1V2MT

Benzamidine in complex with bovine trypsin variant x(triple.glu)bt.a1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Understanding protein-ligand interactions: the price of protein flexibility
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2mT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2mT02
1V2ST 4CBOA 2SGDE 4Y79A 4I32A 1TFXA 1C5UA 1YPMH 3A86A 4Y0YE 2ALVA 1TNKA 2WPIS 1A4WH 2Y7XA 2HVXA 3SU2A 2GVFA 1YPKH 2HALA 1RTFB 2Y5GA 2ZFQH 2CHAB 1TBQH 4AB8A 4BTIB 1GJ8B 1BMLA 1Y3VA 3SGBE 2CHAC 1XVOA 2FLRH 3ZZCA 2RA0A 2BDGA 1LPGB 2ZHWH 1GJ7B 2CN0H 2WYGA 3RLWH 2FOHA 4ZKRU 4CHAB 1TGSZ 3VXFH 4A7IB 4CHAC 1SHHB 1SPJA 2KAIB 1O33A 3RXGA 1EB2A 3EA7A 2TGPZ 2BD7A 2XBWA 2G5VA 2AGEX 3FANA 3IG6B 1FY8E 1FZZA 1GCTB 4ZKOU 1S82A 5JBCS 1BTZA 1YGCH 1RS0A 3MH5A 1GJBB 2TGTA 3LGVA 3BIVH 4A5TS 1EP6A 5FX5A 4O9VA 8GCHF 2G4TA 1QBNA 4ISNA 5E2OA 1NM6A 5C1YA 3LDXH 2P3UB 1ZHMA 4AFQA 2GT7A 3TU7H 4RSPA 1HAVB 1H9HE 3LJOA 2A45B 3SORA 3M36A 1DUEA 1SGCA 4ABDA 1YCPH 2FWWA 2GKVE 3GY2A 1SI5H 2QGRA 5DO4H 2FODA 1O2KA 3ZVFA 1EZUC 2BDCA 4BOHA 2H5DA 2VWLA 1OS8A 1S0RA 2UWOA 1TGTA 3DA9B 3ZZAA 1HLTH 1UTNA 1HCGA 1EPTA 3HK6B 1G37A 3ATLA 1A2CH 1AO5A 4GUXA 2IN2A 5E0HA 3V12A 2PR3A 2ZU2A 3RMMH 1GDUA 4MVNA 3EQ0H 4CH8B 1CHOF 4X1NU 3W95A 1O2RA 5FBIA 1ARCA 3RXLA 2ZFRH 1GMHF 3URCA 1DE7H 1RD3B 1THSH 2BLOA 2UWPA 1SGPE 1GHYH 4DY7B 5EQSA 1NC6A 1YPGH 2FS9A 2FOEA 3HGNA 3SUEA 3BF6H 2PKAA 1CQQA 1GJ4H 1QJ1B 1ZMLA 1DWDH 1XMNB 1C1RA 4E7RG 4Y11E 5PTPA 3Q3XA 2ODYB 2GD4B 3IWMA 1C5PA 1Z1IA 3FP7E 2OQUA 2BOKA 1ELDE 2VH0A 5TJXA 5EQRA 2G4UA 1TIOA 3CS0A 5IDKA 1D3QB 1CA8B 4CRFA 4FVBA 3SV2H 1AU8A 1Y5UT 4K1EA 1NROH 1ACBE 1GHVH 3UWJH 1H4WA 4UFEH 4B75A 1O5AB 1A0LA 1JWTA 2FOBA 4RN6A 1XUGA 3BEFB 3MU4A 1F7ZA 4KKDA 9LPRA 1TWXB 2BVXH 2ZQ2A 5EODA 1F92A 2ZHQH 4K2YA 1SFIA 1A0JA 2SFAA 2O8UA 4O3UA 1PPGE 4YOJA 3GDUA 1SLVB 4NSYA 3SNAA 1MKXH 4BAMB 1GCDA 2BD3A 2BLVA 3TK9A 1N6YA 1P2NA 4MNWA 1O3AA 5ESBA 1P9UA 4X8SH 1O3CA 1O2WA 6LPRA 4UDWH 3SGQE 1PPEE 2WPJS 1O0DH 1HGTH 4THNH 5JB9S 1TNJA 1GI1A 1S83A 2OTVA 2A7CA 1NTPA 2QXJA 1D9IA 1C5MD 1VCWA 5EXMA 4NFFA 3VB4A 1SFQB 1DVAH 3D49H 4SGAE 5LGOA 3M7QA 2CJIA 2H6MA 3V3MA 3TGIE 3P6ZB 2UUYA 1YKTA 4KGAA 5A0AE 1SLXB 4ZHAA 1WBGB 3PTNA 1GHAG 2F9BH 5DP8A 1YF4A 3LGUA 5GWZA 1O35A 1Y3UA 1AUTC 1IQLA 4INHA 1HUTH 1HDTH 1BHXF 2ZP0H 2WUBA 4TYDA 1BTHH 4FU9A 1T7CA 1A7SA 3HGPA 1KXFA 4X6OA 5C20A 3BTEE 1EAIA 1S84A 1ZPZA 3BTFE 3TH2H 3AVZA 1LDTT 1T4UH 2BLQA 1EP5A 2BDIA 1G2MA 1TNHA 5LPFA 1FPCH 2GV6A 8ESTE 4O3TA 3GYLB 2Y81A 4WMFA 5IYTA 2J38A 5DP3A 1K28D 3FP6E 8KME2 1DICA 1A0HB 1ELBA 1RIWB 2Z9JA 5HM9A 4I8JA 7KMEH 1O5GH 5I25A 5A8YA 1DANH 1O3NA 1W0ZU 1OP8A 4A6LA 3UNRA 3MNSA 1YCPM 5FCKA 2R0KA 1HPGA 1TOMH 2XCNA 2GZ8A 4HI3A 4IN1A 4D7GA 2QYIA 1MTSA 3TJVA 1C1WH 1GJ6A 1C5SA 3EE0B 1TAWA 2EI6A 1J9CH 4Q7ZA 5GJ4B 1FV9A 1C5TA 3V0XA 1TX8A 1NPMA 4K1SA 1BJUA 1ZRKA 1TX6A 2AMQA 3TJOA 3LH3A 3GCNA 1GI5A 1YP9A 1C5RA 1Q3XA 2J4IA 2VIWA 1GI9B 2AIQA 2THFB 1O3PB 3UQVA 3SV8A 1S85A 2WYJA 1KIGH 2F9UA 3PMJA 4U32A 3BTQE 1G3DA 1K1JA 1BTPA 2FX4A 4Y8ZA 1QNJA 1D3PB 2ZNKH 4GLYA 5L6NH 5JBBS 1TRYA 1G9IE 1MAYA 2JETC 1BHXB 3ZZ5A 2TGAA 1LPKB 4Z0KA 4NA8A 3M35A 1GI2A 4FUIA 3A7TA 4JZEH 2VVVA 1K1OA 2WPMS 4IBLH 1BT7A 2F83A 1QB1A 1C1MA 2J92A 3U1IB 1HAOH 4ABJA 1O34A 1NRPH 3GY6A 8LPRA 4I8LA 3H5CB 1O5CB 4LK4A 2C8ZB 3MFJA 1HIAB 1KYNA 3P17H 1BJVA 1FNIA 3PMHB 1UVSH 3RU4E 2Z6BD 1DLKB 5SGAE 1ABJH 1QRXA 2FOFA 1KSNA 2ZQ1A 1KLIH 2OC7A 3SU0A 1ZPCA 1IQGA 1AFEH 1QURH 1HAVA 2JH6D 1G30B 1SHYA 3H7TA 4GAWA 2OUAA 4R0IA 4YESB 4ISOA 1T8LA 1VJ9U 3TPIZ 1O3DA 1QBOA 3E3TA 1HAZB 1UTPA 5G4BA 1HAXB 1DUAA 1H9LB 1H8IH 2OINA 2V3OH 1FLEE 1NY22 1F0UA 1OP0A 2SGFE 3KEEA 2H9TH 1TRNA 1K1IA 2SGEE 1NFUA 1O3GA 3MI4A 3SQHE 3TNTA 1GBMA 1QA0A 2XBYA 2PUQH 3ZYDA 1QHRB 1ETRH 5L30H 2QA9E 2Z3CA 1O2OA 4K3JA 2Z9GA 5AF9H 2AIPA 4YLUA 2JH0D 4YOGA 1SB1H 2PTNA 4XSKU 2FPZA 1QQUA 1O32A 3GOVB 3SHAH 1FXYA 1GHXH 4B1TA 2UUKB 3EA8A 4INKA 1BBRH 1ELGA 3M37A 3MH6A 1A3BH 1P3EA 4Y10E 1O30A 1XUHA 3EAJA 5JB8S 4K69A 3MO9A 2BM2A 1GJ5H 3A87A 3PMBB 3LC5A 3GY3A 2XWBI 1PQ8A 1HAYB 2XC5A 1FJSA 1WSSH 4XBBA 4BTUB 1O2MA 2Y82A 3I29A 2XNIA 2Z3DA 2VU8E 2BY7X 1JRSA 3C27B 4NSVA 1GMCG 1O2HA 2D1JA 2XW9A 1O2TA 1GJ9B 1ZGVA 2NU1E 3A85A 1V2UT 4JCNA 3RXBA 3P8GA 4BXSA 4CH2B 1UTKA 1EJAA 1HXFH 4X8TH 1AHTH 2BX4A 3VGCC 5B6OA 1N8OC 1UJ1A 2ASUB 5E0JA 3S9AA 1ESAA 1O2ZA 2V3HH 3GCOA 1C1TA 3R0FA 3E0NB 2ZDKA 3ZZBA 1ARBA 3SU3A 1Y5BT 5K7RA 1DWEH 5F6MA 1O3BA 2G81E 2ZFSA 3RM2H 1ESTA 1HAPH 1ZOMA 2W3IA 3STIA 2SGPE 4IMZA 3RMOH 1SGIB 3RDZA 2LPRA 4ESTE 2J94A 3T29A 3ENSB 3I78A 1UTMA 3SNCA 1W10U 3O8DA 1DWBH 1ZJKA 3R3GB 4XBDA 2Z3EA 4IS5A 2LNCA 3LC3A 4F49A 3SUGA 1LTOA 1GVLA 2IPHA 4OS7A 5DKMA 1EAXA 1NFYA 1SGFA 1GI0A 1AVXA 2VJ1A 4KP0A 4JZIA 1DXPA 1O2XA 1CHGA 1QB6A 1CT2E 1HXEH 2BD9A 1NFWA 1TA2A 1P3CA 4HFPB 1GVZA 1K1PA 1V2OT 2P93A 1N1LA 2ZF0H 4ZXYH 3F9EA 4OGXA 4A1XA 1C5QA 3PO1B 5JPMH 1FAXA 1LCYA 1BOQA 3RXCA 3SO3A 4AYYB 1MMJN 1DSTA 5EGMA 2HLCA 2FMJA 1SLWB 1ZTKA 1GBEA 5DP5A 2SGQE 5AVDA 1SL3A 1MU6B 1J14A 2ODQA 1C5WB 2VH6A 4JZDH 5A8ZA 4WMDA 3V13A 