1V2MT

Benzamidine in complex with bovine trypsin variant x(triple.glu)bt.a1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Understanding protein-ligand interactions: the price of protein flexibility
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2mT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2mT02
2GGVB 2FTLE 1NFUA 1Q31A 1P06A 1ELBA 3ATKA 4K2YA 2ZU4A 1HAZB 2QC2A 3TIUA 1A4WH 1C2MA 3U1JB 2H6MA 2Z7FE 4BXSA 3ODDA 2ZHEH 2UWLA 2A2XH 3KN2A 2ZKSA 3GY5A 3L3TA 1CU1A 3LC5A 2PUXB 1KLIH 1B7XB 2OLGA 1TRYA 4ABGA 3GDUA 1P3EA 1EAUA 1LPZB 3RXPA 8KME2 1EOLA 4WJG2 3KHVA 5L6NH 1OWEA 2TRMA 2FO9A 3MU5A 2AIPA 3T28A 5C1UA 4H42U 2G81E 1FMGA 2UUKB 5FBEA 3M3SA 1A61H 1G3BA 1H4WA 5DK1A 4Y8YA 4X6MA 4BTTB 1E36B 2AMQA 3A8BA 5DP5A 4ZKSU 5PTPA 3TGIE 3SU5A 4FU8A 2ZEBA 4WF8A 1N1LA 3SGBE 2PSYA 3LGVA 1BHXB 2LPRA 1EPTA 2FPZA 4I33A 1ZYOA 1DXWA 2OUAA 4XE4A 2ZHDA 1DE7H 4BANB 1L0ZA 4BAHB 1GBHA 4Y8XA 1C5WB 1DS2E 1K28D 1Z8IB 2FX4A 3F9EA 1XMNB 3AAVA 3GDVA 3A7YA 4CHAC 1SGCA 4X1PU 7GCHF 1C5PA 2ZHQH 2PV9B 1LHCH 5DP8A 1O3GA 3GCTF 2HWLB 1SLUB 2CJIA 4WXIA 3RXGA 1O2RA 1FI8A 1O5EH 1SMFE 1YP9A 1N6XA 3BG4B 1GBKA 3D65E 1Z8JB 4X6OA 2BDAA 3Q00A 1SGQE 2V3HH 1YLCA 4GHQA 3UQOA 2FS9A 4X6NA 4X1SU 2TBSA 4WXVA 4I32A 4U2WA 3K6YA 3OY5U 1EP6A 2GD4B 1SFQB 1J14A 1MBQA 4MPWA 2AH4X 2Y81A 1FIWA 3A86A 1QB6A 1SGFG 1THSH 1NFWA 3STJA 1Y5BT 1L1NA 1DUEA 4UDWH 2DUCA 4NSVA 1LMWB 1KXCA 1T8OA 2GCHF 1O3MA 1O3BA 1Y3VA 2A4QA 3LIWA 3UIRA 1F5LA 1T31A 1UTNA 2H1UA 3S7HB 3SV6A 3A81A 5G4BA 3T5FH 1P02A 3SI3H 2M5TA 5C5OA 3MNSA 2CHAB 2ZQ2A 1NY22 5K7RA 1O35A 1ORFA 4JK6A 2SFAA 3K65B 1ZZZA 2ALVA 4IC6A 5F8TA 2A2QH 1C5XB 4E7NA 3K9XB 2H2ZA 3RC5A 1TBZH 2BD9A 5HYOA 1WQSA 2CV3A 3ZZ4A 5EXLA 1MAYA 2ZFFH 3I78A 3PMJA 5A0BA 3VB3A 9LPRA 2ZHFH 2ZFRH 3RU4E 4D7GA 1H9IE 3MU1A 1AUJA 3SI4H 4CR9A 2NWNA 1O2TA 3I29A 1NU7B 3FP7E 5GCHF 3CS7A 2A1DB 2Y82A 2FZZA 1MTSA 3TGJE 1TNLA 1IQHA 1DM4B 4JCNA 2PKAB 4Y0ZE 1CSOE 1AI8H 1SVPA 1SGNE 1SBWA 2TGTA 3KQDA 4AYYB 2B0FA 1BTZA 2ZFTA 2IPHA 3C1KA 4JZDH 2GZ8A 1HJ9A 1GVLA 1HXEH 1HAXB 2BLWA 1S0RA 2OD3B 1QJ7B 4HFPB 1O34A 1P57B 1ZGVA 1AUTC 1HRTH 3M35A 4GCHF 3CENA 3M7UA 2RG3A 3SOSA 1RTLA 1GJ8B 5J4SA 1WAYB 2W5EA 3SUFA 2W3KA 3QWCH 2PR3A 2C8XB 1D3TB 5JPMH 4U30A 1DLEA 2BQ7B 4K1TA 2I6QA 4ABBA 3UR6A 1MKWH 1E37B 2GV6A 4ESTE 1TGNA 3WY8A 1VGCC 2BMGB 1KTTB 5C5NA 1AGJA 1A7SA 1P2OA 1QFKH 1XUFA 4GAWA 1LVYA 1J16A 1Z8GA 1GI4A 1NRRH 4IGDA 4R0IA 2FP7B 1LHDH 2RDLA 1LO6A 1O2XA 5GWZA 1DOJA 4U01A 4A1VA 1BBRH 5AVDA 1MZDA 2SNVA 1A3EH 2XRCA 4DW2U 1DUAA 1ANBA 3UQVA 1SR5C 2VWNA 5A0AE 4NA9H 2PTNA 1RIWB 2FOAA 1CGIE 3ZZCA 3SORA 3GYLB 4KTCA 1JBUH 2BY8X 2FTMA 1XUIA 1FUJA 1OOKB 3A7XA 1BOQA 1O2ZA 3U8OH 1GG6B 1C1RA 1C5TA 2VIPA 4AFQA 1JIMA 4HTCH 1KY9A 2Q6DA 4DY7B 5BRRE 1LKBA 1XM1A 3SHCH 3EGKH 1P2MA 3A8CA 1BTYA 2BZAA 5LGOA 1GVZA 2Z9JA 4YOIA 3EQ0H 3ODFA 4GPGA 4TY6A 4ZKNU 3RXIA 4ZHLU 1FY3A 5TCAA 1LQDB 3DHKH 1UTOA 3TLOA 2F9VA 1V2PT 1SGFA 4MG3A 2XXLA 1OYTH 1HIAB 5GJ4B 3RMOH 5ESTE 3DA9B 1D3DB 2C3SA 1QB1A 4NSYA 3ZZ5A 3ZVAA 1CT0E 1E0FD 4ISLA 2ZFSA 1MD8A 1O2OA 2AYWA 1BITA 5HM2A 1S81A 1MTNC 2QIQA 3O8BA 1PFXC 2OP9A 2Y80A 5C1YA 2Y7XA 1M9UA 3I77A 2P94A 3LU9B 3PM3A 3AAUA 2A5KA 5HMAA 1FIZA 4WVPE 4E05H 3TVJB 3HKIB 3PV4A 1C1OA 1C2FA 1O36A 1GJBB 1DICA 1QL9A 4TPYA 5F6MA 3B23B 2ZDLA 1BTHH 3QGJA 3UFAA 2QAAA 1XKAC 3QUMP 3RXKA 5JB8S 2BYAX 4B2BA 4E06H 3LC3A 1NPMA 2XW9A 1ELDE 2ZGCA 5IDKA 4IMQA 1T8LA 2Y6TA 1MH0A 1ELGA 2PTCE 4B71A 1AU8A 1SLWB 4O3TA 3VFEA 1IQNA 3MTYA 2QXGA 4Y8ZA 1K1PA 1Z6EA 1DSTA 1AMHA 1P01A 4B2AA 3TNTA 2V6NA 1GJ7B 2ZTYA 1XXFA 1D6RA 1DWBH 1ESTA 3H5CB 1D3QB 3VB6A 4AFZA 2AMDA 1TYNA 1O2GH 1GVKB 1O30A 1NRNH 1UK3A 1XUKA 1AN1E 2EEKA 2FI3E 4ZAEA 3A89A 2QV1A 3EA9A 1MTWA 4THNH 3VPKA 1ELCA 2HOBA 2B8OH 4O03A 4CRAA 1ZPZA 4FUCA 3F1SB 1HAHH 1TNIA 4MVNA 4AORA 2HGTH 3B9FH 2BX3A 2ZU2A 3JZ2B 1AKSB 3T25A 1O2NA 4ISIH 2ZHWH 3A83A 3BTTE 4I8HA 4XBDA 1IQFA 4YT7H 2P8OC 2BM2A 3M5OA 3S9BA 2FYRA 4RN6A 2ZU3A 1C1SA 1AVGH 2FOGA 1DPOA 1ZGIA 3V12A 3M5NA 3SV2H 3IWMA 2ASUB 2FMJA 1EB2A 2VGCB 2ZU5A 3SJOA 1EZQA 4XDEA 1FAKH 5LH8A 2BZ6H 1K22H 1C2KA 1FJSA 1P0SH 2V0BA 1O5CB 2O8WA 3DFLA 2UUYA 1GMCF 3ZZ3A 2VIQA 3ATLA 1BMMH 3OTJE 4SGBE 3LT3A 2A5IA 5JYIA 1SGPE 1NZQH 4NA8A 1A0LA 3QZRA 4WY3A 2Z3DA 2ZDAH 1EP5A 4CREA 2H9TH 3E16B 2VU8E 1V2VT 2BOKA 3UPEA 1O2SA 4FVDA 1EXFA 3E0PB 2J95A 1DY9A 1YCPM 1PPGE 1CA0C 4B76A 1UK4A 1V2WT 1A0JA 1BTUA 1H1BA 4AG2A 2NU3E 1GI8B 1ZSJA 2P93A 2ZDNA 1OPHB 2C93B 2G4TA 3VB5A 1KXBA 2OINA 4YLQH 1NRSH 3HK6B 1VCQA 1GBCA 3O8CA 3Q3YA 1UO6A 2JH5D 1QBNA 3RXDA 1EQ9A 1KDQB 3TJVA 3UNQA 1CQQA 4AB9A 5JBTA 1F92A 2AGGX 1PQAA 1ZTJA 2TIOA 1OWIA 1O39A 4ZKOU 4CR5A 5AFYH 1DANH 4K1SA 2VB0A 3S9CA 1ZJDA 3PLPA 2R2MB 5E0HA 3SQEE 3TK5A 1YF4A 2RA0A 4AZ2B 1F0RA 3TH3H 4DT7B 3B8JA 1GBDA 1MCTA 1N8OC 3U9AH 2A4OA 3P70B 1DX5M 1O38A 5FX5A 1SGRE 2A45B 1C1PA 2XCFA 3Q76A 2D8WA 3RMNH 2TGDA 1QQ4A 1ZMJA 2A0QB 3ATWA 1S84A 4DURA 2ZFQH 4UFGH 2Y5FA 1BRUP 1EX3A 2QGRA 2PKSB 1ZRKA 2GMTB 3SGAE 1DDJA 1O3IA 3GCHB 1GI1A 1TFXA 4FXGH 2VWOA 3ATIA 1VITG 1AB9C 2NU4E 1O2WA 2ZGXH 1B0EA 3BTQE 3PLKA 6CHAB 