1V2TT

Trypsin inhibitor in complex with bovine trypsin variant x(ssfi.glu)bt.b4
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Understanding protein-ligand interactions: the price of protein flexibility
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2tT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2tT02
3GY8A 1S82A 4FUFA 2ZQ2A 5A0CA 2OLGA 1HYLA 1Q2WA 1NESE 1MD7A 4ESTE 2H9EH 4IMZA 4ABBA 3UNQA 3A88A 1K28D 4ABIA 1MTVA 1P04A 1ZOMA 4OGXA 1MCTA 2ZHDA 1C2JA 4BXWA 1AUTC 2P16A 3VB6A 1YC0A 1TX7A 4X1QU 3E16B 1LMWB 5HYOA 2VNTA 1DSUA 1EAXA 3VXFH 2XYAA 2NU1E 3WY8A 4ZXXH 1AKSA 4X2YA 4ISLA 1F0TA 1H8DH 1TGSZ 3RXCA 1C1WH 1OPHB 3T29A 4K69A 2C8WB 2TGPZ 2ZHWH 3A7YA 2XNIA 8GCHF 3MO3A 4I8JA 4CRFA 3AW0A 3I78A 1AKSB 1BTWA 1TIOA 2HPQH 3GDUA 1TBQH 4FVBA 3SJIA 2ULLA 5EG4A 2XXLA 2XWBI 3QTOH 1NN6A 2ODPA 4MTBA 1BIOA 3P17H 4BAMB 3GY3A 1XUHA 3TK9A 1F0RA 1HAPH 3M5NA 1ZJKA 2FOMB 1EB1H 3LH1A 1T4VH 5FCKA 1B5GH 1TPPA 2ZGBH 2Q6DA 2FDAA 1S0QA 1VCPA 1O5BB 4ISOA 4LXBH 3NWUA 3BTFE 2OTVA 2W3KA 1AO5A 2CF8H 1BOQA 2R3UA 1ESBA 2SNWA 3PROA 1Y3UA 1K2I1 1HAZB 1GHAG 2BXTH 1AVGH 1UVSH 2GKVE 4CH8B 3P70B 5LPRA 2UUKB 2A32A 9LPRA 1CHGA 2FOAA 5A09A 1DXWA 3BEIB 1FAXA 1DVAH 5E2OA 3UPEA 1FLEE 2HNTC 4KGAA 4CRCA 1N8OB 3ZVBA 1A2CH 1IQEA 1E36B 4A6LA 1V2WT 3LC5A 4WH6A 3PV4A 3RXVA 1EKBB 2RDLA 3MYWA 3UQVA 4NIYA 3M35A 2JKHA 4FUIA 1EZSC 1O3GA 1P2QA 1IAUA 1FMGA 1NS3A 2XTTB 3BEFB 4OS5A 5A2MH 1UTNA 1BHXB 1W0ZU 1K22H 1CQQA 2D2DA 4RN6A 1ETRH 3SU2A 2A4RA 1ZSLA 1GI6A 1P2NA 2SGDE 3RXEA 3S7KB 4E7NA 5DPAA 2EC9H 1S81A 1QJ6B 5DG6A 1YF4A 1W3CA 3A7XA 5AF9H 3ODDA 1SG8B 2BY6X 1EUFA 4DY7B 3GY4A 1SBWA 1QURH 5J4QA 4D7FA 5FXLA 2QF0A 1K1NA 4ZH8A 2FI5E 4UEHH 1T8MA 1RTLA 5C2ZA 2ESTE 3SUGA 1O2VA 5ESBA 1ELTA 3A83A 2UUFB 2ODYB 2J9NA 4ZAEA 3DHKH 2FODA 5A8ZA 1T8NA 1EX3A 3PO1B 1IQLA 2ZFQH 4KP0A 2FS8A 3LGIA 3LOXA 1HXEH 2VH6A 4AG1A 1DUAA 2Z3EA 1U6QA 3PM3A 2FIRH 2JH0D 1SQTA 1G3DA 1KXDA 1SGRE 3TJNA 1O3IA 1PPZA 2CXVA 1NT1A 3D23A 3C1KA 1AVWA 3PO1C 4AB8A 4BAKB 1W7GH 4Y8XA 3RU4E 2I6SA 1KLIH 1UCYK 3PLBA 1C5OH 2HVXA 2ZPRA 1Z1JA 4ABFA 3O8BA 2Z3CA 2FOEA 1P10A 2VVVA 2XC0A 3RM2H 3LONA 2GT8A 2G8TA 2PUXB 3BTWE 3NPSA 3PWCA 4AFSA 1G3CA 4GUXA 3EE0B 3ZVEA 2TGDA 1P2OA 1YCPM 3PLPA 1P09A 1BUIA 3RXMA 2F3CE 1FY8E 2BY8X 2ANMH 2ZC9H 1O38A 2P95A 1QQ4A 1AUJA 3PMJA 1J8AA 1OYQA 4I8HA 2QXIA 4KTSA 3M7QA 2Y81A 1BITA 2A45B 2P3TB 2AGGX 3PTBA 4HTCH 1C1MA 1GHAF 4XSKU 5LPFA 3RMMH 1TA6A 1DUEA 1H9IE 2D1JA 4HGCA 3LKWA 2WPIS 3KQEA 5E0JA 1O2MA 2BLVA 2G4UA 2WUBA 2YNBA 4XOJA 3MU4A 4NCYA 3UWIA 1C2FA 1MKWH 3BIVH 3PMAB 3SHCH 3MTYA 3U8TH 2O8MA 4OS6A 1DITH 2J38A 1BA8B 1HFDA 1LKAA 3BSQA 4D7GA 4LK4A 5E0HA 1GMCG 4SGAE 4UFGH 1EZUC 4K8BA 1TNIA 1FQ3A 4INLA 4AYVB 3SJKA 1GCDA 2BM2A 1C1PA 3ZZBA 2OCVB 2C8XB 4CHAB 1OP2A 1CT0E 1XKBC 1C2EA 5C67A 2P3FH 3OY5U 2AEIH 3EA9A 1TGCA 4H4FA 1XVOA 2BX4A 3GY5A 2ZFTA 1MTWA 4YESB 3RP2A 4CHAC 2BY7X 3KQBA 1NFWA 4FUCA 4CH2B 1FPCH 1Y3YA 1C1TA 1LPKB 2A2XH 1GHBG 2GTBA 3OYPA 1LDTT 2VVCA 3TJOA 4NSVA 4XBBA 5EPNA 1O30A 6GCHG 2ZDAH 2ZF0H 2CHAB 1WQSA 2FOCA 4JZFH 2XBYA 4D9RA 1Y3XA 1V2VT 1B0FA 1ZGVA 1O2SA 1A7SA 2BD7A 1MUEB 4MDSA 4UE7H 2CHAC 3ZZ7A 3Q76A 2Z3DA 1G36A 1GHXH 3F9GA 4CRGA 3UOPA 1ZHRA 2Z9GA 3EQ0H 4FU8A 1QY6A 4FVDA 1FN8A 1J15A 5FX5A 1C2IA 4FUBA 4AOQA 1LPGB 1HUTH 2XC5A 1O3CA 4ZKOU 4O97A 2FM2A 1O2HA 4BAOB 4AN7A 1W0YH 5K0HA 4RSPA 3SW2B 5CHAB 1WCZA 4M7GA 1WV7H 3RXLA 1TMTH 5A0BA 3AAUA 1O36A 5L2ZH 1EOLA 3GCOA 1M9UA 3T25A 2BLQA 2UUYA 1QRZA 3BN9A 3DA9B 1GVZA 1HGTH 5IYTA 2H9TH 1TBRH 1ZTKA 2CGAA 1BMMH 1GL1A 1C5YB 1ELVA 5L30H 3F1SB 1P8VC 1KLJH 1L1JA 2W3IA 3F9FA 3B23B 4J1YA 3RXSA 1VGCC 1QHRB 5FPTA 1S6HA 4KTCA 1PPEE 4ABGA 5LPEA 5TJXA 1GBFA 2HLCA 2FXRA 1HIAB 5T6FA 1C1RA 3SU5A 4B75A 1QB1A 2WPJS 1OWDA 1PYTC 2ODQA 2ZCHP 1MTSA 3LPRA 4A5TS 2AMPA 1CA0B 2BLOA 2Y82A 1F0SA 3E0NB 2FO9A 3ZYEA 1YM0A 5AVDA 4FUJA 1F2SE 3A8CA 1MBQA 1C1SA 2FOBA 4AG2A 1V2RT 4K3JA 4Y11E 1CA0C 3AAVA 1RFNA 4NGAH 4Y8YA 3SI4H 3NCLA 4A92A 1IQMA 4FXGH 2Q1JA 1D3PB 4Q2KA 3MH5A 1ABIH 2D8WA 3IWMA 5FHTA 1GMCF 4NWKA 2PR3A 