1V2TT

Trypsin inhibitor in complex with bovine trypsin variant x(ssfi.glu)bt.b4
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Understanding protein-ligand interactions: the price of protein flexibility
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2tT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2tT02
1QBOA 3SUGA 1JRTA 3AAVA 4NG9H 1C1UH 1IOEA 1CA8B 1O3NA 1OX1A 3R0FA 1YPHC 1NRSH 1MKWH 3BTTE 2R0KA 3S7KB 2ANYA 1BMMH 5C1XA 1LVMA 3S7HB 1TMTH 1WU1A 1ZSLA 3U8RH 3P8FA 1MQ5A 1KLIH 2ZNKH 1A0HB 3ATWA 4B1TA 1ABJH 1SFQB 1DVAH 3UIRA 2GDDA 2ZCKP 3I77A 4ABFA 1C1PA 1O35A 3F9FA 1O2NA 3D65E 2NU3E 1QFKH 4OS1A 1HIAB 2O8MA 1AI8H 1RIWB 1SHYA 2Q6DA 1AFQB 4Y0ZE 2ZKSA 4J1YA 2OC1A 1H9LB 3QO6A 2F9OA 5E0JA 2Q6FA 4ZHMU 2FI5E 3M7TA 6ESTA 3MHWU 1T4UH 1FQ3A 1GDQA 7KMEH 3GY5A 3AW1A 1WTHD 5T3HA 1ESBA 3S9AA 1P12E 1CA0B 4D9QA 1NM6A 1JOUB 5TJXA 4NFFA 4DURA 1P3CA 1TNHA 3CS0A 3VB6A 2Q6GA 1DT2A 3SHCH 1O3LA 1RIWC 2OP9A 3RXAA 1AFQC 1YPMH 4AN7A 1H8IH 2VIOA 5C67A 3L33A 1UK4A 1C1QA 1RRKA 4WXIA 3SU4A 1O2SA 3VEQB 2IN2A 1L4DA 2A7CA 3MH6A 1CA0C 1BJUA 3KQCA 1AZZA 2HPQH 4Y10E 2R2WU 1TX6A 2OC7A 3M5MA 4ZHAA 3MYWA 3RXCA 5K7RA 1TPSA 3BSQA 2C8ZB 3ZZ8A 1SOTA 2AS9A 1T4VH 4AFSA 2XTTB 3GY6A 1O2UA 1IQMA 4X6OA 2O8UA 5DP7A 1U6QA 5DP3A 1BTHH 1F0UA 2FOCA 5EU8A 2D1JA 3ODFA 1P9SA 1BRCE 4YLUA 1SQOA 1DICA 1XM1A 3QGJA 4NSVA 1OP0A 3Q3YA 1TA2A 3BF6H 1XVMA 2YNBA 1FPHH 9ESTA 3NZIA 1O2ZA 3KCGH 1UVOA 2BOHB 2A4GA 4I8JA 5FBEA 4K69A 1OYQA 3LGUA 1BITA 1ORFA 2Y82A 2VVUA 1C5LH 2B7DH 3RXBA 2ANWA 1Z6JH 1RTLA 5FPYA 4TY6A 1BTWA 2NU4E 3D49H 2STAE 4BANB 1YCPK 1KXFA 1V2NT 1TBRH 2Z94A 2W5EA 2OBQA 1DLEA 1PYTD 3A7WA 7LPRA 1MZDA 2F9VA 1UHBB 2Y5GA 1OWKA 2A5KA 3TGJE 4D76A 4B2CA 4BNRA 6LPRA 3SV8A 5GJ4B 4CRAA 5JBAS 1J8AA 1SGDE 5HXFA 2ZQ2A 1P9UA 3LC3A 3OU0A 3BG4B 1OYTH 1TLDA 3A88A 4JZFH 1IQJA 1NZQH 2ZU2A 1GBMA 2JETB 3ZVAA 1GJ5H 1MTSA 4KELA 1C4Y2 1DPOA 1GMCG 1W3CA 2CGAA 3PTNA 3SZNA 4CH2B 1EQ9A 2AMDA 3A7VA 5AFZH 3UNRA 2Z9KA 1HXFH 4IC5A 1SGQE 2WPJS 4I8LA 4Y8YA 3KQDA 1ZSJA 1E34B 4GVUA 3SI3H 1G36A 2PTCE 3LGTA 1RD3B 4Y6DA 1C2FA 2M5TA 3V7TA 1C2DA 3RDZA 2A32A 1GI2A 4DIHH 3E6PH 1HUTH 4DOQA 2BDCA 1BHXB 1AIXH 1WQSA 4DGJA 3O8BA 5SGAE 1H1BA 2Y7XA 2J34A 1HAPH 3A85A 1NT1A 4D9RA 2BLWA 4JZ1A 3GYLB 2BXTH 1DWBH 5LPRA 3F9EA 4WH6A 3S9CA 5DK1A 2OINA 3V0XA 1O5CB 1D6WA 1HJ9A 4A5TS 1MD8A 2VH0A 2FDAA 2ANMH 3L3TA 4RKJB 4TY7A 1C5RA 1DXWA 4I33A 1Z6EA 2UWPA 3M5LA 3M5NA 2OQUA 1PPBH 1O37A 1GL0E 5E2OA 1A4WH 1HIAA 2ZC9H 2BLOA 3MO3A 3PMBB 2VWOA 3DT0H 1O2TA 1ESAA 1ZJDA 1A5GH 1MTWA 5A09A 1GDNA 2Y7ZA 1SPJA 1S83A 3SO3A 1F2SE 1AB9B 1O38A 4GCHF 2CJIA 1TIOA 1AGJA 2BYAX 1YLDA 4WXVA 1L1JA 1C2MA 1EPTB 2WYJA 1AE8H 2BDGA 1GJ8B 1SB1H 4NA7A 2VIPA 3E1XB 1UTQA 2XCFA 1LHEH 1GCDA 4OS7A 1FJSA 3QUMP 4WMEA 3Q3KA 2AGGX 4B74A 5GCHG 1EPTC 5EODA 1DOJA 1BA8B 2XWAA 1MD7A 5EQRA 3RU4E 1BTZA 2H5CA 1GHYH 2J38A 2FI3E 2BY6X 1C1OA 2ODQA 2ZG0H 4XBDA 1BTYA 1LDTT 1SMFE 2AERH 4AG2A 1NTPA 2SGDE 1W7GH 1GVLA 3MU0A 1V2PT 4DW2U 2TPIZ 1QURH 2G52A 1UCYE 1EXFA 3S0NA 1Z8JB 4HTCH 2W7SA 4BAKB 3SUEA 1TNJA 1X7AC 5F8XA 4X6NA 2BOKA 2QF0A 1TPOA 3M7UA 2FI4E 2EEKA 1EATA 1RFNA 2I6SA 3QZQA 1GBAA 3RXKA 1Y5UT 2PSYA 2WV5A 4HGCA 3P95A 1RJXB 1SL3A 2XBXA 3KIDU 4NFEA 1OWEA 2BLVA 2BDYA 1SGRE 2P16A 1FZZA 3HK6B 2VIVA 3O8DA 3RXLA 3TK6A 1C5VA 1O3BA 1W14U 5J4QA 1QRWA 3Q3XA 1TX7A 1AFEH 4I32A 4YZUA 1NC6A 2UUYA 5F8TA 8GCHF 2CF9H 3ZVGA 1GHWH 4FVBA 2QXHA 1UHBA 4ZROA 1ZPCA 1OPHB 2QXGA 3ESTA 2AH4X 1Q31A 4ZAEA 4INLA 2FZZA 1O2XA 4AFQA 1P2QA 1KTSB 1C1RA 1MU8B 4ABAA 1XUJA 5E0HA 1DFPA 1KXAA 1OP2A 1EP6A 3A7XA 4IN2A 3VGCB 1C5YB 3P92A 1IQIA 3MFJA 3MWIU 1P2OA 3O8CA 3BTQE 2VVVA 2ZHDA 5C5NA 1SGFG 4CRGA 4AB9A 2AFQB 4YM9A 3U98H 3BTWE 4ISHH 2BD4A 1CVWH 1EZUC 4THNH 4Y7AA 2VIQA 1EUFA 3U8OH 3VGCC 1C9TA 3FANA 2BQWB 1HAVA 5ESBA 1NRRH 1L1NA 2WPLS 3SJ9A 2HLCA 3D23A 1C5OH 1C5UA 1C2KA 3M37A 2Y6TA 4BTUB 4DVAU 1NESE 3AVZA 2ZU5A 1P05A 4JYVH 3OX7U 4X2XA 1MMJN 2WPMS 1O5FH 2ZPSA 2F3CE 3U8TH 2P8OB 1OWJA 1YLCA 4TPYA 2AIQA 3PLBA 1NRQH 3KGPA 3K6YA 1S81A 5LH8A 3ZZCA 4Y71A 4Y79A 1OWHA 3M7QA 3MTYA 2Z7FE 4ZH8A 4TPIZ 1XUKA 5C1UA 1O2YA 2Y5FA 3RU4D 1FY1A 1TPPA 2P8OC 4ABDA 1TRMA 3BIVH 1O39A 3ZYDA 3UNQA 1GDUA 1V6DA 1MTVA 3DFLA 3L6PA 2ZZUH 4I8GA 5TCAA 5JB8S 4WMFA 1P8VC 1P57B 4U30A 3TJUA 3BTME 3ZVBA 1TNGA 3BN9A 1AE5A 2GT7A 4ZMAH 1G9IE 3SQHE 1PPCE 3U9AH 1ID5H 2GTBA 1T32A 1EPTA 1O2PA 2WPIS 1B7XB 1WBGB 1H9IE 2TRMA 2ZQ1A 1SGEE 1OXGA 5BRRE 2WINI 1TRYA 5IYTA 1TE0A 5LGOA 1AQ7A 3M3VA 1NFYA 3KQBA 4ZKOU 3C27B 4IS5A 4MDSA 2XXLA 3R3GB 1C5QA 1SGTA 4KKDA 2UUFB 1ZRBA 1EB2A 1OKXA 4X8SH 1S82A 4YO9A 1P2KA 1AWFH 1ZOMA 5E2PA 1E35B 2ASUB 5FCRA 2CMYA 5HM9A 1P09A 5L2ZH 3EYDA 1SHHB 2Z9IA 3M3SA 3T5FH 7GCHF 3SGBE 3ENSB 1D9IA 1MH0A 1J16A 1CT4E 3SQEE 1BBRH 1CU1A 1VJ9U 3KN2A 3ZZ7A 3VB4A 1MCVA 2OC8A 3GY3A 4JK5A 5F8ZA 3MU4A 2TIOA 3SNCA 1A5IA 1EAXA 3M61U 1O34A 1LHDH 1O2HA 4FU8A 4A1VA 1Y8TA 1GJ9B 1EAUA 3BEFB 3EE0B 1ETRH 5JBBS 3ZZAA 4AGKA 1CO7E 3UNSA 4DCDA 2PR3A 3E8LA 1VGCB 1Y3YA 1ELDE 1RTKA 1ZMJA 2GZ9A 1FUJA 3TITA 1ELEE 4DIIH 2PKSB 3A7TA 4ZKNU 2XW9A 4OS5A 2J4IA 3SV6A 