5LPFA 1YBWA 1Z8RA 2AERH 2OQ5A 2W26A 2P16A 3VGCC 5TJXA 3VB4A 3V13A 2GZ9A 2H5DA 1QRXA 5DPAA 4MQAA 4IBLH 3ZZ6A 3A7WA 5CHAC 1GJ9B 3MI4A 1SGEE 1SOTA 2W7SA 5EW1H 1PYTC 3A88A 3UY9A 2O8LA 1K1IA 2GCTB 1V2NT 1PPCE 1Z6JH 1AHTH 1C2GA 1F0UA 2RA3A 5T6FA 1C2HA 1EKBB 1WYKA 2P3UB 2VH0A 5T3HA 4A1XA 1S6HA 4D76A 3STIA 3FFGA 1V2KT 1BTWA 2A7HA 1HUTH 1WQVH 1O2IA 4Y11E 3MH5A 2VIWA 1OP2A 3V3MA 1ZPCA 2BXTH 2A7CA 3MU0A 3ZVDA 2ZPSA 1O2VA 4YZUA 3HKJB 1TLDA 1QJ1B 4OS6A 3ZVGA 4O97A 2G00A 1WBGB 3SN8A 1MTUA 1TA2A 1GL1A 1TNGA 1HBTH 4CRFA 1H8IH 1HYLA 5A8XA 1O3LA 2OCVB 1O32A 2ZF0H 3ZZAA 2FEQH 1AQ7A 3KQBA 4B1TA 1G9IE 1QL7A 5C20A 1THRH 3BTDE 1ID5H 4MPXA 2F9BH 1MU8B 1ZRBA 1V2QT 4FUJA 1BMAA 1DT2A 4X8TH 4YM9A 1IQGA 4LXBH 3QX5H 4AGKA 1IQKA 3T62A 4Y10E 1XX9A 4FUDA 1AFQC 3EDXB 3M5MA 1GCTC 3ENSB 2XBXA 3V7TA 4UFDH 1O31A 2FDAA 3BG8A 1KTSB 1NN6A 1MZAA 1UVOA 1KIGH 3K2UA 4GUXA 5LPRA 3RXRA 1ARCA 4I8JA 2XBYA 4Q80A 2BQ6B 2QY0B 1YM0A 2VIOA 1WCZA 2Y5HA 1EPTC 1QQUA 3LPRA 1WU1A 1QCPA 1O5DH 3MHWU 3RDZA 3TK6A 1C5MD 1P12E 2THFB 7GCHG 3HATH 1OKXA 3BTME 1TQ0B 1SQAA 3VXFH 2QXIA 1OX1A 3GCTG 1P9SA 1AFEH 1EAIA 1C5QA 2JETB 3KQEA 3NCLA 1C5OH 3TK9A 3E3TA 3U8TH 1SB1H 2Z9IA 3EA7A 2ZIQH 3LONA 1OXGA 1VJAU 3W94A 1KXDA 3H7TA 4BAOB 3S69A 2R9PA 4LZ1H 3URCA 1TX6A 1GI7B 3NWUA 5DP4A 4Z0KA 1Z1JA 3SV7A 1CHOF 2LNCA 1UVTH 3M3VA 1SFIA 4K8BA 1FY5A 1FNIA 1MCVA 4FUBA 1IQMA 2F9OA 5FPYA 2BDGA 1IHTH 1P9UA 1QTFA 1YPJH 3A7TA 3E91A 2Z6BD 1FY1A 1YKTA 3DUXH 1GGDB 2XNIA 1ZHPA 2F9UA 2H9HA 1LVOA 3PROA 2A5AA 4MNVA 1KLJH 1E38B 3BTGE 4ZUHA 1TALA 1RRKA 4YESB 1V2OT 3QN7A 3QTVH 2AFQB 2HPPH 2KAIB 3NK8A 3BEIB 1Y5AT 1T8MA 3FZZA 1W12U 1A5IA 2IOTA 3S9AA 3BF6H 5E0JA 1MUEB 2XCNA 1TMTH 5EGMA 3RUOA 4RKJB 1BRBE 1QB9A 1ELTA 3P8GA 1JXPA 3OY6U 1Y3YA 2EC9H 3PO1B 3UNRA 3S7KB 3SU4A 2C8YB 3LJOA 4U32A 2QCYA 3PWCA 2BVSH 4XSKU 1GHBG 1S85A 2ALPA 2FOBA 2TPIZ 1O2HA 1RTFB 4I8GA 3ZVCA 1CA8B 4ABFA 3LH1A 1Y3XA 4INHA 1X7AC 1BRAA 3Q3XA 4AYVB 2WINI 5GPIB 3SNCA 5AF9H 2BD7A 1D9IA 3GCOA 1BUIA 1W14U 4WH6A 4ZXYH 4A1TA 4ABEA 1V2ST 1K1OA 1RS0A 1HAIH 1TRNA 3HGNA 2Z9GA 1Z1IA 1GBLA 4BAKB 2R3YA 1DFPA 1QRZA 3RXEA 3SJIA 1AE8H 1A5HA 3SU2A 5HM9A 1ZHMA 2CF9H 1L1JA 2VWLA 1OWHA 3ELAH 3PMBB 2FOEA 3RU4D 1HJAB 4TPIZ 1G32B 2OBQA 4D9RA 2ODQA 5A2MH 1SGTA 1TONA 3D49H 4NZQA 4GCHG 3SGQE 2ANYA 1HAYB 5EXMA 3T29A 1O3KA 3LGIA 1TAWA 2QF0A 1C5RA 3N7OA 1K1MA 1W11U 3M5LA 2O9QA 1ANCA 3F6UH 3T27A 3TITA 1IQJA 1EZUC 4IC5A 1EATA 4UONA 1CBWC 4AOQA 2HNTE 1AWHB 4HGCA 1EB1H 4D9QA 3P8OA 1TGBA 2BY7X 3MWIU 3BTFE 2WV4A 1XXDA 2SGPE 3UREA 5C3NA 4K60A 2NU2E 3F9HA 1TPAE 2FLBH 4RSPA 5EOKA 4INLA 1NTPA 1QL8A 3SNDA 4KELA 1UTKA 3EYDA 1JIRA 1RXPA 3ATMA 1O2MA 4RKOB 1HFDA 2SGAA 4OS1A 4DVAU 5FAHA 1KLTA 1HCGA 1MTVA 1CO7E 1W2KH 1A2CH 1C2IA 2HALA 2CGAA 9ESTA 1GI3A 2P3FH 1J8AA 1O2YA 5ABWA 1SLXB 2WV5A 3TJOA 3RXUA 3G01A 1GBBA 1SHHB 2XC0A 4KTSA 3L33A 2P3TB 1NM6A 1UTPA 5GDSH 1A5GH 1NFYA 2ZG0H 2A31A 3TH2H 1G30B 3TJNA 1V2JT 1S83A 3DT0H 4OGYA 4B74A 3M7QA 4X2XA 3SJ9A 1B5GH 1TQ7B 2A32A 2V35A 2PGQB 1JWTA 2F3CE 2QA9E 4FU9A 3E1XB 4VGCC 1QA7A 2STBE 2VVVA 2HNTC 3SJKA 4AN7A 3P8FA 3QDZB 2CMYA 5FPTA 2BY5X 4BTUB 3OX7U 2GT8A 3UTUH 2FOHA 2BVXH 1T32A 5FHTA 3L6PA 1V2MT 1NO9H 1LQEA 1ABIH 4JZIA 1NRPH 2ZI2H 1G36A 1W3CA 2G8TA 1E34B 1ZR0A 1MMJN 1VCPA 4Y79A 1QIXB 1LPKB 1UTQA 4HZHA 3MOCA 2WPJS 1HXFH 2QYIA 2Z9KA 4NWKA 4CHAB 2PLXA 1ETTH 2ZDKA 3KCGH 1GI5A 4CRCA 1THPB 1LVBA 4X1NU 1ELVA 1TA6A 2BLOA 1F2SE 3BV9B 4E7RG 1T7CA 3ZZ9A 5B6OA 1C1WH 2UUJB 3T2NA 4KP0A 3SU3A 1P09A 1IOEA 1ELAA 1G2LA 2IJOB 2UWOA 1BJUA 4Y7AA 5EPNA 1C1UH 3M36A 2HRVA 3SV9A 4Z6AH 4H6TA 2ODYB 3GISB 2SGQE 1IQLA 2ANKH 2ANWA 3KL6A 1SQTA 1TBQH 3ITIA 2A7JA 1O3OA 2HVXA 4BOHA 4X8VH 1LDTT 5DKMA 4ZH8A 2BQWB 2OC1A 3RMLH 2VJ1A 4AB8A 5DGJA 1HGTH 1Q3XA 1L4ZA 3LDXH 2O8UA 1JMOH 2XC5A 2J4IA 4UFEH 1O3FA 3RXBA 1DY8A 1EAXA 1YYY1 2Q6FA 4MDSA 1N6YA 2PW8H 5FCKA 1ABJH 4AFSA 1BJVA 3O8RA 1PJPA 4H4FA 5DJ7A 1K9OE 4YOGA 3P95A 2TGAA 3RXCA 2FOFA 3NKKA 4NFEA 4M7GA 1SG8B 3BSQA 1P05A 1VCWA 4X8UH 4BNRA 4JK5A 1HAGE 4KKDA 2VIVA 1JRSA 1YPMH 1YCPK 3LJJA 6GCHF 3PYHA 1GL0E 1FQ3A 7LPRA 2R3UA 4XBBA 2B5TB 1VR1H 2GX4A 4JYVH 2BDCA 1PPZA 2FI4E 8ESTE 5DO4H 1K1JA 1KYNA 1PPHE 3BG4C 4NZLA 5L2YH 2BD3A 1O5AB 1VJ9U 2FYQA 2P95A 3QLPH 3TJUA 2C90B 2G52A 3HPTB 2BB4A 1GMHG 1TRMA 1AY6H 1MQ6A 1YPLH 3SV8A 5J4QA 2DE9A 3LGUA 1BCUH 1H8DH 3FANA 4X8SH 5BPEA 2ZCKP 2G5VA 1LHGH 3KGPA 1BB0B 1C5UA 2C8ZB 3NUMA 5GXPA 1YPGH 3KNXA 1J17T 1P11E 3CP7A 3LGYA 2ULLA 4B75A 1SHYA 1G3EA 1SGYE 3F9FA 2J92A 1GMCG 3MO9A 1WSSH 4AG1A 2JH6D 4OS2A 1GI0A 1GMDG 1HAVB 2AS9A 3AASA 3ZVBA 1UMAH 1TBRH 1WTHD 3ZYDA 1IHSH 2BTCE 1UTLM 2BD5A 2ZQ1A 1MKXK 2CHAC 1O3CA 2XC4A 5A09A 4K69A 1TNJA 4ZKRU 2PKAA 1LTOA 2ZDMA 1P2KA 3BIVH 1UTJA 1PPEE 1TABE 1FN8A 2FM2A 5AHGH 2BDBA 5L2ZH 3ZYEA 3A82A 1VGCB 5HGGA 3QGNB 1E35B 1W13U 3BTKE 1SQOA 1C5SA 1FONA 3A87A 2F9NA 3P17H 4I8LA 4CBOA 1DLKB 1IAUA 1TMBH 7ESTE 3RM0H 1UCYE 1H9HE 1JOUB 2HPQH 3K6ZA 3UR9A 2O8TA 1C5NH 1J9CH 4ABAA 1LHFH 4ASHA 3A84A 1IQIA 1UCYK 3ZZBA 1FY8E 2G5NA 3PLBA 1QHRB 3P6ZB 1GDQA 4ZHMU 1TGTA 3E90B 3PB1E 3SHAH 3OYPA 1W10U 1GHAF 