1GGDB 1NRPH 1TNGA 5DP5A 1SGFA 3E90B 4AGJA 1O2IA 3V7TA 3A89A 3LJOA 2F9PA 2YNAA 1GGDC 3R0FA 1YPLH 3JZ2B 1JBUH 1YYY1 3KQDA 4I7YH 1O3JA 1YPHC 2BDGA 1MKWK 4FUEA 1OS8A 1BTZA 5E0GA 1OYTH 5EU8A 1TQ7B 1UTLM 1Y5AT 2G51A 3DFJA 2BZAA 1GHBF 4TYDA 1ELBA 6ESTA 1BRUP 2BDHA 1L4ZA 3A8DA 1FV9A 2R3YA 4BTTB 6GCHF 1O0DH 2Y7XA 1O5EH 3ZVDA 1W11U 2UUJB 4THNH 2PFEA 1GJ8B 3ZZCA 1TA2A 3SU0A 2OBOA 1O3DA 1KXCA 2OD3B 4E06H 2V35A 3ATWA 2XCFA 4YTAA 1V3XA 2GZ8A 4ZMAH 1IQGA 2AGIX 4DW2U 3KF2A 5GJ4B 4X6PA 3NK8A 5EOKA 1HAIH 3HK3B 2ZTYA 2B9LA 3GCNA 1G2MA 1SGNE 4JZEH 1JRSA 4I33A 3TNSA 2GCTB 4YLQH 4TWYA 3AVZA 4WMEA 4X6NA 3T28A 1EATA 2BDCA 6LPRA 4X1NU 2ALPA 5AHGH 1DE7H 1ABJH 3SO3A 2GCTC 2R0LA 1FIZA 1J9CH 3SORA 4AFUA 1TNKA 1PJPA 1INCA 2VGCB 4FU7A 4MPVA 8KME2 1EAIA 2BDAA 2NU3E 4U01A 3P95A 3ZZ8A 2B0FA 1A0LA 3QX5H 2VGCC 1C2GA 1SGCA 2Y5HA 1UTQA 4TY7A 1EAWA 4U32A 2PLXA 1QL8A 1FY1A 5FPSA 1C5QA 5C3NA 1KY9A 2Z6BD 1H8IH 1D3QB 5HGGA 2THFB 1DANH 1KXEA 5G4BA 1ZLRA 3FP6E 1BBRH 2WV4A 4B2CA 2OC1A 1LTOA 4AZ2B 1O2KA 1TGTA 3OY6U 4FU9A 1C2LA 4MNXA 1L4DA 4HFPB 1ZRKA 3V13A 1EZXC 1CSOE 1AB9B 1GJ5H 2GDEH 1V2LT 1JWTA 2VIWA 1QBVH 4ZROA 4IC5A 4OS1A 3U98H 1PPHE 1WSSH 3Q3XA 1GMDF 1AB9C 5H4IB 1K1OA 3LJJA 2QC2A 3L3TA 1AHTH 1C5RA 3AASA 1DWDH 1W7XH 3GDVA 4UFDH 4TY6A 2W7SA 3ZVGA 1PQ7A 1EPTB 1GG6B 1LCYA 1JIRA 3RC4A 1OP8A 1ZTLA 1C5ZB 3PMHB 5JB8S 1NZQH 1A0JA 4IS5A 2PUQH 1A5IA 2PW8H 1MU6B 5GPIB 1UJ1A 1EPTC 1OX1A 1EZQA 5JBTA 1AIXH 1UVUH 5C1UA 3M7TA 1GBKA 3GICB 3N7OA 2PTNA 2UWPA 1W14U 1AWHB 4JYVH 1TE0A 2ZI2H 3PLKA 1MMJN 3RM0H 1ANCA 2FI3E 1CA8B 3ATKA 1W13U 2AH4X 2SGQE 2VH0A 3RXRA 3LGWA 2GV7A 1AWFH 1P05A 1TMBH 4B74A 3SU4A 1XXFA 4X6OA 1LHGH 4Q7XA 2J4IA 2VJ1A 2HALA 2F9OA 2BVRH 3SNEA 2H6MA 1AZ8A 4OS7A 1A3EH 5L2YH 3A87A 2Y6TA 1LHEH 4I32A 3PTNA 2GCHG 3AW1A 4YLUA 3GCTG 4NSYA 1WUNH 3SNCA 3H7TA 1LVBA 1GBJA 4TWWA 1CT2E 4IBLH 1C5UA 1C4Y2 1V2NT 3D65E 1YPKH 1ZR0A 4B1TA 5TCCA 1IQNA 1SGIB 5EQRA 1EXFA 2Z9IA 2PGQB 2VVUA 1V2TT 1Y8TA 3ZYDA 4IMQA 2GZ9A 2HNTE 4GVUA 4NA7A 3MWIU 3KN2A 2PSXA 2RG3A 3KNXA 4UFFH 2ZGHA 3H7OA 1LPZB 3SUEA 4NFEA 1O3KA 1PPCE 3RXOA 4LOYH 5EW1H 1TLDA 3EYDA 2R0KA 1ZPZA 4YZUA 1D9IA 2O8WA 1UMAH 3ATIA 4E05H 3H5CB 2C8YB 3EDXB 2ZGJA 2RA3A 1CO7E 4X1PU 2GZ7A 1SFIA 1YBWA 3UR9A 1UTKA 2R9PA 4Y71A 1BTXA 1DWEH 3VB3A 5F6MA 1SMFE 4LZ1H 4ZXYH 3URCA 5HM2A 5I46H 2ZCLP 4D76A 1SGYE 2QYIA 1KXFA 3SU6A 1PQ8A 3MU8A 1P2KA 2STAE 1D4PB 3ZZ4A 3BV9B 3GYLB 1BBRK 4YOIA 4A7IB 4OS2A 4Z6AH 1TRNA 1SQOA 2BQWB 1P9UA 1DY8A 1PFXC 2XBXA 1JIMA 1O31A 1KSNA 1O3NA 5C1YA 5A8XA 4MPXA 2Z9JA 2HRVA 2AIQA 1FPHH 1G9IE 1C4V2 1E37B 1QNJA 3DFLA 1GHYH 3SUDA 1S85A 2VIQA 4X1SU 1THPB 4MNWA 3SV8A 2OXSA 1KXBA 1SLUB 1L1GA 3T2NA 8LPRA 1AY6H 4A1XA 4DURA 4FUGA 1DM4B 5GCHG 4UD9H 3Q3KA 2K1QA 3Q77A 4BTUB 4ZKRU 3GY2A 3RLWH 3S9CA 2FX4A 1RJXB 1A46H 1BTPA 1OWHA 3LDXH 1AN1E 2ZFPH 2ZKSA 3BTTE 2AFQB 1QJ1B 1G37A 3P8FA 4ASHA 4K2YA 4YO9A 5EXMA 3A8BA 3RXUA 3E91A 2AMDA 5EXLA 5DO4H 1V2JT 2GCHF 3GCTF 2WV5A 5JBCS 4Y6DA 4TPIZ 1YPMH 1IQJA 3RXBA 1BTUA 1SLXB 2ZZUH 5DP3A 1OOKB 3SV2H 2TIOA 4FUDA 2FOFA 1E35B 1XUGA 1LHDH 1HV7A 2W26A 1DY9A 4NA8A 4Q7ZA 1P3EA 2BD4A 1AMHA 1Z8JB 1RTFB 2J92A 1ZHMA 1MKXH 1QBOA 1AQ7A 2F9NA 2BHGA 5DP9A 1RRKA 4CBNA 1KTSB 3MHWU 2JH5D 1UK3A 4WXIA 3TJVA 2VWOA 3GISB 1C9TA 3RXFA 5JPMH 2EA3A 3KEEA 2ZTXA 2TGAA 1SGEE 3ESTA 1KLTA 2OQ5A 2Q6GA 2PKAB 3PMBB 3GCHC 1EJMA 1FIWA 1GBDA 2WPLS 1TPOA 1Q31A 2FOHA 5JB9S 4X8UH 2EEKA 1GBTA 4J2YB 1DLEA 2BD5A 2OQUA 3A85A 2ILNA 3Q00A 3R3GB 1QB9A 1MH0A 3LT3A 2OC7A 3E0PB 2XWAA 2QCYA 4BAQB 3RXHA 3SU1A 2IPHA 5HMAA 1HXFH 3MMGA 1EB2A 3CS7A 3MU0A 2PKSC 4ZHMU 3ENSB 3RXGA 4O03A 5LGOA 3ZV9A 1AFEH 1EJAA 1WYKA 2BD3A 4ZHAA 1GJCB 3SV6A 1ZSKA 1AFQB 5DP8A 2ZHQH 2BYAX 1MAYA 3P8GA 2BD8A 4MPWA 4WH8A 5FBEA 2ZU3A 2C8ZB 2NU4E 1GHVH 3HKIB 1F5RA 2PTCE 2LNCA 1AFQC 3K6YA 1ZGIA 2AS9A 3ZZ5A 2ZHEH 2G5VA 1BRAA 5EQSA 3RUOA 1FAKH 4B76A 1GHWH 2BTCE 1MU8B 5T6DA 4NZQA 4GAWA 1IQIA 3M5LA 1DT2A 1E34B 5GCHF 2M5TA 2IOTA 1HJAB 1QFKH 1TYNA 3A84A 3O8RA 1QJ7B 4WMFA 2VIVA 1NM6A 2BXUH 1C1NA 1C5MD 1SGTA 1YLCA 1ARCA 2FTLE 