1TGCA 2ULLA 3PLPA 1TOCB 4AORA 1HJ8A 1TOMH 1TRNA 3SV9A 3A87A 3TGKE 4LOYH 1JWTA 1VGCC 2V35A 1UTJA 1P11E 2H2ZA 1QY6A 4XBBA 1KLJH 2BQ6B 2PKSC 3RXEA 1TAWA 1C1VH 1V2QT 2TGPZ 4XDEA 1S0RA 1LPKB 3SHAH 4IC6A 1V2MT 1CT0E 1YKTA 1F0SA 1N6YA 4IGDA 1DM4B 4LK4A 2ZTXA 4NIVA 3QLPH 1NRNH 1K1NA 3HKJB 2FX6A 2KAIB 1FI8A 6GCHF 3ZZ5A 2HALA 4CBNA 3LH1A 3NK8A 1SR5C 2HNTC 1Z7KA 1W12U 4CH8B 1GBIA 4TWYA 1W8BH 2BDIA 4K3JA 4QT8C 3H7OA 3E0PB 3Q00A 5EQQA 2VIDA 4K5ZA 1L0ZA 1FY4A 2PWXA 4MPUA 2PSXA 1WYKA 5JYIA 2CV3A 2FM2A 1MZAA 1W2KH 4IMQA 2ANKH 2H6MA 2LPRA 2UUJB 4FUIA 4GSOA 3SNBA 2SFAA 3ZVEA 2ZCHP 2CF8H 1O3HA 2UWOA 2RCEA 4NSYA 4RKOB 7ESTE 4OS4A 2BX3A 1GHAF 2SGFE 1G3EA 1HPGA 3F1SB 1GJ6A 2C90B 1A2CH 3ZZ6A 2P59A 1KXBA 1ANCA 3ZZBA 1PPEE 1Y59T 1IQNA 3E90B 1C5XB 2CN0H 1MU6B 1AVWA 3A84A 4E7NA 2VNTA 1F0TA 3SU6A 1C2IA 2ZDMA 1P0SH 1O2LA 5DP5A 1RGQA 4FVDA 1PQAA 3P8OA 1ZGVA 1ZTLA 1AU8A 1SLWB 4YOGA 2H1UA 4Y7BA 2TGAA 2ZA5A 3T26A 1T8MA 1YPEH 1F5LA 1SG8B 1E38B 4PROA 1YPJH 3ATIA 4XOJA 3RUOA 1A0JA 2OUAA 5C5OA 5G4BA 4IW4E 4X8TH 1KY9A 3FZDA 3LT3A 1ABIH 1FY8E 2HPPH 2AMQA 1JXPA 2OLGA 1UVUH 5EW1H 3SJKA 3S9BA 2IOTA 1HJAC 1PJPA 2Y80A 2G8TA 1QJ6B 4ABJA 3F6UH 2J2UA 1TNKA 1S6FA 1DSUA 1V2TT 3RXVA 3ATKA 1SGFA 1ANDA 1Y3UA 2FS9A 1QQ4A 5L6NH 5PTPA 3UR9A 4IMZA 3TH4H 1GI3A 3LJOA 1BTPA 3OYPA 3Q77A 4DG4A 3EGKH 1K9OE 1W0YH 1QNJA 3IG6B 4KP0A 1O5GH 2AYWA 1GI1A 3TJVA 5EXMA 1N6XA 4A92A 3BTDE 3VXFH 1NO9H 3CENA 3RP2A 2TGDA 5HGGA 1DWEH 4GPGA 1DWCH 1V2LT 2TBSA 4AFUA 4RSPA 3DA9B 4MG3A 1B0FA 3SNEA 1PQ7A 4NZQA 1O2RA 3E0NB 1GBFA 1YP9A 4XE4A 1WAYB 3V12A 2THFB 3RXPA 4FU7A 4ZXYH 2Q1JA 3U1JB 2FXRA 1BRAA 3BTEE 1ZMNA 4GCHG 2GV6A 2QA9E 1LVBA 1BB0B 3IITA 5GDSH 2D8WA 2ZECA 4ABIA 1BUIA 1HBTH 2GP9B 1D3TB 5B6OA 2A1DB 2O8LA 1UTPA 1E0FD 2VWMA 2KAIA 2GX4A 5HMAA 1E36B 1V2WT 2SNVA 4NA9H 1THSH 1EKBB 3U69H 3SOSA 1GI8B 3P6ZB 3TK5A 1BTXA 5C3NA 1SGCA 3F68H 1T8LA 1JIMA 1BJVA 1FIZA 1HAVB 4B76A 3RXSA 2GMTC 2ZGCA 2BY7X 1KXEA 2FO9A 5DP8A 8KME2 1D6RA 3SUFA 1QRXA 1MCTA 1ZJKA 3MH7A 2PUXB 1LQDB 2PV9B 1BBRE 3DHKH 1LKAA 1AMHA 1TYNA 4ABHA 1EAIA 2FOHA 1ACBE 5C20A 2EA3A 1W0ZU 1SSXA 1TFXA 2QN5T 1UTNA 3RXDA 3KL6A 1FAXA 1P06A 1ZYOA 3HPTB 4NCYA 1IHSH 1T8NA 1VR1H 3RXHA 3SJIA 2G55A 1C4V2 1JMOH 8GCHG 2HNTE 5EQSA 4MNVA 1XUGA 2PGBB 4U32A 1H9HE 1AVXA 1PQ5A 2AGIX 2JKHA 2YNAA 3FAOA 1DDJA 5LPFA 5E0GA 1O3GA 1SI5H 2Z9GA 4DY7B 2WV4A 2P3FH 4DJZB 3D62A 4WMDA 5AF9H 2G4UA 1WSSH 2K1QA 5ETXA 2ALVA 2IJOB 1UO6A 3A81A 4F49A 1GI6A 5K0HA 3ITIA 1THPB 1EP5A 1BRBE 1Y5AT 1HV7A 1MUEB 4ISNA 3UWIA 1F5KU 2FESH 2FOAA 1VJAU 5CHAB 1O31A 1Y3VA 4FUHA 1PFXC 2ZDAH 3BEIB 1T7CA 2QXIA 1DUAA 1YCPH 2F9NA 2Z3EA 4B2BA 2XC4A 1GI9B 2J94A 4I7YH 3UWJH 2G5VA 1QCPA 2G00A 4IBLH 2HRVA 3ZZ9A 5L30H 5CHAC 3SW2B 1TA6A 3EDXB 1O3FA 1HAZB 2DUCA 1AWHB 3K2UA 3RXTA 4Q2KA 2ZFPH 4Y8ZA 4JZEH 1ZR0A 1QQUA 2ZIQH 1AHTH 1P2MA 1ZTKA 1NFUA 2O8TA 3ELAH 3VXEH 1ZHRA 1P2JA 4BAQB 4ISIH 3PMHB 3HKIB 3VB7A 4BTIB 2F91A 5J4SA 2XCNA 2ZEBA 3UREA 4BOHA 1G3DA 2R0LA 3QTVH 1EB1H 2FOMB 3T2NA 4ASHA 1O2MA 2BVRH 5A8XA 2A4QA 1G3CA 1YC0A 3MI4A 3BTFE 3PO1B 2R9PA 2SGEE 2AGEX 2GDEH 3A8AA 4X8UH 1O2WA 3TK9A 1TBQH 1K2I1 5F03A 3TH3H 1MAYA 2ZPRA 3V3MA 3ZZDA 1C1TA 3M5OA 4X8VH 2BHGA 4WF8A 2GV7A 1GBCA 1DUEA 1ZGIA 3PO1C 2R3YA 1CT2E 4SGAE 1TGSZ 3K6ZA 2HGTH 1UTKA 3GDSA 1GMHF 1IHTH 1G37A 4MNWA 4E05H 3ZV8A 2OQ5A 1ETTH 1VITF 2BD8A 3A82A 2VH6A 3UY9A 4VGCB 1E37B 2P3TB 1XX9A 5FPTA 5FCKA 3TNSA 2BMGB 1SGIB 3RM0H 1AVGH 1Y3XA 1O5EH 1HAXB 1D4PB 1EZXC 3TJOA 1ARBA 7GCHG 5FBIA 3MNXA 1JRSA 5EW2H 1NS3A 2ILNA 4B71A 3M35A 4VGCC 4K8BA 4MNXA 1TB6H 1UMAH 2FEQH 3RLYH 3HK3B 3ZYEA 3RXQA 1QTFA 1HAOH 1ELVA 2R3UA 1FAKH 4O3TA 1LHGH 3GCTF 1NU7B 3E91A 4O9VA 3UQVA 1P3EA 1O3PB 1HLTH 2FLRH 4CREA 3BTHE 1IQKA 1XKBC 2ZO3H 5FXLA 3G01A 1HB0B 1SC8U 3T29A 1K22H 1VCPA 4JYUH 3FP8E 2ZFRH 1QL9A 1ESTA 2ZP0H 3GDUA 2GCHF 4X1NU 1SLXB 3NUMA 1GJBB 3KHVA 1YCPM 1FLEE 2ZU3A 1ZRKA 3MU5A 4YTAA 5E8EH 1ZSKA 3SU2A 1CHOG 1XXDA 4AFZA 2D2DA 1P02A 3EAJA 3U1IB 1T31A 2FOFA 1S84A 3EA9A 5EG4A 3DD2H 1C4U2 1H4WA 1O2OA 5FX6A 1BOQA 2ZU1A 1A46H 3T27A 2QC2A 3SJOA 2BLQA 3RM2H 1XUHA 2QAAA 3GISB 1UJ1A 2BZAA 3LPRA 2ZDVH 1ZPBA 1O2GH 2FP7B 3LGWA 4YOJA 3A7YA 2FYRA 2VVCA 3TNTA 2EI6A 3MO9A 1TQ7B 1SLUB 2O8WA 5BPEA 1GBKA 1MKXK 2SNWA 6GCHG 2C4FH 1GWAA 2ZGBH 5ABWA 1H8DH 1SFIA 3QWCH 3GCOA 4Y8XA 1O3AA 1UCYK 4ZKRU 1DX5M 3SU5A 1BZXE 1Q2WA 4AOQA 2RG3A 2F83A 2OBOA 4OS6A 1LKBA 1XKAC 1BIOA 3ODDA 1C9PA 2NU2E 1MKWK 4MQAA 4ZKSU 1D3DB 4U2WA 2H9TH 3SN8A 2HOBA 2FMJA 4KTCA 1C1WH 1TPAE 2GD4B 2IPHA 1YF4A 1SQTA 2V3HH 1SQAA 3CP7A 3W95A 2A7HA 5F6MA 1GBBA 1SBWA 1FN6A 1ELBA 1XVOA 3BTGE 3KF2A 1UVPA 2UWLA 1GHAG 3TU7H 2VWNA 3LOXA 1WQVH 4ABGA 1G30B 3F9GA 3DFJA 4ESTE 1A5HA 3JZ2B 4NWLA 2Z3DA 1S6HA 3Q76A 2ZDKA 1K28D 4JCNA 1QL7A 6CHAB 3MNBA 1NFXA 1GPZA 4ABEA 3UR6A 5C1YA 2ZTYA 4MVNA 2VWLA 2BD9A 5FAHA 1VCQA 2EC9H 2PW8H 4HFPB 1DY9A 4KTUA 3KEEA 2XC5A 3LGVA 1N8OB 3F9HA 1QB1A 4X1PU 1O3IA 3I29A 1SGNE 6CHAC 2DE9A 1O2IA 4YT6H 4GHTA 2W3IA 2ZHWH 3RMLH 2G4TA 1G2LA 4FUJA 4WVPE 4YT7H 1CE5A 3SBKA 1N8OC 4R0IA 1O30A 3BV9B 4O3UA 3GCHC 1GJCB 1LTOA 4FUBA 4X0WU 1NU9A 