8KME2 1SGPE 2NU0E 9LPRA 2Y5HA 3OX7U 5B6OA 4HZHA 3SNCA 4MTBA 1QTFA 4Q2KA 5E0JA 4DW2U 4YM9A 1Q31A 2BLVA 3DA9B 3BTQE 3VPKA 5A8XA 3VGCC 3VXEH 1F0RA 4X2VA 4MQAA 3LDXH 1NRSH 2STAE 2WPLS 4IMQA 4Y10E 2ZPSA 3UWIA 3UOUA 2W5EA 4AYYB 2H9EH 1L4DA 4INKA 1C2DA 4H6SB 4DGJA 1KXCA 1S0QA 3A7ZA 1FIWA 1Z7KA 4WXIA 1LMWB 4B1TA 3ZZ9A 1GHXH 1ELFA 1JRSA 3MWIU 4HI3A 1THSH 1LKAA 2FO9A 4ZUHA 4D9QA 2ODPA 1O3DA 3MH4A 3RU4E 3FANA 7ESTE 3H7TA 3I78A 4NSVA 4K1SA 1PQAA 1LHFH 1VR1H 2FDAA 2FOHA 5IDKA 3RMMH 1FDPA 1YPGH 2A2QH 1MUEB 1N1LA 3NZIA 7GCHG 4OS5A 1KLIH 3GY8A 5EXMA 1TYNA 2GZ8A 3KNXA 2BQ6B 3LH1A 4AG2A 5JBCS 1C5QA 2OC0A 3TJOA 2F9NA 3S69A 1CT4E 4A5TS 3DFJA 2UWLA 1DXPA 3PTBA 2WPMS 3CP7A 1C1QA 4GLYA 1N6YA 3MI4A 1Y3UA 1O2QA 1P2OA 3AVZA 3ATMA 1FXYA 2XBYA 2ZFFH 1GJ8B 1TALA 2A31A 1NRRH 2J95A 5EXNA 5EW1H 2VNTA 4AX9H 2OC7A 2BD4A 1AFQC 1V2OT 5HYOA 2P93A 3VB6A 2C3SA 3A84A 1A0HB 2VINA 1C5SA 1DS2E 2VVVA 1EPTB 1LVMA 1P12E 1C2JA 5AFYH 3U8RH 4MNWA 5JB8S 3TNSA 4DJZB 1O2OA 3RXGA 4Y0YE 1MTSA 3SV6A 5FCKA 3BEFB 1VJAU 1Z8GA 2GDDA 1TA2A 2PR3A 1E36B 3F6UH 1SFQB 5TCCA 3MU5A 4BAOB 1Y5BT 1V2KT 3MHWU 3QGJA 5C5NA 1DANH 1QBVH 1S85A 1QIXB 1THRH 3FP7E 3SV2H 4CREA 1GJ7B 4FUIA 5BPEA 3RXBA 4KTCA 5GJ4B 2P59A 2WV4A 4J1YA 1PPCE 1EZQA 1QL7A 3LU9B 2ZFRH 5FXLA 1HFDA 1SGIB 3RP2A 1BHXB 3STJA 1UTKA 1SGEE 1YGCH 1TONA 1BQYA 2W26A 3JZ1B 3NPSA 2BXTH 2HRVA 2PGBB 3ZVFA 3HK6B 3SQHE 3UFAA 1SGFA 1EOJA 1XKBC 1CT0E 2BD9A 2EI6A 3MO9A 4YOGA 1SGTA 1OWJA 3ZZAA 1H1BA 1V2RT 4MPVA 3VFEA 4SGAE 3TH4H 5E8EH 4HGCA 1S81A 5AF9H 1GVZA 4NGAH 2PW8H 4ABGA 3F9EA 3AW1A 4WWYA 1AWHB 1HB0B 2M5TA 3MOCA 1K1OA 2D8WA 4R0IA 3UIRA 1GJ4H 3HK3B 3SNEA 4X8VH 1BB0B 3P8GA 1FAKH 3MH6A 1DUEA 1FPHH 2BDAA 4BAHB 2AYWA 3NKKA 1K1LA 1LQDB 1LHGH 1OPHB 4Q80A 1CSOE 2ZNKH 5DP6A 3SHCH 4H42U 4KKDA 4WY3A 1SGYE 1L4ZA 3PMJA 1WU1A 1LCYA 2H5DA 4U2WA 2IOTA 3BTEE 1GHAF 1AGJA 1FIZA 1MCTA 1TMBH 3LPRA 2P3FH 2SGFE 1WCZA 2R2WU 3PMBB 1EZSC 3GDSA 2O9QA 3SU6A 2LPRA 2Z9IA 5FPSA 1S5SA 1SHYA 2XC4A 3QZQA 1C4U2 3PM3A 5I25A 2C8YB 3OTJE 1HAIH 2BY7X 2PUXB 1SSXA 1GMDF 1AZZA 1EJAA 2IPHA 4IBLH 1O2RA 5H4IB 3RXUA 1HXEH 2A32A 2UUKB 3L6PA 3MH5A 4YO9A 3PTNA 4AG1A 3E90B 3AAVA 4JZ1A 1GBMA 1O3JA 1C2IA 5A2MH 4ISOA 1C5ZB 1JMOH 3V7TA 4ESTE 1GVKB 3V13A 1GHWH 4H4FA 4XFQA 1JRTA 1Y8TA 2J38A 2VIDA 4UEHH 1KXAA 1AVGH 1FY4A 3MU1A 1LDTT 3SJ8A 1H9LB 1NESE 3KGPA 1GI1A 5GDSH 5L6NH 1GPZA 3LIWA 5CHAB 1OS8A 1W7GH 4GHQA 2JETC 1QA7A 3QWCH 1ZYOA 3E91A 1K9OE 5DP5A 3ATIA 4ZROA 1L1JA 1C1WH 2VU8E 3FAOA 1BUIA 1DICA 1JIMA 1ARBA 1HDTH 3KHVA 2Y5FA 2Z9JA 2A45B 3OY5U 2ODQA 1EQ9A 5F6MA 1QQUA 1RTLA 4B75A 3RDZA 2C4FH 3RXLA 3ZZCA 1BRAA 2ALPA 4DIHH 1SLWB 2F9PA 3RM0H 1BTHH 1F7ZA 2CHAC 4MVNA 1U6QA 4WMDA 1T4VH 4NZLA 4XDEA 1DT2A 3DFLA 1F5KU 1PPZA 3CENA 4TPYA 5EQSA 4ABBA 3FFGA 1SC8U 5T3HA 4CRGA 5T6GA 1UCYH 3LGTA 2R0LA 3QK1A 3A8AA 3T29A 1ACBE 4AFQA 2WYJA 2BD2A 5JB9S 3GY7A 2QXIA 1EZXC 1L0ZA 2PKSB 4CH2B 5F8TA 6GCHG 1HV7A 1RTFB 3IITA 2CGAA 1DE7H 2VWMA 4K5ZA 1GBIA 1DWEH 3TJVA 3TU7H 1NPMA 4YLQH 1RD3B 3F9GA 1WQSA 4IW4E 1NS3A 3VXFH 4X6PA 1VITF 2BB4A 4JK6A 1UVPA 1ZGVA 1SFIA 1CA0B 2BD3A 2GCHG 4CRCA 5E2PA 2R3YA 1VCQA 1A5IA 1G37A 1GHVH 1SQTA 3RLYH 3S7HB 1O38A 1VGCC 4MG3A 1NFXA 3BV9B 2XCNA 1TOMH 2SGDE 1PPBH 1MZDA 4WXVA 3MO3A 4TWWA 5L30H 1F2SE 4XBCA 1GHYH 1KYNA 2ZDLA 1TIOA 2Z94A 1G36A 1QRWA 1EAUA 1F5LA 1QR3E 2BDIA 2VVCA 3TGJE 2P8OB 1BRBE 5K7RA 1UTPA 4DOQA 3QZRA 2FS9A 1O3BA 4YOJA 1OWIA 3BTKE 1O39A 2IN2A 4BAKB 3BEIB 1MAXA 1PPGE 3NWUA 1QL9A 2Y6TA 1C5TA 1O32A 2GP9B 2BDYA 2C93B 3M3VA 4THNH 1O2YA 2ZCLP 1S6FA 2O8LA 1EB2A 4MPUA 4E7RG 1THPB 1O2SA 3E0PB 2PUQH 3Q3YA 4XBDA 6CHAC 1B7XB 1ORFA 1MKWH 5ETXA 1LTOA 4JYVH 1LPZB 1GHZA 1MQ5A 1V2UT 1TNJA 1ZRKA 3KF2A 1J15A 2HOBA 1T4UH 1GMCG 1UTNA 4VGCC 3T28A 3ZVDA 2ZWLH 2UWPA 7GCHF 1QY6A 3SU3A 1KTTB 1SLUB 3ZZ7A 2OC8A 2GVFA 3TH3H 1HUTH 1ANDA 4GCHG 5IYTA 5EPNA 1EJNA 1UMAH 1C2HA 1QJ1B 3N7OA 4BNRA 2H9TH 4ISHH 1K1PA 2A5AA 1O37A 4ABHA 2FP7B 3U1IB 1NU9A 1WQVH 3CS0A 4CRFA 1A1RA 1V3XA 1L1NA 2W7SA 4UONA 3SBKA 3RC6A 3ATKA 1CGIE 1P03A 2BD5A 4O03A 2ANMH 4JZIA 3M5NA 1BZXE 2LNCA 1B0FA 3SJIA 1MD7A 4A1TA 3WY8A 4JYTA 1FY5A 3Q76A 1MQ6A 1J17T 4Z6AH 8ESTE 3A81A 1V2MT 2HLCA 2GV6A 1GCTB 1SVPA 1MBMA 3GCTG 2XCFA 2G5VA 2O8WA 2ZZUH 1TPOA 1QFKH 1YYY1 2TGAA 2VIWA 2ANWA 3M5OA 3CS7A 4LXBH 1BTWA 1XUFA 4FXGH 2VH0A 1C5XB 3SN8A 3GCHC 1AI8H 2AGIX 3LGIA 1TLDA 1WYKA 3RXPA 3BTME 1UK4A 5EPYA 1OP2A 1ZMLA 1V2LT 1TMUH 5J4QA 2EI7A 3OSYA 1LPKB 2Z9KA 1DWBH 3P92A 1QQ4A 1TAWA 2JH5D 2HPQH 2AS9A 1O5BB 3ELAH 2PTCE 1C2MA 5A0BA 4CHAC 2F9OA 3SJ9A 2ZEBA 4TY6A 4Y11E 1W0YH 2I6QA 5F03A 1BOQA 4O3TA 1G30B 3SU0A 2XXLA 2G55A 1T8NA 1CU1A 2AFQB 4AFUA 1GBKA 2SFAA 4Y79A 3ESTA 