3SV9A 2VIPA 3T25A 3PTBA 3P95A 3JZ1B 1YYY1 1ID5H 1UCYK 3KHVA 1NN6A 4DIIH 1IQNA 5F03A 1BDAA 3RXPA 4DJZB 2A1DB 3VB7A 2VIQA 4TWYA 2BB4A 2V0BA 1OKXA 3BTTE 3S69A 1ZMJA 2GCHG 1OXGA 1BQYA 1OYTH 4WH6A 4BANB 1P2QA 1O3JA 3SI3H 5GCHG 2Z9KA 4K1TA 1BB0B 1EUFA 3FAOA 1AN1E 2I6SA 1GBJA 5EOKA 1AKSA 1QL7A 5LPEA 3O8BA 3H7OA 1ELEE 1C2HA 1H1BA 3Q76A 1Z8JB 4ZUHA 1INCA 3A7WA 4FU8A 3TITA 5A09A 1J17T 3EDXB 5EQQA 2Q6DA 4WWYA 1P2JA 4ZAEA 1TGCA 2VNTA 3KQBA 4B71A 2GTBA 4I8KA 1C4V2 1BRUP 4O97A 1GHBG 4J2YB 2VVCA 1MQ6A 5F8XA 2BLWA 1C9TA 6GCHF 1TRMA 3SNBA 2AERH 1THRH 5I46H 3TJNA 1ANDA 1EATA 2A2XH 5BRRE 5JBAS 3SJ8A 1GMCF 3SJIA 1WU1A 5E8EH 2C8XB 2FP7B 2FLBH 3BEIB 3NZIA 2ZECA 1XXDA 2J9NA 3MO6A 4BXWA 4JYUH 1DWCH 1CGJE 1DXWA 4CRDA 1UVPA 3E90B 3VXEH 1ZR0A 3DFJA 4JK5A 4X8VH 3UFAA 1AB9B 4JYVH 4X2WA 1AB9C 1TNIA 2A32A 4WXVA 1GI6A 1F0RA 1D6RA 3KIDU 1O38A 3I77A 3ATKA 1EB1H 1IQKA 3WY8A 4TWWA 3AW0A 1GPZA 4I33A 5JDUB 7GCHF 1GBTA 2BDAA 1ABIH 1HIAA 4FUJA 1TBRH 1E37B 3D23A 2FYQA 3TIUA 1EKBB 3ZVAA 1Y3YA 3UNQA 2ANKH 1AUJA 1O31A 3F9HA 4UD9H 1E36B 1O3IA 3M5NA 1AMHA 3BTME 3KN2A 4OS5A 1CBWB 1W8BH 2F9VA 1FAKH 1UO6A 1YCPK 3C1KA 2BD2A 2HNTF 1CBWC 1SOTA 5GPIB 1TA6A 1DDJA 3AAUA 3FP8E 3A8DA 3QZRA 2G5NA 1ZTLA 2SGAA 4MNVA 1EX3A 2ZHFH 2ZDVH 1IQJA 1P11E 3M5OA 3ELAH 3SV7A 2A31A 2OBOA 2HPQH 1PYTD 3RXUA 2ZGCA 3UIRA 2BD8A 2G8TA 5DP9A 3K6ZA 1A3EH 2A2QH 2ANYA 2ILNA 3ATWA 1TB6H 1RTLA 2ZCLP 3SJKA 2XBXA 1P05A 1BTWA 3RMLH 2FS8A 2ZDAH 4Y8XA 1RXPA 1O2PA 5EPYA 1C1NA 2VWNA 1MKWH 2ZFTA 1QL8A 3Q00A 3RXMA 3UREA 1PPBH 1Y3XA 2FI5E 2GZ7A 2Y5HA 2R2MB 5FX6A 4ZROA 2UUJB 3BG4B 1SGDE 1MD7A 1VZQH 2VWOA 1Y5AT 1OWHA 2I6QA 3BG4C 3ZVBA 3MWIU 3ZZ6A 1O3OA 3ZZ7A 1A46H 2GCHF 1Z8RA 4JYTA 5FPSA 1TPAE 1QIXB 2W7UA 3V7TA 1K22H 1SSXA 1EAUA 2BDBA 5AFYH 3RC5A 2QXHA 5FHTA 4WVPE 3E8LA 5GCHF 4ZKSU 1XUFA 3GDVA 4ABBA 5HGGA 1V2TT 4I8GA 1O37A 3RC6A 3D65E 3TNSA 2QF3A 1UTOA 1ETSH 3UY9A 4IC6A 2QC2A 1E34B 5GDSH 3DUXH 2P8OB 2FX6A 4MPXA 1LVOA 2OQ5A 1D4PB 2P8OC 1ANCA 1T4VH 2NU4E 1T8MA 1TX7A 5DP7A 5LH8A 1PPFE 4YT7H 4M7GA 1MQ5A 1LVMA 1YLDA 4BAKB 4NWKA 1ELCA 1GHBF 1XUIA 1PQ7A 2QIQA 1EZQA 3MYWA 4GSOA 4KELA 4AOQA 1P03A 3SQEE 2OXSA 2XXLA 1VITH 2QXIA 3LOXA 2R0LA 3TVJB 4INLA 1RFNA 4PROA 2ZC9H 2HNTC 1BCUH 3QGJA 1MKXK 4Q7YA 3RMNH 2FOMB 1P01A 1S81A 4NFEA 2OC0A 1CA0B 6CHAB 1C2EA 3SU6A 1DY8A 1GJDB 1ZHRA 1HB0B 1CA0C 1FY1A 6CHAC 4B2AA 1MTNC 1JOUB 4KTUA 1KDQB 3HKIB 1FMGA 2A5AA 7LPRA 3OTJE 3OY6U 1ZRBA 4I7YH 3LGTA 1F0SA 5E2PA 3TH3H 1QR3E 1UHBB 1BMMH 3HPTB 1HYLA 1K21H 2YOLA 1GBHA 1SLUB 4ISLA 4XBCA 1W7XH 2ZKSA 2FEQH 2QF0A 1TNGA 5EPNA 2A0QB 1AE8H 5FPYA 1ELTA 1P02A 1QL9A 2FOCA 4A1VA 3ZZ3A 1GBDA 1G3EA 1IQFA 1AE5A 4Q80A 4RKJB 3GYMA 1S6HA 2XTTB 2HGTH 2BTCE 1Z6EA 3ZVCA 4AFZA 1TALA 1D3DB 2STAE 7ESTE 2BXUH 4AYVB 3KCGH 1V2WT 1B0FA 1ELVA 2BD5A 1SVPA 5HXFA 2B0FA 4NZQA 1GBLA 1TNLA 4MPWA 1K9OE 1O3LA 1UVOA 1RJXB 2Y80A 1QCPA 1W3CA 2PUXB 1C9PA 5C5NA 1TGBA 1YPHC 4DURA 4FU7A 2VVUA 1Z6JH 1AKSB 4CREA 3GCTG 1PJPA 1G3BA 4CRCA 2PV9B 4ZMAH 3NWUA 3KGPA 1QTFA 2HPPH 2ANWA 3UQOA 2QN5T 2A7HA 1FN8A 1GGDC 1YPJH 1KXEA 4UONA 3QGNB 1ESBA 2PFEA 3KQDA 3NPSA 1M9UA 4JK6A 4ISIH 3VB5A 1L4DA 5DPAA 3T2NA 1KTTB 4AG2A 2SNVA 1CU1A 1QRZA 1GBAA 2D26C 3T26A 2QV1A 2JKHA 1NU7B 3BSQA 2VGCB 2JETB 4MLFB 4X6NA 1CSOE 1O2SA 4U30A 3E1XB 1A61H 2VGCC 3ZZ4A 1KTSB 2FI4E 4UEHH 1LVBA 3M7TA 3SW2B 2BOHB 3UPEA 1C1UH 1AWFH 2ZTZA 1PYTC 2ZPSA 2ZTYA 2GX4A 4D7FA 4MNYA 1KY9A 2OD3B 1ETTH 2VIVA 1LO6A 1PPHE 1T8OA 5TCAA 1YC0A 5F8ZA 1MZAA 4UFDH 1HJ9A 1EXFA 1Z8IB 1ZGIA 1TOCB 3UNSA 3LKWA 1BTYA 3F9GA 1TONA 1VJAU 1GL1A 1SGYE 1WQSA 3SGAE 1AQ7A 1K1LA 2QXGA 2BY9X 3CP7A 2DUCA 2O8MA 3KQEA 3VB3A 4DVAU 3BTKE 1XUKA 1UVUH 4JZ1A 2WPKS 3TK5A 1ZTJA 1C2DA 2JH5D 5E0GA 2AGIX 3SUDA 1ORFA 5H4IB 1DLEA 3M61U 2ZCHP 5BPEA 1MTUA 1BA8B 2BQ7B 2GP9B 1O3FA 1Y8TA 4AFUA 4NIWA 1SQAA 2AS9A 3A7ZA 4MNXA 3S9BA 2STBE 1PPZA 2WINI 3Q3KA 4U2WA 4WJG2 3D62A 3GY8A 3K2UA 1V2RT 3VFEA 1ZYOA 9ESTA 2F9PA 4OS6A 2BMGB 4AFSA 3RXSA 2BQ6B 5HM2A 3ZVDA 3FFGA 1W2KH 2BY6X 2P16A 2ZGBH 1QY6A 1GVKB 2V35A 3TGJE 1DT2A 3QTOH 3BG8A 1MTWA 1SC8U 3FZDA 3UR9A 2A7JA 1G32B 1QJ6B 1V2NT 1S5SA 2BX3A 4DIHH 1Z8GA 2H9HA 3PM3A 3SNEA 3LGWA 3U8OH 3A7YA 3LGIA 2AH4X 3MU1A 1AWHB 2FXRA 1C5NH 3UR6A 1SGTA 3KL6A 3QN7A 3ODDA 3RXFA 5JYIA 5LPRA 5EW1H 1WCZA 2BYAX 4BAQB 2ZFFH 2VIOA 1F5LA 2C90B 4B74A 2PGBB 1GI4A 2FIRH 2P3TB 4KTSA 1GDNA 3T27A 3SU1A 3MNBA 4FUHA 2FESH 1UTLM 1OWDA 3UOUA 1BZXE 1G2LA 1C1PA 4NA7A 2PW8H 3Q77A 4K60A 1C2JA 4NA9H 6GCHG 3GCTF 1GL0E 2ZA5A 1UK2A 2TRMA 2BDYA 4ASHA 2C93B 4JZFH 4GCHF 2Z9IA 4H6TA 3VGCB 3SJ9A 2GV7A 3M3SA 4UFFH 1IHSH 1P10A 1BBRK 3RXTA 5JBTA 1N8OB 1FONA 2VB0A 3A81A 1SGEE 4MDSA 2GGVB 2WPLS 5C5OA 4ZHLU 4NIXA 4AX9H 3L33A 3P8NA 4YT6H 1IQHA 2ZDMA 3BTWE 4VGCC 2A4RA 1T8NA 2FI3E 3LU9B 1NRNH 3UUZA 2VWMA 4AZ2B 4Z6AH 1W12U 3VPKA 3ODFA 1A1RA 2BD4A 1O3HA 2BVRH 4K8YA 1KLJH 1EZXC 4D9RA 1O3MA 1BIOA 7GCHG 2BY5X 2W7SA 5EXNA 2P94A 1OPHB 2AEIH 3NK8A 2H5CA 1TBZH 1THPB 2TPIZ 4E06H 1L2EA 1GBFA 3LIWA 1KXBA 5F8TA 5GIBA 2YNBA 4NG9H 2ZWLH 4GHQA 4RKOB 4Y76A 5L2ZH 1O2GH 1JIRA 3U8RH 1A5GH 2VIDA 3VEQB 4WXIA 3SI4H 