3TITA 1HNEE 1O3AA 1GDNA 5DKMA 1HJAC 2A0QB 3K9XB 2A4GA 3O8DA 2FLBH 3W95A 4MQAA 1ESTA 1V2UT 4KELA 4D9QA 4AGKA 1T31A 3FAOA 1T8OA 1G3BA 2Z9KA 1N1LA 3TK6A 2ZFRH 1TOCB 2BDBA 1QBNA 1SHHB 1VGCB 2O9QA 4YM9A 1XKAC 3BTGE 1A5GH 2CV3A 1RGQA 1P2MA 4GHQA 3TIUA 1UCYE 1D6RA 5HXFA 3FP7E 1HIAA 1AI8H 1C5TA 2Q6FA 3QTVH 1KYNA 1YCPH 1H9HE 1UVTH 1O2TA 1TNJA 3MO6A 1S84A 3U1JB 4Y10E 1EJNA 1TRMA 2A4QA 3U1IB 2BMGB 1C1UH 3M3TA 1LHFH 1KDQA 4O3TA 1G30B 3MNXA 1NTPA 3HATH 3SUFA 2SGPE 3QO6A 4BXSA 1FONA 1GI3A 1KDQB 3C27B 1HAGE 2QIQA 2C3SA 3S7HB 1ELDE 2GGVB 1P9SA 5C20A 1XX9A 3UOUA 2H5DA 1BRBE 1Z6EA 1VITH 4GHTA 1NO9H 3LU9B 5F03A 1CGJE 1AZZA 1O33A 1C5LH 2BOKA 1A5HA 2WYGA 2HPPH 1C9PA 1GMDG 1Z71A 3KL6A 2A7HA 4CRBA 1HDTH 3RU4D 3EGKH 1UVOA 1YPHE 1GI5A 4JZDH 2Y5FA 1P03A 1C5NH 1MKXK 1ZPBA 1GPZA 1YPGH 1P57B 3TH2H 1C5WB 5FBIA 1LQEA 2BVSH 3ZZ9A 2A5IA 1MZDA 1GI8B 4CRDA 3BTHE 3SV9A 3GDSA 4ABAA 2STBE 2W7UA 1TB6H 4HI3A 4R8TB 3SJ9A 3V12A 1V2MT 1MD8A 1L0ZA 1PPFE 2XBVA 3MU5A 1BJUA 3QN7A 4AORA 7KMEH 1J17T 1Z8GA 1ZTJA 2ZFFH 4Q7YA 3NZIA 4JZ1A 2CN0H 1GJ4H 1TABE 1TNHA 4INHA 3M3VA 2C93B 2WPKS 3DT0H 4ABEA 3OU0A 1UHBA 1GBIA 3SGAE 2AYWA 2CJIA 3K6ZA 1S6FA 2ZNKH 1THSH 1GDUA 1K1PA 3FFGA 1UHBB 1VJAU 1OSSA 1JRTA 4NG9H 1SLWB 1Z6JH 2ZDKA 1CE5A 1JOUB 1XUIA 1GJ9B 3QLPH 1CHOG 3QGJA 3TH3H 3IITA 2BLWA 2G52A 1BTHH 3DUXH 1XUJA 2EI7A 1WTGH 1EAUA 3A7ZA 2PHBA 3S69A 4WWYA 3BTME 1B0EA 3MU1A 2KAIB 4BAHB 1IQKA 4B73A 1DPOA 2ANWA 5B6OA 2EI8A 1NRNH 2P8OC 1J14A 3D62A 4MNYA 1TWXB 2WYJA 3RXDA 4BANB 5EW2H 4AX9H 3U69H 3UIRA 1HAYB 2JETB 5TCAA 4CREA 4JZIA 3L6PA 4MLFB 1TOMH 4DG4A 2J95A 4X8TH 1HCGA 2C90B 2QN5T 1LVYA 4WJG2 1NPMA 2JETC 1QR3E 2V6NA 1DFPA 1O39A 2BDYA 3A81A 2ANKH 4DGJA 1A4WH 5DGJA 1IOEA 1MAXA 1UTPA 3BIUH 3LGTA 4K5ZA 1F7ZA 4OGYA 2V0BA 1O2ZA 1G2LA 1P06A 4UDWH 1O2NA 2GT7A 3CENA 3FP8E 1KTTB 4JK6A 3RC6A 1ZYOA 1GJ7B 2FYQA 1MZAA 1S5SA 2G00A 4GPGA 1THRH 4MPUA 3ZZ6A 4DIIH 1ARBA 2LPRA 4YT7H 1TALA 2GDDA 1C4U2 4I31A 5K7RA 2GVFA 2CMYA 2IJOB 1YCPK 1SPJA 3RXAA 2GD4B 2ZP0H 3U8OH 1NROH 1EPTA 5C1XA 2RCEA 2H9HA 5I25A 3U9AH 2VWMA 4K8YA 1SHYA 2F9BH 2J94A 3LGUA 3LH3A 3RXPA 3URDA 4A1VA 3TGJE 5IDKA 1C5VA 3RXQA 5JYIA 1KXAA 2SNVA 4AYYB 1GCTB 4DOQA 4Y7BA 3UNSA 4UFEH 3A7VA 3F9EA 2SGEE 3A7TA 5F8ZA 5JDUB 4HZHA 2RA0A 2ANYA 1NRQH 2C4FH 1FJSA 4H6SB 3QZQA 3SNBA 1GCTC 4DVAU 1ETTH 1DXPA 3B8JA 3ITIA 3SBKA 5GWZA 1RIWB 1DICA 1EP6A 1HAOH 1MQ5A 1PYTD 1MBMA 1DLKB 3MI4A 3SU3A 1NFUA 5EXNA 4K60A 1D3DB 1UTJA 4CBOA 3A80A 1RIWC 2XCNA 1T4UH 3MNSA 4I8LA 4JCNA 3GYMA 5GXPA 1ELCA 2D26C 1LKBA 1UTOA 3ZV8A 4BNRA 2H1UA 2GX4A 3QZRA 1NRSH 3ATMA 4R0IA 4Q80A 1HAHH 5T6GA 4XFQA 2A5AA 1A3BH 4IN1A 4JMYA 1GMHG 2SFAA 3M3SA 1WAYB 1YP9A 5FX6A 1O2OA 3U8RH 3VB7A 1CHOF 1RTKA 1YKTA 3LC3A 1GJ6A 1SFQB 1O3MA 6CHAB 1SC8U 3OTJE 1ESAA 1K9OE 2BX3A 3P92A 1GHZA 3BTDE 5CE1A 1O3PB 2FTMA 2G4TA 1C2HA 3BTEE 2OC0A 4DCDA 3BEUA 1N6XA 6CHAC 1GBHA 2ZPQA 3GY6A 2YOLA 1Y3VA 2AMQA 4DT7B 3TGIE 3HPTB 3ZZAA 4DIHH 1V6DA 1C5XB 1OP0A 1YPEH 3BF6H 3SHAH 3M37A 5LH8A 1W10U 2EI6A 3I77A 1BB0B 1NU9A 2B5TB 3QK1A 4WF8A 3ZVCA 1NU7B 3L33A 2HOBA 1GBLA 5FPYA 1H9LB 4E7RG 1XMNB 2Z9LA 1VCWA 1NRRH 1ELFA 1OKXA 5AFYH 2FMJA 1W8BH 5EODA 2R2WU 1GI2A 2QY0B 1J16A 4RKJB 3SQEE 4GLYA 3M5MA 1F5LA 4FUHA 4AFQA 1QIXB 1ZMJA 3QWCH 1Z8RA 3UQOA 1AU8A 1VCQA 3V3MA 3VB5A 1PQAA 5DP7A 2ZFSA 1E0FD 1QA0A 1VITG 1O3OA 1GI7B 3JZ1B 1OWJA 4KKDA 2AERH 3UFAA 4QT8C 1IQFA 3TPIZ 1QCPA 1IHTH 3EA7A 4O9VA 4B71A 5BPEA 1K1JA 3SQHE 4XDEA 3VB4A 2QV1A 1ZZZA 1QB6A 3SGBE 1SGQE 1N8OC 1O3FA 1K1IA 1FY4A 1Z8IB 1TPAE 1P02A 1TQ0B 1TBZH 1SQAA 4F4OC 4I8GA 1OXGA 4YOGA 3P6ZB 4Y79A 1P11E 1O2PA 5PTPA 3T26A 2ZECA 1OWEA 4X8SH 1VJ9U 1N6YA 2P93A 4ZKNU 3PYHA 4ZUHA 1GJBB 3ZZDA 1F92A 1TGBA 3FZZA 1ANEA 2OINA 2PWXA 2ZTZA 3RMOH 4AB9A 2H5CA 2Y80A 1GBBA 1Q3XA 2VINA 3UTUH 2FS9A 4INKA 4WMDA 1ELAA 1O2WA 1LHCH 1O3LA 1QRXA 2FP7B 1BMNH 5SGAE 3TH4H 1HRTH 1P12E 3UREA 3I29A 4NA9H 1A1RA 9ESTA 2ALVA 1EOJA 3MFJA 4U30A 1LVMA 1GMHF 4NIVA 1ZRBA 1P2JA 3FZDA 1WU1A 3TLOA 5L6NH 3DD2H 1O2JA 1FXYA 3EA8A 1BQYA 2HNTF 1CT4E 3RMNH 1TNLA 3M36A 1NY22 