5JYIA 1O3NA 4I8GA 3GCHB 1CQQA 4X8SH 1O5DH 2OQUA 3PLBA 3F1SB 3BN9A 1P11E 2ZU1A 2OXSA 4FUGA 1SGQE 1HCGA 1CHOG 1LHDH 1OWDA 4NFEA 3VB3A 1TX6A 1P57B 5LH8A 3S7KB 1O2UA 2A5IA 3SU5A 2FOBA 2GD4B 2ZPRA 4VGCB 3MNCA 2GTBA 1FLEE 1GDNA 2Q1JA 2QIQA 2ZCHP 1C1OA 2OUAA 2QY0B 2BZ6H 1KXDA 1HAPH 1C2EA 2Z9LA 1FUJA 1F0UA 1C5UA 1DX5M 3GICB 1K1IA 1BMAA 1O3KA 4X1NU 1DXWA 1OWEA 2B8OH 5DJ7A 5DG6A 4ABDA 2BVRH 2P8OC 4ZKRU 3F9HA 3ZZ5A 1HAXB 2GZ7A 5A8ZA 2NU3E 3PYHA 3MNBA 1S82A 1T8LA 1C2GA 2AEIH 2STBE 1P2IA 1WV7H 3SU4A 1QBOA 2Z3DA 3P8FA 4MLFB 2FYQA 2OLGA 3GISB 4GVUA 4ZKSU 5C2ZA 1MTNB 4GHTA 1P3CA 1P9UA 3EQ0H 3LKWA 3M7QA 4CBNA 4K69A 4Y0ZE 2PTNA 3GCOA 2ZDVH 1GWAA 1GVLA 1N8OB 2QA9E 4AOQA 6CHAB 6GCHF 4AB8A 1CA8B 1IQKA 1G3BA 1ZPBA 2OC1A 1V2ST 2BOKA 4OS1A 4YTAA 1UHBB 1D6WA 4MNYA 3ENSB 3ZZBA 3GDVA 3T27A 2A4OA 3VB5A 2ZTZA 1ELCA 2XNIA 4UD9H 2ZTYA 3A8DA 4AFSA 3UNQA 4ABAA 3KIDU 1H8IH 1EAWA 1A0LA 1UVTH 2G81E 1AQ7A 2J4IA 1V6DA 4X1QU 1LO6A 2F83A 2EEKA 1O36A 1K1JA 2VH6A 1D9IA 5DPAA 1KXFA 3A88A 5CHAC 3OU0A 1YPHE 3M7UA 1IQMA 4YOIA 2A7HA 1V2QT 4Y8YA 3P95A 4DT7B 1EASA 1M9UA 1SGCA 2ULLA 2FS8A 2ZU2A 3BEUA 1TGSZ 4BTUB 1VZQH 3RMLH 1W10U 5DP3A 4I8LA 1C1VH 1O2MA 1DOJA 5FBEA 1UJ1A 1A7SA 1MAYA 1WTHD 2G8TA 2BD7A 2ASUB 1Z8JB 3BF6H 4Y6DA 1TNGA 1MTWA 1TE0A 2V6NA 1SL3A 3GCNA 1ETRH 1DDJA 1DY8A 1N6XA 5A8YA 3TGIE 3RXHA 3M36A 2AGGX 1YPKH 3DHKH 3KQBA 4OS2A 1EP5A 2XBXA 4XOJA 1S6HA 1EJMA 4LK4A 1ESBA 4MPWA 4AN7A 3GY4A 3Q3XA 1ZPZA 2C90B 1MU8B 4DCDA 1ELVA 5SGAE 1GI0A 2J34A 4JYUH 2AMQA 3HGNA 2GCHF 1JWTA 1DITH 2OD3B 2FX4A 1H9HE 4LZ1H 1VITH 3GOVB 2H9HA 3H5CB 1V2PT 1V2VT 3RLWH 1ESTA 1DWDH 3AAUA 2PV9B 3A7XA 3EDXB 3ZVAA 2HALA 4JMYA 5EQQA 1HBTH 3ATLA 3RXSA 1GI4A 1QCPA 1KXEA 3M37A 5GWZA 1UCYK 1V2TT 1C1NA 2FESH 2FOEA 2R2MB 4BAQB 1HLTH 1BDAA 3C27B 2BX4A 3P8NA 2BD8A 1P06A 1MTNC 3T25A 1VGCB 1ARCA 1HGTH 2ZQ1A 1C1TA 5LPEA 1QB9A 1WUNH 1A3BH 5FBIA 1HAOH 4CR9A 3BTDE 4I32A 1BITA 2OQ5A 3Q00A 2BMGB 2SGQE 4F49A 4I7YH 1XVOA 1SOTA 2ZCKP 1D3QB 1FONA 4U30A 4FUCA 4KELA 1UTMA 1YPLH 1INCA 2TGTA 1E38B 4TYDA 2A7JA 2V3OH 2O8TA 1TRMA 1PJPA 2D26C 3BTWE 5A09A 1F5RA 3TLOA 1G32B 2FTLE 5GPIB 3ITIA 3NUMA 1FI8A 5LGOA 1PPEE 1J9CH 3P8OA 4NIVA 2PKAB 4RKJB 4X1PU 1T32A 2NU4E 1B5GH 1LHEH 1P8VC 4K1TA 1L1GA 1J8AA 2SNVA 4RN6A 4WMFA 1PYTC 2ZFSA 1O2JA 3Q3KA 1C5RA 2XTTB 1EATA 1V2WT 1K21H 1GJ5H 2PLXA 2ZG0H 1AVWA 3FZDA 3SV8A 4ISNA 1YLDA 2UUFB 1T8MA 2EI8A 1DM4B 2O8UA 4UFGH 4MNXA 3TGKE 5A0AE 3SO3A 1QGFA 3T5FH 4IMZA 4WH6A 1ZLRA 1MKXK 1NRNH 3MFJA 3SOSA 1FZZA 2B0FA 1MZAA 5ABWA 3TJUA 2IJOB 4NSYA 2F91A 2BXUH 2FXRA 5E0HA 3SGQE 4UFDH 1TNIA 3ZZ8A 2SGAA 3SORA 2PFEA 1KDQB 3D65E 3ATWA 1QBNA 1UTQA 2Z3EA 1T31A 3EAJA 2B7DH 2RA0A 1JBUH 2FOGA 1C5LH 3RXOA 3S9BA 3NK8A 4U32A 1O3IA 1FV9A 2HPPH 1BHXF 1AHTH 3SUDA 1Z8IB 4CRBA 1H9IE 1KTSB 1ANBA 4A92A 2Q6DA 2A0QB 1O2ZA 1G3EA 1FY3A 1HAVB 2JKHA 2ZGBH 3GY2A 1O35A 3MO6A 1GG6B 1ZTLA 3RXCA 2WUBA 2XC5A 1V2NT 5T6FA 5E2OA 1RFNA 2FWWA 1GHBG 1EB1H 2QXHA 1OOKB 1GBHA 4Y8XA 1O31A 2GGVB 2P95A 4KTSA 2PSXA 1IHTH 1GBFA 2FOFA 5DK1A 1O3GA 1RIWC 3RXFA 1O30A 4AGJA 3A86A 3QX5H 2GT7A 1AO5A 1GCDA 4BAMB 1A3EH 2BX3A 4D76A 3A87A 5C1YA 2BY6X 2NWNA 2AIQA 2W3KA 2FYRA 2BOHB 3B8JA 1PYTD 2WPJS 2ALVA 3ZYEA 1P9SA 4WMEA 1JIRA 3ZVEA 1ZHRA 2FI4E 2P16A 3AW0A 4UFFH 1AZ8A 3SGAE 1ANEA 3U1JB 2VIQA 3KL6A 4AYVB 2PKAA 3V12A 1QB6A 5GIBA 1IQFA 5EOKA 1YPHC 2RG3A 1ZHPA 1DUAA 4SGBE 3PO1B 5DP7A 3E8LA 3RXMA 5DO4H 2ZDMA 1SQAA 4ABJA 3UR6A 1J16A 1OYTH 1MTVA 1O5EH 3W94A 5FHTA 1TRYA 1XXFA 2UUJB 3M61U 1UCYE 2BQWB 5FPTA 2BLOA 1E35B 3D23A 5LPFA 2XYAA 1NZQH 2C8ZB 1SLVB 2ZGJA 1G9IE 5JPMH 1GBCA 2ZTXA 3RXEA 2FIRH 1NRPH 1CHGA 1RJXB 2FLRH 1YPEH 2G00A 3O8RA 4BANB 3O8DA 1PQ8A 3EYDA 2TPIZ 2J2UA 1CVWH 1BBRK 2ODYB 1MU6B 1TRNA 2H5CA 2VGCC 2FM2A 4J2YB 3BTGE 3M35A 2WV5A 1DWCH 3F9FA 1HIAB 2XWAA 4GSOA 1YPMH 1C5YB 3T26A 1IQHA 1ELBA 2BDBA 3BG4C 2XW9A 2XBWA 1GBJA 2G4UA 1GL1A 4ZAEA 3P6ZB 1IAUA 1AMHA 2THFB 1ZHMA 3M7TA 1GJDB 2PHBA 3P17H 1C5NH 1XMNB 1O2HA 1MD8A 4NWLA 5J4SA 2VGCB 3E3TA 5G4BA 1XKAC 1P2KA 1C4Y2 3BSQA 1UTOA 1MKWK 1TQ0B 2VWOA 4GCHF 2R3UA 4NA8A 4BXWA 1BIOA 5JBBS 1EAIA 2SNWA 3K6YA 1SMFE 2A4RA 3M5LA 1PQ7A 2VWLA 2WPHS 2WPIS 3UTUH 3HATH 3PWCA 1HPGA 2QAAA 4K2YA 3SI4H 3BG4B 2QXJA 2RA3A 1F0SA 3URCA 1UTJA 2CXVA 3D49H 3E0NB 1BRUP 2C8XB 4E7NA 1P09A 4A6LA 1TQ7B 2Y7XA 4TPIZ 3RM2H 4ABFA 2AIPA 2GZ9A 3G01A 3MMGA 4Q7XA 4M7GA 4X0WU 1BRCE 1W7XH 5E0GA 1GHAG 4ISIH 7LPRA 1BA8B 1GBTA 1P10A 5AHGH 1G3CA 1GDQA 1FY8E 2TBSA 3F68H 5ESBA 4JZFH 1NT1A 3PO1C 1ETSH 4AGKA 2ANKH 1DLEA 4DURA 3NXPA 3QTOH 1C1UH 2FPZA 4XSKU 2F9UA 1W0ZU 1ABIH 5ESTE 2W7UA 3K6ZA 3PLKA 4Y7BA 1IQIA 1LHCH 4BOHA 2ZU3A 4YESB 4I33A 1QRXA 3RXDA 1BJVA 