2OC8A 2XWAA 4OS2A 4E05H 3A82A 3ZYEA 3RXJA 4QT8C 3SV6A 1VITG 1F2SE 1FN6A 1EQ9A 3QWCH 3BV9B 4X1SU 5EG4A 2GDEH 1EJNA 3VB6A 3RXOA 1EASA 3S9CA 4O03A 1KDQA 3BN9A 3A89A 1XM1A 2XBVA 4LOYH 1D3TB 2D8WA 1H9IE 2ZPQA 1HAGE 1L1GA 3FVFB 2M5TA 1UHBA 1J16A 1SGQE 4JMYA 1P06A 1W13U 3TH4H 2B9LA 3U98H 2GCTC 1RRKA 2NWNA 3KNXA 1LHEH 1P2IA 4HZHA 4XDEA 2ZFPH 3EGKH 1K1MA 2BVSH 3GY7A 3F1SB 4DGJA 1L4ZA 3RXHA 1CT4E 1MCTA 1FY3A 1BMAA 4Y7BA 1IQEA 2G51A 1Y59T 4CRGA 3B9FH 1WV7H 2FTLE 1ZSJA 1GBKA 1HV7A 3P92A 4MQAA 4B76A 1CGIE 2AMPA 2O8TA 2IJOB 2TGDA 3F68H 3OU0A 1FDPA 2DE9A 5ABWA 2OCVB 1DX5M 1O2LA 1SGNE 5FAHA 1TMBH 2BZ6H 2BZAA 1YPEH 3BEUA 5C1UA 1V2KT 5CE1A 1ZLRA 2EC9H 1O5FH 1O5EH 5DJ7A 1LMWB 3PLPA 2P59A 1UTJA 4NIVA 4WF8A 1VCPA 2WV5A 1LQEA 2CV3A 3P8FA 1O5DH 3S7HB 1SR5C 2Y5FA 3M7UA 2PLXA 3SNDA 4X1RU 4MPVA 3S7KB 2G55A 1K2I1 3NKKA 1AZ8A 1O2UA 2B7DH 2R2WU 4ZKNU 1A5IA 2ZU1A 3A88A 3AW1A 2BXTH 3HK3B 4CRAA 4YM9A 4NZLA 1GHZA 3HKJB 4HTCH 1XVMA 2ZU5A 1O2VA 5T6DA 3PMAB 4KTCA 2XYAA 3CENA 4AGJA 2F9OA 3N7OA 3MHWU 1YM0A 5A2MH 4FUFA 2NU2E 1Z71A 3K65B 2H1UA 2H9EH 1A5HA 1FQ3A 4XOJA 2DE8A 4R8TB 1WAYB 3P8OA 1ZHPA 4X2YA 2ODPA 4FXGH 5C67A 4E7NA 1GCTC 3ZVGA 2R3UA 1YBWA 3MTYA 1IQIA 2NU0E 2BHGA 4WH8A 2IOTA 3GISB 2CXVA 3W94A 4LXBH 4YLQH 2V6NA 2ULLA 3Q3YA 3RXRA 1D6WA 1UVTH 1OWEA 4H6SB 2WPHS 1ZSLA 1KXCA 1AFQB 4UFGH 1P12E 1JMOH 2A5IA 2FZZA 3G01A 1AFQC 3E6PH 2FDAA 3M3TA 4BAHB 4YO9A 1LHDH 1TQ7B 2Z7FE 5J4QA 4IMQA 1BITA 1VITF 2C8YB 5DG6A 1E0FD 1P57B 4YZUA 1MBMA 2EEKA 4ABIA 2ESTE 3QZQA 4F4OC 2F91A 6ESTA 3RU4D 4B73A 1TMTH 1NZQH 1QGFA 4AORA 1CGHA 1NRSH 2XCFA 1LHCH 3ESTA 4YTAA 2FYRA 1GJCB 3ZV9A 2XC0A 5FBEA 2ZGXH 1LKAA 4ISHH 1T31A 2ZU4A 1FIZA 3SBKA 2Q1JA 1ANBA 2BDHA 3TLOA 1GG6B 2FOGA 4K5ZA 1GG6C 1NS3A 4SGBE 3T28A 3BTDE 1SGRE 1OWKA 1Y3WA 3U9AH 2ZTXA 4TPYA 5FPTA 3SU5A 2O9QA 4BNRA 3O8RA 3U1JB 2TIOA 2EI8A 3MMGA 1J8AA 1O2NA 3GDSA 3QLPH 3GY4A 1AGJA 1QBVH 1KLTA 1V2PT 1BUIA 3DFLA 3BIUH 1P8VC 3E91A 1CT0E 2NU3E 4DT7B 1F0TA 1ZPBA 2FO9A 1C2MA 1AY6H 3QTVH 1C2LA 2W26A 1V2JT 1C5OH 4B2CA 4NWLA 3SJOA 1H8DH 3RC4A 1O5BB 3PV4A 1IHTH 1C2FA 2FOAA 1WTHD 5L2YH 1DM4B 1RTKA 1T32A 1MKWK 1UTQA 3QX5H 2PWXA 2ZU3A 2ZZUH 4CR9A 2OC1A 2C4FH 1PFXC 2P3FH 1MAXA 1IOEA 3DT0H 3O8CA 1X7AC 4ABFA 4AB9A 2OBQA 3MNXA 1TE0A 2FTMA 1EOLA 4A92A 4ABEA 3KF2A 2RCEA 1C1VH 1OOKB 1KXDA 1Q31A 2GT8A 2YNAA 1MTNB 1QB9A 1G36A 1NFXA 2J34A 1V6DA 2H2ZA 3MU8A 5T6FA 1B7XB 3SZNA 1HJ8A 2PGQB 2PSYA 4Y7AA 3T62A 1SQOA 2GMTB 1NRQH 2QAAA 1B0EA 5HMAA 4NGAH 1C5VA 2GMTC 2R3YA 3MO3A 4X2VA 5A8XA 1OWIA 3F9FA 3B23B 1BRBE 1DITH 1P2KA 1LHGH 1MBQA 1GJAB 2CF8H 1DSUA 3LPRA 1GBCA 3FZZA 1FI8A 4H4FA 4MTBA 2O8WA 1P9SA 1Z7KA 1VGCB 2G52A 3RP2A 4ABHA 1VGCC 1MU8B 2VINA 2PKSB 4AN7A 2PKSC 3SU4A 3QDZB 3UOPA 1TPPA 1TPSA 1MD8A 2HNTE 5EXLA 1P04A 1JXPA 4GHTA 3LONA 2B5TB 2WUCA 1PPCE 4FUDA 2ZI2H 1W7GH 1O2JA 2D2DA 3S0NA 4LZ4B 4H42U 3TGKE 3E0PB 3A84A 3PWCA 4WMEA 1JBUH 2UWLA 2SNWA 4UE7H 1RIWC 5J4SA 1TQ0B 2ZHDA 4AG1A 1ELFA 1C2KA 1ZMNA 3ITIA 4X6MA 3RM0H 1O3KA 1GGDB 2RG3A 1EZSC 4GCHG 3A8BA 1XUJA 5T6GA 3E16B 2QCYA 2CF9H 2CGAA 1C5ZB 2A5KA 1WUNH 2F9NA 1C5YB 3EYDA 1GI8B 3JZ2B 2ZG0H 4XE4A 5ESTE 1C4U2 5DP6A 3RXAA 1HRTH 3QO6A 1U6QA 4MPUA 3LT3A 1L0ZA 3BTGE 4OS1A 2CMYA 3PROA 2ALPA 4WY3A 3UWIA 3MOCA 1O3EA 1O2QA 1HNEE 3NUMA 1TYNA 1W14U 1C5LH 2ZO3H 3RXDA 2AGGX 4X2XA 3DHKH 1P09A 1WOFA 2FM2A 2C3SA 4D9QA 4NIYA 2W3KA 1N6XA 1YPHE 2O8LA 3GCHB 1OYQA 2GDDA 1GMDG 4DW2U 3GCHC 4X6PA 1AIXH 5DP4A 1JIMA 2UUFB 1DS2E 1YPLH 1V2LT 1EAWA 1QRWA 4YOIA 2KAIA 3NXPA 2R9PA 1V2MT 4Y71A 2WV4A 4DCDA 1V2QT 3EA9A 1YLCA 1CO7E 3A7XA 1NU9A 1NESE 1IAUA 2J2UA 4IGDA 1Q2WA 1HBTH 3NCLA 1S0QA 1BTXA 5EU8A 3OX7U 2ZDNA 1AVWA 5C2ZA 1WQVH 3PLBA 2TBSA 1RGQA 2ZIQH 1C1QA 3M5MA 2AFQB 5C1XA 1EPTB 4CR5A 3PLKA 2HRVA 4DOQA 1EPTC 3MNCA 3K9XB 1C1OA 1DPOA 3SN8A 4OS4A 1E38B 3BTHE 2ZHEH 1J15A 1LKBA 4BTTB 4ZHMU 3QK1A 4I31A 3RXKA 1ZJDA 3T5FH 1WTGH 1HAHH 1GHAF 2ZEBA 1MZDA 3MU0A 1TLDA 4ABGA 1C5XB 1EJMA 1UMAH 2PKAB 3ZZ9A 3RXVA 2ZPRA 5K0HA 1AZZA 2RA3A 4X8UH 2B8OH 3LJJA 1QJ7B 1C4Y2 3M5LA 4FUEA 1GWAA 2J95A 1SMFE 1ANEA 1SQTA 3PYHA 1KXAA 4FUCA 2Z94A 3SHCH 4X1QU 2ZGJA 1GI3A 5DK1A 4Q2KA 1FUJA 3ATIA 3RXEA 2Q6GA 2PTCE 2HOBA 3RU4T 2P95A 1P0SH 4B2BA 3A80A 1GBIA 3U69H 2XRCA 4ABAA 4HGCA 1GDQA 1CVWH 2HWLB 1NO9H 2AMDA 4X1PU 1NRRH 4ZXXH 3MH7A 4AGKA 3A8AA 4IC5A 3TJUA 1FIWA 1W11U 2OLGA 3UTUH 3QUMP 3L3TA 1WYKA 2Y7ZA 1DFPA 3U8TH 2Y6TA 3STJA 3ZZDA 3AAVA 4CRBA 1TABE 1S6FA 3A83A 4FUBA 4IW4E 1XXFA 1UK4A 1MUEB 3LH1A 4J1YA 4D76A 1F5KU 4Q7XA 5AFZH 2RDLA 1FPHH 1C2GA 3TK6A 1AI8H 2A4QA 1B5GH 1QQ4A 1HFDA 2A4OA 4TY6A 3OYPA 3GICB 1F5RA 2ZDLA 3RLYH 1OP2A 2F3CE 3F6UH 1V3XA 3KQCA 2BQWB 3AASA 4VGCB 3B8JA 5CHAB 2PSXA 2W5EA 5CHAC 4DG4A 5T3HA 4OGYA 2AYWA 4BAOB 1P2OA 1LQDB 1XX9A 8GCHG 1MCVA 1DY9A 4U01A 4Y0ZE 3URDA 5A0CA 3IITA 1BBRE 5CMXH 2C8WB 3DD2H 1BRAA 4XFQA 1JRTA 1IQMA 5EW2H 2OP9A 1C1SA 4TPIZ 1GMDF 2ZGHA 2GZ9A 4X0WU 1G3CA 1LVYA 1TPOA 1L1JA 2PHBA 1MH0A 1V2VT 1MTVA 1O2YA 1OX1A 5DGJA 1FY5A 4GVUA 3ZZ8A 1SOZA 1HAIH 3ZVEA 3OSYA 4GPGA 2Q6FA 1OSSA 1SG8B 1GBBA 1VCQA 5FCRA 3K6YA 3A7VA 3PB1E 1DOJA 4NCYA 1CHOG 1E35B 3CS7A 3SUFA 1TMUH 4Y8YA 1XKAC 2EA3A 1PQ5A 3MH4A 1HJAB 1VR1H 2A4GA 2G00A 3M3VA 2QY0B 1SGFG 1GMHG 1HJAC 1GHWH 1ZSKA 4FVDA 4MG3A 4A1TA 3LGYA 3A8CA 2GCTB 1UCYH 3GY5A 1SBWA 1BRCE 5GXPA 1TGNA 1ELAA 4FUGA 1W0YH 1C2IA 3PO1C 4D8NA 1QA7A 2EI7A 4CBNA 1Z1JA 1O36A 1LHFH 4K8BA 5AHGH 3ATMA 3SOSA 1LPZB 2ZCKP 4LZ1H 4Y6DA 2ANMH 1BMNH 1CE5A 1FY4A 1NT1A 2XC4A 5TCCA 4I8HA 1GI7B 3L6PA 2Z9LA 5FXLA 4IN2A 3RXIA 1EOJA 3PWBA 1K1NA 1XKBC 3ZV8A 2BY8X 1QFKH 3MU5A 1AD8H 1UCYE 1PQAA 3HATH 3OY5U 1O39A 5A0BA 1UK3A 4ZH8A 1AVGH 1O2IA 5C3NA 3P70B 1L1NA 2K1QA 1P2MA 1BTUA 1OWJA 1ZZZA 5HYOA 3RUOA 4TY7A 3RXQA 5ETXA