1V2JT 3AAUA 4UEHH 3FFGA 1P04A 3P17H 4TWWA 1TQ0B 2A7JA 5DP9A 3PTBA 3FP7E 1C5ZB 2A31A 3O8RA 3C1KA 1GBTA 1YPKH 4BTTB 3UOPA 1AKSB 1B5GH 1O3DA 3GY8A 5CE1A 1K1IA 3BIUH 2XBWA 4MPXA 1OWIA 4GHQA 4AX9H 1LPGB 3KQEA 1DWDH 1GI4A 1V3XA 1XUIA 3UPEA 4MLFB 4AGJA 4ZHLU 1DLKB 1TGNA 3NCLA 5T6DA 3RU4T 1FMGA 1C5PA 1GHBF 4H6SB 2P93A 4ZUHA 4AG1A 2A4RA 4CBOA 3T62A 3MNCA 5A2MH 4AB8A 2GCTC 1OS8A 1C5MD 3MMGA 1Z8IB 3DUXH 4NIWA 4YESB 1GBLA 4CHAB 1O0DH 2FOGA 2A45B 1EJNA 4Z0KA 3URCA 1FV9A 4OS2A 1IQLA 1LHFH 2ZFTA 4NIYA 1S0QA 2ZGJA 1ELCA 3UUZA 1NFWA 4CRBA 1GMDF 1O5BB 2A0QB 2QV1A 5ESTE 3LIWA 4UD9H 1AD8H 3QGNB 4GLYA 4ISLA 1EZQA 4H4FA 1MBQA 5FX5A 4UONA 2STBE 1KXDA 2FX4A 4CHAC 1GI0A 1JIRA 1THRH 3TH2H 1J15A 5HYOA 1BMNH 2GZ8A 1LO6A 3A8DA 1P10A 1GJ7B 1QBVH 1EX3A 4Q7YA 1YBWA 1O3MA 1OSSA 1P03A 1QHRB 1HJAB 1UTOA 1TMUH 3SGAE 4GAWA 4D7GA 1C2LA 2WPHS 3SI4H 2FTMA 1G3BA 3PMAB 2BVXH 2ZF0H 1QRZA 1O3JA 3LH3A 1FPCH 3VFEA 1C1MA 2FWWA 3B23B 4HZHA 4OGXA 2W26A 1KIGH 1IQFA 2ZGHA 3TLOA 2CXVA 1K1MA 1XXFA 1BRUP 1QR3E 4I31A 1ANBA 1HCGA 1A3BH 1JBUH 1OP8A 5DO4H 3A8BA 3MOCA 3LGIA 3P70B 3QX5H 1GG6B 4NWKA 4X6PA 5GPIB 2VGCB 3MNSA 1O3CA 4ABBA 1Q3XA 1GHZA 4R8TB 3URDA 4X1QU 3SU0A 4Q7XA 4UFEH 1O2JA 1SGYE 4AYVB 1TX8A 3SJ8A 1KDQB 1DY8A 1NROH 1TMBH 4WH8A 3QN7A 1GVKB 1ARCA 3SUDA 1GG6C 1MQ6A 2FYQA 1HDTH 2VGCC 3NWUA 1O3KA 2PGQB 1IQHA 2BDHA 4AYYB 4B2AA 1PPFE 2ZFQH 3HATH 3SU3A 3MH4A 1DITH 1MTNB 1C1SA 3HGPA 2FOBA 2PLXA 1TWXB 1QJ1B 5GIBA 1GBEA 1V2KT 2QGRA 2PKAB 5GWZA 4MNYA 1GBJA 5DP6A 2VB0A 2Z6BD 3RXIA 4K2YA 4YLQH 4FUGA 5EXNA 2XRCA 3S69A 1MBMA 1MAXA 4B73A 5L2YH 2WUBA 5A8YA 3UTUH 1G2MA 2J95A 2BXUH 2ZCLP 3LGYA 4MTBA 2C8WB 3QTOH 1MTNC 2PFEA 3P8NA 3TJNA 3VB3A 3K65B 1ZLRA 4INHA 1EJMA 2BD2A 4MPVA 2OC0A 2GMTB 4UE7H 2ZWLH 1K1LA 1ELFA 2G5NA 4Q80A 2Y5HA 1EASA 1AKSA 1HAYB 2BTCE 1AY6H 3QDZB 5EOKA 1DSTA 3QK1A 4H6TA 4K1SA 3LKWA 5I25A 4U01A 1BHXF 1LHCH 1TABE 3RXOA 1KYNA 1FIWA 3E16B 1K1PA 1FN8A 3CS7A 5AFYH 3STIA 1IQGA 4TYDA 1BCUH 2JH6D 2WUCA 1A1RA 5FPSA 1QB6A 3SORA 3FP6E 3GCNA 3TPIZ 2EI7A 2ZDNA 3KNXA 2GGVB 3FZZA 1TALA 2BM2A 4LZ1H 1BQYA 1K1OA 3BG4C 1C1NA 2A4OA 5DJ7A 3RC4A 1O2VA 3ATMA 2JETC 1RTFB 2J9NA 1C5SA 2ZGXH 3H5CB 5EXLA 4LZ4B 1F5RA 4ZXXH 1YYY1 1O33A 1ELAA 3A86A 3EA7A 4ISOA 4YOIA 2BD3A 2WPKS 3LDXH 4B75A 1W7XH 4BXSA 2BX4A 1HAGE 2BDAA 3ZVDA 1GHXH 2F9PA 2B5TB 4KGAA 5LPEA 2QY0B 1YM0A 1ELGA 4BXWA 1IAUA 2AEIH 1FY3A 1EAWA 1LVOA 1Z8GA 2H9EH 4D7FA 4FU9A 5A0CA 2A2XH 4NIXA 1EOLA 3SNAA 1ZMLA 3OSYA 1KTTB 4CRDA 1MTUA 1M9UA 1WOFA 2Z3CA 3RXUA 2GKVE 2R2MB 3PYHA 1GMHG 3PV4A 5DGJA 4I8KA 4KTSA 5JPMH 5DP4A 2OXSA 1HGTH 2DE8A 3I78A 3TIUA 1VITG 5IDKA 2FS8A 4K60A 4RN6A 1K1JA 3T28A 3GY2A 3A8CA 2GVFA 1S5SA 4K1EA 9LPRA 3OY6U 1F0RA 3A7ZA 1K21H 3IWMA 2BY8X 4WJG2 3M36A 1B0EA 3GDVA 3NXPA 2A2QH 1WV7H 1YPHE 3ZVCA 4JZDH 3B8JA 1TBZH 1G32B 1AB9C 3MU1A 2PHBA 2UUKB 1GMCF 1C5TA 1OWDA 2GT8A 4X2YA 5H4IB 1UVSH 5AHGH 1AUJA 4E7RG 2J92A 4M7GA 3OY5U 4F4OC 1P2NA 1SOZA 1CHGA 3GCTG 1W10U 2WYGA 1HFDA 1PPGE 1YPGH 4D8NA 1CGHA 1KDQA 3PM3A 1GI5A 1CGIE 1NN6A 2AIPA 1O5AB 2OD3B 2SGPE 1YGCH 3BTKE 1TGBA 2CHAB 3GICB 1Z1IA 2GCHG 2XNIA 1ZZZA 2XBYA 1EJAA 2C3SA 1FNIA 2PKAA 2RA3A 1A3EH 4MPWA 2VIWA 3ATLA 1HRTH 4Y76A 1WTGH 2BD7A 3V13A 2C8YB 1F92A 1INCA 1QB9A 3AW0A 2V6NA 2CHAC 2VINA 2XC0A 5EGMA 1DS2E 2RA0A 3GY7A 4JZIA 3RC6A 3MO6A 2ZDLA 1Z1JA 1XMNB 3PWCA 2AMPA 1TNLA 1Z71A 4UDWH 1V2ST 5JBTA 3A80A 2QIQA 1GGDB 5TCCA 3PWBA 3UQOA 1O2QA 1EZSC 1V2OT 1VITH 1P2IA 3ZV9A 2FPZA 4I8HA 2BDBA 2P95A 1ZHMA 1ZHPA 3VB5A 5HM2A 2BD5A 5JB9S 1BBRK 1PYTC 3P8GA 4JMYA 3ZVFA 1GGDC 1L2EA 1C5NH 4LXBH 2B0FA 2QCYA 1C2GA 1CBWB 2NU1E 4Y0YE 1C2EA 1DE7H 3RXGA 1W13U 1V2UT 1BMLA 1WUNH 2SGQE 3RC5A 3H7TA 3K9XB 2NU0E 1IQEA 3PLKA 2V3OH 1C5WB 4FUDA 5GCHF 1UK3A 1HAIH 2FODA 5DKMA 2RDLA 2B9LA 3LC5A 1C2HA 1F7ZA 4X1SU 2H5DA 1FDPA 4AZ2B 1GVZA 1S85A 3PB1E 2Z9JA 1FXYA 1CBWC 3EA8A 2F9UA 1RS0A 1AO5A 3BG8A 4NGAH 1NPMA 3OTJE 2ZHFH 3N7OA 1Y5BT 4JK6A 3A83A 1EOJA 3GOVB 2FIRH 5EPYA 3PROA 1O5DH 2ZPQA 5T6GA 5CMXH 1ANEA 4FUCA 1LVYA 3SV7A 5A8ZA 2XBVA 1HXEH 5DG6A 3SNDA 1O3EA 1FONA 1HAHH 2VU8E 2HWLB 5JBCS 2C8XB 3AASA 4X6MA 1GBHA 4GUXA 4XBCA 1NY22 2P3UB 4O97A 2C93B 1ETSH 3W94A 2JH5D 4Z6AH 1C2JA 1UK2A 3MH5A 4UFDH 4X2VA 4CRFA 5A0AE 1GJDB 1GBDA 1Y3WA 4UFGH 2A5IA 4IN1A 2ESTE 1O32A 2HVXA 3GYMA 1J17T 1KSNA 1TNIA 4Q7ZA 3RMMH 1VCWA 4NA8A 1OOKB 1UTLM 3RMOH 3LONA 2FOEA 3UOUA 4E06H 3E3TA 2D26C 3B9FH 1QGFA 1KLTA 1CGJE 2W7UA 1GCTB 2QF3A 5AVDA 4WY3A 2XWBI 2BVSH 5DPAA 1LMWB 2ALPA 4BAOB 2BY5X 2BB4A 2P94A 3SU1A 1BDAA 1T8OA 2ODPA 2ZU4A 2OTVA 2O9QA 2ZTZA 5I46H 1UVTH 1GL1A 2NWNA 1WCZA 3MU8A 5FHTA 1GHVH 1A0LA 2JH0D 3PMJA 1TGTA 1V2VT 3SV2H 2V0BA 1GCTC 3WY8A 1HYLA 2BQ7B 3A89A 1GI7B 1O3OA 3LJJA 4FUFA 1GHBG 4CRCA 5GXPA 1O2KA 1O36A 4H42U 2OCVB 4O03A 1ZTJA 1QIXB 3QZRA 1D3QB 2W3KA 1J9CH 3BEUA 3ZZ3A 2QYIA 3RLWH 2SGAA 3JZ1B 2BZ6H 2QXJA 2TGTA 2ZFFH 3RXJA 3VPKA 4A1XA 3UFAA 4X2WA 4FUEA 4Y11E 4CR9A 1AUTC 3TVJB 1V2RT 3NKKA 1GMDG 1KXCA 1LQEA 2BY9X 3NPSA 4BAMB 1CSOE 1SVPA 1J14A 2XYAA 5EPNA 2I6QA 3GCHB 4A7IB 1ELTA 3HGNA 1VZQH 2FLBH 2ZHEH 2A5AA 2GZ7A 2YOLA 2ZFSA 2ODYB 2B8OH 5JDUB 1L4ZA 2G51A 1D3PB 2HNTF 5C2ZA 1QL8A 1QA7A 3FVFB 2EI8A 2H9HA 1BTUA 1CHOF 1AZ8A 4SGBE 1PQ8A 2LNCA 4NZLA 1L1GA 4INKA 4OGYA 2FTLE 1QBNA 1QJ7B 1ZPZA 1AN1E 1P01A 4XFQA 8ESTE 1YPLH 3RXMA 1FY5A 1GJAB 4JYTA 4J2YB 4XSKU 3SGQE 2PTNA 1XUFA 3RXRA 3RMNH 4A1TA 1DANH 1QA0A 2G81E 1PPZA 3M3TA 2Y81A 1DXPA 1CQQA 1GJ4H 1NRPH 4CR5A 4BAHB 2F9BH 2GCTB 4K8YA 4HI3A 2ZHQH 3GY4A 1LPZB 4X1RU 3ZZ4A 4DT7B 1BT7A 3STJA 2ZI2H 3RXFA 1SLVB 1A7SA 1Z8RA 4FXGH 1PPHE 5A0BA 1HNEE 4UFFH 3TGIE 1W11U 1LCYA 4WWYA 1MKXH 1BMAA 4A6LA 2Z9LA 1N1LA 3EQ0H 5T6FA 4K1TA 1A61H 2VJ1A 1SGPE 1TONA 1UTMA 2PUQH 1RXPA 3T25A 3LU9B 1UCYH 8LPRA