2ZDKA 4ZXXH 2RDLA 4Q7ZA 8LPRA 2Y7ZA 2Z6BD 1A5HA 4NIYA 1G2MA 1GGDC 1IOEA 3FVFB 3LGWA 4Z0KA 1RIWB 2CJIA 1TNKA 2B5TB 1O3OA 2I6SA 4FVDA 1A5GH 1GL0E 1YLCA 5JBTA 1DLKB 1VCWA 5EU8A 5PTPA 2ZKSA 2BY5X 1DSTA 4KTUA 3TVJB 1Y3WA 4ZKOU 2H1UA 2ZDAH 4A7IB 3L33A 1KIGH 1GJ6A 1AUJA 2ZFTA 2PGQB 2HVXA 1EUFA 2GKVE 1Y3XA 2OBOA 5DP9A 2BQ7B 3NCLA 1ZJDA 1AU8A 1SBWA 4O97A 1AY6H 1Q3XA 1P2MA 4OS4A 1RTKA 2D1JA 1O2LA 1GMHG 3HGPA 1K22H 4Y71A 3UR9A 1BTZA 1GJBB 3PWBA 3QTVH 2H2ZA 3C1KA 1TBZH 2ZHEH 4IGDA 4Y76A 3ZZ3A 1XUKA 1MMJN 1O2XA 2DUCA 3EA7A 4DIIH 8GCHG 1HJAC 2ZF0H 3GYLB 2R0KA 2YNAA 3GY3A 2OINA 1CE5A 3KEEA 1GHBF 4B74A 1K2I1 1CT2E 1DPOA 3M5MA 2BM2A 3MYWA 3SGBE 2ZU4A 3KQCA 2PWXA 2ZFPH 1SI5H 4JK5A 4X6NA 1O2PA 1SG8B 2ZHFH 2TIOA 1RXPA 1ZTJA 4IC6A 3VB4A 1ZRBA 1ELDE 4ZKNU 4Y7AA 5L2YH 3LONA 1J14A 1SR5C 1TGNA 1VITG 1HJAB 5C67A 1NROH 2Q6GA 3O8CA 1K1MA 3ZVBA 2J9NA 2FI5E 2FZZA 1C2LA 1O2VA 1O3EA 3SNDA 1H8DH 1S0RA 1RS0A 2HNTF 1ZJKA 2K1QA 2P3UB 4NZQA 3UQOA 5T6DA 3V0XA 2GMTC 1GBDA 2KAIB 2OCVB 1ZPCA 1GJ9B 5EXLA 3SNBA 1O3LA 3A7TA 4E05H 3U8OH 3MTYA 1IQLA 1GBBA 3MU8A 3HKJB 1O3MA 1IHSH 1Z1JA 2CHAB 1WTGH 2Y5GA 3LH3A 2ZHDA 4X6MA 5C1XA 3EA8A 2NU2E 4B71A 4B76A 2ZHWH 3A89A 4JZEH 1Y3VA 5DKMA 1DSUA 4O3UA 1GI8B 4A1XA 4FUBA 1D3TB 3TJNA 4WJG2 1QA0A 4FUEA 1GJAB 1C5WB 3RXQA 3LJOA 3MU4A 1IQNA 1EXFA 2C8WB 5HXFA 1T7CA 4D8NA 3GDUA 3BIVH 2H6MA 4NFFA 2PKSC 1AIXH 3KQDA 1GI6A 3ODDA 5TCAA 1MTUA 3TK5A 1C9PA 1BBRE 4A1VA 4FUFA 1IQGA 3EA9A 1HAYB 1NFWA 1LQEA 4INHA 1C4V2 3S9CA 2J92A 1CHOF 5FX5A 3I77A 4K60A 1IQJA 3T2NA 9ESTA 3RU4D 1T8OA 2QF0A 3IG6B 2F9BH 4X6OA 3E1XB 1TFXA 3ODFA 1HJ9A 2A1DB 3UNRA 1TGCA 4FVBA 2OBQA 4ABIA 2A4GA 3ZZ6A 3RXVA 3P70B 2QN5T 3FP8E 3MH7A 1VCPA 5K0HA 1UVUH 4X2YA 1AWFH 5GCHG 1C5OH 4XBBA 1ZSKA 2DE9A 2HGTH 1AB9C 3TITA 5LPRA 4K3JA 1XUJA 1YM0A 3OYPA 4MNVA 1SPJA 1XM1A 1OX1A 1P2NA 1Q2WA 3A8CA 1O2KA 3UOPA 2ILNA 4AZ2B 1K28D 1W12U 2BDGA 1AUTC 1Y3YA 1TX7A 1HYLA 1LVOA 4FU8A 5DP4A 1B0EA 2BHGA 4X8UH 4IC5A 1AD8H 1DY9A 1Z6EA 3S0NA 4ZHLU 1AB9B 4MPXA 1BCUH 1W8BH 1ABJH 2GMTB 2ZIQH 5AVDA 1YCPK 3EGKH 1BMLA 1LKBA 4NG9H 4RSPA 1EZUC 1ZOMA 2GV7A 1OWHA 2ZECA 2FLBH 2A7CA 4UFEH 2FTMA 4FU9A 3E6PH 2ZGXH 3E16B 2P3TB 4ZXYH 1ZMNA 4KP0A 1ZZZA 1MCVA 2BY9X 2ZGHA 4I8JA 3EE0B 4ZHMU 1WSSH 1TPSA 4YLUA 3VB7A 4YZUA 1Y5AT 3ZZDA 1HAHH 1HJ8A 5JBAS 2FMJA 3RXKA 1YBWA 3H7OA 1W13U 1P2QA 3BTFE 2XRCA 1MBQA 1QNJA 4GUXA 2GCTB 2FX6A 1UTLM 3JZ2B 3GY5A 2CMYA 3FP6E 3LOXA 5HGGA 4NWKA 1NN6A 3SJOA 1ESAA 1C9TA 1O5GH 1D3PB 1K1NA 1HAVA 5DGJA 3MNSA 4R8TB 4Y8ZA 4WVPE 2QF3A 1TB6H 1AKSB 1P02A 2UUYA 3LGUA 3SHAH 1HRTH 1Z8RA 1UVOA 1RRKA 3UY9A 1TMTH 3PB1E 3A7VA 3RUOA 2ESTE 1OP8A 3HPTB 3K9XB 3AASA 2D2DA 2CF9H 2O8MA 2Q6FA 1A4WH 4B2AA 1O2TA 4X8TH 2BDCA 5FCRA 3LGYA 1FN6A 1BMNH 3URDA 2CV3A 1HNEE 1QB1A 2KAIA 3PROA 3RXRA 2TRMA 4ABEA 4FU7A 1TNHA 2BYAX 4OS6A 1JOUB 1AE5A 2V0BA 5I46H 3SQEE 1OSSA 2HWLB 1O5CB 3PMAB 3O8BA 1CGJE 4ZHAA 1ZMJA 2BDHA 4JCNA 3ZV9A 2OP9A 3LC3A 1D3DB 4ZH8A 3BTTE 5HM9A 4B73A 2ZQ2A 2HNTC 4QT8C 3RMOH 2VIPA 3A83A 5BRRE 3W95A 1AFEH 1FY1A 3A7YA 1BTPA 1AE8H 1SGFG 1Z1IA 2AGEX 1C2KA 1D4PB 2QV1A 5CMXH 4YT7H 1BTXA 1O2GH 2QXGA 4HFPB 4YT6H 1LVYA 1SGDE 3TK6A 5EW2H 1GJCB 5C20A
chains in the Genus database with same CATH superfamily
1Z6JH 3FKSD 2Z7FE 1A61H 1FQ3A 2ZGCA 1YCPH 1P3EA 4OGXA 1G2LA 1NBME 2FOAA 3RMNH 2A4QA 3VGCB 2G5NA 4E06H 2WPKS 3SW2B 2VWNA 4RT1A 1P2JA 3FZZA 1ZSJA 1O2WA 1NM6A 1YCPM 5EG4A 2SGEE 3KQEA 1FN8A 8GCHF 1C2FA 1WAYB 2YMSC 2QGRA 3LT3A 1WBGB 1OWKA 3U8TH 1C1RA 3PMHB 3SU1A 1TGTA 4DY7B 1GMDG 3SUEA 2JH0D 1EP6A 3BG8A 3QDZB 4B2BA 4RKOB 1NU7B 1DVAH 1EX3A 1C5PA 3Q77A 2WINI 3R3GB 1XVMA 3RXTA 1YKTA 3TNTA 3RC4A 5F8ZA 2FOMB 2SGPE 3B23B 3UREA 3ZYDA 2Y81A 1XUHA 3VEQB 4NCYA 5A0CA 1AN1E 3KN2A 2G51A 1W14U 1ELTA 2ZFQH 1Y59T 3PLPA 4X1SU 1KSNA 2JH6D 3M3TA 4X2WA 1GI5A 2F3CE 3MNXA 2VJ1A 2ZPQA 4TT3D 2GT8A 3GYMA 2BTCE 1TBQH 2YOLA 3MU0A 2FODA 1QJ7B 4PROA 2BY8X 1N8OC 4CBOA 1A2CH 4AB9A 2VVUA 2IPQX 4B2CA 4D7GA 5TJXA 1SLXB 1GMHF 5HMAA 4K8BA 5JDUB 3A80A 1V2JT 4NIWA 1S83A 4F4OC 3ZVCA 1W11U 3SUFA 4IS5A 1FMGA 3SZNA 4HTCH 4INLA 1O2NA 1O5AB 4IN2A 4CH8B 1PPFE 1FPCH 5DP8A 2F9VA 1UO6A 2GCTC 3SUGA 3TPIZ 2G52A 1C1SA 1KLTA 2KCYA 1GCTC 5EODA 5GCHF 3UQVA 3D62A 4FUHA 1ZSLA 2AERH 1TWXB 1X7AC 1XXDA 2J98B 1CO7E 1A0JA 2FOCA 2WUCA 3SU2A 4BXSA 1SHHB 3L3TA 4OS7A 1VJ9U 1XUGA 1E0FD 1NO9H 2BZAA 2WYGA 4JZDH 4NA9H 1BT7A 1GDUA 1ELAA 4Q7YA 1C1PA 4X1RU 2ZP0H 2J97A 1GG6C 3GCTF 1ANCA 3GY6A 1CBWB 4P00A 1GBAA 1GI2A 5C5OA 1SGRE 1NFYA 2KR7A 4WF8A 3SI3H 1MH0A 2EA3A 2AMDA 3UB0A 2A2XH 1O5FH 1WOFA 3RU4T 3SJKA 1UVSH 2XWBI 3RXJA 1HAGE 1KXBA 5FAHA 1E34B 2ZDNA 2KCAA 3UNSA 3PV4A 4GPGA 4O9VA 1UHBA 4CR5A 2VIVA 