chains in the Genus database with same CATH superfamily
1V2ST 4CBOA 2SGDE 2VBCA 4Y79A 4I32A 1TFXA 1C5UA 1YPMH 3A86A 4Y0YE 2ALVA 1TNKA 2WPIS 1A4WH 2Y7XA 2HVXA 3SU2A 2GVFA 2KR7A 1YPKH 2HALA 1RTFB 2Y5GA 2ZFQH 2CHAB 1TBQH 4AB8A 4BTIB 2KCAA 1GJ8B 1BMLA 1Y3VA 3SGBE 2CHAC 1XVOA 2FLRH 2JIZD 3ZZCA 2RA0A 2BDGA 1LPGB 2ZHWH 1GJ7B 2CN0H 2WYGA 3RLWH 2FOHA 4ZKRU 4CHAB 1TGSZ 3VXFH 4A7IB 2LELA 4CHAC 1SHHB 1SPJA 2KAIB 1O33A 3RXGA 1EB2A 3EA7A 2TGPZ 2BD7A 2XBWA 2G5VA 2AGEX 3FANA 3IG6B 1FY8E 1FZZA 1GCTB 4ZKOU 1S82A 5JBCS 3AK5A 1BTZA 1YGCH 1RS0A 3MH5A 1GJBB 2TGTA 2J5UA 3LGVA 3BIVH 4A5TS 1EP6A 5FX5A 4O9VA 8GCHF 2G4TA 1QBNA 4ISNA 5E2OA 1NM6A 5C1YA 3LDXH 2P3UB 1ZHMA 4AFQA 2GT7A 3TU7H 4RSPA 1HAVB 1H9HE 3LJOA 2A45B 3SORA 3M36A 1DUEA 1SGCA 4ABDA 1YCPH 2FWWA 2GKVE 3GY2A 1SI5H 4XRNA 2QGRA 5DO4H 2FODA 1O2KA 3ZVFA 1EZUC 2BDCA 4BOHA 2H5DA 2VWLA 1OS8A 1S0RA 2UWOA 1TGTA 3DA9B 3ZZAA 1HLTH 1UTNA 2HVYB 1HCGA 1EPTA 3HK6B 1G37A 3ATLA 1A2CH 1AO5A 4GUXA 2IN2A 5E0HA 3V12A 2PR3A 2ZU2A 3RMMH 1GDUA 4MVNA 3EQ0H 4CH8B 1CHOF 4X1NU 3W95A 1O2RA 3WWFA 5CDFE 5FBIA 1ARCA 3RXLA 2ZFRH 1GMHF 3URCA 1DE7H 1RD3B 1THSH 2BLOA 2UWPA 1SGPE 5C0TA 1GHYH 4DY7B 5EQSA 1NC6A 1YPGH 2FS9A 2FOEA 3HGNA 3SUEA 3BF6H 2PKAA 1CQQA 1GJ4H 1QJ1B 1ZMLA 1DWDH 1XMNB 1C1RA 4E7RG 4Y11E 5PTPA 3Q3XA 2ODYB 2GD4B 3IWMA 1C5PA 1Z1IA 3FP7E 2OQUA 2BOKA 3PRDA 1ELDE 2VH0A 5TJXA 5EQRA 2G4UA 1TIOA 3CS0A 5IDKA 1D3QB 1CA8B 1E1QD 4CRFA 4FVBA 3SV2H 3UB0A 1AU8A 1Y5UT 4K1EA 1NROH 1ACBE 1GHVH 3UWJH 1H4WA 4UFEH 4B75A 1O5AB 1A0LA 1JWTA 2FOBA 4RN6A 1XUGA 3BEFB 3MU4A 1F7ZA 4KKDA 9LPRA 1TWXB 2BVXH 2ZQ2A 5EODA 1F92A 2ZHQH 3KQ5A 4K2YA 1SFIA 1A0JA 2YMSD 2OK5A 2SFAA 2O8UA 4O3UA 3U28C 1PPGE 4YOJA 3GDUA 1SLVB 4NSYA 3SNAA 1MKXH 4BAMB 1GCDA 2BD3A 2BLVA 3TK9A 1N6YA 1P2NA 4MNWA 1O3AA 5ESBA 1P9UA 4X8SH 1O3CA 1O2WA 6LPRA 4UDWH 3SGQE 2XNDD 1PPEE 2WPJS 1O0DH 1HGTH 4THNH 5JB9S 1TNJA 1GI1A 1S83A 2OTVA 2A7CA 1NTPA 2QXJA 1D9IA 1C5MD 1VCWA 5EXMA 4NFFA 3VB4A 1SFQB 1DVAH 3D49H 4SGAE 5LGOA 3M7QA 2CJIA 4OM9A 2H6MA 3V3MA 3TGIE 3P6ZB 2UUYA 1YKTA 4KGAA 5A0AE 1SLXB 3N7DA 4ZHAA 1WBGB 3PTNA 1GHAG 2F9BH 5DP8A 2RDEA 1YF4A 3LGUA 5GWZA 1O35A 1Y3UA 1AUTC 1IQLA 4INHA 1HUTH 1HDTH 1BHXF 2ZP0H 2WUBA 4TYDA 1BTHH 4FU9A 1T7CA 1A7SA 3HGPA 1KXFA 4X6OA 5C20A 3BTEE 1EAIA 1S84A 1ZPZA 3BTFE 3TH2H 3AVZA 1LDTT 1T4UH 2BLQA 1EP5A 2BDIA 1G2MA 1TNHA 5LPFA 1FPCH 2GV6A 8ESTE 4O3TA 3GYLB 2Y81A 4WMFA 5IYTA 2J38A 5DP3A 4I86A 1K28D 3FP6E 8KME2 1DICA 1A0HB 1ELBA 1RIWB 2Z9JA 5HM9A 4I8JA 7KMEH 1O5GH 5I25A 5A8YA 1DANH 1O3NA 1W0ZU 1OP8A 4A6LA 3UNRA 3MNSA 1YCPM 5FCKA 2R0KA 1HPGA 5B6LA 1TOMH 2XCNA 2GZ8A 4HI3A 4IN1A 4D7GA 2QYIA 1MTSA 3TJVA 1C1WH 1GJ6A 3OEHD 1C5SA 3EE0B 1TAWA 2EI6A 1J9CH 4ASUD 4Q7ZA 5GJ4B 1FV9A 1C5TA 3V0XA 1TX8A 4HG6A 1NPMA 2W6ID 4K1SA 1BJUA 1ZRKA 1TX6A 5FL7D 2AMQA 3TJOA 3LH3A 3GCNA 1GI5A 1YP9A 1C5RA 1Q3XA 2J4IA 2VIWA 2QF4A 1GI9B 2AIQA 2THFB 1O3PB 3UQVA 3SV8A 1S85A 2WYJA 1KIGH 2F9UA 3PMJA 4U32A 3BTQE 1G3DA 1K1JA 1BTPA 2FX4A 3PV5A 4Y8ZA 1QNJA 1D3PB 2KM0A 2ZNKH 4GLYA 5L6NH 5JBBS 1TRYA 1G9IE 4P00A 1MAYA 2JETC 1BHXB 3ZZ5A 2TGAA 1LPKB 4Z0KA 4NA8A 3M35A 1GI2A 4FUIA 3A7TA 4JZEH 2VVVA 1K1OA 2WPMS 1YWUA 4IBLH 2WV9A 1BT7A 2F83A 1QB1A 1C1MA 2J92A 3U1IB 1HAOH 4ABJA 1O34A 1NRPH 3GY6A 8LPRA 4I8LA 3H5CB 1O5CB 4LK4A 2C8ZB 3MFJA 1HIAB 1KYNA 3P17H 1BJVA 1FNIA 3PMHB 4FOUC 1UVSH 3RU4E 2Z6BD 1DLKB 5SGAE 1ABJH 1QRXA 2FOFA 1KSNA 2ZQ1A 1KLIH 2OC7A 4FETA 3SU0A 1ZPCA 1IQGA 2YMSB 1AFEH 1QURH 1HAVA 2YMSC 2JH6D 1G30B 1SHYA 3H7TA 4GAWA 2OUAA 4R0IA 4YESB 4ISOA 1T8LA 1VJ9U 3TPIZ 1O3DA 1QBOA 3E3TA 1HAZB 1UTPA 5G4BA 1HAXB 1DUAA 1H9LB 1H8IH 2OINA 2V3OH 1FLEE 1NY22 1F0UA 1OP0A 2SGFE 3KEEA 2H9TH 1TRNA 1K1IA 2SGEE 2KCOA 2WZQA 1NFUA 1O3GA 1SKYE 3MI4A 3SQHE 3TNTA 1GBMA 1QA0A 2XBYA 2PUQH 3ZYDA 1QHRB 1ETRH 5L30H 2QA9E 2Z3CA 1O2OA 4K3JA 2Z9GA 5AF9H 2AIPA 4YLUA 2JH0D 4YOGA 1SB1H 2PTNA 4XSKU 2FPZA 1QQUA 1O32A 3GOVB 3SHAH 1FXYA 1GHXH 4B1TA 2UUKB 3EA8A 4INKA 1BBRH 1ELGA 3M37A 3MH6A 1A3BH 1P3EA 4Y10E 1O30A 1XUHA 3EAJA 5JB8S 4K69A 3MO9A 2BM2A 1GJ5H 3A87A 3PMBB 3LC5A 3GY3A 2XWBI 1PQ8A 1HAYB 2XC5A 1FJSA 1WSSH 4XBBA 4BTUB 1O2MA 2Y82A 3I29A 2XNIA 2Z3DA 2VU8E 2BY7X 1JRSA 3C27B 4NSVA 1GMCG 1O2HA 2D1JA 2XW9A 1O2TA 4Q4LA 1GJ9B 1ZGVA 2NU1E 3A85A 1V2UT 4JCNA 3RXBA 3P8GA 4BXSA 4CH2B 1UTKA 1EJAA 1HXFH 4X8TH 1AHTH 2BX4A 3VGCC 5B6OA 1N8OC 1UJ1A 2ASUB 5E0JA 3S9AA 1ESAA 1O2ZA 1E1RD 2V3HH 3GCOA 1C1TA 3R0FA 3E0NB 2ZDKA 3ZZBA 1ARBA 3SU3A 1Y5BT 