chains in the Genus database with same CATH superfamily
1QBOA 3SUGA 1JRTA 3AAVA 4NG9H 1C1UH 1IOEA 1CA8B 2F4LA 1O3NA 1OX1A 3R0FA 1YPHC 1NRSH 1MKWH 3BTTE 2R0KA 3S7KB 2ANYA 1BMMH 5C1XA 1LVMA 3S7HB 1TMTH 1WU1A 1ZSLA 3U8RH 3P8FA 1MQ5A 1KLIH 2ZNKH 1A0HB 3ATWA 4B1TA 1ABJH 1SFQB 1DVAH 3UIRA 2GDDA 2ZCKP 3I77A 4ABFA 1C1PA 1O35A 3F9FA 1O2NA 3D65E 2NU3E 1QFKH 4OS1A 1HIAB 2O8MA 1AI8H 1RIWB 1SHYA 2Q6DA 1AFQB 4Y0ZE 2ZKSA 3FKSD 4J1YA 2OC1A 1H9LB 3QO6A 2F9OA 5E0JA 2Q6FA 4ZHMU 2FI5E 3PRDA 3M7TA 6ESTA 3MHWU 1T4UH 1FQ3A 1GDQA 7KMEH 3GY5A 3AW1A 1WTHD 5T3HA 1ESBA 3S9AA 1P12E 1CA0B 2J98A 4D9QA 1NM6A 1JOUB 5TJXA 4NFFA 5CHBA 1P3CA 1TNHA 4DURA 3CS0A 3VB6A 2Q6GA 1DT2A 3SHCH 1O3LA 1RIWC 2OP9A 3RXAA 1AFQC 1YPMH 3FN8A 4AN7A 1H8IH 2VIOA 5C67A 3L33A 1UK4A 1C1QA 1RRKA 4WXIA 3SU4A 1O2SA 3VEQB 2IN2A 1L4DA 2A7CA 3MH6A 3VG8A 1CA0C 1BJUA 3KQCA 1AZZA 2HPQH 4Y10E 2R2WU 1TX6A 2OC7A 3M5MA 4ZHAA 3MYWA 3RXCA 5K7RA 1TPSA 3BSQA 2C8ZB 3ZZ8A 1SOTA 2AS9A 1T4VH 4AFSA 2XTTB 3GY6A 1O2UA 1IQMA 4X6OA 2O8UA 5DP7A 1U6QA 5DP3A 1BTHH 1F0UA 4OM9A 2FOCA 5EU8A 2D1JA 3ODFA 1P9SA 1BRCE 3OFND 4YLUA 1SQOA 1DICA 1XM1A 3QGJA 4NSVA 2QF4A 1OP0A 2XNDD 3Q3YA 1TA2A 3BF6H 1XVMA 2YNBA 1FPHH 3CNRA 9ESTA 3NZIA 1O2ZA 3KCGH 5B6LA 1UVOA 2BOHB 2A4GA 4I8JA 5FBEA 4K69A 2W6ID 5EJZA 1OYQA 3LGUA 1BITA 1ORFA 2Y82A 2VVUA 1C5LH 2B7DH 3RXBA 2ANWA 1Z6JH 1RTLA 5FPYA 4TY6A 1BTWA 2NU4E 3D49H 2STAE 4BANB 1YCPK 1KXFA 1V2NT 1TBRH 2Z94A 2W5EA 2OBQA 1DLEA 1PYTD 3A7WA 7LPRA 1MZDA 2F9VA 1UHBB 2Y5GA 1OWKA 2A5KA 3TGJE 4D76A 4B2CA 4BNRA 5EJ1A 6LPRA 3SV8A 5GJ4B 4CRAA 5JBAS 1J8AA 1SGDE 5HXFA 2ZQ2A 1P9UA 3LC3A 3OU0A 3BG4B 1OYTH 1TLDA 3A88A 4JZFH 1IQJA 1NZQH 2ZU2A 1GBMA 3AK5A 3WWFA 2JETB 3ZVAA 1GJ5H 1MTSA 4KELA 1C4Y2 1DPOA 1GMCG 1W3CA 2CGAA 3PTNA 3SZNA 4CH2B 1EQ9A 2AMDA 3A7VA 5AFZH 3UNRA 2Z9KA 1HXFH 4IC5A 1SGQE 2WPJS 4I8LA 4Y8YA 3KQDA 1ZSJA 1E34B 4GVUA 3SI3H 1G36A 2PTCE 3FOAA 3LGTA 1RD3B 3OAAD 4Y6DA 1C2FA 2M5TA 1WDIA 3V7TA 1C2DA 3RDZA 2A32A 1GI2A 4DIHH 3E6PH 1HUTH 4DOQA 2BDCA 1BHXB 1AIXH 1WQSA 3N7EA 4DGJA 3O8BA 5SGAE 1H1BA 3F2HA 2Y7XA 2J34A 1HAPH 3A85A 1NT1A 1YLNA 4D9RA 2BLWA 3KQ5A 4JZ1A 3GYLB 2BXTH 1DWBH 5LPRA 3F9EA 4WH6A 3S9CA 5DK1A 2OINA 3V0XA 1O5CB 1D6WA 1HJ9A 4A5TS 1MD8A 2VH0A 2FDAA 2ANMH 3L3TA 4RKJB 4TY7A 1C5RA 1DXWA 4I33A 1Z6EA 2UWPA 3M5LA 3M5NA 3UB0A 2OQUA 1PPBH 1O37A 1GL0E 5E2OA 1A4WH 1HIAA 2ZC9H 2BLOA 3MO3A 3PMBB 2VWOA 3DT0H 1O2TA 1ESAA 1ZJDA 1A5GH 1MTWA 5A09A 1GDNA 2Y7ZA 1SPJA 1S83A 3SO3A 3OTPA 1F2SE 1AB9B 1O38A 4GCHF 2CJIA 1TIOA 1AGJA 1NBME 2BYAX 1YLDA 4WXVA 1L1JA 1C2MA 1EPTB 2WYJA 1AE8H 2BDGA 1GJ8B 1SB1H 4NA7A 4RT1A 2VIPA 3E1XB 1UTQA 2XCFA 1LHEH 1GCDA 4OS7A 1FJSA 3QUMP 4WMEA 2IJD1 3Q3KA 2AGGX 4B74A 5GCHG 1EPTC 5EODA 1DOJA 1BA8B 2XWAA 1MD7A 5EQRA 3RU4E 1BTZA 2H5CA 1GHYH 5FL7D 2J38A 2FI3E 2BY6X 1C1OA 2ODQA 2ZG0H 4XBDA 1BTYA 1LDTT 1SMFE 2AERH 4AG2A 1NTPA 2SGDE 1W7GH 1GVLA 3MU0A 1V2PT 4DW2U 2TPIZ 1QURH 2G52A 1UCYE 1EXFA 3S0NA 1E1QD 1Z8JB 4HTCH 2W7SA 4BAKB 3SUEA 1TNJA 1X7AC 5F8XA 4X6NA 2BOKA 2QF0A 1TPOA 3M7UA 2FI4E 2EEKA 1EATA 1RFNA 2I6SA 3QZQA 1GBAA 3RXKA 1Y5UT 2PSYA 2WV5A 4HGCA 3P95A 1RJXB 1SL3A 2XBXA 3KIDU 4NFEA 4Q63A 1OWEA 2JDID 2BLVA 2BDYA 1SGRE 2P16A 1FZZA 3HK6B 2VIVA 3O8DA 3RXLA 3TK6A 1C5VA 1O3BA 1W14U 5J4QA 1QRWA 3Q3XA 1TX7A 2WZQA 1AFEH 4I32A 4YZUA 1NC6A 2UUYA 5F8TA 8GCHF 2CF9H 3ZVGA 1GHWH 4FVBA 2QXHA 1UHBA 4ZROA 1ZPCA 1OPHB 2QXGA 3ESTA 2AH4X 1Q31A 4ZAEA 4INLA 2FZZA 1O2XA 4AFQA 1P2QA 1KTSB 1C1RA 1MU8B 4ABAA 1XUJA 5E0HA 1DFPA 1KXAA 1OP2A 1EP6A 3A7XA 4IN2A 3VGCB 1C5YB 3P92A 1IQIA 3MFJA 3MWIU 1P2OA 3O8CA 3BTQE 2VVVA 2ZHDA 5C5NA 1SGFG 4CRGA 4AB9A 2AFQB 4YM9A 3U98H 3BTWE 4ISHH 2BD4A 2HLDD 1CVWH 1EZUC 4THNH 4Y7AA 2VIQA 1EUFA 3U8OH 3VGCC 1C9TA 3FANA 2BQWB 1HAVA 5ESBA 1NRRH 1L1NA 2WPLS 3SJ9A 2HLCA 3D23A 1C5OH 1C5UA 1C2KA 3M37A 2Y6TA 4BTUB 1NBMD 4DVAU 1NESE 3AVZA 2ZU5A 1P05A 4JYVH 3OX7U 4X2XA 1MMJN 2WPMS 1O5FH 2ZPSA 2F3CE 3U8TH 2P8OB 1OWJA 1YLCA 4TPYA 2AIQA 3PLBA 1NRQH 3KGPA 3K6YA 1S81A 5LH8A 3ZZCA 4Y71A 4Y79A 1OWHA 3M7QA 3MTYA 2Z7FE 4ZH8A 4TPIZ 3KYGA 1XUKA 5C1UA 1O2YA 3DSGA 2Y5FA 3RU4D 1FY1A 1TPPA 2P8OC 4ABDA 1TRMA 3BIVH 1O39A 3ZYDA 3UNQA 3DSOA 2KFWA 1E79D 1GDUA 1V6DA 1MTVA 3DFLA 3L6PA 2ZZUH 4I8GA 5TCAA 4P00A 4WMFA 5JB8S 1P8VC 1P57B 4U30A 3TJUA 3BTME 3ZVBA 2V3MA 1TNGA 3BN9A 1AE5A 3SYJA 2GT7A 4ZMAH 1G9IE 3SQHE 1PPCE 3U9AH 1ID5H 2GTBA 1T32A 1EPTA 1O2PA 2WPIS 1B7XB 1WBGB 1H9IE 2TRMA 2ZQ1A 1SGEE 1OXGA 5BRRE 2WINI 1TRYA 