1TMUH 4NIXA 2AIPA 1MQ6A 1YGCH 3UY9A 4Y8ZA 3Q3YA 3ELAH 3SN8A 1PPBH 2DUCA 1BT7A 2F9VA 4OS4A 2BD9A 4CR5A 2J34A 3TGKE 1HBTH 2ASUB 2FEQH 5JBBS 2VWNA 1AE8H 3BTKE 1SGDE 4NIWA 2V3HH 2ZEBA 4K1EA 1O3HA 1Y5UT 3MH4A 3FANA 2BD2A 5EGMA 4LZ4B 1TPSA 4GSOA 5C5NA 2UWOA 3HGPA 1CVWH 2A1DB 2FI4E 1GL0E 1O5FH 1SLVB 3VGCB 1XUKA 2WPHS 1NFXA 1E38B 1BHXF 1L1NA 2P94A 1V2PT 3TK5A 1K21H 1K1MA 1Y3WA 3W94A 3E3TA 1O5GH 3NKKA 3GCHB 2GMTB 4XBCA 4WY3A 2PKAA 3VGCC 1VZQH 3KQCA 5ETXA 2DE9A 1OWKA 1OWIA 2BQ6B 1LO6A 2OBQA 1UK4A 2WINI 3STJA 1ANBA 2FOGA 2O8TA 1W12U 5CMXH 1L2EA 2GMTC 3BG8A 3SI3H 4BTIB 3RU4T 2F9UA 2PSYA 2ZG0H 3ZVFA 2ZA5A 3A82A 1DX5M 1KIGH 2ZGCA 3RDZA 3T5FH 3RC5A 5A0AE 1GVKB 1DWBH 1C1VH 1VITF 1PQ5A 2OC8A 2G81E 1QQUA 4NWLA 2PKSB 4I8KA 1TRYA 7GCHG 4X8VH 4X2VA 4XE4A 2V3OH 1EP5A 3E6PH 2NU0E 3P8NA 1SVPA 2I6QA 3RXTA 4BOHA 2A5KA 2QA9E 1C2KA 8ESTE 4WXVA 5GDSH 2UWLA 1PPGE 1ID5H 1WBGB 2FPZA 2Y5GA 2BZ6H 2A7JA 1CGIE 1SOZA 3PWBA 2JH6D 4X1RU 1MTNB 1BMAA 1GWAA 2VIOA 1AVXA 1O2YA 4NFFA 1H1BA 1TGNA 2Y7ZA 1V2ST 1C1OA 1O2UA 1G32B 2P59A 7LPRA 4JK5A 1MTNC 3RXIA 3S9BA 3LGVA 1BBRE 1IQHA 2ZQ1A 3VPKA 1P0SH 5JBAS 5DK1A 1O2LA 1CBWB 1P2IA 4MVNA 3RXKA 1V2KT 2F91A 3B9FH 1O2GH 4UONA 4K1TA 1GI1A 1QRWA 2IN2A 1GBMA 4VGCB 1V2QT 2XRCA 1JMOH 1DWCH 1DSTA 3T27A 1WTHD 3A7WA 1EASA 1CBWC 1GI0A 2G55A 4XBDA 4H6TA 1MTUA 3E1XB 2BB4A 1C1QA 3A8AA 4VGCC 3SOSA 2FYRA 4ISNA 1T7CA 2A2QH 1HPGA 3MOCA 4KTUA 1ETSH 1TAWA 1UVPA 3OSYA 3SJ8A 3QUMP 1BZXE 1Y5BT 4ISIH 3UWJH 1FUJA 2H2ZA 3KCGH 2CF9H 2O8LA 1ELEE 1CGHA 1RS0A 1C2MA 1LVOA 1GBEA 1T32A 4U2WA 3LGYA 4ZHLU 1GI4A 1SI5H 5DP4A 5BRRE 2QF3A 1P3CA 2VB0A 5F8TA 1C5PA 5J4SA 5CHAC 4ABJA 3SJOA 4MNVA 3M61U 1H4WA 2FESH 1F0UA 2A4OA 3RXJA 1GBAA 1BCUH 5DP6A 1F5KU 1W2KH 1FN6A 2F83A 4GCHG 1SGFG 3P8OA 3KGPA 1RXPA 1QTFA 2W5EA 4Y0YE 1QL7A 2VWLA 1O37A 1TFXA 1SL3A 1A61H 3UUZA 3K2UA 3ATLA 3NXPA 3CS0A 5C5OA 3MNCA 2BQ7B 4B2BA 1MCVA 1ZHPA 1ORFA 2GV6A 1VR1H 1BRCE 3RLYH 5ESTE 2ZPSA 1O5CB 2ZU4A 1O34A 3UNRA 4K1SA 2VU8E 4X6MA 1HLTH 1AGJA 1O32A 1SGPE 1TX6A 3V0XA 1BJVA 7GCHF 4TPYA 1GJAB 4X2XA 1HAXB 5T3HA 1D6WA 1TX8A 3F68H 3M5OA 3S9AA 2OUAA 1BDAA 1ZPCA 3HK6B 3VEQB 1YPJH 3SGQE 1DS2E 5DJ7A 2VIPA 2WPMS 3ZVAA 3RMLH 1C5SA 2AGEX 4ISHH 1WOFA 4Z0KA 5FAHA 3MH7A 1SB1H 4F49A 4RKOB 3TNTA 1SR5C 2ZHFH 3UR6A 3QDZB 4JYTA 1T8LA 4WVPE 2PV9B 4A1TA 1FY3A 1O3EA 2TPIZ 2ZDMA 1XUFA 5E2PA 4D8NA 1O35A 3S0NA 1UK2A 4YOJA 3F6UH 2SGAA 1FNIA 1O2QA 1HAVA 2BDIA 3TVJB 2BOHB 2KAIA 2P8OB 4X0WU 5GIBA 2BVXH 1ELGA 1YLDA 1FI8A 1DOJA 3HGNA 4ZKSU 1HAVB 2HGTH 2R2MB 4MG3A 1HJ8A 1XVMA 1V2OT 1FZZA 1SOTA 2QXJA 2VIDA 2ZU5A 2ZDVH 3T62A 2ZCKP 8GCHG 1P01A 1AE5A 3MO9A 1FDPA 2QAAA 3BTQE 3A86A 4ABHA 2BY5X 3STIA 1AD8H 4JYUH 1NC6A 5FCRA 2QXGA 2ZDLA 4IC6A 1FY5A 5AFZH 3HKJB 2ZU1A 2Z94A 4Y76A 4ABDA 4YT6H 1UTMA 3SZNA 3ZZ3A 5A8YA 1UO6A 2FZZA 1O5DH 1S83A 1K1LA 2P3UB 3G01A 3IG6B 1BTYA 2ZU2A 3PB1E 4H42U 4CR9A 1Y59T 1CU1A 2OP9A 1O2RA 4AFZA 1D3TB 1O5AB 4X2WA 1ZMLA 3VXEH 3ODFA 4GCHF 1JXPA 3KHVA 2J2UA 1IHSH 1NFYA 5E8EH 3KIDU 4DJZB 2XW9A 3BG4B 4IW4E 1A0HB 5F8XA 2QGRA 2PGBB 4NZLA 1RD3B 4PROA 4CRAA 1S0RA 1O2XA 2ZWLH 1C2DA 2QXHA 3TJUA 1BMLA 2GP9B 4Y7AA 1GI9B 2B8OH 2HWLB 3BG4C 3SNDA 3K65B 3EAJA 3M7UA 1G3EA 3FVFB 2SGFE 5EPYA 2A31A 1QGFA 1ACBE 3MH6A 2NU2E 2FX6A 1EQ9A 3O8CA 1XXDA 3GOVB 2DE8A 3VFEA 2G5NA 1QA7A 2Z7FE 3GY7A 3LIWA 1GDQA 2B7DH 1ZMNA 2FLRH 1B7XB 1Z7KA 2XBWA 1GVLA 5EQQA 3F9HA 4SGBE 1SSXA 3TU7H 2NWNA 4B2AA 1LQDB 2BY9X 1O3BA 2TRMA 1Z1IA 1ZSJA 5HM9A 4IN2A 1ANDA 1XM1A 2ZGXH 7ESTE 2FWWA 2A7CA 2XC4A 3OX7U 1GJDB 1ZJDA 1GBCA 1HJ9A 4Y0ZE 1QL9A 3NUMA 1WQVH 2O8UA 2WUCA 4IGDA 1X7AC 2ZIQH 1GG6C 2TGTA 3E8LA 3QGNB 1UCYH 4O3UA 1DDJA 2ZO3H 3D49H 5ABWA 1HB0B 3MNBA 1TONA 3CP7A 2TBSA 3SNAA 3SV7A 2ZDNA
chains in the Genus database with same CATH superfamily