5K7RA 1DWEH 5F6MA 1O3BA 2G81E 2ZFSA 3RM2H 1ESTA 1HAPH 4B6FA 1ZOMA 2W3IA 3STIA 2SGPE 4IMZA 3RMOH 1SGIB 3RDZA 2LPRA 4ESTE 2J94A 3T29A 3ENSB 3I78A 1UTMA 3SNCA 1W10U 3O8DA 1DWBH 1ZJKA 3R3GB 4XBDA 2Z3EA 4IS5A 2LNCA 3LC3A 4F49A 3SUGA 1LTOA 1GVLA 2IPHA 4OS7A 5DKMA 1EAXA 3SZEA 1NFYA 1SGFA 3OEED 1GI0A 1AVXA 2VJ1A 4KP0A 4JZIA 1DXPA 1O2XA 1CHGA 1QB6A 1CT2E 1HXEH 2BD9A 1NFWA 1TA2A 1P3CA 4HFPB 1GVZA 1K1PA 1V2OT 3FKSD 2P93A 1N1LA 2ZF0H 4ZXYH 3F9EA 4OGXA 4A1XA 1C5QA 3PO1B 5JPMH 1FAXA 1LCYA 1BOQA 3RXCA 3SO3A 4AYYB 1MMJN 2K0QA 1DSTA 5EGMA 2HLCA 2FMJA 1SLWB 1ZTKA 1GBEA 5DP5A 2SGQE 5AVDA 1SL3A 1MU6B 1J14A 1UW7A 2ODQA 1C5WB 2VH6A 4JZDH 5A8ZA 1FX0B 4WMDA 3F2GA 3V13A 2VIPA 3T25A 3SV9A 3PTBA 3P95A 3JZ1B 1YYY1 1ID5H 1S6LA 1UCYK 3KHVA 1NN6A 4DIIH 1IQNA 5F03A 1BDAA 3RXPA 4DJZB 2A1DB 3VB7A 4AC9A 2VIQA 4TWYA 2BB4A 2V0BA 1OKXA 2HLDD 3BTTE 4RT0A 3S69A 1ZMJA 2GCHG 2XOKD 2JDID 5C94A 1OXGA 1BQYA 1OYTH 4WH6A 4BANB 1P2QA 1O3JA 3SI3H 5GCHG 2Z9KA 4K1TA 1BB0B 1EUFA 3FAOA 1AN1E 2I6SA 1GBJA 5EOKA 1AKSA 1QL7A 5LPEA 3O8BA 3H7OA 1ELEE 1C2HA 1H1BA 3Q76A 1Z8JB 4ZUHA 1INCA 3A7WA 4FU8A 3TITA 2V7QD 5A09A 4XD7D 1J17T 3EDXB 5EQQA 2Q6DA 4WWYA 1P2JA 4ZAEA 1TGCA 2VNTA 3KQBA 4B71A 2GTBA 4I8KA 1C4V2 1BRUP 4O97A 1GHBG 4J2YB 2VVCA 1MQ6A 5F8XA 2BLWA 1C9TA 6GCHF 1TRMA 3SNBA 2AERH 1THRH 5I46H 3TJNA 1ANDA 1EATA 2A2XH 5BRRE 5JBAS 3SJ8A 1GMCF 3SJIA 1WU1A 5E8EH 2C8XB 2FP7B 2FLBH 3BEIB 3NZIA 2ZECA 1XXDA 2J9NA 3MO6A 4BXWA 4JYUH 1DWCH 2F43B 1CGJE 1DXWA 2WHXA 4CRDA 1UVPA 3E90B 3VXEH 1ZR0A 3DFJA 4JK5A 4X8VH 3UFAA 1AB9B 4JYVH 4X2WA 1AB9C 1TNIA 2A32A 4TT3D 4WXVA 1GI6A 1F0RA 1D6RA 3KIDU 1O38A 3I77A 3ATKA 1EB1H 1IQKA 3WY8A 4TWWA 3AW0A 1GPZA 4I33A 5JDUB 7GCHF 1GBTA 2BDAA 1ABIH 1HIAA 4FUJA 1TBRH 1E37B 3D23A 2FYQA 3TIUA 1EKBB 3ZVAA 1Y3YA 3UNQA 2ANKH 1AUJA 1O31A 1YLNA 3F9HA 4UD9H 1E36B 1O3IA 3M5NA 1AMHA 3BTME 3KN2A 4OS5A 1CBWB 1W8BH 2F9VA 1FAKH 1UO6A 1YCPK 3C1KA 2BD2A 2HNTF 1CBWC 1SOTA 5GPIB 1TA6A 1DDJA 3AAUA 3FP8E 5HKKD 3A8DA 3QZRA 2G5NA 1ZTLA 2SGAA 4MNVA 1EX3A 2ZHFH 2ZDVH 1IQJA 1P11E 3M5OA 3ELAH 3SV7A 2A31A 4P02A 5GNDA 3WW7A 2OBOA 2HPQH 1PYTD 3RXUA 3MQKC 2ZGCA 3UIRA 2BD8A 2G8TA 5DP9A 3K6ZA 1A3EH 2A2QH 2ANYA 2ILNA 3ATWA 1TB6H 1RTLA 2ZCLP 3SJKA 2XBXA 1P05A 1BTWA 3RMLH 2FS8A 2ZDAH 2K8IA 4Y8XA 1RXPA 1O2PA 5EPYA 1C1NA 2VWNA 1MKWH 2ZFTA 1QL8A 3Q00A 3RXMA 3UREA 1PPBH 1Y3XA 2FI5E 2GZ7A 2Y5HA 2R2MB 3OFND 5FX6A 4ZROA 2UUJB 3BG4B 1SGDE 1MD7A 1VZQH 2VWOA 1Y5AT 1OWHA 2I6QA 3BG4C 3ZVBA 3MWIU 3ZZ6A 1O3OA 3ZZ7A 1A46H 3KYGA 2GCHF 1Z8RA 4JYTA 5FPSA 2KCYA 2KZ4A 1TPAE 1QIXB 2W7UA 3V7TA 1K22H 1SSXA 1EAUA 2BDBA 5AFYH 3RC5A 2QXHA 5FHTA 4WVPE 3E8LA 5GCHF 4ZKSU 1XUFA 3GDVA 4ABBA 4F48B 5HGGA 1V2TT 4I8GA 1O37A 3RC6A 3D65E 3TNSA 2QF3A 1UTOA 2CK3D 2AHME 1ETSH 3UY9A 3SYJA 4IC6A 2QC2A 1E34B 5GDSH 3DUXH 2P8OB 2FX6A 4MPXA 1LVOA 2OQ5A 1D4PB 1ANCA 2NU4E 1T4VH 2P8OC 1T8MA 1TX7A 5DP7A 5LH8A 1PPFE 4YT7H 4M7GA 1MQ5A 1LVMA 1YLDA 4BAKB 4NWKA 1ELCA 1GHBF 1XUIA 1PQ7A 2QIQA 1EZQA 2J98B 3MYWA 4GSOA 4KELA 4AOQA 1P03A 3SQEE 2OXSA 2XXLA 3DCLA 1VITH 2QXIA 3LOXA 2R0LA 3TVJB 4INLA 1RFNA 4PROA 2ZC9H 2HNTC 1BCUH 3QGJA 1MKXK 4Q7YA 3RMNH 2FOMB 1P01A 1S81A 4NFEA 2OC0A 1CA0B 6CHAB 1C2EA 3OTPA 3SU6A 1DY8A 1GJDB 1ZHRA 1HB0B 1CA0C 1FY1A 6CHAC 4B2AA 1MTNC 1JOUB 4KTUA 1KDQB 3HKIB 1FMGA 2A5AA 7LPRA 3OTJE 3DSPA 3OY6U 1ZRBA 4I7YH 3LGTA 1F0SA 5E2PA 3TH3H 1QR3E 1UHBB 1BMMH 3NRLA 3HPTB 1HYLA 1K21H 2YOLA 1GBHA 1SLUB 4ISLA 4XBCA 1W7XH 2ZKSA 2FEQH 2QF0A 1TNGA 2W6JD 5EPNA 2A0QB 1AE8H 5FPYA 1ELTA 1P02A 1QL9A 2FOCA 4A1VA 3ZZ3A 1GBDA 1G3EA 1IQFA 1AE5A 4Q80A 4RKJB 3GYMA 1S6HA 2XTTB 2HGTH 2BTCE 1Z6EA 3ZVCA 4AFZA 1TALA 1D3DB 2STAE 7ESTE 2BXUH 4AYVB 3KCGH 5C17A 1V2WT 1B0FA 1ELVA 2BD5A 1SVPA 5HXFA 2B0FA 4NZQA 1GBLA 1TNLA 3GS9A 1K9OE 4MPWA 1O3LA 1UVOA 1RJXB 2Y80A 1QCPA 1W3CA 2PUXB 1C9PA 1W0JD 5C5NA 1TGBA 1YPHC 4DURA 4FU7A 2VVUA 1Z6JH 1AKSB 4CREA 3GCTG 1PJPA 1G3BA 4CRCA 1MABB 2PV9B 4ZMAH 3NWUA 3KGPA 1QTFA 2HPPH 2ANWA 3UQOA 2QN5T 2A7HA 1FN8A 1GGDC 1YPJH 1KXEA 4UONA 3QGNB 1ESBA 2PFEA 3KQDA 3NPSA 1M9UA 4JK6A 4ISIH 3VB5A 1L4DA 5DPAA 3T2NA 1KTTB 4AG2A 2SNVA 1CU1A 1QRZA 1GBAA 2D26C 3T26A 2QV1A 2JKHA 1NU7B 3BSQA 2VGCB 2JETB 4MLFB 4X6NA 1CSOE 1O2SA 4U30A 3E1XB 1A61H 2VGCC 3ZZ4A 1KTSB 2FI4E 4UEHH 4DT4A 1LVBA 3M7TA 3SW2B 2BOHB 3UPEA 1C1UH 1AWFH 2ZTZA 1PYTC 2ZPSA 2ZTYA 2GX4A 4D7FA 4MNYA 1KY9A 2OD3B 1ETTH 2VIVA 1LO6A 1PPHE 1T8OA 5TCAA 1YC0A 5F8ZA 1MZAA 4UFDH 1HJ9A 1EXFA 1Z8IB 1ZGIA 1TOCB 3UNSA 3LKWA 1BTYA 3F9GA 1TONA 1VJAU 1GL1A 1SGYE 1WQSA 3SGAE 1AQ7A 1K1LA 2QXGA 2BY9X 3CP7A 2DUCA 2O8MA 3KQEA 3VB3A 4DVAU 3BTKE 1XUKA 1UVUH 4JZ1A 4ZCNA 3F3BA 2WPKS 3TK5A 1ZTJA 1C2DA 2JH5D 5E0GA 2AGIX 3SUDA 1ORFA 5H4IB 1DLEA 3M61U 2ZCHP 5BPEA 1MTUA 1BA8B 2BQ7B 2GP9B 1O3FA 1Y8TA 4AFUA 4NIWA 1SQAA 2AS9A 3A7ZA 4MNXA 3S9BA 2STBE 1PPZA 2WINI 3Q3KA 4U2WA 4WJG2 3D62A 3GY8A 3K2UA 1V2RT 3VFEA 1ZYOA 9ESTA 2F9PA 4OS6A 2BMGB 4AFSA 3RXSA 2BQ6B 5HM2A 3ZVDA 3FFGA 1W2KH 2BY6X 2P16A 2ZGBH 1QY6A 1GVKB 2V35A 3TGJE 1DT2A 3QTOH 3BG8A 1MTWA 1SC8U 3FZDA 3UR9A 2A7JA 1G32B 1QJ6B 1V2NT 2JJ1D 1S5SA 2BX3A 4DIHH 1Z8GA 2H9HA 