5EQRA 3U98H 1FNIA 1TA6A 2XBVA 1C5MD 1GMCF 3RC5A 3OEED 2ZI2H 5GXPA 3PV2A 4K8YA 1NC6A 7KMEH 5T1VA 2TGDA 3LC5A 4XE4A 1FJSA 5F8XA 1EOLA 3DT0H 3T62A 4TY7A 1G3DA 1SQOA 1P01A 3SNAA 4D7FA 1CGHA 2VIOA 1TABE 2QC2A 2OTVA 3FO8D 4CRAA 1A46H 4K1EA 2FI3E 1ETTH 2GDEH 1O2IA 1YP9A 3DSOA 1LPGB 2GX4A 3ZVGA 3R0FA 2QCYA 2B9LA 1FAXA 2CF8H 1BMMH 1RGQA 2P94A 1GI3A 3TK9A 4I86A 1P04A 2BLQA 1Z71A 1OXGA 5C3NA 4MDSA 3M3SA 1GBLA 3DUXH 1NTPA 4DG4A 3OY6U 4ISLA 2BLWA 1ZTKA 1Y5UT 1H4WA 3DD2H 1QL8A 3AK5A 2JJ2D 2FEQH 4LOYH 3RXAA 2G4TA 1YF4A 2V35A 1KY9A 4KGAA 1SB1H 1O3HA 4BTTB 1GI9B 1HAZB 2VB0A 2EY4C 2V7QD 3ZV8A 1MKXH 1QHRB 3QO6A 3K2UA 5C0UA 1NFUA 1S84A 1TGBA 2EC9H 2JETB 5CE1A 5HM2A 2BVXH 1AVXA 1XX9A 1EKBB 4NA7A 4BTIB 5EJZA 3QGNB 4FUJA 3SV7A 1COWD 5EIYA 1P0SH 1EFRD 2XC0A 2A5KA 4FUDA 1O33A 4TWYA 1AFQB 3BIUH 1OYQA 5FX6A 3UPEA 1BJUA 1L2EA 1OP0A 3S9AA 4Z1MD 4AORA 2CK3D 3QN7A 1TOCB 2PSYA 3TIUA 3A85A 3KCGH 4DVAU 3A7WA 3BTHE 1TPPA 1D6RA 1ZR0A 1QURH 4CRDA 1BTUA 1O3FA 1KDQA 4X2XA 4NIXA 1NRQH 1CBWC 2RCEA 2Z3CA 1QRZA 1TBRH 3QLPH 1HIAA 4GAWA 3A82A 4WH8A 1UK3A 6LPRA 1XUIA 2OK5A 1UK2A 2ANYA 2W3IA 4U01A 3LGVA 2J94A 4IN1A 1ZGIA 3UWJH 2ZO3H 3U9AH 1IQEA 1GBEA 2Y82A 4UDWH 1DFPA 1NY22 2VBCA 1SQRA 1C5VA 1P05A 1ID5H 5C1UA 1QJ6B 2ZC9H 1PFXC 4I8KA 1EAXA 2ZA5A 2AH4X 5KGOA 2R9PA 1F92A 1LVBA 2Z9GA 3QUMP 1AKSA 2ZHQH 1JXPA 4CHAB 3U69H 1CA0C 1TPAE 3B9FH 3VG8A 1W2KH 4ASHA 4OGYA 5HIZA 3ZZ4A 3LJJA 3RXIA 1TNLA 5FPYA 2YNBA 2K0QA 5L2ZH 3K65B 3TH2H 1KLJH 2JIZD 1SOZA 2V3HH 2TGPZ 2AMPA 2GJGA 1OKXA 1HXFH 1PQ5A 1EPTC 4UE7H 4D9RA 3SV9A 2NU1E 3OFND 1O34A 1O3CA 6ESTA 2QYIA 1EPTA 3I29A 1O0DH 5EGMA 4ZMAH 1SGNE 1ELGA 1BTYA 1GI7B 1C1MA 2ZU5A 4AFZA 5AFZH 4I31A 3A8BA 3HKIB 1O3PB 1E37B 1ELEE 1W3CA 2HNTE 1YC0A 2CN0H 1GGDB 1O3AA 3STIA 4LZ4B 1TX8A 2Y80A 1YPJH 1PPHE 2DE8A 4I8HA 3UUZA 1F0TA 3IWMA 4H6TA 3OTPA 2UWOA 3V3MA 1BBRH 2BVSH 3N7EA 1SGPE 2NU0E 8KME2 9LPRA 5HKKD 2Y5HA 3OX7U 5B6OA 4HZHA 3SNCA 4MTBA 1QTFA 4Q2KA 5E0JA 4DW2U 4YM9A 1Q31A 2BLVA 3DA9B 3BTQE 3VPKA 5A8XA 3VGCC 3VXEH 2LELA 1F0RA 4X2VA 4MQAA 3LDXH 1NRSH 2STAE 2WPLS 4IMQA 4Y10E 2ZPSA 3UWIA 3UOUA 2W5EA 4AYYB 2H9EH 1L4DA 4INKA 1C2DA 4H6SB 4DGJA 1KXCA 1S0QA 2YMSB 3A7ZA 1FIWA 1Z7KA 4WXIA 1LMWB 4B1TA 3ZZ9A 1GHXH 1ELFA 1JRSA 3MWIU 4HI3A 1THSH 1LKAA 2FO9A 4ZUHA 4D9QA 2ODPA 1YLNA 1O3DA 3MH4A 3RU4E 3FANA 7ESTE 3H7TA 3I78A 4NSVA 4K1SA 1PQAA 1LHFH 1VR1H 2FDAA 2FOHA 5IDKA 3RMMH 1FDPA 1YPGH 2A2QH 3DSPA 3KQ5A 1MUEB 1N1LA 1FX0B 3NZIA 7GCHG 4OS5A 1KLIH 3GY8A 5EXMA 1TYNA 2GZ8A 3KNXA 2BQ6B 3LH1A 4AG2A 5JBCS 1C5QA 2OC0A 3TJOA 2F9NA 3S69A 1CT4E 4A5TS 3DFJA 2UWLA 1DXPA 3PTBA 2WPMS 3CP7A 1C1QA 5DN6D 4GLYA 1N6YA 3MI4A 1Y3UA 1O2QA 2PP6A 1P2OA 3ATMA 3AVZA 1FXYA 2JDID 2XBYA 2ZFFH 1GJ8B 1TALA 2A31A 1NRRH 2J95A 5EXNA 5EW1H 2VNTA 4AX9H 2OC7A 2BD4A 1AFQC 1V2OT 5HYOA 2P93A 3VB6A 2C3SA 3A84A 1A0HB 2WZQA 2VINA 1C5SA 1DS2E 2VVVA 1EPTB 1LVMA 1P12E 1C2JA 5AFYH 3U8RH 4MNWA 5JB8S 3TNSA 4DJZB 1O2OA 3RXGA 4FETA 4Y0YE 1MTSA 3SV6A 5FCKA 3BEFB 1VJAU 1Z8GA 2GDDA 2M2AA 1TA2A 2PR3A 1E36B 3F6UH 1SFQB 5TCCA 3MU5A 4BAOB 1Y5BT 1V2KT 3MHWU 3QGJA 2KCPA 1DANH 5C5NA 1QBVH 1S85A 1QIXB 1THRH 3FP7E 3SV2H 1KMHB 4CREA 1GJ7B 4FUIA 5BPEA 3RXBA 4KTCA 5GJ4B 2L6OA 2P59A 2WV4A 4J1YA 1PPCE 1EZQA 1QL7A 3LU9B 2ZFRH 5FXLA 1HFDA 1SGIB 3RP2A 1BHXB 3STJA 1UTKA 1SGEE 1YGCH 1TONA 1BQYA 2W26A 3JZ1B 3NPSA 2BXTH 2HRVA 2PGBB 3ZVFA 3HK6B 3SQHE 3UFAA 1SGFA 1EOJA 1XKBC 1CT0E 2BD9A 2EI6A 3MO9A 4YOGA 1SGTA 1OWJA 3ZZAA 1H1BA 1V2RT 4MPVA 3VFEA 4SGAE 3TH4H 5E8EH 4HGCA 1S81A 5AF9H 1GVZA 2IJD1 2PW8H 4NGAH 4ABGA 3F9EA 1OHHD 3AW1A 4WWYA 1AWHB 1HB0B 2M5TA 3MOCA 1K1OA 2D8WA 4R0IA 3UIRA 1GJ4H 3HK3B 3SNEA 4X8VH 1BB0B 3P8GA 1FAKH 3MH6A 1DUEA 1FPHH 2BDAA 4BAHB 2AYWA 3NKKA 1K1LA 1LQDB 1LHGH 1OPHB 4Q80A 1CSOE 2ZNKH 3F0OA 5DP6A 3SHCH 4H42U 4KKDA 4WY3A 1SGYE 5C94A 1L4ZA 3PMJA 1WU1A 1LCYA 2H5DA 4U2WA 2IOTA 3BTEE 1GHAF 1AGJA 1FIZA 1MCTA 1TMBH 3LPRA 2P3FH 2SGFE 1WCZA 2R2WU 3PMBB 1EZSC 3GDSA 2O9QA 3SU6A 2LPRA 2Z9IA 5FPSA 1S5SA 4ACBA 1SHYA 2XC4A 3QZQA 1C4U2 3PM3A 5I25A 2C8YB 3OTJE 1HAIH 2BY7X 5GNDA 2PUXB 1SSXA 1GMDF 1AZZA 1EJAA 2IPHA 4IBLH 1O2RA 5H4IB 3RXUA 1HXEH 2A32A 2UUKB 3L6PA 3MH5A 4YO9A 3PTNA 4AG1A 3E90B 3AAVA 4JZ1A 1GBMA 1O3JA 1C2IA 5A2MH 4ISOA 1C5ZB 1JMOH 3V7TA 4ESTE 1GVKB 3V13A 1GHWH 4H4FA 4XFQA 1JRTA 1Y8TA 2J38A 2VIDA 4UEHH 1KXAA 1AVGH 1FY4A 3MU1A 1LDTT 3SJ8A 1H9LB 2XNDD 2RFKC 1NESE 3KGPA 1GI1A 5GDSH 5L6NH 1GPZA 1NBMD 3LIWA 5CHAB 1OS8A 1W7GH 4GHQA 2JETC 1QA7A 3QWCH 1ZYOA 3E91A 1K9OE 5DP5A 3ATIA 4ZROA 2KX4A 3F2GA 1L1JA 1C1WH 2VU8E 3FAOA 1BUIA 1DICA 1JIMA 1ARBA 1HDTH 3KHVA 2Y5FA 2Z9JA 2A45B 3OY5U 4HG6A 2ODQA 1EQ9A 5F6MA 1QQUA 1RTLA 4B75A 