3GY8A 1S82A 4FUFA 2ZQ2A 5A0CA 2OLGA 1HYLA 1Q2WA 1NESE 1MD7A 4ESTE 2H9EH 4IMZA 4ABBA 3UNQA 3A88A 1K28D 4ABIA 1MTVA 1P04A 1ZOMA 4OGXA 1MCTA 1E1RD 2ZHDA 1C2JA 4BXWA 1AUTC 2P16A 3VB6A 1YC0A 1TX7A 4X1QU 3E16B 1LMWB 5HYOA 2VNTA 1DSUA 1EAXA 3VXFH 2XYAA 2NU1E 3WY8A 4ZXXH 1AKSA 4X2YA 4ISLA 1F0TA 1H8DH 1TGSZ 2KM0A 3FO8D 3RXCA 1C1WH 1OPHB 3T29A 4K69A 2C8WB 2TGPZ 2ZHWH 3A7YA 2XNIA 8GCHF 3MO3A 4I8JA 4CRFA 3AW0A 3I78A 1AKSB 1BTWA 1TIOA 2HPQH 2KCYA 3GDUA 1TBQH 3KYFA 4FVBA 3SJIA 2ULLA 5EG4A 2XXLA 2XWBI 3QTOH 1NN6A 2ODPA 4MTBA 1BIOA 3P17H 4BAMB 3GY3A 1XUHA 3TK9A 1F0RA 1HAPH 3M5NA 1ZJKA 2FOMB 1EB1H 3LH1A 1T4VH 5FCKA 1B5GH 1TPPA 2ZGBH 2Q6DA 2FDAA 1S0QA 1VCPA 5KEDA 1O5BB 4ISOA 4LXBH 3NWUA 4Q4LA 3BTFE 2OTVA 2W3KA 1AO5A 2CF8H 1BOQA 2R3UA 5EJ1A 1ESBA 2SNWA 3PROA 1Y3UA 1K2I1 3CNRA 1HAZB 1GHAG 1YWUA 2BXTH 1AVGH 1UVSH 2GKVE 4CH8B 3P70B 5LPRA 1OHHD 2UUKB 2A32A 9LPRA 1CHGA 2FOAA 5A09A 1DXWA 3BEIB 1FAXA 1DVAH 5E2OA 3UPEA 1FLEE 2HNTC 4KGAA 4CRCA 1N8OB 3ZVBA 1A2CH 1IQEA 1E36B 4A6LA 2L6OA 1V2WT 3LC5A 4WH6A 3PV4A 3RXVA 1EKBB 2RDLA 3MYWA 3UQVA 4NIYA 3M35A 2JKHA 4FUIA 1EZSC 1O3GA 1P2QA 1IAUA 1FMGA 1NS3A 2XTTB 3BEFB 4OS5A 5A2MH 1H8HD 1UTNA 2RDEA 1BHXB 1W0ZU 1K22H 1CQQA 2D2DA 4RN6A 1ETRH 3SU2A 2A4RA 1ZSLA 1GI6A 1P2NA 2SGDE 3RXEA 3S7KB 4E7NA 5DPAA 2EC9H 1S81A 5FL7D 1QJ6B 5DG6A 5C94A 1YF4A 1W3CA 3A7XA 5AF9H 3ODDA 1SG8B 2BY6X 1EUFA 4DY7B 3GY4A 1SBWA 1QURH 5J4QA 4D7FA 5FXLA 2QF0A 1K1NA 4ZH8A 2FI5E 4UEHH 1T8MA 1RTLA 5C2ZA 2ESTE 3SUGA 1O2VA 5ESBA 1ELTA 3A83A 2UUFB 2ODYB 2J9NA 4ZAEA 3DHKH 2FODA 5A8ZA 1T8NA 1EX3A 4RT1A 3PO1B 1IQLA 2ZFQH 4KP0A 2FS8A 4TSFD 3LGIA 3LOXA 1HXEH 2VH6A 4AG1A 1DUAA 2Z3EA 1U6QA 3PM3A 2FIRH 2JH0D 1SQTA 1G3DA 1KXDA 1SGRE 3TJNA 1O3IA 1PPZA 2CXVA 1NT1A 3D23A 3C1KA 1AVWA 3PO1C 4AB8A 4BAKB 1W7GH 4Y8XA 3RU4E 2I6SA 1KLIH 1UCYK 3PLBA 1C5OH 2HVXA 2ZPRA 1Z1JA 4ABFA 3O8BA 2Z3CA 2FOEA 1P10A 2VVVA 2XC0A 3RM2H 3LONA 2GT8A 2G8TA 2PUXB 3BTWE 3NPSA 3PWCA 4AFSA 1G3CA 4GUXA 3EE0B 3ZVEA 2TGDA 1P2OA 1YCPM 3PLPA 1P09A 1BUIA 3RXMA 2F3CE 1FY8E 2BY8X 2ANMH 2ZC9H 1O38A 2P95A 2QE7D 1QQ4A 1AUJA 3PMJA 1J8AA 1OYQA 4I8HA 2QXIA 4KTSA 3M7QA 2Y81A 1BITA 2A45B 2AGGX 2P3TB 3PTBA 4HTCH 1C1MA 1GHAF 4XSKU 5LPFA 3RMMH 1TA6A 1DUEA 1H9IE 2D1JA 4HGCA 3LKWA 2WPIS 3KQEA 5E0JA 1O2MA 2BLVA 4FOUC 2G4UA 2WUBA 2YNBA 4XOJA 3MU4A 4NCYA 3UWIA 1C2FA 3GS9A 1MKWH 3BIVH 3PMAB 3SHCH 3MTYA 3U8TH 2O8MA 2V7QD 4OS6A 1DITH 2J38A 1BA8B 1HFDA 1LKAA 3BSQA 3SYJA 4D7GA 4LK4A 5E0HA 1GMCG 4SGAE 4UFGH 1EZUC 4K8BA 1TNIA 1FQ3A 4INLA 4AYVB 3SJKA 1GCDA 2BM2A 1C1PA 3ZZBA 1SKYE 2OCVB 2C8XB 4CHAB 1OP2A 1CT0E 1XKBC 2F4LA 1C2EA 5C67A 2P3FH 3OY5U 5CHBA 2AEIH 3EA9A 1TGCA 4H4FA 1XVOA 2BX4A 3GY5A 2ZFTA 1MTWA 4YESB 3RP2A 4CHAC 2BY7X 3KQBA 1NFWA 4FUCA 4CH2B 1FPCH 1Y3YA 1C1TA 1LPKB 2A2XH 1GHBG 3F0OA 2GTBA 3OYPA 1LDTT 2VVCA 3TJOA 4NSVA 4XBBA 5EPNA 1O30A 2EY4C 6GCHG 2ZDAH 2ZF0H 2CHAB 1WQSA 2FOCA 4JZFH 2XBYA 4D9RA 1Y3XA 1V2VT 1B0FA 2YMSD 1ZGVA 1O2SA 1A7SA 2BD7A 5C0TA 1MUEB 4MDSA 4UE7H 2QF4A 2CHAC 3ZZ7A 3Q76A 2Z3DA 1G36A 1GHXH 3F9GA 3OEHD 5KGOA 4CRGA 3UOPA 1ZHRA 2Z9GA 3EQ0H 4FU8A 1QY6A 4FVDA 1FN8A 1J15A 5FX5A 1C2IA 4FUBA 4AOQA 1LPGB 1HUTH 2XC5A 1O3CA 4ZKOU 4O97A 2FM2A 1O2HA 1YLNA 1FX0B 1W0JD 4AN7A 4BAOB 1W0YH 5K0HA 4RSPA 3DSOA 3SW2B 5CHAB 1WCZA 4M7GA 1WV7H 3RXLA 1TMTH 5A0BA 3AAUA 1O36A 5L2ZH 1EOLA 3GCOA 1M9UA 3T25A 2BLQA 2CK3D 2UUYA 1QRZA 3BN9A 3DA9B 1VKYA 1GVZA 1HGTH 5IYTA 2H9TH 1TBRH 1ZTKA 2CGAA 1BMMH 2J5UA 1GL1A 1C5YB 1ELVA 5L30H 3F1SB 1P8VC 1KLJH 1L1JA 2W3IA 4XRNA 3F9FA 3B23B 4J1YA 3RXSA 1VGCC 1QHRB 5FPTA 1S6HA 4KTCA 1PPEE 4ABGA 5LPEA 5TJXA 1GBFA 2HLCA 2FXRA 1HIAB 5T6FA 1C1RA 3SU5A 4B75A 2HVYB 1QB1A 2WPJS 1OWDA 1PYTC 2ODQA 2ZCHP 1MTSA 3LPRA 4A5TS 2AMPA 1CA0B 2BLOA 2Y82A 1F0SA 3E0NB 2FO9A 3ZYEA 1YM0A 5AVDA 4FUJA 1F2SE 3A8CA 1MBQA 1C1SA 2FOBA 4AG2A 1V2RT 4K3JA 4Y11E 1CA0C 3AAVA 1RFNA 4NGAH 4Y8YA 3SI4H 3NCLA 4A92A 3NRLA 1IQMA 4FXGH 5EJZA 2Q1JA 2F43B 1D3PB 4Q2KA 3MH5A 1ABIH 2D8WA 3IWMA 5FHTA 1GMCF 4NWKA 2PR3A 1GGDB 1NRPH 1TNGA 5DP5A 1SGFA 3E90B 3DCLA 4AGJA 1O2IA 3V7TA 3EE7A 3A89A 3LJOA 2F9PA 2YNAA 5C0UA 1GGDC 3R0FA 1YPLH 3JZ2B 1JBUH 1YYY1 3KQDA 4I7YH 1O3JA 4RT0A 1YPHC 2BDGA 4TT3D 1MKWK 4FUEA 2IPQX 1OS8A 1BTZA 5E0GA 1OYTH 5EU8A 1TQ7B 1UTLM 1Y5AT 2G51A 3SZEA 3DFJA 2BZAA 1GHBF 4TYDA 1ELBA 6ESTA 1BRUP 2BDHA 1L4ZA 3A8DA 