3PM3A 2IPQX 3SNEA 3LGWA 3U8OH 3A7YA 3LGIA 2AH4X 3MU1A 1AWHB 2FXRA 1C5NH 3UR6A 1SGTA 3KL6A 3QN7A 3ODDA 3RXFA 5JYIA 5LPRA 5EW1H 1WCZA 2BYAX 4BAQB 2ZFFH 1W0KD 2VIOA 1F5LA 2C90B 4B74A 2PGBB 1GI4A 2FIRH 5EJZA 3KYFA 2P3TB 4KTSA 5F53A 1GDNA 3T27A 3SU1A 3MNBA 4FUHA 2FESH 1UTLM 1OWDA 3UOUA 1G2LA 1BZXE 1C1PA 4NA7A 2PW8H 3Q77A 4K60A 1C2JA 3FOAA 4NA9H 4ACBA 6GCHG 3GCTF 1GL0E 2ZA5A 1UK2A 2TRMA 1E79D 2BDYA 4ASHA 2C93B 4JZFH 4GCHF 2Z9IA 4H6TA 3VGCB 3SJ9A 2GV7A 3M3SA 4UFFH 1IHSH 1P10A 1BBRK 3RXTA 5JBTA 1N8OB 1FONA 2VB0A 3PV2A 3A81A 1SGEE 4MDSA 2GGVB 2WPLS 5C5OA 4ZHLU 4NIXA 4AX9H 3L33A 3P8NA 4YT6H 1IQHA 2ZDMA 3BTWE 4VGCC 2A4RA 1T8NA 2FI3E 3LU9B 1NRNH 3UUZA 2VWMA 4AZ2B 4Z6AH 1W12U 3VPKA 3ODFA 1A1RA 2BD4A 1O3HA 2BVRH 4K8YA 1KLJH 1EZXC 4D9RA 1O3MA 1BIOA 7GCHG 2BY5X 2W7SA 5EXNA 2P94A 1OPHB 2AEIH 3NK8A 2H5CA 1TBZH 1THPB 2TPIZ 4E06H 1L2EA 1GBFA 3LIWA 1KXBA 5F8TA 5GIBA 2YNBA 4NG9H 2ZWLH 2J98A 4GHQA 4RKOB 4Y76A 5L2ZH 1O2GH 1JIRA 3U8RH 1A5GH 3UAIC 2VIDA 3VEQB 4WXIA 3SI4H 2OC8A 2XWAA 4OS2A 4E05H 3A82A 3ZYEA 3RXJA 4QT8C 3SV6A 1VITG 1F2SE 1FN6A 1EQ9A 3QWCH 3BV9B 4X1SU 5EG4A 2GDEH 1EJNA 3VB6A 3RXOA 1EASA 3S9CA 4O03A 1KDQA 3BN9A 3A89A 1XM1A 2XBVA 4LOYH 1D3TB 2D8WA 1H9IE 2ZPQA 1HAGE 1L1GA 5T1VA 3FVFB 2M5TA 1UHBA 1J16A 1SGQE 4JMYA 1P06A 1W13U 3TH4H 2B9LA 3U98H 2GCTC 1RRKA 2NWNA 3KNXA 3CNRA 1LHEH 1P2IA 4HZHA 4XDEA 2PP6A 2ZFPH 3EGKH 1K1MA 2BVSH 3GY7A 3F1SB 4DGJA 2IJD1 1L4ZA 3RXHA 1CT4E 1MCTA 1FY3A 4RI0A 1BMAA 4Y7BA 1IQEA 2G51A 1Y59T 4CRGA 3B9FH 1WV7H 2FTLE 1ZSJA 1GBKA 1HV7A 3P92A 4MQAA 4B76A 1CGIE 2AMPA 2O8TA 2IJOB 2TGDA 3F68H 3OU0A 1FDPA 2DE9A 5ABWA 2OCVB 1DX5M 1O2LA 1SGNE 5FAHA 1TMBH 2BZ6H 2BZAA 1YPEH 3BEUA 5C1UA 1V2KT 5CE1A 1ZLRA 2EC9H 1O5FH 1O5EH 5DJ7A 1LMWB 1H8HD 2P59A 3PLPA 1UTJA 4NIVA 4WF8A 1VCPA 2WV5A 1LQEA 2CV3A 3P8FA 5HIYA 1O5DH 3S7HB 1SR5C 2Y5FA 3M7UA 2PLXA 3SNDA 1QZ8A 4X1RU 4MPVA 3S7KB 2G55A 1K2I1 3ZIAD 3NKKA 1AZ8A 1O2UA 2B7DH 2R2WU 4ZKNU 1A5IA 2ZU1A 3A88A 3AW1A 2BXTH 3HK3B 4CRAA 4YM9A 4NZLA 1GHZA 3HKJB 4HTCH 1XVMA 2ZU5A 1O2VA 5T6DA 3PMAB 4KTCA 2XYAA 5KEDA 3CENA 4AGJA 2F9OA 3N7OA 5EJLA 3MHWU 1YM0A 5A2MH 4FUFA 2NU2E 1Z71A 3K65B 2H1UA 2H9EH 1A5HA 1FQ3A 4XOJA 2DE8A 4R8TB 1WAYB 3P8OA 1ZHPA 4X2YA 2ODPA 4FXGH 4TSFD 5C67A 4E7NA 1GCTC 3ZVGA 2R3UA 1YBWA 3MTYA 1IQIA 2NU0E 2BHGA 4WH8A 2IOTA 3GISB 2CXVA 3W94A 4LXBH 4YLQH 2V6NA 2ULLA 3Q3YA 3RXRA 4Z1MD 1D6WA 1UVTH 1OWEA 4H6SB 2WPHS 2JJ2D 1ZSLA 1KXCA 1AFQB 4UFGH 1P12E 1JMOH 2A5IA 1OHHD 2FZZA 3G01A 1AFQC 1KMHB 2FDAA 3E6PH 3M3TA 4BAHB 4YO9A 1LHDH 1TQ7B 2Z7FE 5J4QA 4IMQA 1BITA 1VITF 2C8YB 5DG6A 1E0FD 1P57B 2LP6A 4YZUA 2WSSD 1MBMA 2EEKA 4ABIA 2KFWA 2ESTE 3QZQA 4F4OC 2F91A 6ESTA 3RU4D 4B73A 2RFKC 1TMTH 2QF5A 1NZQH 3PRBA 1QGFA 4AORA 1CGHA 1NRSH 2XCFA 1LHCH 3ESTA 4YTAA 2FYRA 1GJCB 3ZV9A 2XC0A 5FBEA 2ZGXH 1LKAA 4ISHH 1T31A 2ZU4A 5DSFA 1FIZA 3SBKA 2Q1JA 1ANBA 2BDHA 3TLOA 1GG6B 2FOGA 5HIZA 2KX4A 4K5ZA 1GG6C 1NS3A 4SGBE 3T28A 4ACAA 3BTDE 1SGRE 1OWKA 1Y3WA 3U9AH 2ZTXA 4TPYA 5FPTA 3SU5A 2O9QA 2F4LA 4BNRA 3O8RA 3U1JB 2TIOA 2EI8A 3MMGA 1J8AA 1O2NA 3GDSA 1SQRA 3QLPH 3GY4A 1AGJA 1QBVH 1KLTA 1V2PT 1BUIA 3DFLA 3BIUH 1P8VC 3E91A 1CT0E 2NU3E 4DT7B 1F0TA 1ZPBA 2FO9A 1C2MA 1AY6H 3QTVH 1C2LA 2W26A 1V2JT 1C5OH 4B2CA 4NWLA 3SJOA 1H8DH 3RC4A 1O5BB 3PV4A 1IHTH 1C2FA 2FOAA 1WTHD 5C0UA 5L2YH 1DM4B 1RTKA 3DSGA 1T32A 1MKWK 1UTQA 3QX5H 2PWXA 2ZU3A 2ZZUH 4CR9A 2OC1A 2C4FH 1PFXC 1NBMD 2P3FH 1MAXA 3FO8D 1IOEA 3DT0H 3O8CA 4RT1A 2L74A 1X7AC 4ABFA 1WDIA 4AB9A 2OBQA 3MNXA 1TE0A 4Q63A 2FTMA 1EOLA 4A92A 4M9FA 4ABEA 3KF2A 2RCEA 1C1VH 1OOKB 1KXDA 1Q31A 2GT8A 3H09A 2YNAA 2WPDD 1MTNB 1QB9A 1G36A 1NFXA 5EIYA 2J34A 1V6DA 2H2ZA 3MU8A 5T6FA 1B7XB 3SZNA 4YXWD 1HJ8A 2PGQB 2PSYA 4Y7AA 3T62A 1SQOA 2GMTB 1NRQH 2QAAA 1B0EA 5HMAA 4NGAH 1C5VA 2GMTC 2R3YA 3F2HA 3MO3A 4X2VA 5A8XA 1OWIA 3F9FA 2EQNA 3B23B 1BRBE 1DITH 1P2KA 5KECA 1LHGH 1H8ED 1MBQA 1GJAB 2CF8H 1DSUA 3LPRA 1GBCA 3FZZA 1FI8A 4H4FA 4MTBA 2O8WA 1P9SA 1Z7KA 1VGCB 2G52A 3RP2A 4ABHA 1VGCC 1MU8B 2VINA 2PKSB 4AN7A 2PKSC 3SU4A 1COWD 3QDZB 3UOPA 1TPPA 1TPSA 1MD8A 2HNTE 5EXLA 3F0OA 1P04A 3F0PA 1JXPA 4GHTA 3LONA 2B5TB 2WUCA 1PPCE 4FUDA 2ZI2H 1W7GH 1O2JA 2D2DA 3S0NA 4LZ4B 4H42U 3TGKE 3E0PB 3A84A 3PWCA 4WMEA 1JBUH 2UWLA 2SNWA 4UE7H 1RIWC 4F55A 5J4SA 1TQ0B 2ZHDA 4AG1A 1ELFA 1C2KA 1ZMNA 3ITIA 4X6MA 3RM0H 1O3KA 1GGDB 2RG3A 1EZSC 2M2AA 4GCHG 3A8BA 1XUJA 5T6GA 3E16B 2QCYA 2CF9H 2CGAA 1C5ZB 2A5KA 1WUNH 2F9NA 1C5YB 3EYDA 1GI8B 3JZ2B 2ZG0H 4XE4A 5ESTE 1C4U2 5DP6A 3RXAA 1HRTH 3QO6A 1U6QA 4MPUA 3LT3A 1L0ZA 3BTGE 4OS1A 2CMYA 3PROA 2ALPA 4WY3A 3UWIA 3MOCA 1O3EA 1O2QA 1K0HA 1HNEE 3NUMA 1TYNA 1W14U 1C5LH 2ZO3H 3RXDA 2AGGX 4X2XA 3DHKH 1P09A 1WOFA 2FM2A 2C3SA 3F2FA 4D9QA 4NIYA 2W3KA 1N6XA 1YPHE 2O8LA 3GCHB 1OYQA 2GDDA 1GMDG 4DW2U 3GCHC 4X6PA 1AIXH 5DP4A 1JIMA 2GJGA 2UUFB 1DS2E 1YPLH 1V2LT 1EAWA 1QRWA 4YOIA 2KAIA 3NXPA 2R9PA 1V2MT 4Y71A 2J97A 5KGOA 2WV4A 4DCDA 1V2QT 3EA9A 1YLCA 1CO7E 3A7XA 1NU9A 3N99A 1NESE 1IAUA 2J2UA 4IGDA 1Q2WA 1HBTH 3NCLA 1S0QA 1BTXA 5EU8A 3OX7U 2ZDNA 1AVWA 5C2ZA 1WQVH 3PLBA 1VKYA 2TBSA 1RGQA 2ZIQH 