4YOJA 1HDTH 2CXVA 3PMAB 2ZDVH 1GHYH 2AGIX 1TIOA 4JYUH 3RXFA 2OC7A 2BVRH 2P59A 3ZVEA 2HLCA 1DXPA 4GSOA 3MNBA 1A46H 1W7XH 4ZXXH 2XWBI 8GCHG 1W7GH 2NU1E 1Q2WA 1WOFA 1D6WA 1GHZA 2WYGA 3PMHB 2BLVA 8LPRA 5JB9S 1AWFH 1TPPA 4ABJA 1U6QA 1MTNB 4FUGA 3MH6A 4IW4E 3GY8A 4KTUA 3EE0B 1AD8H 2OC8A 4FVBA 4Q7ZA 1FY4A 4NIYA 1Y5UT 6ESTA 1UVSH 4HI3A 5E2OA 3P8NA 1C5VA 4I8KA 1RIWC 4H6SB 4PROA 2A4RA 1O37A 1TGCA 1BDAA 1F0TA 3M7TA 1HIAA 1QNJA 2EI6A 1TPSA 3NXPA 4Y0YE 1OP8A 3HGPA 3M3TA 2ILNA 1GG6C 3A8AA 5EQSA 1XKBC 1P10A 1TE0A 3V0XA 3GY3A 2PUQH 1VZQH 3T26A 3ZV9A 3RC6A 2FS8A 2BDIA 4NCYA 4R8TB 1C4V2 1GI9B 2Q1JA 4JYTA 1L4DA 4JZ1A 7KMEH 2ANMH 3QK1A 1OWJA 4X1QU 4CH8B 4NFFA 3SUDA 1F0SA 2QN5T 3BTEE 4K1EA 1L1GA 3MO6A 1O2PA 5AFZH 5ETXA 1GJ5H 1SSXA 2OTVA 2EI8A 5CE1A 3GICB 1C2DA 1GBFA 4X2WA 1FDPA 1AVWA 5T6DA 5A8YA 1GBIA 2YOLA 1RFNA 1NU9A 3NZIA 3SBKA 5JDUB 3S0NA 1C5YB 1QJ6B 3UOUA 1T4VH 2FIRH 4UEHH 1QA0A 3AW0A 3NPSA 1FPCH 1WTGH 3RXMA 1SOZA 4WMDA 1GDNA 2QXHA 3SO3A 2J38A 2H9EH 1GI6A 2AEIH 3MU4A 2BHGA 1ETRH 1NRQH 1GBAA 5L30H 1HAOH 1A1RA 4YO9A 4JZEH 2WPKS 4A5TS 2PFEA 5E2PA 3BIUH 1NT1A 2C8WB 2EA3A 1ZHRA 1W0ZU 1AIXH 1TX8A 1LCYA 4TWWA 2WUCA 2P8OB 1FN6A 4OS7A 5A8ZA 4K8YA 5C67A 1P2IA 1FPHH 2OQUA 2AGEX 1UHBB 1XVMA 1P2JA 2Z94A 5EU8A 4A7IB 2HNTF 1SPJA 3VXEH 5EW2H 3RXOA 2G55A 1O2UA 3SNBA 4YTAA 1O2KA 4CRGA 4F4OC 4X2YA 1QGFA 1GPZA 2FODA 1YLDA 3R3GB 3U98H 4XOJA 5FXLA 1OYQA 2PHBA 3TGKE 1BMNH 5C2ZA 3RLYH 4ABDA 1BIOA 1AKSA 4K5ZA 1O2LA 3Q77A 4NWLA 5E8EH 1O3NA 2UUFB 3RXHA 2ZGHA 1QR3E 2J9NA 3RXAA 1Y8TA 3SU0A 2ZTXA 2ZTZA 4DGJA 1DVAH 1YCPH 1AZZA 4B73A 2OBOA 2R2WU 4FUIA 1INCA 1CHOG 2G51A 2AIQA 2BDYA 1QRWA 2F83A 3M61U 1ZTLA 2GCHG 1YC0A 1O3HA 2V3OH 1UVPA 3TH4H 1CA0B 1EUFA 2ZPRA 1GHVH 3D62A 1O3EA 1C1MA 1GBTA 1Z71A 5JBAS 1RD3B 1A0HB 1SL3A 5EQQA 4CRDA 4I31A 1F7ZA 3Q3KA 1GBMA 1TPOA 1BHXF 2Z3EA 5DP6A 3EAJA 3UUZA 4NIWA 3LKWA 3SJ8A 2VGCC 4UD9H 1TB6H 3FVFB 1GWAA 1ZSLA 2ZZUH 1PQ7A 1GHBF 1EJAA 1TWXB 1V2LT 2ZECA 1HAVA 2VINA 3RXLA 1EZXC 1DWCH 1C9PA 3QO6A 3E0NB 1G3CA 1C2EA 4O9VA 3P92A 2ZP0H 3FP8E 1N8OB 1PQ5A 5GCHG 2XWAA 1GHWH 5F03A 1FXYA 4CH2B 5FCRA 3UNSA 1TOCB 1C4Y2 1WUNH 3GOVB 1Y3UA 2VVCA 4Y76A 1T4UH 1KDQA 4J1YA 1D3PB 1MKXH 4D8NA 1GJAB 4IN2A 1V2UT 3U69H 4AX9H 3EA8A 1BMLA 4JMYA 2VH6A 1ZTKA 1AB9B 5LPEA 4DIIH 4NIXA 1AZ8A 1CT2E 3DD2H 5EG4A 1KXEA 1TMUH 4ISOA 5DG6A 3MFJA 1GJCB 3FAOA 2B7DH 1C1VH 1RTKA 3VGCB 2UWPA 4AGJA 3A7VA 3UWJH 2GTBA 3ZZ8A 1ARBA 5CHAB 1RJXB 1DWDH 2ZA5A 1ZJKA 2G4UA 2PSXA 1OP0A 2W7UA 1P2QA 2Z9LA 3GYMA 5DP7A 3RXJA 4DG4A 3RP2A 4Q2KA 3GY2A 4Q7XA 2GVFA 1MU6B 3GY4A 3A8DA 2BXUH 3D23A 1EJNA 2D1JA 3RLWH 6LPRA 1C1NA 3MU8A 1YPKH 1ANEA 2ESTE 1BA8B 4BAQB 1UCYH 1PQ8A 5C1XA 3H7OA 4IN1A 1V2RT 4YLUA 1CVWH 1NS3A 4UE7H 3BTHE 5EODA 5JBBS 1TGSZ 3E8LA 3MMGA 1O3JA 4MNWA 3KIDU 4GHTA 5FX6A 2PKSC 2GMTC 3MYWA 3F9GA 2XBVA 4D7FA 2ZU1A 3SUEA 1CHGA 3GCHC 3LGTA 3OSYA 3M37A 1UTMA 4NIVA 1O3DA 1MD7A 1F5RA 3F68H 4IS5A 6CHAC 3QTOH 3MH4A 2Y5GA 1KSNA 1EZSC 2YNBA 2K1QA 3BEFB 1LHEH 4MNXA 1ACBE 4NGAH 3KEEA 1K21H 3LOXA 1D4PB 4MPUA 2IN2A 2FOMB 3GY6A 1ZMNA 3UWIA 1EASA 2GCTC 2VNTA 4LOYH 3PTBA 4INKA 1AFQB 2ZC9H 1QY6A 1GCTB 1SGDE 4FUEA 2DE8A 2NU0E 5H4IB 1YPHE 3IITA 3MO3A 3A85A 4ISNA 1LPGB 5F8ZA 2PGBB 5I46H 1OSSA 4Q7YA 5DP3A 3LGWA 3AVZA 4BXWA 3BN9A 3RMMH 2TGPZ 1GDUA 1P04A 1B0FA 1FV9A 1O5GH 2FESH 2FXRA 5EPYA 1QBOA 2QF3A 5DP9A 4GLYA 5FPSA 1O5FH 1HLTH 1O2JA 1ELFA 1C5LH 1EPTB 1LKAA 2Z3CA 1G3DA 1CE5A 4DOQA 1HJ8A 5ESBA 4FU7A 1ELEE 1F5KU 3BTWE 3RU4T 2R0LA 2BD2A 3OU0A 4NA7A 1C5ZB 4OGXA 4TYDA 3SZNA 4OS4A 2FOCA 1EAWA 1ZOMA 1K2I1 2J2UA 1BTPA 2J34A 3SNEA 1YGCH 2O8MA 1GJDB 1C1QA 1QURH 2Q6GA 2BDHA 1QBVH 4DCDA 1KXFA 1OS8A 1SLVB 2AMPA 2D2DA 2ZFPH 3R0FA 1WV7H 1DWEH 2GKVE 3RXQA 1P2NA 2GDDA 1XUGA 1ESAA 5GIBA 1GBJA 1GJ4H 3ESTA 2ZCLP 3RXVA 4TWYA 1FAXA 2ZGBH 1ZLRA 3JZ1B 1BRCE 4OS5A 4QT8C 2ZCHP 2SGDE 4X6PA 3RXSA 1TNHA 2R0KA 3PTNA 3RM2H 3SU6A 2D26C 1O2QA 1ZPBA 2EI7A 5A0CA 1YPHC 1S0QA 3U1IB 2SGFE 2ZPQA 1UHBA 5EXNA 2BOHB 4CRBA 2BD4A 1C9TA 3SW2B 4B2CA 2GV7A 1LVMA 1ZMLA 2A4GA 2CF8H 2GP9B 4ABIA 3O8DA 4ISHH 5FBIA 1S5SA 2H5CA 1GCDA 2STAE 1XUHA 1NC6A 1SI5H 1S82A 1SC8U 2XBWA 3A80A 4YT6H 2ZNKH 1CGHA 3A7ZA 4NG9H 1OWDA 1BZXE 2VIDA 1C2LA 1NROH 5SGAE 3FP6E 1V6DA 1VITH 6GCHG 2OC0A 1YPEH 3KQCA 4ZROA 1KXAA 1C1TA 3GDSA 1P3CA 1K1NA 2J94A 4IMZA 2F91A 4Y71A 1T8NA 5E0GA 2WPLS 2B9LA 2XTTB 2WPHS 4Y6DA 4X1RU 4JZFH 1GMHF 3E6PH 2JETC 3SNAA 1BTXA 4TY7A 3VEQB 3ZZ7A 1V2TT 2FLRH 3QZQA 4DIHH 1XUJA 1XVOA 3TU7H 1FLEE 1ETSH 5CMXH 3GY7A 5IYTA 1ANDA 1BT7A 5HXFA 2FI5E 3TNSA 2SNWA 2GDEH 2KAIA 3BEUA 4X2VA 1NESE 4DJZB 1HV7A 1RGQA 2WUBA 1PPFE 3SQHE 2I6SA 3MNXA 1UJ1A 1SGIB 2VVUA 1TX7A 4A6LA 4KGAA 3C27B 1GMDF 1O3AA 1ESBA 1NFXA 4K3JA 4MTBA 1MAXA 4UFFH 1GI2A 1HAPH 1AO5A 1GGDC 1IQEA 3SUGA 1HNEE 1K1LA 1TNKA 3HK3B 4CBNA 2SGEE 3PWBA 1JRTA 5JBCS 1O33A 1UK2A 2QXJA 4FUFA 4X0WU 3CS0A 2WYJA 1OWKA 4MLFB 3UOPA 5K0HA 1MQ5A 3VB7A 1GBEA 1HPGA 3RC4A 2VWMA 1UVUH 1PPBH 1P8VC 2ZGJA 1GJ6A 2GT7A 1G2MA 3ZVFA 1Y3WA 1MBMA 1V3XA 2YNAA 3PO1C 2BX4A 1O0DH 1CBWB 1W0YH 3MNCA 2FX6A 2W3IA 2F9PA 4LZ4B 3TPIZ 2WPIS 4LK4A 1MKWK 1CT4E 2JH0D 1AVXA 4BAMB 3LH3A 1O5BB 1C4U2 1BBRE 4A92A 4ABHA 4O3UA 1W8BH 5TCCA 4WH8A 4WWYA 4ZHAA 1CGJE 1HB0B 1BBRK 1VITF 2GZ7A 2Y7ZA 4XBCA 1J15A 3ZZDA 4AFUA 1C2JA 1GHXH 1PYTD 2ZO3H 1EOJA 2OXSA 1Y59T 4J2YB 3ZV8A 2ZWLH 1A3BH 5EQRA 2ODPA 4BTIB 2FWWA 2BY6X 1P03A 1AE5A 3FZDA 1EJMA 1H9LB 1HJAC 2PWXA 1DSUA 1FZZA 5F8XA 3IG6B 2BY9X 1GHAG 2JKHA 2RCEA 3DFJA 1Z7KA 1TOMH 4SGAE 3W95A 2BLQA 4WMEA 5T6GA 1DITH 5I25A 3KF2A 4MNYA 8GCHF 2WPMS 3URDA 3MH7A 1S6FA 1G37A 4GVUA 4VGCB 1BQYA 4Y7BA 3RXTA 1ZSKA 1L2EA 2BD8A 4FUHA 2CN0H 4I7YH 3GCNA 2XYAA 4MPVA 4XFQA 1O3PB 3SU1A 3U8RH 4ZMAH 3AW1A 4WMFA 2C4FH 4F49A