5IYTA 1TE0A 5T1VA 5LGOA 1AQ7A 3M3VA 1NFYA 3KQBA 4ZKOU 3C27B 4IS5A 4MDSA 2XXLA 3R3GB 1C5QA 1SGTA 4KKDA 2UUFB 1ZRBA 1EB2A 1OKXA 4X8SH 1S82A 4YO9A 1P2KA 1AWFH 1ZOMA 5E2PA 1E35B 2ASUB 5FCRA 2CMYA 5HM9A 1P09A 5L2ZH 3EYDA 1SHHB 2Z9IA 3M3SA 3N7DA 3T5FH 7GCHF 3SGBE 2JJ1D 3ENSB 1D9IA 1MH0A 1J16A 1CT4E 3SQEE 1BBRH 1CU1A 1VJ9U 3KN2A 3ZZ7A 3VB4A 1MCVA 2OC8A 3GY3A 4JK5A 5F8ZA 3MU4A 2TIOA 3SNCA 1A5IA 1EAXA 3M61U 1O34A 1LHDH 1O2HA 4FU8A 4A1VA 1Y8TA 1GJ9B 1EAUA 3BEFB 3EE0B 1ETRH 5JBBS 3ZZAA 4AGKA 4TT3D 1CO7E 3UNSA 4DCDA 2PR3A 3E8LA 1VGCB 1Y3YA 1ELDE 1RTKA 1ZMJA 2GZ9A 1FUJA 3TITA 1ELEE 4DIIH 2PKSB 3A7TA 4ZKNU 2XW9A 4OS5A 2J4IA 3SV6A 1TGCA 2ULLA 3PLPA 1TOCB 4AORA 1HJ8A 1TOMH 1TRNA 3SV9A 3A87A 3TGKE 4LOYH 1JWTA 1VGCC 2V35A 1UTJA 1P11E 2H2ZA 1QY6A 4XBBA 3OEED 1KLJH 2BQ6B 2PKSC 3RXEA 1TAWA 1C1VH 1V2QT 2TGPZ 4XDEA 1S0RA 1LPKB 3SHAH 4IC6A 1V2MT 1CT0E 1YKTA 1F0SA 1N6YA 4IGDA 1DM4B 4LK4A 2ZTXA 4NIVA 3QLPH 1WXRA 1NRNH 1K1NA 3HKJB 2FX6A 2KAIB 3OEHD 1FI8A 4F55A 6GCHF 3ZZ5A 2HALA 4CBNA 3LH1A 3NK8A 1E1RD 1SR5C 2JIZD 2RFKC 2HNTC 2WSSD 1Z7KA 1W12U 4CH8B 1GBIA 2YMSD 4TWYA 1W8BH 2BDIA 1MABB 4K3JA 3H7OA 4QT8C 3E0PB 3Q00A 5EQQA 2VIDA 2WV9A 4K5ZA 1L0ZA 1FY4A 2PWXA 4MPUA 2PSXA 1WYKA 5JYIA 2CV3A 2FM2A 1MZAA 1W2KH 4IMQA 2ANKH 2H6MA 2LPRA 2UUJB 4FUIA 4GSOA 3SNBA 2SFAA 3ZVEA 2ZCHP 2CF8H 1O3HA 2UWOA 2RCEA 4NSYA 4RKOB 7ESTE 4OS4A 2BX3A 1GHAF 2SGFE 1G3EA 1HPGA 3F1SB 1GJ6A 2C90B 1A2CH 3ZZ6A 2P59A 1KXBA 1SKYE 1ANCA 3ZZBA 1PPEE 1Y59T 1IQNA 3E90B 1C5XB 2CN0H 1MU6B 1AVWA 3A84A 4E7NA 2VNTA 1F0TA 3SU6A 1C2IA 2ZDMA 1P0SH 1O2LA 5DP5A 1RGQA 4FVDA 2L74A 1PQAA 2KCAA 3P8OA 3F3BA 1ZGVA 1ZTLA 1AU8A 1SLWB 4YOGA 2H1UA 4Y7BA 2TGAA 4HG6A 2ZA5A 3T26A 1T8MA 1YPEH 1F5LA 1SG8B 1E38B 4PROA 2KX4A 1YPJH 3ATIA 4XOJA 3RUOA 1A0JA 2OUAA 5C5OA 5G4BA 4IW4E 4X8TH 3KYFA 1KY9A 3FZDA 3LT3A 1ABIH 1FY8E 2HPPH 2AMQA 1JXPA 2OLGA 1UVUH 5EW1H 3SJKA 3S9BA 2IOTA 1HJAC 1PJPA 3MQKC 2Y80A 2G8TA 3OE7D 1QJ6B 4ABJA 3F6UH 3DSPA 2J2UA 2F43B 1TNKA 1S6FA 1DSUA 1V2TT 3RXVA 3ATKA 1SGFA 1ANDA 1Y3UA 2FS9A 1QQ4A 4F48B 5L6NH 5PTPA 3UR9A 3DCLA 4IMZA 1GI3A 3TH4H 3LJOA 1BTPA 3OYPA 3Q77A 4DG4A 3EGKH 1K9OE 1W0YH 1QNJA 3IG6B 4KP0A 1O5GH 2AYWA 1GI1A 3TJVA 5EXMA 1N6XA 4A92A 3BTDE 3VXFH 1NO9H 3CENA 3RP2A 2TGDA 5HGGA 1DWEH 4GPGA 5C0TA 1DWCH 1V2LT 2TBSA 4AFUA 4RSPA 3DA9B 4MG3A 1B0FA 3SNEA 1PQ7A 4NZQA 1O2RA 3E0NB 1GBFA 1YP9A 4XE4A 1WAYB 3V12A 2THFB 3RXPA 4FU7A 4ZXYH 2Q1JA 3U1JB 2FXRA 1BRAA 3BTEE 1ZMNA 4GCHG 2GV6A 2QA9E 1LVBA 1BB0B 3IITA 5GDSH 2D8WA 2ZECA 3EE7A 4ABIA 1BUIA 1HBTH 2GP9B 1D3TB 5B6OA 2A1DB 2O8LA 1UTPA 1E0FD 2VWMA 2KAIA 1W0KD 2GX4A 5HMAA 1E36B 1V2WT 2SNVA 4NA9H 1THSH 1EKBB 3U69H 3SOSA 1GI8B 5CDFE 3P6ZB 3TK5A 1BTXA 5C3NA 1SGCA 3F68H 1T8LA 1JIMA 1BJVA 1FIZA 1HAVB 3GS9A 4B76A 3RXSA 2GMTC 2YMSB 2ZGCA 2BY7X 1KXEA 2FO9A 5DP8A 8KME2 1D6RA 3SUFA 1QRXA 1MCTA 1ZJKA 3MH7A 2PUXB 1LQDB 2PV9B 1BBRE 3DHKH 1LKAA 1AMHA 1TYNA 3PV2A 4ABHA 1EAIA 2FOHA 1ACBE 5C20A 2EA3A 2YMSC 1W0ZU 1SSXA 1TFXA 2QN5T 1UTNA 3RXDA 3KL6A 1FAXA 1P06A 1ZYOA 3HPTB 2J5UA 4NCYA 1IHSH 1T8NA 1VR1H 3RXHA 3SJIA 5IK2D 2G55A 1C4V2 1JMOH 8GCHG 2HNTE 5EQSA 4MNVA 1XUGA 5GNDA 3U28C 2PGBB 4U32A 1H9HE 5DN6D 1AVXA 1PQ5A 5EJLA 2AGIX 2JKHA 2YNAA 3FAOA 1DDJA 5LPFA 5E0GA 4ACAA 1O3GA 1SI5H 2Z9GA 4DY7B 2WV4A 2P3FH 4DJZB 3D62A 4WMDA 5AF9H 2G4UA 1WSSH 2K1QA 5ETXA 2ALVA 2IJOB 1UO6A 3A81A 4F49A 1GI6A 5K0HA 3ITIA 1THPB 1EP5A 1BRBE 1Y5AT 1HV7A 1MUEB 4ISNA 3UWIA 1F5KU 2FESH 2FOAA 1VJAU 5CHAB 1O31A 1Y3VA 4FUHA 1PFXC 2ZDAH 3BEIB 1T7CA 1UW7A 2QE7D 2QXIA 1DUAA 1YCPH 2F9NA 2Z3EA 4B2BA 2XC4A 3F0OA 1GI9B 2J94A 4I7YH 3UWJH 2G5VA 1QCPA 2G00A 4IBLH 2HRVA 3ZZ9A 5L30H 5CHAC 3SW2B 1TA6A 3EDXB 1O3FA 1HAZB 2DUCA 1AWHB 3K2UA 3RXTA 4Q2KA 2ZFPH 4Y8ZA 4JZEH 1ZR0A 1QQUA 2ZIQH 1AHTH 1P2MA 1ZTKA 1NFUA 2O8TA 3ELAH 3VXEH 1ZHRA 1P2JA 4BAQB 4ISIH 3PMHB 3HKIB 3VB7A 4BTIB 2F91A 5J4SA 2XCNA 2ZEBA 3F2FA 3UREA 4BOHA 2OK5A 1G3DA 2R0LA 3QTVH 1EB1H 2FOMB 3T2NA 4ASHA 1O2MA 2BVRH 5A8XA 2A4QA 1G3CA 1YC0A 5KEDA 3MI4A 3BTFE 3PO1B 2R9PA 2SGEE 2AGEX 2GDEH 3A8AA 4X8UH 1O2WA 2RDEA 3TK9A 1TBQH 1K2I1 5F03A 3TH3H 1MAYA 2ZPRA 3V3MA 3ZZDA 4XD7D 1C1TA 3M5OA 4X8VH 2BHGA 4WF8A 2GV7A 1GBCA 1DUEA 1ZGIA 3PO1C 2R3YA 1CT2E 4SGAE 1TGSZ 3K6ZA 2HGTH 1UTKA 3GDSA 1GMHF 1IHTH 1G37A 4MNWA 4E05H 3ZV8A 2OQ5A 1ETTH 1VITF 2BD8A 3A82A 2VH6A 3UY9A 4VGCB 2KM0A 1E37B 2P3TB 1XX9A 5FPTA 5FCKA 3TNSA 2BMGB 1SGIB 3RM0H 1AVGH 1Y3XA 1O5EH 1HAXB 1D4PB 1EZXC 3TJOA 1ARBA 7GCHG 5FBIA 3MNXA 1JRSA 5EW2H 1NS3A 2ILNA 4B71A 3M35A 4VGCC 4K8BA 4MNXA 1TB6H 1UMAH 2FEQH 3RLYH 3NRLA 3HK3B 3ZYEA 3RXQA 1QTFA 1HAOH 1ELVA 2R3UA 1FAKH 3SZEA 4O3TA 1LHGH 3GCTF 1NU7B 3E91A 4O9VA 3UQVA 1P3EA 1O3PB 1HLTH 2J97A 2FLRH 4CREA 3BTHE 1IQKA 1XKBC 2ZO3H 5FXLA 2EQNA 3G01A 1HB0B 1SC8U 3T29A 1K22H 1VCPA 4JYUH 3FP8E 2ZFRH 1QL9A 1ESTA 2ZP0H 3GDUA 2GCHF 4X1NU 1SLXB 3NUMA 1GJBB 3KHVA 1YCPM 1FLEE 2ZU3A 1ZRKA 3MU5A 4YTAA 2W6JD 5E8EH 1ZSKA 3SU2A 1CHOG 1XXDA 4AFZA 2D2DA 1P02A 3EAJA 3U1IB 1T31A 2FOFA 1S84A 3EA9A 5EG4A 3DD2H 1C4U2 1H4WA 1O2OA 5FX6A 1BOQA 2ZU1A 1A46H 3T27A 2QC2A 3SJOA 2BLQA 3RM2H 1XUHA 