1C1QA 3M5MA 2AFQB 3VG8A 5C1XA 1EPTB 4CR5A 3PLKA 2HRVA 4DOQA 1EPTC 3MNCA 3K9XB 1C1OA 1DPOA 3SN8A 4OS4A 1E38B 3BTHE 2ZHEH 1J15A 1LKBA 4BTTB 4ZHMU 3QK1A 4I31A 3RXKA 1ZJDA 3T5FH 1WTGH 4B6EA 1HAHH 1GHAF 2ZEBA 1MZDA 3MU0A 1TLDA 4ABGA 1C5XB 1EJMA 1UMAH 2PKAB 3ZZ9A 3RXVA 2ZPRA 5K0HA 1AZZA 2RA3A 4X8UH 3OE7D 2B8OH 3LJJA 1QJ7B 1C4Y2 3M5LA 4FUEA 1GWAA 2J95A 1SMFE 1ANEA 1SQTA 3PYHA 1KXAA 4FUCA 2Z94A 1BMFD 3SHCH 4X1QU 2ZGJA 1GI3A 5DK1A 4Q2KA 1FUJA 3ATIA 3RXEA 2Q6GA 2PTCE 2HOBA 3RU4T 2P95A 1P0SH 4B2BA 3A80A 1GBIA 3U69H 2XRCA 4ABAA 4HGCA 1GDQA 1CVWH 2HWLB 1NO9H 2AMDA 4X1PU 1NRRH 4ZXXH 3MH7A 4AGKA 2KCPA 3A8AA 5EJ1A 4IC5A 3TJUA 1FIWA 1W11U 2OLGA 3UTUH 3QUMP 3L3TA 1WYKA 2Y7ZA 1DFPA 3U8TH 2Y6TA 3STJA 3ZZDA 3AAVA 4CRBA 1TABE 1S6FA 1NBME 3A83A 4FUBA 4IW4E 1XXFA 1UK4A 1MUEB 3LH1A 4J1YA 4D76A 1F5KU 4Q7XA 5AFZH 2RDLA 1FPHH 1C2GA 2V3MA 3TK6A 1AI8H 2A4QA 1B5GH 1QQ4A 1HFDA 2A4OA 4TY6A 3OYPA 3GICB 1F5RA 2ZDLA 3RLYH 1OP2A 2F3CE 3F6UH 1V3XA 3KQCA 2BQWB 3AASA 4VGCB 3B8JA 5CHAB 2PSXA 2W5EA 5CHAC 4DG4A 5T3HA 4OGYA 2AYWA 4BAOB 1P2OA 1LQDB 1XX9A 1EFRD 8GCHG 1MCVA 1DY9A 4U01A 4Y0ZE 3URDA 5A0CA 3IITA 1BBRE 2QE7D 5CMXH 2C8WB 3DD2H 1BRAA 4XFQA 5CHBA 1JRTA 1IQMA 5EW2H 2OP9A 1C1SA 4TPIZ 3FN8A 1GMDF 2ZGHA 2GZ9A 4X0WU 1G3CA 1LVYA 5IK2D 1TPOA 1L1JA 2PHBA 1MH0A 1V2VT 1MTVA 1O2YA 1OX1A 5DGJA 1FY5A 4GVUA 3ZZ8A 1SOZA 3N7EA 1HAIH 3ZVEA 1YY3A 2L6OA 3OSYA 4GPGA 2Q6FA 1OSSA 1SG8B 1GBBA 1VCQA 5FCRA 3WWBA 3K6YA 3A7VA 3PB1E 1DOJA 4NCYA 1CHOG 1E35B 3CS7A 3SUFA 1TMUH 4Y8YA 1XKAC 2EA3A 1PQ5A 3MH4A 1HJAB 1VR1H 2A4GA 2G00A 3M3VA 2QY0B 2EY4C 1SGFG 1GMHG 1GHWH 1HJAC 1ZSKA 4FVDA 4MG3A 3LGYA 4A1TA 3A8CA 1WXRA 2GCTB 1UCYH 3GY5A 1SBWA 1BRCE 5GXPA 3W1EA 1TGNA 1ELAA 4FUGA 1W0YH 1C2IA 3PO1C 4D8NA 1QA7A 2EI7A 4CBNA 1Z1JA 1O36A 1LHFH 4K8BA 5AHGH 3ATMA 3SOSA 1LPZB 3DSOA 2ZCKP 4LZ1H 4Y6DA 2ANMH 1BMNH 5DN6D 1CE5A 1FY4A 1NT1A 2XC4A 5TCCA 4I8HA 1GI7B 3L6PA 2Z9LA 3OAAD 5FXLA 4IN2A 3RXIA 1EOJA 3PWBA 1K1NA 1XKBC 3ZV8A 2BY8X 1QFKH 3MU5A 1AD8H 1UCYE 1PQAA 3HATH 3OY5U 1O39A 5A0BA 1UK3A 4ZH8A 1AVGH 1O2IA 5C3NA 3P70B 1L1NA 2K1QA 1P2MA 1BTUA 1OWJA 1ZZZA 3EE7A 5HYOA 3RUOA 4TY7A 3RXQA 5ETXA
chains in the Genus database with same CATH topology
1V2ST 4CBOA 2SGDE 4Y79A 4I32A 1TFXA 1C5UA 1YPMH 3A86A 4Y0YE 2ALVA 1TNKA 2WPIS 1A4WH 2Y7XA 2HVXA 3SU2A 2GVFA 1YPKH 2HALA 1RTFB 2Y5GA 2ZFQH 2CHAB 1TBQH 4AB8A 4BTIB 1GJ8B 1BMLA 1Y3VA 3SGBE 2CHAC 1XVOA 2FLRH 3ZZCA 2RA0A 2BDGA 1LPGB 2ZHWH 1GJ7B 2CN0H 2WYGA 3RLWH 2FOHA 4ZKRU 4CHAB 1TGSZ 3VXFH 4A7IB 4CHAC 1SHHB 1SPJA 2KAIB 1O33A 3RXGA 1EB2A 3EA7A 2TGPZ 2BD7A 2XBWA 2G5VA 2AGEX 3FANA 3IG6B 1FY8E 1FZZA 1GCTB 4ZKOU 1S82A 5JBCS 1BTZA 1YGCH 1RS0A 3MH5A 1GJBB 2TGTA 3LGVA 3BIVH 4A5TS 1EP6A 5FX5A 4O9VA 8GCHF 2G4TA 1QBNA 4ISNA 5E2OA 1NM6A 5C1YA 3LDXH 2P3UB 1ZHMA 4AFQA 2GT7A 3TU7H 4RSPA 1HAVB 1H9HE 3LJOA 2A45B 3SORA 3M36A 1DUEA 1SGCA 4ABDA 1YCPH 2FWWA 2GKVE 3GY2A 1SI5H 2QGRA 5DO4H 2FODA 1O2KA 3ZVFA 1EZUC 2BDCA 4BOHA 2H5DA 2VWLA 1OS8A 1S0RA 2UWOA 1TGTA 3DA9B 3ZZAA 1HLTH 1UTNA 1HCGA 1EPTA 3HK6B 1G37A 3ATLA 1A2CH 1AO5A 4GUXA 2IN2A 5E0HA 3V12A 2PR3A 2ZU2A 3RMMH 1GDUA 4MVNA 3EQ0H 4CH8B 1CHOF 4X1NU 3W95A 1O2RA 5FBIA 1ARCA 3RXLA 2ZFRH 1GMHF 3URCA 1DE7H 1RD3B 1THSH 2BLOA 2UWPA 1SGPE 1GHYH 4DY7B 5EQSA 1NC6A 1YPGH 2FS9A 2FOEA 3HGNA 3SUEA 3BF6H 2PKAA 1CQQA 1GJ4H 1QJ1B 1ZMLA 1DWDH 1XMNB 1C1RA 4E7RG 4Y11E 5PTPA 3Q3XA 2ODYB 2GD4B 3IWMA 1C5PA 1Z1IA 3FP7E 2OQUA 2BOKA 1ELDE 2VH0A 5TJXA 5EQRA 2G4UA 1TIOA 3CS0A 5IDKA 1D3QB 1CA8B 4CRFA 4FVBA 3SV2H 1AU8A 1Y5UT 4K1EA 1NROH 1ACBE 1GHVH 3UWJH 1H4WA 4UFEH 4B75A 1O5AB 1A0LA 1JWTA 2FOBA 4RN6A 1XUGA 3BEFB 3MU4A 1F7ZA 4KKDA 9LPRA 1TWXB 2BVXH 2ZQ2A 5EODA 1F92A 2ZHQH 4K2YA 1SFIA 1A0JA 2SFAA 2O8UA 4O3UA 1PPGE 4YOJA 3GDUA 1SLVB 4NSYA 3SNAA 1MKXH 4BAMB 1GCDA 2BD3A 2BLVA 3TK9A 1N6YA 1P2NA 4MNWA 1O3AA 5ESBA 1P9UA 4X8SH 1O3CA 1O2WA 6LPRA 4UDWH 3SGQE 1PPEE 2WPJS 1O0DH 1HGTH 4THNH 5JB9S 1TNJA 1GI1A 1S83A 2OTVA 2A7CA 1NTPA 2QXJA 1D9IA 1C5MD 1VCWA 5EXMA 4NFFA 3VB4A 1SFQB 1DVAH 3D49H 4SGAE 5LGOA 3M7QA 2CJIA 2H6MA 3V3MA 3TGIE 3P6ZB 2UUYA 1YKTA 4KGAA 5A0AE 1SLXB 4ZHAA 1WBGB 3PTNA 1GHAG 2F9BH 5DP8A 1YF4A 3LGUA 5GWZA 1O35A 1Y3UA 1AUTC 1IQLA 4INHA 1HUTH 1HDTH 1BHXF 2ZP0H 2WUBA 4TYDA 1BTHH 4FU9A 1T7CA 1A7SA 3HGPA 1KXFA 4X6OA 5C20A 3BTEE 1EAIA 1S84A 1ZPZA 3BTFE 3TH2H 3AVZA 1LDTT 1T4UH 2BLQA 1EP5A 2BDIA 1G2MA 1TNHA 5LPFA 1FPCH 2GV6A 8ESTE 4O3TA 3GYLB 2Y81A 4WMFA 5IYTA 2J38A 5DP3A 1K28D 3FP6E 8KME2 1DICA 1A0HB 1ELBA 1RIWB 2Z9JA 5HM9A 4I8JA 7KMEH 1O5GH 5I25A 5A8YA 1DANH 1O3NA 1W0ZU 1OP8A 4A6LA 3UNRA 3MNSA 1YCPM 5FCKA 2R0KA 1HPGA 1TOMH 2XCNA 2GZ8A 4HI3A 4IN1A 4D7GA 2QYIA 1MTSA 3TJVA 1C1WH 1GJ6A 1C5SA 3EE0B 1TAWA 2EI6A 1J9CH 4Q7ZA 5GJ4B 1FV9A 1C5TA 3V0XA 1TX8A 1NPMA 4K1SA 1BJUA 1ZRKA 1TX6A 2AMQA 3TJOA 3LH3A 3GCNA 1GI5A 1YP9A 1C5RA 1Q3XA 2J4IA 2VIWA 1GI9B 2AIQA 2THFB 1O3PB 3UQVA 3SV8A 1S85A 2WYJA 1KIGH 2F9UA 3PMJA 4U32A 3BTQE 1G3DA 1K1JA 1BTPA 2FX4A 4Y8ZA 1QNJA 1D3PB 2ZNKH 4GLYA 5L6NH 5JBBS 1TRYA 1G9IE 1MAYA 2JETC 1BHXB 3ZZ5A 2TGAA 1LPKB 4Z0KA 4NA8A 3M35A 1GI2A 4FUIA 3A7TA 