chains in the Genus database with same CATH superfamily
2GGVB 2FTLE 1NFUA 1Q31A 1P06A 1ELBA 3ATKA 4K2YA 2ZU4A 1HAZB 2QC2A 3TIUA 1A4WH 1C2MA 3U1JB 2H6MA 2Z7FE 4BXSA 3ODDA 2ZHEH 2UWLA 2A2XH 3KN2A 2ZKSA 3GY5A 3L3TA 1CU1A 3LC5A 2PUXB 1KLIH 1B7XB 2OLGA 1TRYA 4ABGA 3GDUA 1P3EA 4M9FA 1EAUA 1LPZB 3RXPA 8KME2 1EOLA 4WJG2 3KHVA 5L6NH 1OWEA 2TRMA 2FO9A 3MU5A 2AIPA 3T28A 5C1UA 4H42U 2G81E 1FMGA 2UUKB 5FBEA 3M3SA 1A61H 1G3BA 3F3BA 3MQKC 1H4WA 5DK1A 4Y8YA 4X6MA 4BTTB 1E36B 2AMQA 2YMSB 3A8BA 5DP5A 4ZKSU 5PTPA 3TGIE 3SU5A 4FU8A 2ZEBA 4WF8A 1N1LA 3SGBE 3F0OA 2PSYA 3LGVA 1BHXB 4ACAA 2LPRA 1EPTA 2FPZA 4I33A 1ZYOA 1DXWA 2OUAA 4XE4A 2ZHDA 1DE7H 4BANB 1L0ZA 4I86A 4BAHB 1GBHA 4Y8XA 1C5WB 1DS2E 1K28D 1Z8IB 2FX4A 3F9EA 1XMNB 3AAVA 3GDVA 3A7YA 4CHAC 1SGCA 4X1PU 7GCHF 1C5PA 2ZHQH 2PV9B 1LHCH 5DP8A 1O3GA 3GCTF 3W1EA 2HWLB 1SLUB 2CJIA 4WXIA 3RXGA 1O2RA 1FI8A 3OTPA 1O5EH 1UW7A 1SMFE 1YP9A 1N6XA 3BG4B 1GBKA 3D65E 1Z8JB 4X6OA 2BDAA 3Q00A 1SGQE 2V3HH 3KQ5A 1YLCA 4GHQA 3UQOA 2FS9A 2KCYA 4X6NA 4X1SU 2TBSA 4WXVA 4I32A 4U2WA 3K6YA 3OY5U 1EP6A 2GD4B 1SFQB 1J14A 1MBQA 4MPWA 5EJ1A 2AH4X 2Y81A 1FIWA 3A86A 1QB6A 1SGFG 1THSH 1NFWA 3STJA 1Y5BT 3AK5A 1L1NA 2J98A 1DUEA 4UDWH 2EY4C 2DUCA 4NSVA 1LMWB 1KXCA 1T8OA 2GCHF 1O3MA 1O3BA 1Y3VA 2A4QA 3LIWA 3UIRA 1F5LA 1T31A 1UTNA 2H1UA 3S7HB 3SV6A 3A81A 5G4BA 3T5FH 1P02A 3SI3H 2M5TA 5C5OA 3MNSA 2CHAB 2ZQ2A 1BMFD 1NY22 5K7RA 1O35A 1ORFA 4JK6A 2SFAA 3K65B 1ZZZA 2ALVA 4IC6A 5F8TA 2A2QH 1C5XB 4E7NA 3K9XB 2H2ZA 3RC5A 1TBZH 2BD9A 5HYOA 3OEHD 1WQSA 2CV3A 3ZZ4A 5EXLA 1MAYA 2ZFFH 3I78A 3PMJA 5A0BA 3VB3A 9LPRA 2ZHFH 2ZFRH 3RU4E 4D7GA 1H9IE 3MU1A 1AUJA 3SI4H 4CR9A 3DCLA 2NWNA 1O2TA 3I29A 1NU7B 3FP7E 5GCHF 3CS7A 2A1DB 2Y82A 2FZZA 1MTSA 3TGJE 1TNLA 1IQHA 3CNRA 1DM4B 4JCNA 2PKAB 4Y0ZE 1CSOE 1AI8H 1SVPA 1SGNE 1SBWA 2TGTA 3KQDA 4AYYB 2B0FA 1BTZA 2ZFTA 2IPHA 3C1KA 4JZDH 2GZ8A 1HJ9A 1GVLA 1HXEH 1HAXB 2BLWA 1S0RA 2OD3B 1QJ7B 4HFPB 1O34A 1P57B 1ZGVA 1AUTC 1HRTH 3M35A 4GCHF 3CENA 3M7UA 2RG3A 3DSGA 3SOSA 1RTLA 1GJ8B 5J4SA 1WAYB 2W5EA 3SUFA 2W3KA 3QWCH 2PR3A 2C8XB 1D3TB 5JPMH 4U30A 1DLEA 2BQ7B 4K1TA 2I6QA 4ABBA 3UR6A 1MKWH 1E37B 2CK3D 2GV6A 4ESTE 1TGNA 3WY8A 5EJLA 1VGCC 2BMGB 1KTTB 5C5NA 1AGJA 1A7SA 1P2OA 1QFKH 1XUFA 5HIYA 4GAWA 1LVYA 1J16A 1Z8GA 1GI4A 1NRRH 4IGDA 4R0IA 2FP7B 1LHDH 2RDLA 1LO6A 1O2XA 5GWZA 1DOJA 4U01A 4A1VA 1BBRH 5AVDA 1MZDA 3WWBA 2SNVA 1A3EH 2XRCA 4DW2U 1DUAA 1ANBA 3UQVA 1SR5C 2VWNA 5A0AE 4NA9H 2PTNA 1RIWB 2FOAA 1CGIE 3ZZCA 3SORA 3GYLB 4KTCA 1JBUH 2BY8X 2FTMA 1XUIA 1FUJA 1OOKB 3A7XA 1E1RD 1BOQA 1O2ZA 3U8OH 1GG6B 1C1RA 1C5TA 2VIPA 4AFQA 1JIMA 3FN8A 4HTCH 1KY9A 1EFRD 2Q6DA 4DY7B 5BRRE 1LKBA 1XM1A 3SHCH 3EGKH 1P2MA 3A8CA 1BTYA 2BZAA 5LGOA 1GVZA 2Z9JA 3PRDA 4YOIA 3EQ0H 2JJ2D 3ODFA 4GPGA 4TY6A 4ZKNU 3RXIA 5B6LA 4ZHLU 1FY3A 5TCAA 1LQDB 3DHKH 1UTOA 2L6OA 3TLOA 2F9VA 1V2PT 1SGFA 4TSFD 4MG3A 2XXLA 1OYTH 1HIAB 5GJ4B 3RMOH 5ESTE 3DA9B 1D3DB 2C3SA 1QB1A 4NSYA 3ZZ5A 3ZVAA 1CT0E 1E0FD 4ISLA 2ZFSA 1MD8A 1O2OA 2AYWA 1BITA 5HM2A 1S81A 1MTNC 2QIQA 3O8BA 1PFXC 2OP9A 2Y80A 5C1YA 2Y7XA 1M9UA 3I77A 2P94A 3LU9B 3PM3A 3AAUA 2A5KA 5HMAA 1FIZA 4WVPE 4B6FA 4E05H 3TVJB 3HKIB 3PV4A 1C1OA 2IPQX 1C2FA 1O36A 1GJBB 1DICA 1QL9A 4TPYA 5F6MA 3B23B 2ZDLA 1BTHH 3QGJA 3UFAA 2QAAA 1XKAC 3QUMP 3RXKA 5JB8S 3GS9A 2BYAX 4B2BA 4E06H 3LC3A 1NPMA 2XW9A 1ELDE 2ZGCA 5IDKA 4IMQA 1T8LA 2Y6TA 1MH0A 1S6LA 1ELGA 2PTCE 4B71A 1AU8A 1SLWB 4O3TA 3VFEA 1IQNA 3MTYA 2QXGA 4Y8ZA 4ASUD 1K1PA 1Z6EA 1DSTA 1AMHA 1P01A 4B2AA 3TNTA 2V6NA 1GJ7B 2ZTYA 1H8ED 1XXFA 3KYFA 1D6RA 1DWBH 1ESTA 3H5CB 1D3QB 3VB6A 4AFZA 2AMDA 4HG6A 1TYNA 1O2GH 1GVKB 1O30A 1NRNH 1UK3A 1XUKA 1AN1E 2EEKA 2FI3E 2IJD1 4ZAEA 3A89A 2QV1A 3EA9A 1MTWA 4THNH 3VPKA 1ELCA 2HOBA 3SYJA 2B8OH 4O03A 4CRAA 1ZPZA 4FUCA 2WPDD 3F1SB 3PV5A 1HAHH 1TNIA 4MVNA 4AORA 2HGTH 3B9FH 2BX3A 2ZU2A 3JZ2B 1AKSB 3T25A 1O2NA 4ISIH 2ZHWH 3A83A 3BTTE 4I8HA 4XBDA 1IQFA 4YT7H 2P8OC 2BM2A 3M5OA 3S9BA 2FYRA 4RN6A 2ZU3A 1C1SA 1AVGH 2FOGA 1DPOA 1ZGIA 3V12A 3M5NA 3SV2H 3IWMA 2ASUB 2FMJA 1EB2A 2VGCB 2ZU5A 3SJOA 1EZQA 4XDEA 1FAKH 5LH8A 2BZ6H 1K22H 1C2KA 1FJSA 1P0SH 2V0BA 1O5CB 2O8WA 3DFLA 2UUYA 1GMCF 3ZZ3A 2VIQA 3ATLA 1BMMH 3OTJE 4SGBE 3LT3A 2A5IA 5JYIA 1SGPE 1NZQH 4NA8A 1A0LA 2VBCA 2AHME 3QZRA 4WY3A 2Z3DA 2ZDAH 1EP5A 4CREA 2H9TH 3E16B 2VU8E 1V2VT 2BOKA 1K0HA 3UPEA 1O2SA 4FVDA 1EXFA 3E0PB 2J95A 1DY9A 1YCPM 1PPGE 1CA0C 4B76A 1UK4A 1V2WT 1A0JA 1BTUA 1H1BA 4AG2A 2NU3E 1GI8B 