3RDZA 2C4FH 3RXLA 3ZZCA 1BRAA 2ALPA 4DIHH 1SLWB 2F9PA 3RM0H 1BTHH 1F7ZA 2CHAC 4MVNA 1U6QA 4WMDA 1T4VH 4NZLA 4XDEA 1DT2A 2WSSD 1F5KU 3DFLA 1PPZA 3CENA 4TPYA 5EQSA 4ABBA 3FFGA 1SC8U 5T3HA 5C0TA 4CRGA 5T6GA 1SKYE 1UCYH 3LGTA 2R0LA 3QK1A 3A8AA 3T29A 1ACBE 4AFQA 2WYJA 2BD2A 5JB9S 3GY7A 2QXIA 1EZXC 1L0ZA 2PKSB 4CH2B 5F8TA 6GCHG 1HV7A 1RTFB 3IITA 2CGAA 3KYGA 1DE7H 2VWMA 4K5ZA 1GBIA 1DWEH 3TJVA 3TU7H 1NPMA 4YLQH 1RD3B 3F9GA 1WQSA 4IW4E 1W0KD 1NS3A 3VXFH 4X6PA 1VITF 2BB4A 4JK6A 1UVPA 1ZGVA 1SFIA 1CA0B 2BD3A 5CHBA 2GCHG 4CRCA 5E2PA 2R3YA 1VCQA 1A5IA 1G37A 1GHVH 1SQTA 3RLYH 3S7HB 1O38A 1VGCC 4MG3A 1NFXA 3BV9B 2XCNA 1TOMH 2SGDE 1PPBH 1MZDA 4WXVA 3OE7D 3MO3A 4TWWA 5C17A 5L30H 1F2SE 4XBCA 1GHYH 1KYNA 2ZDLA 1TIOA 2Z94A 3F2FA 1G36A 1QRWA 2QF5A 2KFWA 1EAUA 1F5LA 1WXRA 1QR3E 2BDIA 2VVCA 3TGJE 2P8OB 1BRBE 5K7RA 1UTPA 4DOQA 3QZRA 2FS9A 1O3BA 4YOJA 1OWIA 3BTKE 1O39A 2IN2A 4BAKB 3BEIB 1MAXA 1PPGE 3FN8A 3NWUA 1QL9A 2Y6TA 3PRBA 1C5TA 1O32A 2GP9B 2BDYA 2C93B 3M3VA 4THNH 1O2YA 2ZCLP 1S6FA 2O8LA 1EB2A 4MPUA 4E7RG 1THPB 1O2SA 3E0PB 2PUQH 3Q3YA 4XBDA 6CHAC 1S6LA 1B7XB 1ORFA 2WHXA 1MKWH 5ETXA 1LTOA 4JYVH 4XRNA 1LPZB 1GHZA 1MQ5A 1V2UT 5FL7D 1TNJA 1ZRKA 3KF2A 1J15A 2HOBA 1T4UH 1GMCG 1UTNA 4VGCC 3T28A 3ZVDA 4AC9A 2ZWLH 2UWPA 7GCHF 1QY6A 3SU3A 1KTTB 1SLUB 3ZZ7A 2OC8A 2GVFA 3TH3H 1HUTH 1ANDA 4GCHG 5IYTA 5EPNA 1EJNA 1UMAH 1C2HA 1QJ1B 3N7OA 4BNRA 2H9TH 4ISHH 1K1PA 2A5AA 1O37A 4ABHA 2FP7B 3U1IB 1NU9A 4YXWD 1WQVH 3CS0A 4CRFA 1A1RA 1V3XA 1L1NA 2W7SA 4UONA 3SBKA 3RC6A 3ATKA 1CGIE 1P03A 2BD5A 4O03A 2ANMH 4JZIA 3M5NA 1BZXE 2LNCA 1B0FA 3SJIA 1MD7A 4A1TA 3WY8A 4JYTA 1FY5A 3Q76A 1MQ6A 1J17T 4Z6AH 8ESTE 5IK2D 3A81A 1V2MT 2HLCA 2GV6A 3KYFA 1GCTB 1SVPA 1MBMA 3GCTG 2XCFA 2G5VA 2O8WA 2ZZUH 1TPOA 1QFKH 1YYY1 2TGAA 2VIWA 2ANWA 3M5OA 3CS7A 4LXBH 1BTWA 1XUFA 4FXGH 2VH0A 1C5XB 3SN8A 3GCHC 1AI8H 2AGIX 3LGIA 1TLDA 1WYKA 3RXPA 3BTME 1UK4A 5EPYA 1OP2A 1ZMLA 1V2LT 1TMUH 5J4QA 2EI7A 3OSYA 1LPKB 2Z9KA 1DWBH 3P92A 1QQ4A 1TAWA 2JH5D 2HPQH 2W6JD 2AS9A 1O5BB 3ELAH 2PTCE 1C2MA 5A0BA 4CHAC 2F9OA 3SJ9A 2ZEBA 4TY6A 4Y11E 1W0YH 2I6QA 5F03A 1BOQA 4O3TA 1G30B 3SU0A 2XXLA 2G55A 1T8NA 1CU1A 2AFQB 4AFUA 1GBKA 2SFAA 4Y79A 3ESTA 5JYIA 1O3NA 4I8GA 3GCHB 1CQQA 4X8SH 1O5DH 2OQUA 3PLBA 3F1SB 3BN9A 1P11E 2ZU1A 2OXSA 4FUGA 1SGQE 1HCGA 1CHOG 1LHDH 1OWDA 4NFEA 3VB3A 1TX6A 1P57B 5LH8A 3S7KB 1O2UA 1W0JD 2A5IA 3F3BA 3SU5A 2FOBA 2GD4B 2XOKD 2ZPRA 4VGCB 3MNCA 2GTBA 1K0HA 1UW7A 1FLEE 1GDNA 2Q1JA 2QIQA 2ZCHP 1C1OA 2OUAA 2QY0B 2BZ6H 1KXDA 1HAPH 1C2EA 2Z9LA 1FUJA 1F0UA 1C5UA 1DX5M 3GICB 5KECA 1K1IA 1BMAA 1O3KA 4X1NU 1QZ8A 1DXWA 1OWEA 2B8OH 5DJ7A 5DG6A 4ABDA 2BVRH 2P8OC 4ZKRU 3F9HA 3ZZ5A 1HAXB 2GZ7A 5A8ZA 2NU3E 3PYHA 3F2HA 3DSGA 3MNBA 1S82A 1T8LA 1C2GA 2AEIH 2STBE 1P2IA 1WV7H 3OAAD 1QBOA 3SU4A 2Z3DA 2AHME 3P8FA 4MLFB 2FYQA 2OLGA 3GISB 4GVUA 4ZKSU 5C2ZA 1MTNB 4GHTA 1P3CA 1P9UA 3EQ0H 3LKWA 3M7QA 4CBNA 4K69A 4Y0ZE 2PTNA 3GCOA 2ZDVH 1GWAA 1GVLA 1N8OB 2QA9E 4AOQA 6CHAB 6GCHF 4AB8A 1CA8B 1IQKA 1G3BA 1ZPBA 2OC1A 1V2ST 2BOKA 4OS1A 4YTAA 1UHBB 1D6WA 4MNYA 3ENSB 3ZZBA 3GDVA 3T27A 2A4OA 3VB5A 2ZTZA 1ELCA 2XNIA 4UD9H 2ZTYA 3A8DA 1BMFD 4AFSA 3UNQA 4ABAA 3KIDU 1H8IH 1EAWA 1A0LA 1UVTH 2G81E 3GS9A 1AQ7A 2J4IA 1YWUA 1V6DA 4X1QU 1LO6A 2F83A 2EEKA 1O36A 1K1JA 2VH6A 1D9IA 5DPAA 1KXFA 3A88A 5CHAC 3OU0A 1YPHE 3M7UA 1IQMA 4YOIA 2A7HA 1V2QT 4Y8YA 3P95A 4DT7B 1EASA 1M9UA 1SGCA 2ULLA 2FS8A 2ZU2A 3BEUA 1TGSZ 4BTUB 1VZQH 3RMLH 1W10U 2KZ4A 5DP3A 4I8LA 1C1VH 1O2MA 1DOJA 5FBEA 1UJ1A 1A7SA 1MAYA 1WTHD 2G8TA 2BD7A 2ASUB 1Z8JB 3BF6H 4Y6DA 1TNGA 1MTWA 1E79D 1TE0A 2V6NA 1SL3A 3GCNA 1ETRH 1DDJA 1DY8A 1N6XA 5A8YA 3TGIE 3RXHA 3M36A 2AGGX 1YPKH 3DHKH 5B6LA 3KQBA 4OS2A 1EP5A 2XBXA 4XOJA 1S6HA 1EJMA 4LK4A 1E1RD 1ESBA 4MPWA 4AN7A 3GY4A 2RDEA 3Q3XA 1ZPZA 2C90B 1MU8B 4DCDA 1ELVA 5SGAE 1GI0A 2J34A 4JYUH 2AMQA 3HGNA 2GCHF 1JWTA 1DITH 3CNRA 2OD3B 2FX4A 1H9HE 4LZ1H 2J98A 1VITH 3GOVB 2H9HA 3H5CB 1V2PT 1V2VT 3RLWH 1ESTA 1DWDH 3AAUA 2PV9B 3A7XA 3EDXB 3ZVAA 2HALA 4JMYA 5EQQA 1HBTH 2EQNA 3ATLA 3RXSA 1GI4A 1QCPA 1KXEA 3M37A 4ZCNA 5GWZA 1UCYK 1V2TT 1C1NA 2FESH 2FOEA 2R2MB 4BAQB 1HLTH 1BDAA 3C27B 2BX4A 3P8NA 2BD8A 1P06A 1MTNC 3T25A 1VGCB 3W1EA 1ARCA 1HGTH 2ZQ1A 1C1TA 5LPEA 1QB9A 1WUNH 1A3BH 5FBIA 1HAOH 4CR9A 3BTDE 4I32A 1BITA 2OQ5A 3Q00A 2BMGB 2SGQE 4F49A 4I7YH 1XVOA 1SOTA 2ZCKP 1D3QB 1FONA 2WPDD 4U30A 4FUCA 5HIYA 4KELA 1UTMA 2LP6A 1YPLH 1INCA 2TGTA 4ASUD 1E38B 4TYDA 2A7JA 2V3OH 2O8TA 1TRMA 1PJPA 2D26C 3BTWE 5A09A 1F5RA 3TLOA 1G32B 2FTLE 5GPIB 3ITIA 3NUMA 3FOAA 1FI8A 5LGOA 4F48B 1PPEE 1J9CH 3P8OA 4NIVA 2PKAB 4RKJB 4X1PU 1T32A 1VKYA 2NU4E 1B5GH 1LHEH 1P8VC 4K1TA 1L1GA 