4JZEH 2VVVA 1K1OA 2WPMS 4IBLH 1BT7A 2F83A 1QB1A 1C1MA 2J92A 3U1IB 1HAOH 4ABJA 1O34A 1NRPH 3GY6A 8LPRA 4I8LA 3H5CB 1O5CB 4LK4A 2C8ZB 3MFJA 1HIAB 1KYNA 3P17H 1BJVA 1FNIA 3PMHB 1UVSH 3RU4E 2Z6BD 1DLKB 5SGAE 1ABJH 1QRXA 2FOFA 1KSNA 2ZQ1A 1KLIH 2OC7A 3SU0A 1ZPCA 1IQGA 1AFEH 1QURH 1HAVA 2JH6D 1G30B 1SHYA 3H7TA 4GAWA 2OUAA 4R0IA 4YESB 4ISOA 1T8LA 1VJ9U 3TPIZ 1O3DA 1QBOA 3E3TA 1HAZB 1UTPA 5G4BA 1HAXB 1DUAA 1H9LB 1H8IH 2OINA 2V3OH 1FLEE 1NY22 1F0UA 1OP0A 2SGFE 3KEEA 2H9TH 1TRNA 1K1IA 2SGEE 1NFUA 1O3GA 3MI4A 3SQHE 3TNTA 1GBMA 1QA0A 2XBYA 2PUQH 3ZYDA 1QHRB 1ETRH 5L30H 2QA9E 2Z3CA 1O2OA 4K3JA 2Z9GA 5AF9H 2AIPA 4YLUA 2JH0D 4YOGA 1SB1H 2PTNA 4XSKU 2FPZA 1QQUA 1O32A 3GOVB 3SHAH 1FXYA 1GHXH 4B1TA 2UUKB 3EA8A 4INKA 1BBRH 1ELGA 3M37A 3MH6A 1A3BH 1P3EA 4Y10E 1O30A 1XUHA 3EAJA 5JB8S 4K69A 3MO9A 2BM2A 1GJ5H 3A87A 3PMBB 3LC5A 3GY3A 2XWBI 1PQ8A 1HAYB 2XC5A 1FJSA 1WSSH 4XBBA 4BTUB 1O2MA 2Y82A 3I29A 2XNIA 2Z3DA 2VU8E 2BY7X 1JRSA 3C27B 4NSVA 1GMCG 1O2HA 2D1JA 2XW9A 1O2TA 1GJ9B 1ZGVA 2NU1E 3A85A 1V2UT 4JCNA 3RXBA 3P8GA 4BXSA 4CH2B 1UTKA 1EJAA 1HXFH 4X8TH 1AHTH 2BX4A 3VGCC 5B6OA 1N8OC 1UJ1A 2ASUB 5E0JA 3S9AA 1ESAA 1O2ZA 2V3HH 3GCOA 1C1TA 3R0FA 3E0NB 2ZDKA 3ZZBA 1ARBA 3SU3A 1Y5BT 5K7RA 1DWEH 5F6MA 1O3BA 2G81E 2ZFSA 3RM2H 1ESTA 1HAPH 1ZOMA 2W3IA 3STIA 2SGPE 4IMZA 3RMOH 1SGIB 3RDZA 2LPRA 4ESTE 2J94A 3T29A 3ENSB 3I78A 1UTMA 3SNCA 1W10U 3O8DA 1DWBH 1ZJKA 3R3GB 4XBDA 2Z3EA 4IS5A 2LNCA 3LC3A 4F49A 3SUGA 1LTOA 1GVLA 2IPHA 4OS7A 5DKMA 1EAXA 1NFYA 1SGFA 1GI0A 1AVXA 2VJ1A 4KP0A 4JZIA 1DXPA 1O2XA 1CHGA 1QB6A 1CT2E 1HXEH 2BD9A 1NFWA 1TA2A 1P3CA 4HFPB 1GVZA 1K1PA 1V2OT 2P93A 1N1LA 2ZF0H 4ZXYH 3F9EA 4OGXA 4A1XA 1C5QA 3PO1B 5JPMH 1FAXA 1LCYA 1BOQA 3RXCA 3SO3A 4AYYB 1MMJN 1DSTA 5EGMA 2HLCA 2FMJA 1SLWB 1ZTKA 1GBEA 5DP5A 2SGQE 5AVDA 1SL3A 1MU6B 1J14A 2ODQA 1C5WB 2VH6A 4JZDH 5A8ZA 4WMDA 3V13A 3SV9A 2VIPA 3T25A 3PTBA 3P95A 3JZ1B 1YYY1 1ID5H 1UCYK 3KHVA 1NN6A 4DIIH 1IQNA 5F03A 1BDAA 3RXPA 4DJZB 2A1DB 3VB7A 2VIQA 4TWYA 2BB4A 2V0BA 1OKXA 3BTTE 3S69A 1ZMJA 2GCHG 1OXGA 1BQYA 1OYTH 4WH6A 4BANB 1P2QA 1O3JA 3SI3H 5GCHG 2Z9KA 4K1TA 1BB0B 1EUFA 3FAOA 1AN1E 2I6SA 1GBJA 5EOKA 1AKSA 1QL7A 5LPEA 3O8BA 3H7OA 1ELEE 1C2HA 1H1BA 3Q76A 1Z8JB 4ZUHA 1INCA 3A7WA 4FU8A 3TITA 5A09A 1J17T 3EDXB 5EQQA 2Q6DA 4WWYA 1P2JA 4ZAEA 1TGCA 2VNTA 3KQBA 4B71A 2GTBA 4I8KA 1C4V2 1BRUP 4O97A 1GHBG 4J2YB 2VVCA 1MQ6A 5F8XA 2BLWA 1C9TA 6GCHF 1TRMA 3SNBA 2AERH 1THRH 5I46H 3TJNA 1ANDA 1EATA 2A2XH 5BRRE 5JBAS 3SJ8A 1GMCF 3SJIA 1WU1A 5E8EH 2C8XB 2FP7B 2FLBH 3BEIB 3NZIA 2ZECA 1XXDA 2J9NA 3MO6A 4BXWA 4JYUH 1DWCH 1CGJE 1DXWA 4CRDA 1UVPA 3E90B 3VXEH 1ZR0A 3DFJA 4JK5A 4X8VH 3UFAA 1AB9B 4JYVH 4X2WA 1AB9C 1TNIA 2A32A 4WXVA 1GI6A 1F0RA 1D6RA 3KIDU 1O38A 3I77A 3ATKA 1EB1H 1IQKA 3WY8A 4TWWA 3AW0A 1GPZA 4I33A 5JDUB 7GCHF 1GBTA 2BDAA 1ABIH 1HIAA 4FUJA 1TBRH 1E37B 3D23A 2FYQA 3TIUA 1EKBB 3ZVAA 1Y3YA 3UNQA 2ANKH 1AUJA 1O31A 3F9HA 4UD9H 1E36B 1O3IA 3M5NA 1AMHA 3BTME 3KN2A 4OS5A 1CBWB 1W8BH 2F9VA 1FAKH 1UO6A 1YCPK 3C1KA 2BD2A 2HNTF 1CBWC 1SOTA 5GPIB 1TA6A 1DDJA 3AAUA 3FP8E 3A8DA 3QZRA 2G5NA 1ZTLA 2SGAA 4MNVA 1EX3A 2ZHFH 2ZDVH 1IQJA 1P11E 3M5OA 3ELAH 3SV7A 2A31A 2OBOA 2HPQH 1PYTD 3RXUA 2ZGCA 3UIRA 2BD8A 2G8TA 5DP9A 3K6ZA 1A3EH 2A2QH 2ANYA 2ILNA 3ATWA 1TB6H 1RTLA 2ZCLP 3SJKA 2XBXA 1P05A 1BTWA 3RMLH 2FS8A 2ZDAH 4Y8XA 1RXPA 1O2PA 5EPYA 1C1NA 2VWNA 1MKWH 2ZFTA 1QL8A 3Q00A 3RXMA 3UREA 1PPBH 1Y3XA 2FI5E 2GZ7A 2Y5HA 2R2MB 5FX6A 4ZROA 2UUJB 3BG4B 1SGDE 1MD7A 1VZQH 2VWOA 1Y5AT 1OWHA 2I6QA 3BG4C 3ZVBA 3MWIU 3ZZ6A 1O3OA 3ZZ7A 1A46H 2GCHF 1Z8RA 4JYTA 5FPSA 1TPAE 1QIXB 2W7UA 3V7TA 1K22H 1SSXA 1EAUA 2BDBA 5AFYH 3RC5A 2QXHA 5FHTA 4WVPE 3E8LA 5GCHF 4ZKSU 1XUFA 3GDVA 4ABBA 5HGGA 1V2TT 4I8GA 1O37A 3RC6A 3D65E 3TNSA 2QF3A 1UTOA 1ETSH 3UY9A 4IC6A 2QC2A 1E34B 5GDSH 3DUXH 2P8OB 2FX6A 4MPXA 1LVOA 2OQ5A 1D4PB 2P8OC 1ANCA 1T4VH 2NU4E 1T8MA 1TX7A 5DP7A 5LH8A 1PPFE 4YT7H 4M7GA 1MQ5A 1LVMA 1YLDA 4BAKB 4NWKA 1ELCA 1GHBF 1XUIA 1PQ7A 2QIQA 1EZQA 3MYWA 4GSOA 4KELA 4AOQA 1P03A 3SQEE 2OXSA 2XXLA 1VITH 2QXIA 3LOXA 2R0LA 3TVJB 4INLA 1RFNA 4PROA 2ZC9H 2HNTC 1BCUH 3QGJA 1MKXK 4Q7YA 3RMNH 2FOMB 1P01A 1S81A 4NFEA 2OC0A 1CA0B 6CHAB 1C2EA 3SU6A 1DY8A 1GJDB 1ZHRA 1HB0B 1CA0C 1FY1A 6CHAC 4B2AA 1MTNC 1JOUB 4KTUA 1KDQB 3HKIB 1FMGA 2A5AA 7LPRA 3OTJE 3OY6U 1ZRBA 4I7YH 3LGTA 1F0SA 5E2PA 3TH3H 1QR3E 1UHBB 1BMMH 3HPTB 1HYLA 1K21H 2YOLA 1GBHA 1SLUB 4ISLA 4XBCA 1W7XH 2ZKSA 2FEQH 2QF0A 1TNGA 5EPNA 2A0QB 1AE8H 5FPYA 1ELTA 1P02A 1QL9A 2FOCA 4A1VA 3ZZ3A 1GBDA 1G3EA 1IQFA 1AE5A 4Q80A 4RKJB 3GYMA 1S6HA 2XTTB 2HGTH 2BTCE 1Z6EA 3ZVCA 4AFZA 1TALA 1D3DB 2STAE 7ESTE 2BXUH 4AYVB 3KCGH 1V2WT 1B0FA 1ELVA 2BD5A 1SVPA 5HXFA 2B0FA 4NZQA 1GBLA 1TNLA 4MPWA 1K9OE 1O3LA 1UVOA 1RJXB 2Y80A 1QCPA 1W3CA 2PUXB 1C9PA 5C5NA 1TGBA 1YPHC 4DURA 4FU7A 2VVUA 1Z6JH 1AKSB 4CREA 3GCTG 1PJPA 1G3BA 4CRCA 2PV9B 4ZMAH 3NWUA 3KGPA 1QTFA 2HPPH 2ANWA 3UQOA 2QN5T 2A7HA 1FN8A 1GGDC 1YPJH 1KXEA 4UONA 3QGNB 1ESBA 2PFEA 3KQDA 3NPSA 1M9UA 4JK6A 4ISIH 3VB5A 1L4DA 5DPAA 3T2NA 1KTTB 4AG2A 2SNVA 1CU1A 1QRZA 1GBAA 2D26C