1ZSJA 2P93A 2ZDNA 1OPHB 2C93B 2G4TA 3VB5A 1KXBA 2OINA 4YLQH 1NRSH 3HK6B 1VCQA 1GBCA 3O8CA 3Q3YA 3OAAD 1UO6A 2LP6A 2JH5D 1QBNA 3RXDA 1EQ9A 1KDQB 3TJVA 3UNQA 1CQQA 4AB9A 5JBTA 1F92A 2AGGX 1PQAA 1ZTJA 2TIOA 1OWIA 1O39A 4ZKOU 4CR5A 5AFYH 1DANH 4K1SA 2VB0A 3S9CA 1ZJDA 3PLPA 2R2MB 5E0HA 3SQEE 3TK5A 1YF4A 2RA0A 4AZ2B 1F0RA 3TH3H 4DT7B 3B8JA 1GBDA 1MCTA 1N8OC 3SZEA 3U9AH 2A4OA 3P70B 1DX5M 1O38A 5FX5A 1SGRE 2A45B 1C1PA 2XCFA 3Q76A 2D8WA 3RMNH 2TGDA 1QQ4A 1ZMJA 2A0QB 3ATWA 1S84A 4DURA 2ZFQH 4UFGH 2Y5FA 1BRUP 1EX3A 1NBME 2PKSB 2QGRA 1ZRKA 2GMTB 3SGAE 1DDJA 1O3IA 3GCHB 1GI1A 1TFXA 4FXGH 2VWOA 3ATIA 1VITG 1AB9C 3H09A 2J5UA 2NU4E 1O2WA 2ZGXH 1B0EA 3BTQE 3PLKA 6CHAB 5LPFA 1YBWA 1Z8RA 2AERH 2OQ5A 2W26A 2P16A 3VG8A 3VGCC 5TJXA 3VB4A 3V13A 2GZ9A 2H5DA 1QRXA 5DPAA 4MQAA 4IBLH 3ZZ6A 3A7WA 1MABB 1GJ9B 5CHAC 3MI4A 1SGEE 1SOTA 2W7SA 5EW1H 1PYTC 3A88A 3UY9A 2O8LA 1K1IA 2GCTB 1V2NT 1PPCE 1Z6JH 1AHTH 1C2GA 1F0UA 2RA3A 5T6FA 1C2HA 1EKBB 1WYKA 2KCAA 1WDIA 2P3UB 2VH0A 5T3HA 4A1XA 1S6HA 4D76A 3STIA 3FFGA 1V2KT 1BTWA 2A7HA 1HUTH 1WQVH 1O2IA 4Y11E 3MH5A 2VIWA 1OP2A 3V3MA 5IK2D 1ZPCA 2BXTH 2A7CA 3MU0A 3ZVDA 2ZPSA 1O2VA 4YZUA 4TT3D 3HKJB 1TLDA 1QJ1B 4OS6A 3ZVGA 4O97A 2G00A 1WBGB 3SN8A 1MTUA 1TA2A 1GL1A 1TNGA 1HBTH 4CRFA 1H8IH 1HYLA 5A8XA 3FKSD 1O3LA 2OCVB 1O32A 2ZF0H 3ZZAA 2FEQH 1AQ7A 3KQBA 4B1TA 1G9IE 1QL7A 5C20A 1THRH 3BTDE 1ID5H 4MPXA 2F9BH 1MU8B 3WWFA 1ZRBA 1V2QT 4FUJA 1BMAA 1DT2A 4X8TH 3N7DA 4YM9A 1IQGA 3OEED 4LXBH 3QX5H 4AGKA 1IQKA 3T62A 4Y10E 1XX9A 4FUDA 1AFQC 1KMHB 3EDXB 3M5MA 1GCTC 3ENSB 2XBXA 3V7TA 3WW7A 4UFDH 1O31A 2FDAA 3BG8A 1KTSB 2L74A 1NN6A 1MZAA 1UVOA 1KIGH 5C0UA 3K2UA 4GUXA 5LPRA 3RXRA 1ARCA 4I8JA 3DSPA 2XBYA 5CHBA 4Q80A 2BQ6B 2QY0B 1YM0A 2VIOA 1WCZA 2Y5HA 1EPTC 1QQUA 3LPRA 1WU1A 1QCPA 1O5DH 3MHWU 3RDZA 3TK6A 1C5MD 1P12E 2THFB 7GCHG 3HATH 1OKXA 3BTME 1TQ0B 1SQAA 3VXFH 2QXIA 1OX1A 2WSSD 3GCTG 1P9SA 1AFEH 1EAIA 1C5QA 2JETB 3KQEA 3NCLA 4FETA 2KZ4A 1C5OH 3TK9A 3E3TA 3U8TH 1SB1H 2Z9IA 3EA7A 2ZIQH 3LONA 1OXGA 1VJAU 3W94A 1KXDA 3H7TA 4BAOB 3S69A 2R9PA 4LZ1H 3URCA 1TX6A 1GI7B 3NWUA 5DP4A 4Z0KA 1Z1JA 3SV7A 1CHOF 2LNCA 1UVTH 3M3VA 1SFIA 4K8BA 5EJZA 1FY5A 1FNIA 1MCVA 4FUBA 1IQMA 2F9OA 5FPYA 2BDGA 1IHTH 1P9UA 5DN6D 1QTFA 1YPJH 3A7TA 3E91A 2Z6BD 2RFKC 1FY1A 1YKTA 3DUXH 1GGDB 2XNIA 1ZHPA 2F9UA 2H9HA 1LVOA 3PROA 2A5AA 4MNVA 1KLJH 1E38B 3BTGE 4ZUHA 1TALA 1RRKA 4YESB 1V2OT 3QN7A 3QTVH 2AFQB 2HPPH 2KAIB 3NK8A 3BEIB 1Y5AT 1T8MA 3FZZA 4P00A 1W12U 1A5IA 2IOTA 3S9AA 3BF6H 5E0JA 1MUEB 2XCNA 1TMTH 5EGMA 3RUOA 4RKJB 1BRBE 1QB9A 1ELTA 2J97A 3P8GA 1JXPA 3OY6U 1Y3YA 2EC9H 3PO1B 2W6ID 2HLDD 3UNRA 3S7KB 3SU4A 2C8YB 3LJOA 3DSOA 2QCYA 4U32A 3PWCA 2BVSH 4XSKU 1GHBG 1S85A 2ALPA 2FOBA 2TPIZ 1O2HA 1RTFB 4I8GA 3ZVCA 1CA8B 4ABFA 3LH1A 1Y3XA 4INHA 1X7AC 1BRAA 3U28C 3Q3XA 4AYVB 2WINI 5GPIB 3SNCA 5AF9H 2BD7A 1D9IA 3GCOA 1BUIA 1W14U 4WH6A 4ZXYH 4A1TA 4ABEA 1V2ST 1K1OA 1RS0A 1HAIH 1TRNA 3HGNA 2Z9GA 1Z1IA 1GBLA 4BAKB 2R3YA 1DFPA 1QRZA 3RXEA 3SJIA 1AE8H 1A5HA 2QF5A 3SU2A 5HM9A 1ZHMA 2CF9H 1L1JA 2VWLA 1OWHA 3ELAH 3PMBB 2FOEA 3RU4D 1HJAB 4TPIZ 1G32B 1E1QD 2OBQA 4D9RA 5C0TA 2ODQA 5A2MH 1SGTA 1TONA 3D49H 4NZQA 4GCHG 3SGQE 2ANYA 1HAYB 5EXMA 3T29A 1O3KA 3LGIA 1TAWA 2QF0A 1C5RA 3N7OA 1K1MA 4OM9A 1W11U 2JDID 3M5LA 2O9QA 1ANCA 4RI0A 4FOUC 3F6UH 3T27A 3TITA 1IQJA 1EZUC 4IC5A 1EATA 4UONA 1CBWC 4AOQA 4DT4A 2HNTE 1AWHB 4HGCA 1EB1H 4D9QA 3P8OA 1TGBA 2BY7X 3MWIU 3BTFE 2WV4A 1XXDA 2SGPE 1W0JD 3UREA 2JJ1D 5C3NA 4K60A 2V3MA 2NU2E 3F9HA 1TPAE 2FLBH 4RSPA 5EOKA 4INLA 1NTPA 1QL8A 3SNDA 4KELA 1UTKA 3EYDA 1JIRA 1RXPA 3ATMA 1O2MA 4RKOB 1HFDA 2SGAA 4OS1A 4DVAU 5FAHA 1KLTA 1HCGA 1MTVA 1CO7E 1W2KH 1A2CH 1C2IA 2WV9A 2HALA 2CGAA 9ESTA 1GI3A 2P3FH 1J8AA 1O2YA 2OK5A 2EQNA 5ABWA 1SLXB 2WV5A 3TJOA 3RXUA 2GJGA 3G01A 1GBBA 1SHHB 2XC0A 4KTSA 3L33A 2P3TB 1NM6A 1UTPA 5GDSH 1A5GH 1NFYA 2ZG0H 2A31A 3TH2H 1G30B 3TJNA 1V2JT 1S83A 3DT0H 4OGYA 4B74A 3M7QA 4X2XA 3SJ9A 1B5GH 1TQ7B 2A32A 2V35A 2PGQB 1JWTA 2F3CE 2QA9E 4FU9A 3E1XB 4VGCC 1QA7A 2STBE 2VVVA 2HNTC 3SJKA 4AN7A 3P8FA 3QDZB 2CMYA 3KYGA 5FPTA 2BY5X 4BTUB 3OX7U 2GT8A 3UTUH 2FOHA 3UAIC 2BVXH 1T32A 5FHTA 3L6PA 1V2MT 1NO9H 1LQEA 1ABIH 4JZIA 1NRPH 2ZI2H 1G36A 1W3CA 2G8TA 1E34B 1ZR0A 1MMJN 1VCPA 4Y79A 1QIXB 1LPKB 1UTQA 4HZHA 3MOCA 2WPJS 1HXFH 2QYIA 2Z9KA 4NWKA 4CHAB 2PLXA 1ETTH 3NRLA 2ZDKA 3KCGH 1GI5A 4CRCA 1THPB 2XOKD 1LVBA 4X1NU 1ELVA 1TA6A 2BLOA 1F2SE 3BV9B 4E7RG 1T7CA 3ZZ9A 5B6OA 1C1WH 2UUJB 3T2NA 4KP0A 3SU3A 1P09A 1IOEA 1ELAA 1G2LA 2IJOB 2UWOA 1BJUA 4Y7AA 5EPNA 1C1UH 3M36A 2HRVA 3SV9A 4Z6AH 4H6TA 2ODYB 3GISB 2SGQE 1IQLA 2ANKH 2ANWA 3KL6A 2YMSC 1SQTA 1TBQH 3ITIA 2A7JA 1O3OA 2HVXA 4BOHA 4X8VH 1LDTT 5DKMA 4ZH8A 2BQWB 2OC1A 3RMLH 2VJ1A 4AB8A 5DGJA 1HGTH 1Q3XA 1L4ZA 3LDXH 2O8UA 1JMOH 2XC5A 2J4IA 4UFEH 1O3FA 3RXBA 1DY8A 1EAXA 1YYY1 2Q6FA 4MDSA 1N6YA 2PW8H 5FCKA 1ABJH 4AFSA 1BJVA 3O8RA 1PJPA 4H4FA 5DJ7A 1K9OE 4YOGA 3P95A 2TGAA 3N7EA 3RXCA 2FOFA 3NKKA 4NFEA 4Q4LA 4M7GA 1SG8B 3BSQA 1P05A 1VCWA 4X8UH 4BNRA 4JK5A 1HAGE 4KKDA 2VIVA 1JRSA 1YPMH 1YCPK 3LJJA 6GCHF 3PYHA 1GL0E 