1FV9A 2R3YA 4BTTB 6GCHF 1O0DH 2Y7XA 1O5EH 3F2FA 3ZVDA 1W11U 2UUJB 4THNH 2PFEA 1GJ8B 3ZZCA 1TA2A 3SU0A 2OBOA 1O3DA 1KXCA 2OD3B 4E06H 2V35A 3ATWA 2XCFA 4YTAA 1V3XA 2GZ8A 4ZMAH 1IQGA 2AGIX 4DW2U 3KF2A 5GJ4B 4X6PA 3NK8A 5EOKA 3W1EA 1HAIH 3HK3B 2ZTYA 2B9LA 3GCNA 1G2MA 1SGNE 4JZEH 1JRSA 4I33A 2HLDD 3TNSA 3DSGA 2GCTB 4YLQH 4TWYA 3AVZA 4WMEA 4X6NA 3T28A 1EATA 2BDCA 6LPRA 4X1NU 2ALPA 5AHGH 1DE7H 1ABJH 3FOAA 3SO3A 2GCTC 2R0LA 1FIZA 1J9CH 3SORA 4AFUA 1TNKA 1PJPA 1INCA 5HKKD 2VGCB 4FU7A 4MPVA 8KME2 1EAIA 2BDAA 2NU3E 4U01A 3P95A 3ZZ8A 2B0FA 5EIYA 1A0LA 3QX5H 2KZ4A 2VGCC 1C2GA 1SGCA 2Y5HA 1UTQA 4TY7A 1EAWA 4U32A 4ACAA 2PLXA 1QL8A 1FY1A 5FPSA 1C5QA 5C3NA 1KY9A 2Z6BD 1H8IH 2AHME 1D3QB 5HGGA 2THFB 1DANH 1KXEA 5G4BA 1QZ8A 1ZLRA 3FP6E 1BBRH 2WV4A 4B2CA 2OC1A 1LTOA 4AZ2B 1O2KA 1TGTA 3OY6U 4FU9A 1C2LA 4MNXA 1L4DA 4HFPB 1ZRKA 3V13A 1EZXC 1CSOE 1AB9B 1GJ5H 2GDEH 1V2LT 1JWTA 3UB0A 2VIWA 1QBVH 4ZROA 4IC5A 4OS1A 3U98H 1PPHE 1WSSH 3Q3XA 1GMDF 1AB9C 5H4IB 1K1OA 3LJJA 2QC2A 3L3TA 1AHTH 1C5RA 3AASA 1DWDH 1W7XH 3GDVA 4UFDH 4TY6A 2W7SA 3ZVGA 1PQ7A 1EPTB 1GG6B 1LCYA 1JIRA 3RC4A 1OP8A 1ZTLA 1C5ZB 3PMHB 5JB8S 1NZQH 1A0JA 4IS5A 2PUQH 1A5IA 2PW8H 1MU6B 5GPIB 1UJ1A 1EPTC 1OX1A 1EZQA 5JBTA 1AIXH 1UVUH 5C1UA 3M7TA 1GBKA 3GICB 2EQNA 3N7OA 2PTNA 2UWPA 1W14U 1AWHB 4JYVH 1TE0A 5HIZA 2ZI2H 3PLKA 1MMJN 3RM0H 1ANCA 2FI3E 1CA8B 3ATKA 1W13U 2AH4X 2SGQE 2VH0A 3RXRA 3LGWA 2GV7A 1AWFH 1P05A 1TMBH 4B74A 3SU4A 1XXFA 4X6OA 1LHGH 4Q7XA 2J4IA 2VJ1A 2HALA 2F9OA 2BVRH 3SNEA 2H6MA 1AZ8A 4OS7A 1A3EH 5L2YH 3A87A 2Y6TA 1LHEH 2WPDD 4I32A 3PTNA 2GCHG 3AW1A 4YLUA 3GCTG 4NSYA 1WUNH 3SNCA 3H7TA 1LVBA 1GBJA 4TWWA 1CT2E 4IBLH 1C5UA 1C4Y2 1V2NT 3D65E 1YPKH 1ZR0A 4B1TA 5TCCA 1IQNA 1SGIB 5EQRA 1EXFA 2Z9IA 2PGQB 2VVUA 1V2TT 1Y8TA 3F2HA 3ZYDA 4IMQA 2GZ9A 2HNTE 4GVUA 4NA7A 3MWIU 3KN2A 2PSXA 2RG3A 3KNXA 4UFFH 3PRDA 2ZGHA 3H7OA 1H8ED 1LPZB 3FN8A 3SUEA 4NFEA 1O3KA 1PPCE 3RXOA 4LOYH 5EW1H 1TLDA 3EYDA 2R0KA 1ZPZA 4YZUA 1D9IA 2O8WA 1UMAH 3ATIA 4E05H 3H5CB 2C8YB 3EDXB 2ZGJA 2RA3A 1CO7E 4X1PU 2GZ7A 1SFIA 1YBWA 3UR9A 1UTKA 2R9PA 4Y71A 1BTXA 1DWEH 3VB3A 5F6MA 1SMFE 2JJ1D 4LZ1H 4ZXYH 3URCA 5HM2A 5I46H 2ZCLP 4D76A 1SGYE 2QYIA 1KXFA 3SU6A 1PQ8A 3MU8A 1P2KA 1NBMD 2STAE 1D4PB 3ZZ4A 3BV9B 3GYLB 2K8IA 1BBRK 4YOIA 4A7IB 4OS2A 4Z6AH 1TRNA 1SQOA 2BQWB 3KQ5A 1P9UA 5T1VA 1DY8A 1PFXC 2XBXA 1JIMA 1O31A 1E79D 1KSNA 1O3NA 5C1YA 5A8XA 4MPXA 2Z9JA 2HRVA 2AIQA 1FPHH 1G9IE 1C4V2 1E37B 2KCOA 1QNJA 3DFLA 1GHYH 3SUDA 1S85A 2VIQA 4X1SU 1THPB 4MNWA 3SV8A 2OXSA 1KXBA 1SLUB 1L1GA 3T2NA 8LPRA 1AY6H 4A1XA 3FKSD 4DURA 4FUGA 1DM4B 1EFRD 5GCHG 4UD9H 3Q3KA 2K1QA 3Q77A 4BTUB 4ZKRU 3GY2A 3RLWH 3S9CA 2FX4A 1RJXB 1A46H 1BTPA 1YY3A 1OWHA 3LDXH 1AN1E 2ZFPH 2ZKSA 3BTTE 2AFQB 1QJ1B 1G37A 3P8FA 4ASHA 4K2YA 4YO9A 2XOKD 5EXMA 3A8BA 3RXUA 3E91A 2AMDA 5EXLA 5DO4H 1V2JT 2GCHF 2PP6A 3GCTF 2WV5A 4B6EA 5JBCS 4Y6DA 4TPIZ 1YPMH 1IQJA 3RXBA 1BTUA 1SLXB 2ZZUH 5DP3A 1OOKB 3SV2H 2IJD1 2TIOA 4FUDA 2FOFA 1E35B 1XUGA 1LHDH 1HV7A 2W26A 1DY9A 1K0HA 4NA8A 4Q7ZA 1P3EA 2BD4A 1AMHA 1Z8JB 1RTFB 4AC9A 3OEED 2J92A 1ZHMA 1MKXH 1QBOA 1AQ7A 2F9NA 2BHGA 5DP9A 1RRKA 4CBNA 1KTSB 3MHWU 2JH5D 3KYGA 1UK3A 4WXIA 3TJVA 2VWOA 3GISB 1C9TA 3RXFA 5JPMH 2EA3A 3KEEA 2ZTXA 2TGAA 1SGEE 3ESTA 1KLTA 2OQ5A 2Q6GA 2PKAB 3PMBB 3GCHC 1EJMA 1FIWA 1GBDA 2WPLS 1TPOA 2OK5A 1Q31A 2FOHA 2WSSD 5JB9S 4X8UH 2EEKA 1GBTA 4J2YB 1DLEA 2BD5A 2OQUA 3A85A 2ILNA 3Q00A 3R3GB 1QB9A 1MH0A 3LT3A 2OC7A 3E0PB 2XWAA 2QCYA 4BAQB 3RXHA 3SU1A 3WWFA 2IPHA 5HMAA 1HXFH 3MMGA 1EB2A 3CS7A 3MU0A 2PKSC 4ZHMU 3ENSB 3RXGA 2KR7A 4YXWD 4O03A 5LGOA 3ZV9A 1AFEH 1EJAA 1WYKA 2BD3A 4ZHAA 1GJCB 3SV6A 1ZSKA 1AFQB 5DP8A 2JDID 2ZHQH 2BYAX 1MAYA 3P8GA 2BD8A 4MPWA 4WH8A 5FBEA 2ZU3A 2C8ZB 2NU4E 1GHVH 3HKIB 1F5RA 2PTCE 1AFQC 2LNCA 3K6YA 1COWD 1ZGIA 2AS9A 3ZZ5A 2ZHEH 2G5VA 1BRAA 5EQSA 3RUOA 5GNDA 1FAKH 4B76A 1GHWH 2BTCE 1MU8B 5T6DA 4NZQA 4GAWA 1IQIA 3M5LA 1DT2A 1E34B 5GCHF 2M5TA 2IOTA 1HJAB 1QFKH 1TYNA 3A84A 3O8RA 1QJ7B 4WMFA 2VIVA 1NM6A 2BXUH 1C1NA 1C5MD 3OE7D 1SGTA 1YLCA 4F55A 