1J8AA 2SNVA 4RN6A 4WMFA 1PYTC 2ZFSA 1O2JA 3Q3KA 1C5RA 2XTTB 1EATA 1V2WT 3NRLA 1K21H 1GJ5H 2PLXA 2ZG0H 1AVWA 3FZDA 3SV8A 4ISNA 1YLDA 2UUFB 1T8MA 2EI8A 1DM4B 2O8UA 4UFGH 4MNXA 3TGKE 5A0AE 3SO3A 1QGFA 3T5FH 4IMZA 4WH6A 1ZLRA 1MKXK 1NRNH 3H09A 3MFJA 3SOSA 1FZZA 2B0FA 1MZAA 5ABWA 3TJUA 2IJOB 4NSYA 2F91A 2BXUH 4M9FA 2FXRA 5E0HA 3SGQE 4UFDH 1TNIA 3ZZ8A 2SGAA 3SORA 2PFEA 1KDQB 3D65E 3ATWA 1QBNA 1UTQA 2Z3EA 1T31A 3EAJA 2B7DH 2RA0A 1JBUH 2FOGA 1C5LH 3RXOA 3S9BA 3NK8A 4U32A 3DCLA 1O3IA 1FV9A 2HPPH 1BHXF 1AHTH 3SUDA 1Z8IB 4CRBA 1H9IE 1KTSB 1ANBA 4A92A 2Q6DA 2A0QB 1O2ZA 1G3EA 1FY3A 1WDIA 1HAVB 2JKHA 2ZGBH 3GY2A 1O35A 3MO6A 1GG6B 1ZTLA 3RXCA 2WUBA 2XC5A 1V2NT 5T6FA 5E2OA 1RFNA 2FWWA 1GHBG 1EB1H 2QXHA 1OOKB 1GBHA 4Y8XA 1O31A 2GGVB 2P95A 4KTSA 2PSXA 1IHTH 1GBFA 2FOFA 5DK1A 1O3GA 1RIWC 3RXFA 1O30A 4AGJA 3A86A 3QX5H 2GT7A 1AO5A 1GCDA 4BAMB 1A3EH 2BX3A 4D76A 3A87A 5C1YA 2BY6X 2NWNA 2AIQA 2W3KA 2FYRA 2L74A 2BOHB 3B8JA 1PYTD 2WPJS 2ALVA 3ZYEA 1P9SA 4WMEA 1JIRA 3ZVEA 1ZHRA 2FI4E 2P16A 3AW0A 4UFFH 1AZ8A 3SGAE 1ANEA 3U1JB 2VIQA 3KL6A 4AYVB 2PKAA 3V12A 1QB6A 5GIBA 1IQFA 5EOKA 1YPHC 2RG3A 1ZHPA 1DUAA 4SGBE 3PO1B 5DP7A 3E8LA 3RXMA 5DO4H 2ZDMA 1SQAA 4ABJA 3UR6A 1J16A 1OYTH 1MTVA 1O5EH 3W94A 5FHTA 2JJ1D 1TRYA 2K8IA 1XXFA 2UUJB 3M61U 4Q63A 1UCYE 2BQWB 5FPTA 2BLOA 1E35B 3D23A 5LPFA 2XYAA 1NZQH 2C8ZB 1SLVB 2ZGJA 4B6FA 1G9IE 5JPMH 4F55A 1GBCA 2ZTXA 4FOUC 3EE7A 5EJLA 3RXEA 2FIRH 1NRPH 1CHGA 1RJXB 2FLRH 1YPEH 2G00A 3O8RA 2KM0A 4BANB 2KCOA 3O8DA 1PQ8A 3EYDA 2TPIZ 4RI0A 2J2UA 1CVWH 1BBRK 2ODYB 1MU6B 1TRNA 2H5CA 2VGCC 2FM2A 4J2YB 3BTGE 3M35A 2WV5A 1DWCH 3F9FA 1HIAB 2XWAA 1H8HD 4GSOA 1YPMH 1C5YB 3T26A 1IQHA 1ELBA 2BDBA 3BG4C 2XW9A 2XBWA 1GBJA 2G4UA 1GL1A 4ZAEA 3P6ZB 1IAUA 1AMHA 2THFB 1ZHMA 3N7DA 3M7TA 1GJDB 2PHBA 3P17H 1C5NH 1XMNB 1O2HA 1MD8A 4NWLA 5J4SA 2VGCB 3E3TA 5G4BA 1XKAC 1P2KA 1C4Y2 3BSQA 1UTOA 1MKWK 1TQ0B 2VWOA 4GCHF 2R3UA 4NA8A 4BXWA 1BIOA 5JBBS 1EAIA 2SNWA 3K6YA 1SMFE 2A4RA 3M5LA 1PQ7A 2VWLA 2WPHS 2WPIS 3UTUH 3HATH 3PWCA 1HPGA 2QAAA 4K2YA 3SI4H 3BG4B 2QXJA 2RA3A 1F0SA 3URCA 1UTJA 2CXVA 3D49H 3E0NB 1BRUP 2C8XB 4E7NA 1P09A 4A6LA 1TQ7B 2Y7XA 4TPIZ 3RM2H 4ABFA 2AIPA 2GZ9A 3G01A 3MMGA 4Q7XA 4M7GA 4X0WU 1BRCE 1W7XH 5E0GA 1GHAG 4ISIH 7LPRA 1BA8B 1GBTA 1P10A 5AHGH 1G3CA 1GDQA 1FY8E 2TBSA 3F68H 5ESBA 4JZFH 1NT1A 3PO1C 1ETSH 4AGKA 2ANKH 1DLEA 4DURA 3NXPA 3QTOH 1C1UH 2FPZA 4XSKU 2F9UA 1W0ZU 1ABIH 5ESTE 2W7UA 3K6ZA 4B6EA 3PLKA 4Y7BA 1IQIA 1LHCH 4BOHA 2ZU3A 4YESB 4I33A 1QRXA 3RXDA 1BJVA 2ZDKA 4ZXXH 2RDLA 4Q7ZA 8LPRA 2Y7ZA 2Z6BD 1A5HA 4NIYA 1G2MA 1GGDC 1IOEA 3FVFB 3LGWA 4Z0KA 1RIWB 5DSFA 2CJIA 1TNKA 2B5TB 1O3OA 2I6SA 4FVDA 1A5GH 1GL0E 4OM9A 1YLCA 5JBTA 1DLKB 1VCWA 5EU8A 5PTPA 2ZKSA 2BY5X 1DSTA 4KTUA 3TVJB 1Y3WA 4ZKOU 2H1UA 2ZDAH 4A7IB 3L33A 1KIGH 1GJ6A 1AUJA 2ZFTA 2PGQB 2HVXA 1EUFA 2GKVE 1Y3XA 2OBOA 3F0PA 5DP9A 2BQ7B 3NCLA 1ZJDA 1AU8A 1SBWA 4O97A 1AY6H 1Q3XA 1P2MA 4OS4A 1H8ED 1RTKA 2D1JA 1O2LA 1GMHG 3HGPA 1K22H 4Y71A 3UR9A 1BTZA 1GJBB 3PWBA 2YMSD 3QTVH 2H2ZA 3C1KA 1TBZH 2ZHEH 4IGDA 4Y76A 3ZZ3A 1XUKA 1MMJN 1O2XA 2DUCA 3EA7A 4DIIH 8GCHG 1HJAC 2ZF0H 3GYLB 2R0KA 2YNAA 3SZEA 3GY3A 2OINA 1CE5A 3KEEA 1GHBF 4B74A 1K2I1 1CT2E 1DPOA 3M5MA 2BM2A 3MYWA 3SGBE 2W6ID 2ZU4A 3KQCA 2PWXA 2ZFPH 1SI5H 4JK5A 4X6NA 1O2PA 1SG8B 2ZHFH 3PV5A 2TIOA 1RXPA 1ZTJA 2J5UA 4IC6A 3VB4A 1ZRBA 1ELDE 4ZKNU 4Y7AA 5L2YH 3LONA 1J14A 1SR5C 1MABB 1TGNA 1VITG 1HJAB 5C67A 1NROH 2Q6GA 3O8CA 1K1MA 3ZVBA 2J9NA 2FI5E 2FZZA 1C2LA 1O2VA 1O3EA 3SNDA 1H8DH 1S0RA 1RS0A 2HNTF 4Q4LA 1ZJKA 2K1QA 2P3UB 4NZQA 3UQOA 5T6DA 3V0XA 2GMTC 1GBDA 2KAIB 2OCVB 1ZPCA 1GJ9B 5EXLA 3SNBA 1O3LA 3A7TA 4E05H 3U8OH 3MTYA 1IQLA 1GBBA 3MU8A 3HKJB 1O3MA 1IHSH 5F53A 2HVYB 1Z1JA 2CHAB 2QE7D 1WTGH 4RT0A 2Y5GA 3LH3A 2ZHDA 4X6MA 4ACAA 3EA8A 5C1XA 2NU2E 4B71A 4B76A 2ZHWH 3A89A 4JZEH 5CDFE 1Y3VA 5DKMA 1DSUA 4O3UA 1GI8B 4A1XA 4FUBA 1D3TB 3TJNA 4WJG2 1QA0A 4FUEA 1GJAB 1YY3A 1C5WB 2F4LA 3RXQA 3LJOA 3MU4A 1IQNA 1EXFA 2C8WB 5HXFA 1T7CA 4D8NA 5EJ1A 3GDUA 3BIVH 2H6MA 4NFFA 2PKSC 1AIXH 3KQDA 1GI6A 3ODDA 5TCAA 1MTUA 3TK5A 1C9PA 1BBRE 4A1VA 4FUFA 1IQGA 3EA9A 1HAYB 1NFWA 1LQEA 4INHA 1C4V2 3S9CA 2J92A 1CHOF 5FX5A 2F43B 3I77A 4K60A 1IQJA 3T2NA 9ESTA 3RU4D 1T8OA 2QF0A 3IG6B 2F9BH 4X6OA 3E1XB 1TFXA 3ODFA 1HJ9A 2A1DB 3SYJA 4TSFD 3UNRA 1TGCA 4FVBA 2OBQA 4ABIA 2A4GA 3ZZ6A 3RXVA 3P70B 2QN5T 3FP8E 3MH7A 1VCPA 5K0HA 1UVUH 4X2YA 1AWFH 5GCHG 1C5OH 4XBBA 1E1QD 1ZSKA 2DE9A 2HGTH 1AB9C 3TITA 5LPRA 4K3JA 1XUJA 1YM0A 3OYPA 2V3MA 4MNVA 1SPJA 1XM1A 1OX1A 1P2NA 1Q2WA 3A8CA 1O2KA 3UOPA 2ILNA 4AZ2B 1K28D 1W12U 2BDGA 1AUTC 1Y3YA 1TX7A 1HYLA 1LVOA 4FU8A 5DP4A 1B0EA 2BHGA 