1FQ3A 7LPRA 2R3UA 4XBBA 2B5TB 1VR1H 2GX4A 4JYVH 4AC9A 2BDCA 1PPZA 2FI4E 8ESTE 5DO4H 1K1JA 1KYNA 1PPHE 3BG4C 2XNDD 2J98B 4NZLA 5L2YH 2BD3A 1O5AB 1VJ9U 2FYQA 2P95A 3QLPH 3TJUA 2C90B 2G52A 2KFWA 3HPTB 2BB4A 1GMHG 1TRMA 1AY6H 1MQ6A 1YPLH 3SV8A 5J4QA 2DE9A 3LGUA 1BCUH 1H8DH 3FANA 4X8SH 5BPEA 2ZCKP 2G5VA 1LHGH 3KGPA 1BB0B 1C5UA 2C8ZB 3NUMA 5GXPA 1YPGH 3KNXA 1J17T 1P11E 3CP7A 3LGYA 2ULLA 5KECA 4B75A 1SHYA 1G3EA 1SGYE 3F9FA 2J92A 1GMCG 3MO9A 1WSSH 4AG1A 2JH6D 2QE7D 4OS2A 1GI0A 1GMDG 1HAVB 2AS9A 5KEDA 3AASA 2QF4A 3ZVBA 1UMAH 1TBRH 1WTHD 3ZYDA 1IHSH 2BTCE 1UTLM 2BD5A 2ZQ1A 1MKXK 2HVYB 1VKYA 1O3CA 2CHAC 2XC4A 5A09A 4K69A 1TNJA 4ZKRU 2PKAA 1LTOA 2ZDMA 1P2KA 3BIVH 1UTJA 1PPEE 1TABE 1FN8A 2FM2A 5AHGH 2BDBA 5L2ZH 3ZYEA 3A82A 1VGCB 5HGGA 3QGNB 1E35B 4YXWD 1W13U 5CDFE 3BTKE 1SQOA 1C5SA 1FONA 3A87A 2F9NA 3P17H 4I8LA 4CBOA 1DLKB 1IAUA 1TMBH 7ESTE 3RM0H 1UCYE 1SQRA 1H9HE 1JOUB 1YY3A 2HPQH 3K6ZA 3UR9A 2O8TA 1C5NH 1J9CH 4ABAA 1LHFH 4ASHA 3A84A 1IQIA 1UCYK 3ZZBA 1FY8E 2G5NA 3PLBA 1QHRB 3P6ZB 1GDQA 4ZHMU 1TGTA 3E90B 3PB1E 3SHAH 3OYPA 1W10U 1GHAF 4YOJA 1HDTH 2CXVA 3PMAB 2ZDVH 5T1VA 1GHYH 2AGIX 1TIOA 4JYUH 3RXFA 2OC7A 2BVRH 2P59A 3ZVEA 2HLCA 1DXPA 4GSOA 3MNBA 1A46H 1W7XH 1E79D 4ZXXH 2XWBI 3F2HA 8GCHG 1W7GH 2NU1E 1Q2WA 1WOFA 1D6WA 1GHZA 2WYGA 3PMHB 2BLVA 3OFND 8LPRA 1NBMD 5JB9S 4F55A 1AWFH 1TPPA 4ABJA 1U6QA 1MTNB 4FUGA 3MH6A 4IW4E 3GY8A 3F0PA 4KTUA 3EE0B 1AD8H 2OC8A 4FVBA 4Q7ZA 1FY4A 4NIYA 1Y5UT 6ESTA 1UVSH 4HI3A 4B6EA 5E2OA 3P8NA 1C5VA 4P02A 4I8KA 1RIWC 4H6SB 4PROA 2A4RA 1O37A 1TGCA 1BDAA 1F0TA 3M7TA 1QZ8A 1HIAA 1QNJA 2EI6A 1TPSA 3NXPA 4Y0YE 1FX0B 1OP8A 3HGPA 3M3TA 2ILNA 1GG6C 3A8AA 5EQSA 1XKBC 1P10A 1TE0A 3V0XA 3GY3A 2PUQH 1VZQH 3T26A 3ZV9A 1YLNA 2FS8A 3RC6A 2BDIA 4NCYA 4R8TB 1C4V2 1GI9B 4ZCNA 2Q1JA 4JYTA 1L4DA 4JZ1A 7KMEH 2ANMH 3QK1A 1OWJA 1COWD 4X1QU 4CH8B 4NFFA 3SUDA 1F0SA 2QN5T 2F43B 3BTEE 4K1EA 1L1GA 3MO6A 1O2PA 5AFZH 5ETXA 1GJ5H 1SSXA 2OTVA 2EI8A 5CE1A 3GICB 1C2DA 1GBFA 4X2WA 1FDPA 1AVWA 5T6DA 5A8YA 1GBIA 2YOLA 1RFNA 1NU9A 3NZIA 3SBKA 5JDUB 3S0NA 1C5YB 1QJ6B 3UOUA 1T4VH 2FIRH 4UEHH 1QA0A 3AW0A 3NPSA 1FPCH 1WTGH 3RXMA 1SOZA 4WMDA 1GDNA 2QXHA 3SO3A 2J38A 2H9EH 1GI6A 2AEIH 3MU4A 2BHGA 1ETRH 1NRQH 1GBAA 5L30H 1HAOH 1A1RA 2KCPA 4YO9A 4JZEH 2WPKS 4A5TS 4XRNA 2PFEA 5E2PA 3BIUH 1NT1A 2C8WB 2EA3A 1ZHRA 1W0ZU 1AIXH 1TX8A 1LCYA 4TWWA 1SKYE 2WUCA 2P8OB 1FN6A 4OS7A 5A8ZA 4K8YA 5C67A 1P2IA 1FPHH 2OQUA 2AGEX 1UHBB 1XVMA 1P2JA 2Z94A 5EU8A 4A7IB 2HNTF 1SPJA 3VXEH 5EW2H 3RXOA 2G55A 1O2UA 3SNBA 4YTAA 1O2KA 4CRGA 4F4OC 4X2YA 1QGFA 1GPZA 2FODA 1YLDA 3R3GB 3U98H 3FOAA 4XOJA 5FXLA 1OYQA 2PHBA 3TGKE 1BMNH 5C2ZA 3RLYH 4ABDA 1BIOA 1AKSA 4K5ZA 1O2LA 3Q77A 4NWLA 5E8EH 1O3NA 2UUFB 3RXHA 2W6JD 2ZGHA 1QR3E 2J9NA 3N99A 3RXAA 1Y8TA 3SU0A 2ZTXA 2ZTZA 4DGJA 1DVAH 1YCPH 1AZZA 4B73A 2OBOA 2R2WU 4FUIA 1INCA 1CHOG 2G51A 2AIQA 2K8IA 2BDYA 1QRWA 2F83A 3M61U 1ZTLA 2GCHG 1YC0A 1O3HA 2V3OH 1UVPA 3TH4H 1CA0B 1EUFA 2ZPRA 4Q63A 1GHVH 3D62A 1O3EA 1C1MA 1GBTA 1Z71A 5JBAS 1RD3B 1A0HB 1SL3A 5EQQA 4CRDA 4I31A 1F7ZA 3Q3KA 1GBMA 1TPOA 1BHXF 2Z3EA 5DP6A 2WZQA 3EAJA 2PP6A 3UUZA 4NIWA 3LKWA 3SJ8A 2VGCC 4UD9H 1TB6H 3FVFB 1GWAA 1ZSLA 5GNDA 2ZZUH 1PQ7A 1GHBF 1EJAA 1TWXB 1V2LT 2ZECA 1HAVA 2VINA 3RXLA 1EZXC 1DWCH 1C9PA 3QO6A 3E0NB 1G3CA 1C2EA 4O9VA 3P92A 2ZP0H 3FP8E 1N8OB 1PQ5A 5GCHG 2XWAA 1GHWH 5F03A 1FXYA 4CH2B 5FCRA 3UNSA 1TOCB 5FL7D 1C4Y2 1WUNH 3GOVB 1Y3UA 2VVCA 4Y76A 1T4UH 1KDQA 4J1YA 1D3PB 1MKXH 4D8NA 1GJAB 4IN2A 1V2UT 2RDEA 3UB0A 3U69H 4AX9H 3EA8A 1BMLA 5F53A 4JMYA 2VH6A 1ZTKA 3FO8D 1AB9B 5LPEA 4DIIH 4NIXA 1AZ8A 1CT2E 3DD2H 5EG4A 1KXEA 1TMUH 4ISOA 5DG6A 3MFJA 1GJCB 3FAOA 2B7DH 1C1VH 1RTKA 3VGCB 2UWPA 4AGJA 3A7VA 3UWJH 2GTBA 3ZZ8A 1H8HD 2V7QD 1ARBA 5CHAB 5HIZA 1RJXB 1DWDH 2ZA5A 1ZJKA 2G4UA 2PSXA 1OP0A 3PV2A 2W7UA 1P2QA 3F2FA 2Z9LA 3GYMA 5DP7A 3RXJA 4DG4A 3RP2A 4Q2KA 3GY2A 4Q7XA 2GVFA 1MU6B 3GY4A 3ZIAD 3A8DA 2BXUH 3D23A 1EJNA 2D1JA 3RLWH 6LPRA 2K0QA 1C1NA 3MU8A 1YPKH 1ANEA 5DSFA 2ESTE 1BA8B 4BAQB 1UCYH 1PQ8A 5C1XA 3H7OA 4IN1A 1V2RT 4YLUA 1CVWH 1NS3A 4UE7H 3BTHE 5EODA 5JBBS 1TGSZ 1W0KD 3E8LA 3MMGA 1O3JA 4MNWA 3KIDU 4GHTA 5FX6A 2PKSC 2GMTC 3MYWA 3F9GA 2XBVA 4D7FA 2ZU1A 3SUEA 1CHGA 3GCHC 3LGTA 3OSYA 3M37A 1UTMA 4NIVA 1O3DA 1MD7A 1F5RA 3F68H 4IS5A 6CHAC 3QTOH 3MH4A 2Y5GA 1KSNA 1EZSC 5HKKD 2YNBA 2K1QA 3BEFB 2F4LA 1LHEH 4MNXA 1ACBE 4NGAH 3KEEA 1K21H 3LOXA 1D4PB 4MPUA 1YWUA 2IN2A 2FOMB 3GY6A 1ZMNA 3UWIA 1EASA 2GCTC 2VNTA 4LOYH 3PTBA 4INKA 1AFQB 2ZC9H 1QY6A 1GCTB 1SGDE 4FUEA 2DE8A 4ACBA 2NU0E 5H4IB 1YPHE 3IITA 3MO3A 3A85A 4ISNA 1LPGB 5F8ZA 2PGBB 5I46H 1OSSA 4Q7YA 5DP3A 3LGWA 2WHXA 3AVZA 4BXWA 2M2AA 3BN9A 3RMMH 2TGPZ 1WXRA 1GDUA 1P04A 1B0FA 1FV9A 1O5GH 2FESH 2FXRA 5EPYA 1QBOA 2QF3A 5DP9A 4GLYA 5FPSA 1O5FH 1HLTH 5EIYA 1O2JA 1ELFA 1C5LH 1EPTB 1LKAA 4Z1MD 2Z3CA 1G3DA 1CE5A 4DOQA 5KGOA 3F2GA 1HJ8A 5ESBA 2YMSD 1ELEE 4FU7A 1F5KU 3BTWE 3RU4T 2R0LA 2BD2A 3OU0A 4NA7A 1C5ZB 4OGXA 4TYDA 3SZNA 4OS4A 2FOCA 1EAWA 1ZOMA 1K2I1 2J2UA 1BTPA 2J34A 3SNEA 1YGCH 2O8MA 1GJDB 1C1QA 1QURH 2Q6GA 2BDHA 1QBVH 2KX4A 