2QAAA 3GISB 1UJ1A 2BZAA 3LPRA 2ZDVH 1ZPBA 1O2GH 2FP7B 3LGWA 4YOJA 3A7YA 2FYRA 2VVCA 3TNTA 2EI6A 3MO9A 1TQ7B 4FETA 1SLUB 2O8WA 5BPEA 1GBKA 1MKXK 2SNWA 6GCHG 2C4FH 1GWAA 2ZGBH 5ABWA 1H8DH 1SFIA 3QWCH 3GCOA 4Y8XA 1O3AA 1UCYK 4ZKRU 1DX5M 3SU5A 1BZXE 1Q2WA 4AOQA 2RG3A 2F83A 2OBOA 4OS6A 1LKBA 1XKAC 1BIOA 3ODDA 1C9PA 2NU2E 1MKWK 4MQAA 4ZKSU 1D3DB 4U2WA 2H9TH 4YXWD 3SN8A 4ZCNA 2HOBA 2FMJA 4KTCA 1C1WH 1TPAE 2GD4B 2IPHA 1YF4A 1SQTA 2V3HH 1SQAA 3CP7A 3W95A 2A7HA 5F6MA 1GBBA 1SBWA 1FN6A 1ELBA 1XVOA 3BTGE 3KF2A 1FX0B 1UVPA 2UWLA 1GHAG 3TU7H 2VWNA 3LOXA 5F53A 1WQVH 4ABGA 1G30B 3F9GA 3DFJA 4ESTE 1A5HA 3JZ2B 4NWLA 5C94A 2Z3DA 1S6HA 3Q76A 2ZDKA 1K28D 1H8ED 4JCNA 1QL7A 6CHAB 3MNBA 1NFXA 1GPZA 4ABEA 3UR6A 5C1YA 2ZTYA 4MVNA 2VWLA 2BD9A 5FAHA 1VCQA 2EC9H 2PW8H 4HFPB 1DY9A 4KTUA 3N99A 3KEEA 2XC5A 3LGVA 1N8OB 4ACBA 3F9HA 1QB1A 4X1PU 1O3IA 3I29A 1SGNE 3ZIAD 6CHAC 2DE9A 1O2IA 4YT6H 4GHTA 2W3IA 2ZHWH 3RMLH 3UAIC 2G4TA 1G2LA 4FUJA 4WVPE 4YT7H 1CE5A 3SBKA 2VBCA 1N8OC 4R0IA 1O30A 3BV9B 4O3UA 3GCHC 2EY4C 1GJCB 1LTOA 4FUBA 4X0WU 1NU9A 1V2JT 3AAUA 4UEHH 3FFGA 1P04A 3P17H 4TWWA 1TQ0B 2A7JA 5DP9A 3PTBA 3FP7E 1C5ZB 2A31A 3O8RA 3C1KA 1GBTA 1YPKH 3W1EA 4BTTB 3UOPA 1AKSB 1B5GH 1O3DA 3GY8A 5CE1A 1K1IA 3BIUH 2XBWA 4MPXA 1OWIA 4GHQA 4AX9H 1LPGB 1W0JD 3KQEA 1DWDH 1GI4A 1V3XA 1XUIA 3UPEA 4MLFB 4AGJA 4ZHLU 2M2AA 1DLKB 1TGNA 4TSFD 3NCLA 5T6DA 3RU4T 1FMGA 1C5PA 1GHBF 4H6SB 2P93A 4ZUHA 4AG1A 2A4RA 4CBOA 3T62A 3MNCA 5A2MH 4AB8A 2GCTC 4AC9A 1OS8A 1C5MD 1YWUA 3MMGA 1Z8IB 3DUXH 4NIWA 4YESB 1GBLA 4CHAB 1O0DH 2FOGA 2A45B 1EJNA 4Z0KA 3URCA 1FV9A 4OS2A 1IQLA 1LHFH 2ZFTA 4NIYA 1S0QA 2ZGJA 1ELCA 3UUZA 1NFWA 4CRBA 2IPQX 1GMDF 1O5BB 2A0QB 2QV1A 5ESTE 3LIWA 4UD9H 1AD8H 3QGNB 4GLYA 4ISLA 1EZQA 4H4FA 1MBQA 5FX5A 4UONA 2STBE 1KXDA 2FX4A 4CHAC 1GI0A 1JIRA 1THRH 3TH2H 1J15A 5HYOA 1BMNH 2GZ8A 1LO6A 3A8DA 1P10A 1GJ7B 1QBVH 1EX3A 4Q7YA 1YBWA 1O3MA 1OSSA 1P03A 1QHRB 1HJAB 1UTOA 1TMUH 3SGAE 4GAWA 4D7GA 2KR7A 1C2LA 2WPHS 3SI4H 2FTMA 1G3BA 3PMAB 2BVXH 2ZF0H 1QRZA 1O3JA 3LH3A 1FPCH 3VFEA 1C1MA 2FWWA 4Q4LA 3B23B 4HZHA 4OGXA 2W26A 1KIGH 1IQFA 2ZGHA 3TLOA 2CXVA 1K1MA 1XXFA 1BRUP 1QR3E 4I31A 1ANBA 1HCGA 1A3BH 1JBUH 1OP8A 5DO4H 3A8BA 3MOCA 3LGIA 3P70B 3QX5H 1GG6B 4NWKA 4X6PA 5GPIB 2VGCB 3MNSA 1O3CA 4ABBA 1Q3XA 1GHZA 4R8TB 3URDA 4X1QU 2XOKD 3SU0A 4Q7XA 4UFEH 1O2JA 1SGYE 4AYVB 1TX8A 3SJ8A 1KDQB 1DY8A 1NROH 1TMBH 4WH8A 3QN7A 1GVKB 1ARCA 3SUDA 1GG6C 1MQ6A 2FYQA 1HDTH 1YY3A 2VGCC 3NWUA 1O3KA 2PGQB 1IQHA 2BDHA 4AYYB 4B2AA 1PPFE 2ZFQH 3HATH 3SU3A 3MH4A 1DITH 1MTNB 1C1SA 3HGPA 2FOBA 2PLXA 1TWXB 1QJ1B 5GIBA 1GBEA 1V2KT 2QGRA 2PKAB 5GWZA 4MNYA 1GBJA 5DP6A 2VB0A 2Z6BD 3RXIA 4K2YA 4YLQH 4FUGA 5EXNA 2XRCA 3S69A 1MBMA 1MAXA 4B73A 5L2YH 2WUBA 5A8YA 3UTUH 1G2MA 2J95A 2BXUH 2ZCLP 3LGYA 4MTBA 2C8WB 3QTOH 1MTNC 2PFEA 3P8NA 1BMFD 3TJNA 3VB3A 3K65B 1ZLRA 1OHHD 4INHA 1EJMA 2BD2A 4MPVA 2OC0A 2GMTB 4UE7H 2ZWLH 1K1LA 1ELFA 2G5NA 4Q80A 2Y5HA 1EASA 3PV5A 1AKSA 1HAYB 2BTCE 1AY6H 3QDZB 2KCYA 5EOKA 1DSTA 3QK1A 4XRNA 4H6TA 4K1SA 3LKWA 5I25A 4U01A 1BHXF 1LHCH 1TABE 3RXOA 1KYNA 1FIWA 3E16B 1K1PA 1FN8A 3CS7A 5AFYH 3STIA 1IQGA 4TYDA 1BCUH 2JH6D 2WUCA 1A1RA 5FPSA 1QB6A 3SORA 3FP6E 3GCNA 3TPIZ 2EI7A 2ZDNA 3KNXA 2GGVB 3FZZA 1TALA 2BM2A 4LZ1H 1BQYA 1K1OA 3BG4C 1C1NA 2A4OA 5DJ7A 3RC4A 1O2VA 3ATMA 2JETC 1RTFB 2J9NA 1C5SA 2ZGXH 3H5CB 5EXLA 4LZ4B 1F5RA 4ZXXH 1YYY1 4B6EA 4RI0A 1O33A 1ELAA 3A86A 3EA7A 4ISOA 4YOIA 1S6LA 2V7QD 2BD3A 2WPKS 3LDXH 4B75A 1W7XH 4BXSA 2BX4A 1HAGE 2BDAA 3ZVDA 1GHXH 2F9PA 2B5TB 4M9FA 2QF5A 4KGAA 5LPEA 2QY0B 1YM0A 1ELGA 4BXWA 1IAUA 2AEIH 1FY3A 1EAWA 1LVOA 1Z8GA 2H9EH 4D7FA 4FU9A 5A0CA 2A2XH 4NIXA 1EOLA 3SNAA 1ZMLA 3OSYA 1KTTB 4CRDA 1MTUA 1M9UA 1WOFA 2Z3CA 3RXUA 2KCOA 2GKVE 2R2MB 3PYHA 1GMHG 3PV4A 5DGJA 4I8KA 4KTSA 5JPMH 5DP4A 2OXSA 1HGTH 2DE8A 3I78A 3TIUA 1VITG 2WHXA 5IDKA 2FS8A 4K60A 4RN6A 1K1JA 3T28A 3GY2A 3A8CA 2GVFA 1S5SA 4K1EA 9LPRA 3OY6U 1F0RA 2K0QA 3A7ZA 1K21H 3IWMA 2BY8X 4WJG2 3M36A 1B0EA 3GDVA 3NXPA 2PP6A 3FO8D 2A2QH 1WV7H 1YPHE 3ZVCA 4JZDH 4ASUD 3B8JA 1TBZH 3WW7A 1G32B 1AB9C 3MU1A 2PHBA 2UUKB 1GMCF 1C5TA 1OWDA 2GT8A 4X2YA 5H4IB 3F0PA 1UVSH 5AHGH 1AUJA 4E7RG 5HIYA 2J92A 4M7GA 3OY5U 4F4OC 4B6FA 1P2NA 1SOZA 1CHGA 2JJ2D 3GCTG 1W10U 2WYGA 4FOUC 1HFDA 1PPGE 1YPGH 4D8NA 1CGHA 1KDQA 3PM3A 1GI5A 2K8IA 2GJGA 5C0UA 1CGIE 1NN6A 2AIPA 1O5AB 2OD3B 4Z1MD 2SGPE 1YGCH 4I86A 3BTKE 1TGBA 2CHAB 3GICB 1Z1IA 2GCHG 2XNIA 1ZZZA 2XBYA 1EJAA 2C3SA 1FNIA 2PKAA 2RA3A 1A3EH 4MPWA 2VIWA 3ATLA 1HRTH 4Y76A 1WTGH 2BD7A 3V13A 2C8YB 1F92A 1INCA 1QB9A 3AW0A 2V6NA 2CHAC 2VINA 2XC0A 5EGMA 1DS2E 2LELA 2RA0A 3GY7A 4JZIA 3RC6A 3MO6A 2ZDLA 2KZ4A 1Z1JA 1XMNB 3PWCA 2AMPA 5EIYA 1TNLA 1Z71A 4UDWH 1V2ST 5JBTA 3A80A 2QIQA 1GGDB 5TCCA 3PWBA 1SQRA 3UQOA 5C17A 5DSFA 1O2QA 1EZSC 1V2OT 1VITH 1P2IA 3ZV9A 2FPZA 4I8HA 1COWD 2BDBA 2P95A 1ZHMA 1ZHPA 3VB5A 5HM2A 2BD5A 5JB9S 1BBRK 1PYTC 3P8GA 4JMYA 3ZVFA 1GGDC 1L2EA 1C5NH 4LXBH 2B0FA 2QCYA 1C2GA 1CBWB 2NU1E 4Y0YE 1C2EA 1DE7H 3RXGA 1W13U 1V2UT 1BMLA 1WUNH 2SGQE 3RC5A 3H7TA 3K9XB 2NU0E 1IQEA 3PLKA 2V3OH 