4XD7D 1ARCA 2FTLE 3TITA 1HNEE 1O3AA 1GDNA 5DKMA 1HJAC 2A0QB 3K9XB 2A4GA 3O8DA 2FLBH 3W95A 4MQAA 1ESTA 1V2UT 4KELA 4D9QA 4AGKA 1T31A 3FAOA 1T8OA 1G3BA 4F48B 2Z9KA 1N1LA 3TK6A 2ZFRH 1TOCB 2BDBA 1QBNA 1SHHB 1VGCB 2O9QA 4YM9A 1XKAC 3BTGE 1A5GH 2CV3A 1RGQA 1P2MA 2LP6A 4GHQA 3TIUA 1UCYE 1D6RA 5HXFA 3FP7E 1HIAA 1AI8H 1C5TA 2Q6FA 3QTVH 1KYNA 1YCPH 1H9HE 1UVTH 1O2TA 1TNJA 3MO6A 1S84A 3U1JB 4Y10E 1EJNA 1TRMA 2A4QA 3U1IB 2BMGB 1C1UH 3M3TA 1LHFH 3PV5A 1KDQA 4O3TA 1G30B 3MNXA 3VG8A 1NTPA 3HATH 3SUFA 2SGPE 3QO6A 4BXSA 1FONA 1GI3A 1KDQB 3C27B 1HAGE 2QIQA 2C3SA 3S7HB 1ELDE 2GGVB 1P9SA 5C20A 1XX9A 3UOUA 2H5DA 1BRBE 1Z6EA 1VITH 4GHTA 1NO9H 3LU9B 5F03A 1CGJE 1AZZA 1O33A 1C5LH 2BOKA 1A5HA 2WYGA 2HPPH 1C9PA 1GMDG 1Z71A 3KL6A 2A7HA 4CRBA 1HDTH 3RU4D 3EGKH 1UVOA 4Z1MD 1YPHE 1GI5A 4JZDH 2Y5FA 1P03A 1C5NH 1MKXK 1ZPBA 1GPZA 1YPGH 1P57B 3TH2H 1C5WB 5FBIA 1LQEA 5EJLA 2BVSH 3ZZ9A 2A5IA 1MZDA 1GI8B 4CRDA 3BTHE 3SV9A 3GDSA 4ABAA 2STBE 2W7UA 1TB6H 4HI3A 4R8TB 3SJ9A 3V12A 1V2MT 1MD8A 1L0ZA 1PPFE 2XBVA 3MU5A 1BJUA 3QN7A 2J97A 4AORA 7KMEH 1J17T 1Z8GA 1ZTJA 2ZFFH 4Q7YA 3NZIA 4JZ1A 2CN0H 1GJ4H 1TABE 1TNHA 4INHA 3M3VA 4P02A 2C93B 2WPKS 3DT0H 4ABEA 3OU0A 1UHBA 1GBIA 3SGAE 2AYWA 2CJIA 3K6ZA 1S6FA 2ZNKH 1THSH 1GDUA 1K1PA 3FFGA 1UHBB 1VJAU 1OSSA 1JRTA 4NG9H 1SLWB 1Z6JH 2ZDKA 1CE5A 1JOUB 1XUIA 1GJ9B 3QLPH 1CHOG 3QGJA 3TH3H 3IITA 2BLWA 2G52A 1BTHH 3DUXH 1XUJA 2EI7A 1WTGH 1EAUA 3A7ZA 2PHBA 3S69A 4WWYA 3BTME 1B0EA 3MU1A 2KAIB 4BAHB 1IQKA 4B73A 1DPOA 2ANWA 5B6OA 2EI8A 1NRNH 2P8OC 1J14A 3D62A 4MNYA 1TWXB 2WYJA 3RXDA 4BANB 5EW2H 4AX9H 3U69H 3UIRA 1HAYB 2QF5A 1E1QD 2JETB 5TCAA 4CREA 4JZIA 2W6ID 3L6PA 4MLFB 1TOMH 4DG4A 2J95A 4X8TH 1HCGA 2C90B 2QN5T 1LVYA 4WJG2 1NPMA 2JETC 1QR3E 2V6NA 1DFPA 1O39A 2BDYA 3A81A 3DSPA 2ANKH 4DGJA 1A4WH 5DGJA 1IOEA 1MAXA 1UTPA 3BIUH 3LGTA 4K5ZA 1F7ZA 4OGYA 2V0BA 1O2ZA 1G2LA 1P06A 4UDWH 1O2NA 2GT7A 3CENA 3FP8E 1KTTB 4JK6A 3RC6A 1ZYOA 2JIZD 1GJ7B 2W6JD 2XNDD 2FYQA 1MZAA 1S5SA 2G00A 4GPGA 1THRH 2KCAA 4MPUA 3ZZ6A 4DIIH 1ARBA 2LPRA 4YT7H 1TALA 2GDDA 1C4U2 4I31A 5K7RA 2GVFA 2CMYA 2IJOB 1YCPK 1SPJA 3RXAA 2GD4B 2ZP0H 3U8OH 1NROH 1EPTA 5C1XA 2RCEA 2H9HA 5I25A 3U9AH 2VWMA 4K8YA 1SHYA 2F9BH 2J94A 3LGUA 3LH3A 3RXPA 3URDA 4M9FA 4A1VA 3TGJE 5IDKA 1C5VA 3RXQA 5JYIA 1KXAA 2SNVA 4AYYB 1GCTB 4DOQA 4Y7BA 3UNSA 4UFEH 3A7VA 3F9EA 2SGEE 3A7TA 5F8ZA 5JDUB 4HZHA 2RA0A 2ANYA 1NRQH 2C4FH 1FJSA 4H6SB 3QZQA 3SNBA 1GCTC 4DVAU 1ETTH 1DXPA 3B8JA 3ITIA 3SBKA 4DT4A 5GWZA 1RIWB 1DICA 1EP6A 1HAOH 1MQ5A 1PYTD 4OM9A 1MBMA 1DLKB 3MI4A 3SU3A 1NFUA 5EXNA 4K60A 1D3DB 1UTJA 4CBOA 3A80A 1RIWC 2XCNA 5DN6D 1T4UH 3MNSA 4I8LA 4JCNA 3GYMA 5GXPA 1ELCA 2D26C 1LKBA 1UTOA 3ZV8A 4BNRA 2H1UA 2GX4A 3QZRA 1NRSH 3ATMA 4R0IA 4FETA 4Q80A 1HAHH 5T6GA 4XFQA 2A5AA 1A3BH 4IN1A 4JMYA 1GMHG 2SFAA 3M3SA 1WAYB 1YP9A 5FX6A 1O2OA 3U8RH 3VB7A 1CHOF 1RTKA 1YKTA 3LC3A 1GJ6A 1SFQB 1O3MA 6CHAB 1SC8U 3OTJE 1ESAA 1K9OE 2BX3A 3P92A 1GHZA 3BTDE 5CE1A 1O3PB 2FTMA 2G4TA 5F53A 1C2HA 3BTEE 2OC0A 4DCDA 3BEUA 1N6XA 6CHAC 1GBHA 2WZQA 5HIYA 2ZPQA 3GY6A 2YOLA 1Y3VA 2AMQA 4DT7B 3TGIE 3U28C 3HPTB 3ZZAA 3WWBA 4DIHH 1V6DA 1C5XB 1OP0A 1YPEH 3BF6H 3SHAH 3M37A 5LH8A 1W10U 2EI6A 3I77A 4I86A 1BB0B 3PV2A 1NU9A 2B5TB 3QK1A 4WF8A 3ZVCA 1NU7B 1WXRA 3L33A 2HOBA 1GBLA 5FPYA 1H9LB 4E7RG 1XMNB 2Z9LA 1VCWA 1NRRH 1ELFA 1OKXA 5AFYH 2FMJA 1W8BH 5EODA 2R2WU 1GI2A 2QY0B 4Q63A 1J16A 2YMSB 4RKJB 5KECA 3SQEE 4GLYA 3M5MA 1F5LA 4FUHA 4AFQA 1QIXB 1ZMJA 2KX4A 3QWCH 1Z8RA 3UQOA 1AU8A 1VCQA 4ACBA 3F2GA 3V3MA 3VB5A 1PQAA 5DP7A 2ZFSA 1E0FD 1QA0A 2YMSC 1VITG 1O3OA 1GI7B 3JZ1B 1OWJA 4KKDA 2AERH 3UFAA 4QT8C 1IQFA 3TPIZ 1QCPA 1IHTH 3EA7A 4O9VA 4B71A 5BPEA 1K1JA 3SQHE 4XDEA 3VB4A 2QV1A 1ZZZA 1QB6A 3SGBE 1SGQE 1N8OC 1O3FA 1K1IA 1FY4A 1Z8IB 1TPAE 1P02A 1TQ0B 1TBZH 3UAIC 1SQAA 4F4OC 4I8GA 1OXGA 4YOGA 4HG6A 3P6ZB 4Y79A 1P11E 1O2PA 5PTPA 3T26A 2ZECA 1OWEA 4X8SH 1VJ9U 1N6YA 4B6FA 2P93A 4ZKNU 3PYHA 4ZUHA 1GJBB 3ZZDA 1F92A 1TGBA 3FZZA 1ANEA 2OINA 2PWXA 2ZTZA 3RMOH 4AB9A 2H5CA 2Y80A 1GBBA 1Q3XA 5C17A 2VINA 