4DCDA 1KXFA 1OS8A 1SLVB 2AMPA 2D2DA 2ZFPH 3R0FA 1WV7H 1DWEH 2GKVE 3RXQA 1P2NA 2GDDA 1XUGA 1ESAA 5GIBA 1GBJA 1GJ4H 3ESTA 2ZCLP 3RXVA 4TWYA 1FAXA 2ZGBH 1ZLRA 3JZ1B 1BRCE 4OS5A 4QT8C 2ZCHP 2SGDE 4X6PA 3RXSA 1TNHA 2R0KA 3PTNA 3RM2H 3SU6A 2D26C 1O2QA 1ZPBA 2EI7A 5A0CA 1YPHC 1S0QA 3U1IB 2SGFE 2ZPQA 2KCOA 1UHBA 5EXNA 2BOHB 4CRBA 2BD4A 1C9TA 3SW2B 4B2CA 2GV7A 1LVMA 1ZMLA 2A4GA 2CF8H 2GP9B 4ABIA 3O8DA 4ISHH 5FBIA 1S5SA 2H5CA 1GCDA 2STAE 1XUHA 1NC6A 1SI5H 1S82A 1SC8U 2XBWA 3A80A 4YT6H 2ZNKH 1CGHA 3A7ZA 3OE7D 4NG9H 1OWDA 1BZXE 2VIDA 1C2LA 1NROH 5SGAE 3FP6E 1V6DA 1VITH 6GCHG 2OC0A 1YPEH 3KQCA 4ZROA 1KXAA 1C1TA 2KR7A 1P3CA 3GDSA 1K1NA 2J94A 4IMZA 2F91A 4Y71A 1T8NA 5E0GA 2WPLS 2B9LA 2XTTB 2WPHS 4Y6DA 4RT1A 4X1RU 4JZFH 4XD7D 1GMHF 3E6PH 2JETC 3SNAA 1BTXA 4TY7A 3VEQB 3ZZ7A 1V2TT 2FLRH 3QZQA 4DIHH 1XUJA 1XVOA 3TU7H 1FLEE 1ETSH 5CMXH 3GY7A 5IYTA 1ANDA 1BT7A 5HXFA 2FI5E 3TNSA 2SNWA 2GDEH 2KAIA 3BEUA 4X2VA 1NESE 4DJZB 1HV7A 1RGQA 2WUBA 1PPFE 3SQHE 2I6SA 3MNXA 1UJ1A 1SGIB 2VVUA 1TX7A 4A6LA 4KGAA 3C27B 1GMDF 1O3AA 1ESBA 1NFXA 4K3JA 4MTBA 1MAXA 4UFFH 1GI2A 1HAPH 1AO5A 3PRBA 1GGDC 1IQEA 2KM0A 3SUGA 1HNEE 1K1LA 1TNKA 3HK3B 4CBNA 2SGEE 3PWBA 1JRTA 1OHHD 5JBCS 3EE7A 1O33A 1UK2A 2QXJA 4FUFA 4X0WU 3CS0A 2WYJA 1OWKA 4MLFB 3UOPA 5K0HA 1MQ5A 3VB7A 1GBEA 1HPGA 3RC4A 2VWMA 1UVUH 1PPBH 1P8VC 2ZGJA 1GJ6A 2GT7A 1G2MA 3ZVFA 1Y3WA 1MBMA 1V3XA 2YNAA 3PO1C 2BX4A 1O0DH 1CBWB 1W0YH 3MNCA 2FX6A 2W3IA 2F9PA 4LZ4B 3TPIZ 2WPIS 4LK4A 1MKWK 1CT4E 5C94A 2JH0D 1AVXA 4BAMB 3LH3A 1O5BB 1C4U2 1BBRE 4A92A 4ABHA 4O3UA 1W8BH 5TCCA 4WH8A 4WWYA 4ZHAA 1CGJE 1HB0B 1BBRK 1VITF 5C17A 2GZ7A 2Y7ZA 4XBCA 1J15A 3ZZDA 4AFUA 1C2JA 1GHXH 1PYTD 2ZO3H 1EOJA 2OXSA 1Y59T 4J2YB 3ZV8A 2ZWLH 4RT0A 1A3BH 5EQRA 2ODPA 4BTIB 2FWWA 2BY6X 1P03A 1AE5A 3FZDA 1EJMA 1H9LB 1HJAC 2PWXA 1DSUA 1FZZA 5F8XA 3IG6B 2BY9X 1GHAG 2JIZD 2JKHA 2RCEA 3DFJA 1Z7KA 1TOMH 4SGAE 3W95A 2BLQA 4WMEA 5T6GA 1DITH 5I25A 3KF2A 4MNYA 8GCHF 2WPMS 3URDA 3MH7A 1S6FA 1G37A 4GVUA 4VGCB 1BQYA 4Y7BA 3RXTA 4F48B 1ZSKA 1L2EA 2BD8A 4FUHA 2CN0H 4I7YH 3GCNA 2XYAA 4MPVA 4XFQA 1O3PB 3SU1A 3U8RH 4ZMAH 3AW1A 4WMFA 2C4FH 2LELA 4F49A
chains in the Genus database with same CATH topology
2GGVB 2FTLE 1NFUA 1Q31A 1P06A 1ELBA 3ATKA 4K2YA 2ZU4A 1HAZB 2QC2A 3TIUA 1A4WH 1C2MA 3U1JB 2H6MA 2Z7FE 4BXSA 3ODDA 2ZHEH 2UWLA 2A2XH 3KN2A 2ZKSA 3GY5A 3L3TA 1CU1A 3LC5A 2PUXB 1KLIH 1B7XB 2OLGA 1TRYA 4ABGA 3GDUA 1P3EA 1EAUA 1LPZB 3RXPA 8KME2 1EOLA 4WJG2 3KHVA 5L6NH 1OWEA 2TRMA 2FO9A 3MU5A 2AIPA 3T28A 5C1UA 4H42U 2G81E 1FMGA 2UUKB 5FBEA 3M3SA 1A61H 1G3BA 1H4WA 5DK1A 4Y8YA 4X6MA 4BTTB 1E36B 2AMQA 3A8BA 5DP5A 4ZKSU 5PTPA 3TGIE 3SU5A 4FU8A 2ZEBA 4WF8A 1N1LA 3SGBE 2PSYA 3LGVA 1BHXB 2LPRA 1EPTA 2FPZA 4I33A 1ZYOA 1DXWA 2OUAA 4XE4A 2ZHDA 1DE7H 4BANB 1L0ZA 4BAHB 1GBHA 4Y8XA 1C5WB 1DS2E 1K28D 1Z8IB 2FX4A 3F9EA 1XMNB 3AAVA 3GDVA 3A7YA 4CHAC 1SGCA 4X1PU 7GCHF 1C5PA 2ZHQH 2PV9B 1LHCH 5DP8A 1O3GA 3GCTF 2HWLB 1SLUB 2CJIA 4WXIA 3RXGA 1O2RA 1FI8A 1O5EH 1SMFE 1YP9A 1N6XA 3BG4B 1GBKA 3D65E 1Z8JB 4X6OA 2BDAA 3Q00A 1SGQE 2V3HH 1YLCA 4GHQA 3UQOA 2FS9A 4X6NA 4X1SU 2TBSA 4WXVA 4I32A 4U2WA 3K6YA 3OY5U 1EP6A 2GD4B 1SFQB 1J14A 1MBQA 4MPWA 2AH4X 2Y81A 1FIWA 3A86A 1QB6A 1SGFG 1THSH 1NFWA 3STJA 1Y5BT 1L1NA 1DUEA 4UDWH 2DUCA 4NSVA 1LMWB 1KXCA 1T8OA 2GCHF 1O3MA 1O3BA 1Y3VA 2A4QA 3LIWA 3UIRA 1F5LA 1T31A 1UTNA 2H1UA 3S7HB 3SV6A 3A81A 5G4BA 3T5FH 1P02A 3SI3H 2M5TA 5C5OA 3MNSA 2CHAB 2ZQ2A 1NY22 5K7RA 1O35A 1ORFA 4JK6A 2SFAA 3K65B 1ZZZA 2ALVA 4IC6A 5F8TA 2A2QH 1C5XB 4E7NA 3K9XB 2H2ZA 3RC5A 1TBZH 2BD9A 5HYOA 1WQSA 2CV3A 3ZZ4A 5EXLA 1MAYA 2ZFFH 3I78A 3PMJA 5A0BA 3VB3A 9LPRA 2ZHFH 2ZFRH 3RU4E 4D7GA 1H9IE 3MU1A 1AUJA 3SI4H 4CR9A 2NWNA 1O2TA 3I29A 1NU7B 3FP7E 5GCHF 3CS7A 2A1DB 2Y82A 2FZZA 1MTSA 3TGJE 1TNLA 1IQHA 1DM4B 4JCNA 2PKAB 4Y0ZE 1CSOE 1AI8H 1SVPA 1SGNE 1SBWA 2TGTA 3KQDA 4AYYB 2B0FA 1BTZA 2ZFTA 2IPHA 3C1KA 4JZDH 2GZ8A 1HJ9A 1GVLA 1HXEH 1HAXB 2BLWA 1S0RA 2OD3B 1QJ7B 4HFPB 1O34A 1P57B 1ZGVA 1AUTC 1HRTH 3M35A 4GCHF 3CENA 3M7UA 2RG3A 3SOSA 1RTLA 1GJ8B 5J4SA 1WAYB 2W5EA 3SUFA 2W3KA 3QWCH 2PR3A 2C8XB 1D3TB 5JPMH 4U30A 1DLEA 2BQ7B 4K1TA 2I6QA 4ABBA 3UR6A 1MKWH 1E37B 2GV6A 4ESTE 1TGNA 3WY8A 1VGCC 2BMGB 1KTTB 5C5NA 1AGJA 1A7SA 1P2OA 1QFKH 1XUFA 4GAWA 1LVYA 1J16A 1Z8GA 1GI4A 1NRRH 4IGDA 4R0IA 2FP7B 1LHDH 2RDLA 1LO6A 1O2XA 5GWZA 1DOJA 4U01A 4A1VA 1BBRH 5AVDA 1MZDA 2SNVA 1A3EH 2XRCA 4DW2U 1DUAA 1ANBA 3UQVA 1SR5C 2VWNA 5A0AE 4NA9H 2PTNA 1RIWB 2FOAA 1CGIE 3ZZCA 3SORA 3GYLB 4KTCA 1JBUH 2BY8X 2FTMA 1XUIA 1FUJA 1OOKB 3A7XA 1BOQA 1O2ZA 3U8OH 1GG6B 1C1RA 1C5TA 2VIPA 4AFQA 1JIMA 4HTCH 1KY9A 2Q6DA 4DY7B 5BRRE 1LKBA 1XM1A 3SHCH 3EGKH 1P2MA 3A8CA 1BTYA 2BZAA 5LGOA 1GVZA 2Z9JA 4YOIA 3EQ0H 3ODFA 4GPGA 4TY6A 4ZKNU 3RXIA 4ZHLU 1FY3A 5TCAA 1LQDB 3DHKH 1UTOA 3TLOA 2F9VA 1V2PT 1SGFA 4MG3A 2XXLA 1OYTH 1HIAB 5GJ4B 3RMOH 5ESTE 3DA9B 1D3DB 2C3SA 1QB1A 4NSYA 3ZZ5A 3ZVAA 1CT0E 1E0FD 4ISLA 2ZFSA 1MD8A 1O2OA 2AYWA 1BITA 5HM2A 1S81A 1MTNC 2QIQA 3O8BA 1PFXC 2OP9A 2Y80A 5C1YA 2Y7XA 1M9UA 3I77A 2P94A 3LU9B 3PM3A 3AAUA 2A5KA 5HMAA 