1C5WB 4FUDA 5GCHF 1UK3A 1HAIH 2FODA 5DKMA 1KMHB 2RDLA 2B9LA 3LC5A 1C2HA 1F7ZA 4X1SU 2H5DA 1FDPA 4AZ2B 1GVZA 1S85A 3PB1E 2Z9JA 1FXYA 1CBWC 3EA8A 2F9UA 1RS0A 1AO5A 3BG8A 4NGAH 1NPMA 3OTJE 2ZHFH 3N7OA 1Y5BT 4JK6A 3A83A 1EOJA 1EFRD 3GOVB 2FIRH 5EPYA 3PROA 1O5DH 2ZPQA 5T6GA 5CMXH 1ANEA 4FUCA 1LVYA 3SV7A 5A8ZA 2XBVA 1HXEH 4RT0A 5DG6A 3SNDA 1O3EA 1FONA 1HAHH 2VU8E 2HWLB 5JBCS 2C8XB 3AASA 4X6MA 1GBHA 4GUXA 4XBCA 1NY22 5HKKD 2P3UB 4O97A 2C93B 1ETSH 3W94A 2JH5D 4Z6AH 1C2JA 1UK2A 2L6OA 3MH5A 4UFDH 4X2VA 4CRFA 5A0AE 1GJDB 1GBDA 1Y3WA 4UFGH 2A5IA 4IN1A 2ESTE 1O32A 2HVYB 2HVXA 3GYMA 1J17T 4DT4A 2CK3D 1KSNA 1TNIA 4Q7ZA 3RMMH 1VCWA 4NA8A 1OOKB 1UTLM 3RMOH 1K0HA 3LONA 2FOEA 3UOUA 1QZ8A 5KECA 4E06H 3E3TA 2D26C 3B9FH 1QGFA 1KLTA 1CGJE 2W7UA 1GCTB 2QF3A 5AVDA 4WY3A 2XWBI 2BVSH 5DPAA 1LMWB 2ALPA 4BAOB 2BY5X 2BB4A 2P94A 3SU1A 1BDAA 1T8OA 2ODPA 2ZU4A 2OTVA 2O9QA 2J98B 2ZTZA 5I46H 3H09A 1UVTH 1GL1A 2NWNA 1WCZA 3MU8A 5FHTA 1GHVH 1A0LA 2JH0D 3PMJA 1TGTA 1V2VT 3SV2H 2V0BA 1GCTC 3WY8A 1HYLA 2BQ7B 3A89A 1GI7B 1O3OA 3LJJA 4FUFA 1GHBG 4CRCA 5GXPA 1O2KA 1O36A 4H42U 2OCVB 4O03A 1ZTJA 1QIXB 3QZRA 1D3QB 2W3KA 5HIZA 1J9CH 3BEUA 3ZZ3A 2QYIA 3RLWH 2SGAA 3JZ1B 2BZ6H 2QXJA 2TGTA 2ZFFH 3RXJA 3VPKA 4A1XA 3UFAA 3WWBA 4X2WA 4FUEA 4Y11E 4CR9A 1AUTC 3TVJB 1V2RT 3NKKA 1GMDG 1KXCA 1LQEA 2BY9X 3NPSA 4BAMB 2AHME 1CSOE 1SVPA 1J14A 2XYAA 5EPNA 5KGOA 2I6QA 3GCHB 4A7IB 1ELTA 3HGNA 1VZQH 2FLBH 2ZHEH 2A5AA 2GZ7A 2YOLA 2ZFSA 2LP6A 2ODYB 2B8OH 5JDUB 1L4ZA 2G51A 1D3PB 2HNTF 1H8HD 3PRBA 5C2ZA 1QL8A 1QA7A 3FVFB 2EI8A 2H9HA 1BTUA 1CHOF 1AZ8A 4SGBE 1PQ8A 2LNCA 4NZLA 1L1GA 4INKA 4OGYA 2FTLE 1QBNA 1QJ7B 1ZPZA 1AN1E 1P01A 4XFQA 8ESTE 1YPLH 3RXMA 1FY5A 1GJAB 4JYTA 4J2YB 4XSKU 3SGQE 2PTNA 1XUFA 3RXRA 3RMNH 4A1TA 1DANH 1QA0A 2G81E 1PPZA 3F2GA 3M3TA 2Y81A 1DXPA 1CQQA 1GJ4H 1NRPH 4CR5A 4BAHB 2F9BH 2GCTB 4K8YA 4HI3A 2ZHQH 3GY4A 1LPZB 2WPDD 4X1RU 3ZZ4A 4DT7B 1BT7A 3STJA 2ZI2H 3RXFA 1SLVB 1A7SA 1Z8RA 4FXGH 1PPHE 5A0BA 1HNEE 4UFFH 1VKYA 3TGIE 1W11U 1LCYA 4WWYA 1MKXH 1BMAA 4A6LA 2Z9LA 1N1LA 3EQ0H 5T6FA 4K1TA 2KCPA 1A61H 2VJ1A 1SGPE 1TONA 1UTMA 2PUQH 1RXPA 4P02A 3T25A 3LU9B 1UCYH 8LPRA
chains in the Genus database with same CATH topology
1QBOA 3SUGA 1JRTA 3AAVA 4NG9H 1C1UH 1IOEA 1CA8B 1O3NA 1OX1A 3R0FA 1YPHC 1NRSH 1MKWH 3BTTE 2R0KA 3S7KB 2ANYA 1BMMH 5C1XA 1LVMA 3S7HB 1TMTH 1WU1A 1ZSLA 3U8RH 3P8FA 1MQ5A 1KLIH 2ZNKH 1A0HB 3ATWA 4B1TA 1ABJH 1SFQB 1DVAH 3UIRA 2GDDA 2ZCKP 3I77A 4ABFA 1C1PA 1O35A 3F9FA 1O2NA 3D65E 2NU3E 1QFKH 4OS1A 1HIAB 2O8MA 1AI8H 1RIWB 1SHYA 2Q6DA 1AFQB 4Y0ZE 2ZKSA 4J1YA 2OC1A 1H9LB 3QO6A 2F9OA 5E0JA 2Q6FA 4ZHMU 2FI5E 3M7TA 6ESTA 3MHWU 1T4UH 1FQ3A 1GDQA 7KMEH 3GY5A 3AW1A 1WTHD 5T3HA 1ESBA 3S9AA 1P12E 1CA0B 4D9QA 1NM6A 1JOUB 5TJXA 4NFFA 4DURA 1P3CA 1TNHA 3CS0A 3VB6A 2Q6GA 1DT2A 3SHCH 1O3LA 1RIWC 2OP9A 3RXAA 1AFQC 1YPMH 4AN7A 1H8IH 2VIOA 5C67A 3L33A 1UK4A 1C1QA 1RRKA 4WXIA 3SU4A 1O2SA 3VEQB 2IN2A 1L4DA 2A7CA 3MH6A 1CA0C 1BJUA 3KQCA 1AZZA 2HPQH 4Y10E 2R2WU 1TX6A 2OC7A 3M5MA 4ZHAA 3MYWA 3RXCA 5K7RA 1TPSA 3BSQA 2C8ZB 3ZZ8A 1SOTA 2AS9A 1T4VH 4AFSA 2XTTB 3GY6A 1O2UA 1IQMA 4X6OA 2O8UA 5DP7A 1U6QA 5DP3A 1BTHH 1F0UA 2FOCA 5EU8A 2D1JA 3ODFA 1P9SA 1BRCE 4YLUA 1SQOA 1DICA 1XM1A 3QGJA 4NSVA 1OP0A 3Q3YA 1TA2A 3BF6H 1XVMA 2YNBA 1FPHH 9ESTA 3NZIA 1O2ZA 3KCGH 1UVOA 2BOHB 2A4GA 4I8JA 5FBEA 4K69A 1OYQA 3LGUA 1BITA 1ORFA 2Y82A 2VVUA 1C5LH 2B7DH 3RXBA 2ANWA 1Z6JH 1RTLA 5FPYA 4TY6A 1BTWA 2NU4E 3D49H 2STAE 4BANB 1YCPK 1KXFA 1V2NT 1TBRH 2Z94A 2W5EA 2OBQA 1DLEA 1PYTD 3A7WA 7LPRA 1MZDA 2F9VA 1UHBB 2Y5GA 1OWKA 2A5KA 3TGJE 4D76A 4B2CA 4BNRA 6LPRA 3SV8A 5GJ4B 4CRAA 5JBAS 1J8AA 1SGDE 5HXFA 2ZQ2A 1P9UA 3LC3A 3OU0A 3BG4B 1OYTH 1TLDA 3A88A 4JZFH 1IQJA 1NZQH 2ZU2A 1GBMA 2JETB 3ZVAA 1GJ5H 1MTSA 4KELA 1C4Y2 1DPOA 1GMCG 1W3CA 2CGAA 3PTNA 3SZNA 4CH2B 1EQ9A 2AMDA 3A7VA 5AFZH 3UNRA 2Z9KA 1HXFH 4IC5A 1SGQE 2WPJS 4I8LA 4Y8YA 3KQDA 1ZSJA 1E34B 4GVUA 3SI3H 1G36A 2PTCE 3LGTA 1RD3B 4Y6DA 1C2FA 2M5TA 3V7TA 1C2DA 3RDZA 2A32A 1GI2A 4DIHH 3E6PH 1HUTH 4DOQA 2BDCA 1BHXB 1AIXH 1WQSA 4DGJA 3O8BA 5SGAE 1H1BA 2Y7XA 2J34A 1HAPH 3A85A 1NT1A 4D9RA 2BLWA 4JZ1A 3GYLB 2BXTH 1DWBH 5LPRA 3F9EA 4WH6A 3S9CA 5DK1A 2OINA 3V0XA 1O5CB 1D6WA 1HJ9A 4A5TS 1MD8A 2VH0A 2FDAA 2ANMH 3L3TA 4RKJB 4TY7A 1C5RA 1DXWA 4I33A 1Z6EA 2UWPA 3M5LA 3M5NA 2OQUA 1PPBH 1O37A 1GL0E 5E2OA 1A4WH 1HIAA 2ZC9H 2BLOA 3MO3A 3PMBB 2VWOA 3DT0H 1O2TA 1ESAA 1ZJDA 1A5GH 1MTWA 5A09A 1GDNA 2Y7ZA 1SPJA 1S83A 3SO3A 1F2SE 1AB9B 1O38A 4GCHF 2CJIA 1TIOA 1AGJA 2BYAX 1YLDA 4WXVA 1L1JA 1C2MA 1EPTB 2WYJA 1AE8H 2BDGA 1GJ8B 1SB1H 4NA7A 2VIPA 3E1XB 1UTQA 2XCFA 1LHEH 1GCDA 4OS7A 1FJSA 3QUMP 4WMEA 3Q3KA 2AGGX 4B74A 5GCHG 1EPTC 5EODA 1DOJA 1BA8B 2XWAA 1MD7A 5EQRA 3RU4E 1BTZA 2H5CA 1GHYH 2J38A 2FI3E 2BY6X 1C1OA 2ODQA 2ZG0H 4XBDA 1BTYA 1LDTT 1SMFE 2AERH 4AG2A 1NTPA 2SGDE 1W7GH 1GVLA 3MU0A 1V2PT 4DW2U 2TPIZ 1QURH 2G52A 1UCYE 1EXFA 3S0NA 1Z8JB 4HTCH 2W7SA 4BAKB 3SUEA 1TNJA 1X7AC 5F8XA 4X6NA 2BOKA 2QF0A 1TPOA 3M7UA 2FI4E 2EEKA 1EATA 1RFNA 2I6SA 3QZQA 1GBAA 3RXKA 1Y5UT 2PSYA 2WV5A 4HGCA 3P95A 1RJXB 