4X8UH 3WWFA 4IC5A 1AD8H 1DY9A 1Z6EA 3S0NA 4ZHLU 1AB9B 4MPXA 1BCUH 1W8BH 1ABJH 2GMTB 2ZIQH 5AVDA 1YCPK 3EGKH 1BMLA 1LKBA 4NG9H 4RSPA 1EZUC 1ZOMA 2GV7A 1OWHA 2ZECA 2FLBH 2A7CA 4UFEH 2FTMA 4FU9A 3E6PH 2ZGXH 4P02A 3E16B 2P3TB 3OEHD 4ZXYH 1ZMNA 4KP0A 1ZZZA 1MCVA 2BY9X 2ZGHA 4I8JA 3EE0B 4ZHMU 1WSSH 1TPSA 4YLUA 3VB7A 4YZUA 1Y5AT 3ZZDA 1HAHH 1HJ8A 5JBAS 2FMJA 3RXKA 1YBWA 3H7OA 2QF4A 1W13U 1P2QA 3BTFE 2XRCA 1MBQA 1QNJA 4GUXA 2GCTB 2FX6A 2WV9A 1UTLM 3JZ2B 3GY5A 2CMYA 3FP6E 3LOXA 5HGGA 4NWKA 1NN6A 3SJOA 1ESAA 1C9TA 1O5GH 1D3PB 1K1NA 1HAVA 5DGJA 3MNSA 4R8TB 4DT4A 4Y8ZA 4WVPE 2QF3A 1TB6H 1AKSB 1P02A 5KEDA 2UUYA 3LGUA 3SHAH 1HRTH 1Z8RA 1UVOA 1RRKA 3UAIC 3UY9A 1TMTH 3PB1E 3A7VA 4XD7D 3RUOA 2ESTE 1OP8A 3HPTB 3K9XB 3AASA 2D2DA 2CF9H 2O8MA 2Q6FA 1A4WH 4B2AA 1O2TA 4X8TH 3U28C 2BDCA 5FCRA 3LGYA 1FN6A 1BMNH 3URDA 2CV3A 1HNEE 3WWBA 1QB1A 2KAIA 3PROA 3RXRA 2TRMA 4ABEA 4FU7A 1TNHA 2BYAX 4OS6A 1JOUB 1AE5A 2V0BA 2HLDD 3SQEE 5I46H 1OSSA 2HWLB 1O5CB 3PMAB 3O8BA 3WW7A 1CGJE 3ZIAD 4ZHAA 1ZMJA 2BDHA 4JCNA 3ZV9A 2OP9A 3LC3A 1D3DB 4ZH8A 3BTTE 5HM9A 4B73A 3MQKC 2ZQ2A 3PRDA 2HNTC 4QT8C 3RMOH 2VIPA 3A83A 5BRRE 3W95A 1AFEH 1FY1A 3A7YA 1BTPA 1AE8H 1SGFG 1Z1IA 2AGEX 1C2KA 1D4PB 2QV1A 5CMXH 4YT7H 1BTXA 1O2GH 2QXGA 4HFPB 4YT6H 1LVYA 1SGDE 3N99A 3TK6A 5EW2H 1GJCB 5C20A
chains in the Genus database with same CATH topology
1Z6JH 2Z7FE 1A61H 1FQ3A 2ZGCA 1YCPH 1P3EA 4OGXA 1G2LA 3RMNH 2FOAA 3VGCB 2A4QA 2G5NA 4E06H 2WPKS 3SW2B 2VWNA 1P2JA 3FZZA 1ZSJA 1O2WA 1NM6A 1YCPM 5EG4A 2SGEE 3KQEA 1FN8A 8GCHF 1C2FA 1WAYB 2QGRA 3LT3A 1WBGB 1OWKA 3U8TH 1C1RA 3PMHB 3SU1A 1TGTA 4DY7B 1GMDG 3SUEA 2JH0D 1EP6A 3BG8A 3QDZB 4B2BA 4RKOB 1NU7B 1DVAH 1EX3A 1C5PA 3Q77A 2WINI 3R3GB 1XVMA 3RXTA 1YKTA 3TNTA 3RC4A 5F8ZA 2FOMB 2SGPE 3B23B 3UREA 3ZYDA 2Y81A 1XUHA 3VEQB 4NCYA 5A0CA 1AN1E 3KN2A 2G51A 1W14U 1ELTA 2ZFQH 1Y59T 3PLPA 4X1SU 1KSNA 2JH6D 3M3TA 4X2WA 1GI5A 2F3CE 3MNXA 2VJ1A 2ZPQA 2GT8A 3GYMA 2BTCE 1TBQH 2YOLA 3MU0A 2FODA 1QJ7B 4PROA 2BY8X 1N8OC 4CBOA 1A2CH 4AB9A 2VVUA 4B2CA 4D7GA 5TJXA 1SLXB 1GMHF 5HMAA 4K8BA 5JDUB 3A80A 1V2JT 4NIWA 1S83A 4F4OC 3ZVCA 1W11U 3SUFA 4IS5A 1FMGA 3SZNA 4HTCH 4INLA 1O2NA 1O5AB 4IN2A 4CH8B 1PPFE 1FPCH 5DP8A 2F9VA 1UO6A 2GCTC 3SUGA 3TPIZ 2G52A 1C1SA 1KLTA 1GCTC 5EODA 5GCHF 3UQVA 3D62A 4FUHA 1ZSLA 2AERH 1TWXB 1X7AC 1XXDA 1CO7E 1A0JA 2FOCA 2WUCA 3SU2A 4BXSA 1SHHB 3L3TA 4OS7A 1VJ9U 1XUGA 1E0FD 1NO9H 2BZAA 2WYGA 4JZDH 4NA9H 1BT7A 1GDUA 1ELAA 4Q7YA 1C1PA 4X1RU 2ZP0H 1GG6C 3GCTF 1ANCA 3GY6A 1CBWB 1GBAA 1GI2A 5C5OA 1SGRE 1NFYA 4WF8A 3SI3H 1MH0A 2EA3A 2AMDA 2A2XH 1O5FH 1WOFA 3RU4T 3SJKA 1UVSH 2XWBI 3RXJA 1HAGE 1KXBA 5FAHA 1E34B 2ZDNA 3UNSA 3PV4A 4GPGA 4O9VA 1UHBA 4CR5A 2VIVA 5EQRA 3U98H 1FNIA 1TA6A 2XBVA 1C5MD 1GMCF 3RC5A 2ZI2H 5GXPA 4K8YA 1NC6A 7KMEH 2TGDA 3LC5A 4XE4A 1FJSA 5F8XA 1EOLA 3DT0H 3T62A 4TY7A 1G3DA 1SQOA 1P01A 3SNAA 4D7FA 1CGHA 2VIOA 1TABE 2QC2A 2OTVA 4CRAA 1A46H 4K1EA 2FI3E 1ETTH 2GDEH 1O2IA 1YP9A 1LPGB 2GX4A 3ZVGA 3R0FA 2QCYA 2B9LA 1FAXA 2CF8H 1BMMH 1RGQA 2P94A 1GI3A 3TK9A 1P04A 2BLQA 1Z71A 1OXGA 5C3NA 4MDSA 3M3SA 1GBLA 3DUXH 1NTPA 4DG4A 3OY6U 4ISLA 2BLWA 1ZTKA 1Y5UT 1H4WA 3DD2H 1QL8A 2FEQH 4LOYH 3RXAA 2G4TA 1YF4A 2V35A 1KY9A 4KGAA 1SB1H 1O3HA 4BTTB 1GI9B 1HAZB 2VB0A 3ZV8A 1MKXH 1QHRB 3QO6A 3K2UA 1NFUA 1S84A 1TGBA 2EC9H 2JETB 5CE1A 5HM2A 2BVXH 1AVXA 1XX9A 1EKBB 4NA7A 4BTIB 3QGNB 4FUJA 3SV7A 1P0SH 2XC0A 2A5KA 4FUDA 1O33A 4TWYA 1AFQB 3BIUH 1OYQA 5FX6A 3UPEA 1BJUA 1L2EA 1OP0A 3S9AA 4AORA 3QN7A 1TOCB 2PSYA 3TIUA 3A85A 3KCGH 4DVAU 3A7WA 3BTHE 1TPPA 1D6RA 1ZR0A 1QURH 4CRDA 1BTUA 1O3FA 1KDQA 4X2XA 4NIXA 1NRQH 1CBWC 2RCEA 2Z3CA 1QRZA 1TBRH 3QLPH 1HIAA 4GAWA 3A82A 4WH8A 1UK3A 6LPRA 1XUIA 1UK2A 2ANYA 2W3IA 4U01A 3LGVA 2J94A 4IN1A 1ZGIA 3UWJH 2ZO3H 3U9AH 1IQEA 1GBEA 2Y82A 4UDWH 1DFPA 1NY22 1C5VA 1P05A 1ID5H 5C1UA 1QJ6B 2ZC9H 1PFXC 4I8KA 1EAXA 2ZA5A 2AH4X 2R9PA 1F92A 1LVBA 2Z9GA 3QUMP 1AKSA 2ZHQH 1JXPA 4CHAB 3U69H 1CA0C 1TPAE 3B9FH 1W2KH 4ASHA 4OGYA 3ZZ4A 3LJJA 3RXIA 1TNLA 5FPYA 2YNBA 5L2ZH 3K65B 3TH2H 1KLJH 1SOZA 2V3HH 2TGPZ 2AMPA 1OKXA 1HXFH 1PQ5A 1EPTC 4UE7H 4D9RA 3SV9A 2NU1E 1O34A 1O3CA 6ESTA 2QYIA 1EPTA 3I29A 1O0DH 5EGMA 4ZMAH 1SGNE 1ELGA 1BTYA 1GI7B 1C1MA 2ZU5A 4AFZA 5AFZH 4I31A 3A8BA 3HKIB 1O3PB 1E37B 1ELEE 1W3CA 2HNTE 1YC0A 2CN0H 1GGDB 1O3AA 3STIA 4LZ4B 1TX8A 2Y80A 1YPJH 1PPHE 2DE8A 4I8HA 3UUZA 1F0TA 3IWMA 4H6TA 3V3MA 2UWOA 1BBRH 2BVSH 8KME2 1SGPE 2NU0E 9LPRA 2Y5HA 3OX7U 5B6OA 4HZHA 3SNCA 4MTBA 1QTFA 4Q2KA 5E0JA 4DW2U 4YM9A 1Q31A 2BLVA 3DA9B 3BTQE 3VPKA 5A8XA 3VGCC 3VXEH 1F0RA 4X2VA 4MQAA 3LDXH 1NRSH 2STAE 2WPLS 4IMQA 4Y10E 2ZPSA 3UWIA 3UOUA 2W5EA 4AYYB 2H9EH 