1FIZA 4WVPE 4E05H 3TVJB 3HKIB 3PV4A 1C1OA 1C2FA 1O36A 1GJBB 1DICA 1QL9A 4TPYA 5F6MA 3B23B 2ZDLA 1BTHH 3QGJA 3UFAA 2QAAA 1XKAC 3QUMP 3RXKA 5JB8S 2BYAX 4B2BA 4E06H 3LC3A 1NPMA 2XW9A 1ELDE 2ZGCA 5IDKA 4IMQA 1T8LA 2Y6TA 1MH0A 1ELGA 2PTCE 4B71A 1AU8A 1SLWB 4O3TA 3VFEA 1IQNA 3MTYA 2QXGA 4Y8ZA 1K1PA 1Z6EA 1DSTA 1AMHA 1P01A 4B2AA 3TNTA 2V6NA 1GJ7B 2ZTYA 1XXFA 1D6RA 1DWBH 1ESTA 3H5CB 1D3QB 3VB6A 4AFZA 2AMDA 1TYNA 1O2GH 1GVKB 1O30A 1NRNH 1UK3A 1XUKA 1AN1E 2EEKA 2FI3E 4ZAEA 3A89A 2QV1A 3EA9A 1MTWA 4THNH 3VPKA 1ELCA 2HOBA 2B8OH 4O03A 4CRAA 1ZPZA 4FUCA 3F1SB 1HAHH 1TNIA 4MVNA 4AORA 2HGTH 3B9FH 2BX3A 2ZU2A 3JZ2B 1AKSB 3T25A 1O2NA 4ISIH 2ZHWH 3A83A 3BTTE 4I8HA 4XBDA 1IQFA 4YT7H 2P8OC 2BM2A 3M5OA 3S9BA 2FYRA 4RN6A 2ZU3A 1C1SA 1AVGH 2FOGA 1DPOA 1ZGIA 3V12A 3M5NA 3SV2H 3IWMA 2ASUB 2FMJA 1EB2A 2VGCB 2ZU5A 3SJOA 1EZQA 4XDEA 1FAKH 5LH8A 2BZ6H 1K22H 1C2KA 1FJSA 1P0SH 2V0BA 1O5CB 2O8WA 3DFLA 2UUYA 1GMCF 3ZZ3A 2VIQA 3ATLA 1BMMH 3OTJE 4SGBE 3LT3A 2A5IA 5JYIA 1SGPE 1NZQH 4NA8A 1A0LA 3QZRA 4WY3A 2Z3DA 2ZDAH 1EP5A 4CREA 2H9TH 3E16B 2VU8E 1V2VT 2BOKA 3UPEA 1O2SA 4FVDA 1EXFA 3E0PB 2J95A 1DY9A 1YCPM 1PPGE 1CA0C 4B76A 1UK4A 1V2WT 1A0JA 1BTUA 1H1BA 4AG2A 2NU3E 1GI8B 1ZSJA 2P93A 2ZDNA 1OPHB 2C93B 2G4TA 3VB5A 1KXBA 2OINA 4YLQH 1NRSH 3HK6B 1VCQA 1GBCA 3O8CA 3Q3YA 1UO6A 2JH5D 1QBNA 3RXDA 1EQ9A 1KDQB 3TJVA 3UNQA 1CQQA 4AB9A 5JBTA 1F92A 2AGGX 1PQAA 1ZTJA 2TIOA 1OWIA 1O39A 4ZKOU 4CR5A 5AFYH 1DANH 4K1SA 2VB0A 3S9CA 1ZJDA 3PLPA 2R2MB 5E0HA 3SQEE 3TK5A 1YF4A 2RA0A 4AZ2B 1F0RA 3TH3H 4DT7B 3B8JA 1GBDA 1MCTA 1N8OC 3U9AH 2A4OA 3P70B 1DX5M 1O38A 5FX5A 1SGRE 2A45B 1C1PA 2XCFA 3Q76A 2D8WA 3RMNH 2TGDA 1QQ4A 1ZMJA 2A0QB 3ATWA 1S84A 4DURA 2ZFQH 4UFGH 2Y5FA 1BRUP 1EX3A 2QGRA 2PKSB 1ZRKA 2GMTB 3SGAE 1DDJA 1O3IA 3GCHB 1GI1A 1TFXA 4FXGH 2VWOA 3ATIA 1VITG 1AB9C 2NU4E 1O2WA 2ZGXH 1B0EA 3BTQE 3PLKA 6CHAB 5LPFA 1YBWA 1Z8RA 2AERH 2OQ5A 2W26A 2P16A 3VGCC 5TJXA 3VB4A 3V13A 2GZ9A 2H5DA 1QRXA 5DPAA 4MQAA 4IBLH 3ZZ6A 3A7WA 5CHAC 1GJ9B 3MI4A 1SGEE 1SOTA 2W7SA 5EW1H 1PYTC 3A88A 3UY9A 2O8LA 1K1IA 2GCTB 1V2NT 1PPCE 1Z6JH 1AHTH 1C2GA 1F0UA 2RA3A 5T6FA 1C2HA 1EKBB 1WYKA 2P3UB 2VH0A 5T3HA 4A1XA 1S6HA 4D76A 3STIA 3FFGA 1V2KT 1BTWA 2A7HA 1HUTH 1WQVH 1O2IA 4Y11E 3MH5A 2VIWA 1OP2A 3V3MA 1ZPCA 2BXTH 2A7CA 3MU0A 3ZVDA 2ZPSA 1O2VA 4YZUA 3HKJB 1TLDA 1QJ1B 4OS6A 3ZVGA 4O97A 2G00A 1WBGB 3SN8A 1MTUA 1TA2A 1GL1A 1TNGA 1HBTH 4CRFA 1H8IH 1HYLA 5A8XA 1O3LA 2OCVB 1O32A 2ZF0H 3ZZAA 2FEQH 1AQ7A 3KQBA 4B1TA 1G9IE 1QL7A 5C20A 1THRH 3BTDE 1ID5H 4MPXA 2F9BH 1MU8B 1ZRBA 1V2QT 4FUJA 1BMAA 1DT2A 4X8TH 4YM9A 1IQGA 4LXBH 3QX5H 4AGKA 1IQKA 3T62A 4Y10E 1XX9A 4FUDA 1AFQC 3EDXB 3M5MA 1GCTC 3ENSB 2XBXA 3V7TA 4UFDH 1O31A 2FDAA 3BG8A 1KTSB 1NN6A 1MZAA 1UVOA 1KIGH 3K2UA 4GUXA 5LPRA 3RXRA 1ARCA 4I8JA 2XBYA 4Q80A 2BQ6B 2QY0B 1YM0A 2VIOA 1WCZA 2Y5HA 1EPTC 1QQUA 3LPRA 1WU1A 1QCPA 1O5DH 3MHWU 3RDZA 3TK6A 1C5MD 1P12E 2THFB 7GCHG 3HATH 1OKXA 3BTME 1TQ0B 1SQAA 3VXFH 2QXIA 1OX1A 3GCTG 1P9SA 1AFEH 1EAIA 1C5QA 2JETB 3KQEA 3NCLA 1C5OH 3TK9A 3E3TA 3U8TH 1SB1H 2Z9IA 3EA7A 2ZIQH 3LONA 1OXGA 1VJAU 3W94A 1KXDA 3H7TA 4BAOB 3S69A 2R9PA 4LZ1H 3URCA 1TX6A 1GI7B 3NWUA 5DP4A 4Z0KA 1Z1JA 3SV7A 1CHOF 2LNCA 1UVTH 3M3VA 1SFIA 4K8BA 1FY5A 1FNIA 1MCVA 4FUBA 1IQMA 2F9OA 5FPYA 2BDGA 1IHTH 1P9UA 1QTFA 1YPJH 3A7TA 3E91A 2Z6BD 1FY1A 1YKTA 3DUXH 1GGDB 2XNIA 1ZHPA 2F9UA 2H9HA 1LVOA 3PROA 2A5AA 4MNVA 1KLJH 1E38B 3BTGE 4ZUHA 1TALA 1RRKA 4YESB 1V2OT 3QN7A 3QTVH 2AFQB 2HPPH 2KAIB 3NK8A 3BEIB 1Y5AT 1T8MA 3FZZA 1W12U 1A5IA 2IOTA 3S9AA 3BF6H 5E0JA 1MUEB 2XCNA 1TMTH 5EGMA 3RUOA 4RKJB 1BRBE 1QB9A 1ELTA 3P8GA 1JXPA 3OY6U 1Y3YA 2EC9H 3PO1B 3UNRA 3S7KB 3SU4A 2C8YB 3LJOA 4U32A 2QCYA 3PWCA 2BVSH 4XSKU 1GHBG 1S85A 2ALPA 2FOBA 2TPIZ 1O2HA 1RTFB 4I8GA 3ZVCA 1CA8B 4ABFA 3LH1A 1Y3XA 4INHA 1X7AC 1BRAA 3Q3XA 4AYVB 2WINI 5GPIB 3SNCA 5AF9H 2BD7A 1D9IA 3GCOA 1BUIA 1W14U 4WH6A 4ZXYH 4A1TA 4ABEA 1V2ST 1K1OA 1RS0A 1HAIH 1TRNA 3HGNA 2Z9GA 1Z1IA 1GBLA 4BAKB 2R3YA 1DFPA 1QRZA 3RXEA 3SJIA 1AE8H 1A5HA 3SU2A 5HM9A 1ZHMA 2CF9H 1L1JA 2VWLA 1OWHA 3ELAH 3PMBB 2FOEA 3RU4D 1HJAB 4TPIZ 1G32B 2OBQA 4D9RA 2ODQA 5A2MH 1SGTA 1TONA 3D49H 4NZQA 4GCHG 3SGQE 2ANYA 1HAYB 5EXMA 3T29A 1O3KA 3LGIA 1TAWA 2QF0A 1C5RA 3N7OA 1K1MA 1W11U 3M5LA 2O9QA 1ANCA 3F6UH 3T27A 3TITA 1IQJA 1EZUC 4IC5A 1EATA 4UONA 1CBWC 4AOQA 2HNTE 1AWHB 4HGCA 1EB1H 4D9QA 3P8OA 1TGBA 2BY7X 3MWIU 3BTFE 2WV4A 1XXDA 2SGPE 3UREA 5C3NA 4K60A 2NU2E 3F9HA 1TPAE 2FLBH 4RSPA 5EOKA 4INLA 1NTPA 1QL8A 3SNDA 4KELA 1UTKA 3EYDA 1JIRA 1RXPA 3ATMA 1O2MA 4RKOB 1HFDA 2SGAA 4OS1A 4DVAU 5FAHA 1KLTA 1HCGA 1MTVA 1CO7E 1W2KH 1A2CH 1C2IA 2HALA 2CGAA 9ESTA 1GI3A 2P3FH 1J8AA 1O2YA 5ABWA 1SLXB 2WV5A 3TJOA 3RXUA 3G01A 1GBBA 1SHHB 2XC0A 4KTSA 3L33A 2P3TB 1NM6A 1UTPA 5GDSH 1A5GH 1NFYA 2ZG0H 2A31A 3TH2H 1G30B 3TJNA 1V2JT 1S83A 3DT0H 4OGYA 4B74A 3M7QA 4X2XA 3SJ9A 1B5GH 1TQ7B 2A32A 2V35A 2PGQB 1JWTA 2F3CE 2QA9E 4FU9A 3E1XB 4VGCC 1QA7A 2STBE 2VVVA 2HNTC 3SJKA 4AN7A 3P8FA 3QDZB 2CMYA 5FPTA 2BY5X 4BTUB 3OX7U 2GT8A 3UTUH 2FOHA 2BVXH 1T32A 5FHTA 3L6PA 1V2MT 1NO9H 1LQEA