1SL3A 2XBXA 3KIDU 4NFEA 1OWEA 2BLVA 2BDYA 1SGRE 2P16A 1FZZA 3HK6B 2VIVA 3O8DA 3RXLA 3TK6A 1C5VA 1O3BA 1W14U 5J4QA 1QRWA 3Q3XA 1TX7A 1AFEH 4I32A 4YZUA 1NC6A 2UUYA 5F8TA 8GCHF 2CF9H 3ZVGA 1GHWH 4FVBA 2QXHA 1UHBA 4ZROA 1ZPCA 1OPHB 2QXGA 3ESTA 2AH4X 1Q31A 4ZAEA 4INLA 2FZZA 1O2XA 4AFQA 1P2QA 1KTSB 1C1RA 1MU8B 4ABAA 1XUJA 5E0HA 1DFPA 1KXAA 1OP2A 1EP6A 3A7XA 4IN2A 3VGCB 1C5YB 3P92A 1IQIA 3MFJA 3MWIU 1P2OA 3O8CA 3BTQE 2VVVA 2ZHDA 5C5NA 1SGFG 4CRGA 4AB9A 2AFQB 4YM9A 3U98H 3BTWE 4ISHH 2BD4A 1CVWH 1EZUC 4THNH 4Y7AA 2VIQA 1EUFA 3U8OH 3VGCC 1C9TA 3FANA 2BQWB 1HAVA 5ESBA 1NRRH 1L1NA 2WPLS 3SJ9A 2HLCA 3D23A 1C5OH 1C5UA 1C2KA 3M37A 2Y6TA 4BTUB 4DVAU 1NESE 3AVZA 2ZU5A 1P05A 4JYVH 3OX7U 4X2XA 1MMJN 2WPMS 1O5FH 2ZPSA 2F3CE 3U8TH 2P8OB 1OWJA 1YLCA 4TPYA 2AIQA 3PLBA 1NRQH 3KGPA 3K6YA 1S81A 5LH8A 3ZZCA 4Y71A 4Y79A 1OWHA 3M7QA 3MTYA 2Z7FE 4ZH8A 4TPIZ 1XUKA 5C1UA 1O2YA 2Y5FA 3RU4D 1FY1A 1TPPA 2P8OC 4ABDA 1TRMA 3BIVH 1O39A 3ZYDA 3UNQA 1GDUA 1V6DA 1MTVA 3DFLA 3L6PA 2ZZUH 4I8GA 5TCAA 5JB8S 4WMFA 1P8VC 1P57B 4U30A 3TJUA 3BTME 3ZVBA 1TNGA 3BN9A 1AE5A 2GT7A 4ZMAH 1G9IE 3SQHE 1PPCE 3U9AH 1ID5H 2GTBA 1T32A 1EPTA 1O2PA 2WPIS 1B7XB 1WBGB 1H9IE 2TRMA 2ZQ1A 1SGEE 1OXGA 5BRRE 2WINI 1TRYA 5IYTA 1TE0A 5LGOA 1AQ7A 3M3VA 1NFYA 3KQBA 4ZKOU 3C27B 4IS5A 4MDSA 2XXLA 3R3GB 1C5QA 1SGTA 4KKDA 2UUFB 1ZRBA 1EB2A 1OKXA 4X8SH 1S82A 4YO9A 1P2KA 1AWFH 1ZOMA 5E2PA 1E35B 2ASUB 5FCRA 2CMYA 5HM9A 1P09A 5L2ZH 3EYDA 1SHHB 2Z9IA 3M3SA 3T5FH 7GCHF 3SGBE 3ENSB 1D9IA 1MH0A 1J16A 1CT4E 3SQEE 1BBRH 1CU1A 1VJ9U 3KN2A 3ZZ7A 3VB4A 1MCVA 2OC8A 3GY3A 4JK5A 5F8ZA 3MU4A 2TIOA 3SNCA 1A5IA 1EAXA 3M61U 1O34A 1LHDH 1O2HA 4FU8A 4A1VA 1Y8TA 1GJ9B 1EAUA 3BEFB 3EE0B 1ETRH 5JBBS 3ZZAA 4AGKA 1CO7E 3UNSA 4DCDA 2PR3A 3E8LA 1VGCB 1Y3YA 1ELDE 1RTKA 1ZMJA 2GZ9A 1FUJA 3TITA 1ELEE 4DIIH 2PKSB 3A7TA 4ZKNU 2XW9A 4OS5A 2J4IA 3SV6A 1TGCA 2ULLA 3PLPA 1TOCB 4AORA 1HJ8A 1TOMH 1TRNA 3SV9A 3A87A 3TGKE 4LOYH 1JWTA 1VGCC 2V35A 1UTJA 1P11E 2H2ZA 1QY6A 4XBBA 1KLJH 2BQ6B 2PKSC 3RXEA 1TAWA 1C1VH 1V2QT 2TGPZ 4XDEA 1S0RA 1LPKB 3SHAH 4IC6A 1V2MT 1CT0E 1YKTA 1F0SA 1N6YA 4IGDA 1DM4B 4LK4A 2ZTXA 4NIVA 3QLPH 1NRNH 1K1NA 3HKJB 2FX6A 2KAIB 1FI8A 6GCHF 3ZZ5A 2HALA 4CBNA 3LH1A 3NK8A 1SR5C 2HNTC 1Z7KA 1W12U 4CH8B 1GBIA 4TWYA 1W8BH 2BDIA 4K3JA 4QT8C 3H7OA 3E0PB 3Q00A 5EQQA 2VIDA 4K5ZA 1L0ZA 1FY4A 2PWXA 4MPUA 2PSXA 1WYKA 5JYIA 2CV3A 2FM2A 1MZAA 1W2KH 4IMQA 2ANKH 2H6MA 2LPRA 2UUJB 4FUIA 4GSOA 3SNBA 2SFAA 3ZVEA 2ZCHP 2CF8H 1O3HA 2UWOA 2RCEA 4NSYA 4RKOB 7ESTE 4OS4A 2BX3A 1GHAF 2SGFE 1G3EA 1HPGA 3F1SB 1GJ6A 2C90B 1A2CH 3ZZ6A 2P59A 1KXBA 1ANCA 3ZZBA 1PPEE 1Y59T 1IQNA 3E90B 1C5XB 2CN0H 1MU6B 1AVWA 3A84A 4E7NA 2VNTA 1F0TA 3SU6A 1C2IA 2ZDMA 1P0SH 1O2LA 5DP5A 1RGQA 4FVDA 1PQAA 3P8OA 1ZGVA 1ZTLA 1AU8A 1SLWB 4YOGA 2H1UA 4Y7BA 2TGAA 2ZA5A 3T26A 1T8MA 1YPEH 1F5LA 1SG8B 1E38B 4PROA 1YPJH 3ATIA 4XOJA 3RUOA 1A0JA 2OUAA 5C5OA 5G4BA 4IW4E 4X8TH 1KY9A 3FZDA 3LT3A 1ABIH 1FY8E 2HPPH 2AMQA 1JXPA 2OLGA 1UVUH 5EW1H 3SJKA 3S9BA 2IOTA 1HJAC 1PJPA 2Y80A 2G8TA 1QJ6B 4ABJA 3F6UH 2J2UA 1TNKA 1S6FA 1DSUA 1V2TT 3RXVA 3ATKA 1SGFA 1ANDA 1Y3UA 2FS9A 1QQ4A 5L6NH 5PTPA 3UR9A 4IMZA 3TH4H 1GI3A 3LJOA 1BTPA 3OYPA 3Q77A 4DG4A 3EGKH 1K9OE 1W0YH 1QNJA 3IG6B 4KP0A 1O5GH 2AYWA 1GI1A 3TJVA 5EXMA 1N6XA 4A92A 3BTDE 3VXFH 1NO9H 3CENA 3RP2A 2TGDA 5HGGA 1DWEH 4GPGA 1DWCH 1V2LT 2TBSA 4AFUA 4RSPA 3DA9B 4MG3A 1B0FA 3SNEA 1PQ7A 4NZQA 1O2RA 3E0NB 1GBFA 1YP9A 4XE4A 1WAYB 3V12A 2THFB 3RXPA 4FU7A 4ZXYH 2Q1JA 3U1JB 2FXRA 1BRAA 3BTEE 1ZMNA 4GCHG 2GV6A 2QA9E 1LVBA 1BB0B 3IITA 5GDSH 2D8WA 2ZECA 4ABIA 1BUIA 1HBTH 2GP9B 1D3TB 5B6OA 2A1DB 2O8LA 1UTPA 1E0FD 2VWMA 2KAIA 2GX4A 5HMAA 1E36B 1V2WT 2SNVA 4NA9H 1THSH 1EKBB 3U69H 3SOSA 1GI8B 3P6ZB 3TK5A 1BTXA 5C3NA 1SGCA 3F68H 1T8LA 1JIMA 1BJVA 1FIZA 1HAVB 4B76A 3RXSA 2GMTC 2ZGCA 2BY7X 1KXEA 2FO9A 5DP8A 8KME2 1D6RA 3SUFA 1QRXA 1MCTA 1ZJKA 3MH7A 2PUXB 1LQDB 2PV9B 1BBRE 3DHKH 1LKAA 1AMHA 1TYNA 4ABHA 1EAIA 2FOHA 1ACBE 5C20A 2EA3A 1W0ZU 1SSXA 1TFXA 2QN5T 1UTNA 3RXDA 3KL6A 1FAXA 1P06A 1ZYOA 3HPTB 4NCYA 1IHSH 1T8NA 1VR1H 3RXHA 3SJIA 2G55A 1C4V2 1JMOH 8GCHG 2HNTE 5EQSA 4MNVA 1XUGA 2PGBB 4U32A 1H9HE 1AVXA 1PQ5A 2AGIX 2JKHA 2YNAA 3FAOA 1DDJA 5LPFA 5E0GA 1O3GA 1SI5H 2Z9GA 4DY7B 2WV4A 2P3FH 4DJZB 3D62A 4WMDA 5AF9H 2G4UA 1WSSH 2K1QA 5ETXA 2ALVA 2IJOB 1UO6A 3A81A 4F49A 1GI6A 5K0HA 3ITIA 1THPB 1EP5A 1BRBE 1Y5AT 1HV7A 1MUEB 4ISNA 3UWIA 1F5KU 2FESH 2FOAA 1VJAU 5CHAB 1O31A 1Y3VA 4FUHA 1PFXC 2ZDAH 3BEIB 1T7CA 2QXIA 1DUAA 1YCPH 2F9NA 2Z3EA 4B2BA 2XC4A 1GI9B 2J94A 4I7YH 3UWJH 2G5VA 1QCPA 2G00A 4IBLH 2HRVA 3ZZ9A 5L30H 5CHAC 3SW2B 1TA6A 3EDXB 1O3FA 1HAZB 2DUCA 1AWHB 3K2UA 3RXTA 4Q2KA 2ZFPH 4Y8ZA 4JZEH 1ZR0A 1QQUA 2ZIQH 1AHTH 1P2MA 1ZTKA 1NFUA 2O8TA 3ELAH 3VXEH 1ZHRA 1P2JA 4BAQB 4ISIH 3PMHB 3HKIB 3VB7A 4BTIB 2F91A 5J4SA 2XCNA 2ZEBA 3UREA 4BOHA 1G3DA 2R0LA 3QTVH 1EB1H 2FOMB 3T2NA 4ASHA 1O2MA 2BVRH 5A8XA 2A4QA 1G3CA 1YC0A 3MI4A 3BTFE 3PO1B 2R9PA 2SGEE 2AGEX 2GDEH 3A8AA 4X8UH 1O2WA 3TK9A 1TBQH 1K2I1 5F03A 3TH3H 1MAYA 2ZPRA 3V3MA 3ZZDA 1C1TA 3M5OA 4X8VH 2BHGA 4WF8A 2GV7A