1L4DA 4INKA 1C2DA 4H6SB 4DGJA 1KXCA 1S0QA 3A7ZA 1FIWA 1Z7KA 4WXIA 1LMWB 4B1TA 3ZZ9A 1GHXH 1ELFA 1JRSA 3MWIU 4HI3A 1THSH 1LKAA 2FO9A 4ZUHA 4D9QA 2ODPA 1O3DA 3MH4A 3RU4E 3FANA 7ESTE 3H7TA 3I78A 4NSVA 4K1SA 1PQAA 1LHFH 1VR1H 2FDAA 2FOHA 5IDKA 3RMMH 1FDPA 1YPGH 2A2QH 1MUEB 1N1LA 3NZIA 7GCHG 4OS5A 1KLIH 3GY8A 5EXMA 1TYNA 2GZ8A 3KNXA 2BQ6B 3LH1A 4AG2A 5JBCS 1C5QA 2OC0A 3TJOA 2F9NA 3S69A 1CT4E 4A5TS 3DFJA 2UWLA 1DXPA 3PTBA 2WPMS 3CP7A 1C1QA 4GLYA 1N6YA 3MI4A 1Y3UA 1O2QA 1P2OA 3AVZA 3ATMA 1FXYA 2XBYA 2ZFFH 1GJ8B 1TALA 2A31A 1NRRH 2J95A 5EXNA 5EW1H 2VNTA 4AX9H 2OC7A 2BD4A 1AFQC 1V2OT 5HYOA 2P93A 3VB6A 2C3SA 3A84A 1A0HB 2VINA 1C5SA 1DS2E 2VVVA 1EPTB 1LVMA 1P12E 1C2JA 5AFYH 3U8RH 4MNWA 5JB8S 3TNSA 4DJZB 1O2OA 3RXGA 4Y0YE 1MTSA 3SV6A 5FCKA 3BEFB 1VJAU 1Z8GA 2GDDA 1TA2A 2PR3A 1E36B 3F6UH 1SFQB 5TCCA 3MU5A 4BAOB 1Y5BT 1V2KT 3MHWU 3QGJA 5C5NA 1DANH 1QBVH 1S85A 1QIXB 1THRH 3FP7E 3SV2H 4CREA 1GJ7B 4FUIA 5BPEA 3RXBA 4KTCA 5GJ4B 2P59A 2WV4A 4J1YA 1PPCE 1EZQA 1QL7A 3LU9B 2ZFRH 5FXLA 1HFDA 1SGIB 3RP2A 1BHXB 3STJA 1UTKA 1SGEE 1YGCH 1TONA 1BQYA 2W26A 3JZ1B 3NPSA 2BXTH 2HRVA 2PGBB 3ZVFA 3HK6B 3SQHE 3UFAA 1SGFA 1EOJA 1XKBC 1CT0E 2BD9A 2EI6A 3MO9A 4YOGA 1SGTA 1OWJA 3ZZAA 1H1BA 1V2RT 4MPVA 3VFEA 4SGAE 3TH4H 5E8EH 4HGCA 1S81A 5AF9H 1GVZA 4NGAH 2PW8H 4ABGA 3F9EA 3AW1A 4WWYA 1AWHB 1HB0B 2M5TA 3MOCA 1K1OA 2D8WA 4R0IA 3UIRA 1GJ4H 3HK3B 3SNEA 4X8VH 1BB0B 3P8GA 1FAKH 3MH6A 1DUEA 1FPHH 2BDAA 4BAHB 2AYWA 3NKKA 1K1LA 1LQDB 1LHGH 1OPHB 4Q80A 1CSOE 2ZNKH 5DP6A 3SHCH 4H42U 4KKDA 4WY3A 1SGYE 1L4ZA 3PMJA 1WU1A 1LCYA 2H5DA 4U2WA 2IOTA 3BTEE 1GHAF 1AGJA 1FIZA 1MCTA 1TMBH 3LPRA 2P3FH 2SGFE 1WCZA 2R2WU 3PMBB 1EZSC 3GDSA 2O9QA 3SU6A 2LPRA 2Z9IA 5FPSA 1S5SA 1SHYA 2XC4A 3QZQA 1C4U2 3PM3A 5I25A 2C8YB 3OTJE 1HAIH 2BY7X 2PUXB 1SSXA 1GMDF 1AZZA 1EJAA 2IPHA 4IBLH 1O2RA 5H4IB 3RXUA 1HXEH 2A32A 2UUKB 3L6PA 3MH5A 4YO9A 3PTNA 4AG1A 3E90B 3AAVA 4JZ1A 1GBMA 1O3JA 1C2IA 5A2MH 4ISOA 1C5ZB 1JMOH 3V7TA 4ESTE 1GVKB 3V13A 1GHWH 4H4FA 4XFQA 1JRTA 1Y8TA 2J38A 2VIDA 4UEHH 1KXAA 1AVGH 1FY4A 3MU1A 1LDTT 3SJ8A 1H9LB 1NESE 3KGPA 1GI1A 5GDSH 5L6NH 1GPZA 3LIWA 5CHAB 1OS8A 1W7GH 4GHQA 2JETC 1QA7A 3QWCH 1ZYOA 3E91A 1K9OE 5DP5A 3ATIA 4ZROA 1L1JA 1C1WH 2VU8E 3FAOA 1BUIA 1DICA 1JIMA 1ARBA 1HDTH 3KHVA 2Y5FA 2Z9JA 2A45B 3OY5U 2ODQA 1EQ9A 5F6MA 1QQUA 1RTLA 4B75A 3RDZA 2C4FH 3RXLA 3ZZCA 1BRAA 2ALPA 4DIHH 1SLWB 2F9PA 3RM0H 1BTHH 1F7ZA 2CHAC 4MVNA 1U6QA 4WMDA 1T4VH 4NZLA 4XDEA 1DT2A 3DFLA 1F5KU 1PPZA 3CENA 4TPYA 5EQSA 4ABBA 3FFGA 1SC8U 5T3HA 4CRGA 5T6GA 1UCYH 3LGTA 2R0LA 3QK1A 3A8AA 3T29A 1ACBE 4AFQA 2WYJA 2BD2A 5JB9S 3GY7A 2QXIA 1EZXC 1L0ZA 2PKSB 4CH2B 5F8TA 6GCHG 1HV7A 1RTFB 3IITA 2CGAA 1DE7H 2VWMA 4K5ZA 1GBIA 1DWEH 3TJVA 3TU7H 1NPMA 4YLQH 1RD3B 3F9GA 1WQSA 4IW4E 1NS3A 3VXFH 4X6PA 1VITF 2BB4A 4JK6A 1UVPA 1ZGVA 1SFIA 1CA0B 2BD3A 2GCHG 4CRCA 5E2PA 2R3YA 1VCQA 1A5IA 1G37A 1GHVH 1SQTA 3RLYH 3S7HB 1O38A 1VGCC 4MG3A 1NFXA 3BV9B 2XCNA 1TOMH 2SGDE 1PPBH 1MZDA 4WXVA 3MO3A 4TWWA 5L30H 1F2SE 4XBCA 1GHYH 1KYNA 2ZDLA 1TIOA 2Z94A 1G36A 1QRWA 1EAUA 1F5LA 1QR3E 2BDIA 2VVCA 3TGJE 2P8OB 1BRBE 5K7RA 1UTPA 4DOQA 3QZRA 2FS9A 1O3BA 4YOJA 1OWIA 3BTKE 1O39A 2IN2A 4BAKB 3BEIB 1MAXA 1PPGE 3NWUA 1QL9A 2Y6TA 1C5TA 1O32A 2GP9B 2BDYA 2C93B 3M3VA 4THNH 1O2YA 2ZCLP 1S6FA 2O8LA 1EB2A 4MPUA 4E7RG 1THPB 1O2SA 3E0PB 2PUQH 3Q3YA 4XBDA 6CHAC 1B7XB 1ORFA 1MKWH 5ETXA 1LTOA 4JYVH 1LPZB 1GHZA 1MQ5A 1V2UT 1TNJA 1ZRKA 3KF2A 1J15A 2HOBA 1T4UH 1GMCG 1UTNA 4VGCC 3T28A 3ZVDA 2ZWLH 2UWPA 7GCHF 1QY6A 3SU3A 1KTTB 1SLUB 3ZZ7A 2OC8A 2GVFA 3TH3H 1HUTH 1ANDA 4GCHG 5IYTA 5EPNA 1EJNA 1UMAH 1C2HA 1QJ1B 3N7OA 4BNRA 2H9TH 4ISHH 1K1PA 2A5AA 1O37A 4ABHA 2FP7B 3U1IB 1NU9A 1WQVH 3CS0A 4CRFA 1A1RA 1V3XA 1L1NA 2W7SA 4UONA 3SBKA 3RC6A 3ATKA 1CGIE 1P03A 2BD5A 4O03A 2ANMH 4JZIA 3M5NA 1BZXE 2LNCA 1B0FA 3SJIA 1MD7A 4A1TA 3WY8A 4JYTA 1FY5A 3Q76A 1MQ6A 1J17T 4Z6AH 8ESTE 3A81A 1V2MT 2HLCA 2GV6A 1GCTB 1SVPA 1MBMA 3GCTG 2XCFA 2G5VA 2O8WA 2ZZUH 1TPOA 1QFKH 1YYY1 2TGAA 2VIWA 2ANWA 3M5OA 3CS7A 4LXBH 1BTWA 1XUFA 4FXGH 2VH0A 1C5XB 3SN8A 3GCHC 1AI8H 2AGIX 3LGIA 1TLDA 1WYKA 3RXPA 3BTME 1UK4A 5EPYA 1OP2A 1ZMLA 1V2LT 1TMUH 5J4QA 2EI7A 3OSYA 1LPKB 2Z9KA 1DWBH 3P92A 1QQ4A 1TAWA 2JH5D 2HPQH 2AS9A 1O5BB 3ELAH 2PTCE 1C2MA 5A0BA 4CHAC 2F9OA 3SJ9A 2ZEBA 4TY6A 4Y11E 1W0YH 2I6QA 5F03A 1BOQA 4O3TA 1G30B 3SU0A 2XXLA 2G55A 1T8NA 1CU1A 2AFQB 4AFUA 1GBKA 2SFAA 4Y79A 3ESTA 5JYIA 1O3NA 4I8GA 3GCHB 1CQQA 4X8SH 1O5DH 2OQUA 3PLBA 3F1SB 3BN9A 1P11E 2ZU1A 2OXSA 4FUGA 1SGQE 1HCGA 1CHOG 1LHDH 1OWDA 4NFEA 3VB3A 1TX6A 1P57B 5LH8A 3S7KB 1O2UA 2A5IA 3SU5A 2FOBA 2GD4B 2ZPRA 4VGCB 3MNCA 2GTBA 1FLEE 1GDNA 2Q1JA