3UTUH 2LELA 2FS9A 4INKA 4WMDA 1ELAA 1O2WA 1LHCH 1O3LA 4P00A 1QRXA 2FP7B 1BMNH 5SGAE 3TH4H 1HRTH 1P12E 3UREA 3I29A 4NA9H 1A1RA 9ESTA 2ALVA 1EOJA 3MFJA 4U30A 1LVMA 1GMHF 4NIVA 1ZRBA 1P2JA 3FZDA 1WU1A 3TLOA 5L6NH 3DD2H 1O2JA 1FXYA 3EA8A 1BQYA 2HNTF 1CT4E 3RMNH 1TNLA 3M36A 1NY22 1TMUH 4NIXA 2AIPA 1MQ6A 1YGCH 3UY9A 4Y8ZA 3Q3YA 3ELAH 3SN8A 1PPBH 2DUCA 1BT7A 2F9VA 4OS4A 2BD9A 4CR5A 2J34A 3TGKE 1HBTH 2ASUB 2FEQH 5JBBS 2VWNA 1AE8H 3BTKE 1SGDE 4NIWA 2V3HH 2ZEBA 4K1EA 1O3HA 1Y5UT 3MH4A 3FANA 2BD2A 5EGMA 4LZ4B 1TPSA 4GSOA 5C5NA 2UWOA 3HGPA 1CVWH 2A1DB 2KFWA 2FI4E 1GL0E 1O5FH 1SLVB 3VGCB 1XUKA 2WPHS 1NFXA 1E38B 2GJGA 1BHXF 1L1NA 3OTPA 2P94A 1V2PT 3TK5A 1K21H 1K1MA 1Y3WA 3W94A 3E3TA 1O5GH 3NKKA 3GCHB 2GMTB 4XBCA 4WY3A 2PKAA 3VGCC 1VZQH 3KQCA 5ETXA 2DE9A 1OWKA 1OWIA 2BQ6B 3ZIAD 1LO6A 2OBQA 1UK4A 2WINI 3STJA 1ANBA 2FOGA 2O8TA 1W12U 5CMXH 3H09A 1L2EA 2GMTC 3BG8A 3SI3H 4BTIB 3RU4T 2F9UA 2PSYA 2ZG0H 3ZVFA 2ZA5A 3A82A 1DX5M 1KIGH 2ZGCA 3RDZA 3T5FH 3RC5A 5A0AE 1GVKB 1DWBH 1C1VH 1VITF 1PQ5A 2OC8A 2G81E 1QQUA 4NWLA 1W0KD 2PKSB 4I8KA 1TRYA 1MABB 7GCHG 4X8VH 4X2VA 4XE4A 2V3OH 1EP5A 3E6PH 2NU0E 3P8NA 1SVPA 2I6QA 3RXTA 4BOHA 2A5KA 2QA9E 1C2KA 8ESTE 4WXVA 5GDSH 2UWLA 1PPGE 1ID5H 1WBGB 2FPZA 2Y5GA 2BZ6H 2A7JA 1CGIE 1SOZA 3PWBA 2JH6D 4X1RU 1MTNB 1BMAA 1GWAA 2VIOA 1AVXA 1O2YA 4NFFA 1H1BA 1TGNA 2Y7ZA 1V2ST 1C1OA 1O2UA 1G32B 2P59A 4RI0A 7LPRA 4JK5A 1MTNC 3RXIA 3S9BA 3LGVA 3N99A 1BBRE 1IQHA 2ZQ1A 3VPKA 1P0SH 5JBAS 5DK1A 1O2LA 2K0QA 1CBWB 1P2IA 4MVNA 3RXKA 1V2KT 2F91A 3B9FH 1O2GH 4UONA 4K1TA 1GI1A 1QRWA 2IN2A 1GBMA 4VGCB 1V2QT 2XRCA 1JMOH 1DWCH 1DSTA 3T27A 1WTHD 3A7WA 1EASA 1CBWC 1GI0A 2VBCA 2G55A 4XBDA 4H6TA 1MTUA 3E1XB 2BB4A 1C1QA 3A8AA 2WV9A 5DSFA 4VGCC 3SOSA 4ASUD 2FYRA 4ISNA 1T7CA 2A2QH 1HPGA 3MOCA 4KTUA 1ETSH 1TAWA 1UVPA 3OSYA 3N7EA 3SJ8A 3QUMP 1BZXE 1Y5BT 4ISIH 3UWJH 1FUJA 2H2ZA 3KCGH 2CF9H 2O8LA 1ELEE 1CGHA 1RS0A 1C2MA 1LVOA 3AK5A 1GBEA 1T32A 4U2WA 3LGYA 4ZHLU 1GI4A 1SI5H 5DP4A 5BRRE 2QF3A 1P3CA 2VB0A 5F8TA 1C5PA 5J4SA 5B6LA 5CHAC 4ABJA 3SJOA 4MNVA 3M61U 1H4WA 2FESH 1F0UA 2A4OA 3RXJA 3F3BA 1GBAA 1BCUH 5DP6A 1F5KU 1W2KH 1FN6A 2F83A 4GCHG 1SGFG 3P8OA 3KGPA 1RXPA 1QTFA 2W5EA 4Y0YE 1QL7A 2VWLA 1O37A 1TFXA 1SL3A 1A61H 2JJ2D 3UUZA 3K2UA 3ATLA 3NXPA 3CS0A 2L74A 5C5OA 3MNCA 2BQ7B 4B2BA 1MCVA 1ZHPA 1ORFA 2GV6A 1VR1H 1BRCE 3RLYH 5ESTE 2ZPSA 1O5CB 3F0PA 2ZU4A 1O34A 3UNRA 4K1SA 2VU8E 4X6MA 1HLTH 1AGJA 5CDFE 1O32A 1SGPE 1TX6A 3V0XA 1BJVA 7GCHF 4TPYA 1GJAB 4X2XA 1HAXB 5T3HA 1D6WA 1TX8A 3F68H 3M5OA 3S9AA 2OUAA 1BDAA 1ZPCA 3HK6B 1SQRA 3VEQB 1YPJH 3SGQE 1DS2E 5DJ7A 2VIPA 2WPMS 3ZVAA 3RMLH 1C5SA 2AGEX 4ISHH 1WOFA 4Z0KA 5FAHA 3MH7A 1SB1H 4F49A 4ZCNA 3MQKC 4RKOB 3TNTA 1SR5C 2ZHFH 3UR6A 3QDZB 4JYTA 1T8LA 4WVPE 2PV9B 4A1TA 1FY3A 1O3EA 2TPIZ 2ZDMA 1S6LA 1XUFA 5E2PA 4D8NA 1O35A 3S0NA 5IK2D 1UK2A 4YOJA 3F6UH 2SGAA 1FNIA 1O2QA 1HAVA 2M2AA 2BDIA 3TVJB 2BOHB 2KAIA 2P8OB 4X0WU 5GIBA 2BVXH 1ELGA 1YLDA 1FI8A 1DOJA 3HGNA 4ZKSU 1HAVB 2HGTH 2R2MB 4MG3A 1HJ8A 1XVMA 1V2OT 1FZZA 1SOTA 2QXJA 2VIDA 2ZU5A 2ZDVH 3T62A 2ZCKP 8GCHG 1WDIA 1P01A 1AE5A 3MO9A 1FDPA 2KCPA 1NBME 2QAAA 3A86A 3BTQE 4ABHA 2BY5X 3STIA 1AD8H 4JYUH 2WHXA 1NC6A 5FCRA 2QXGA 2ZDLA 4IC6A 1FY5A 5AFZH 3HKJB 2ZU1A 2Z94A 4Y76A 4ABDA 4YT6H 1UTMA 3SZNA 3ZZ3A 5A8YA 1UO6A 2FZZA 3OFND 1O5DH 1S83A 1K1LA 2P3UB 3G01A 3IG6B 3WW7A 1BTYA 2ZU2A 3PB1E 4H42U 4CR9A 1Y59T 1CU1A 2OP9A 1O2RA 4AFZA 1D3TB 1O5AB 4X2WA 1ZMLA 3VXEH 3ODFA 4GCHF 1JXPA 3KHVA 2J2UA 1IHSH 1NFYA 5E8EH 3KIDU 4DJZB 2XW9A 3BG4B 4IW4E 2J98A 1A0HB 5F8XA 2QGRA 2PGBB 4NZLA 1RD3B 4PROA 4CRAA 1S0RA 1O2XA 2ZWLH 1C2DA 2QXHA 3TJUA 2J98B 1BMLA 2GP9B 4Y7AA 1GI9B 2B8OH 2HWLB 3BG4C 3SNDA 3K65B 3EAJA 3M7UA 1G3EA 3FVFB 2RFKC 2SGFE 3OAAD 5EPYA 2A31A 1QGFA 1ACBE 3MH6A 2NU2E 2FX6A 1EQ9A 3O8CA 1XXDA 3GOVB 2DE8A 1KMHB 3VFEA 1BMFD 2G5NA 1QA7A 2Z7FE 3GY7A 3LIWA 1GDQA 2B7DH 1ZMNA 2FLRH 1B7XB 1Z7KA 2XBWA 1GVLA 3PRBA 3F9HA 5EQQA 4SGBE 1SSXA 3TU7H 2NWNA 4B2AA 1UW7A 1LQDB 2BY9X 1O3BA 2TRMA 1Z1IA 1ZSJA 5HM9A 2V3MA 4IN2A 1ANDA 1XM1A 2ZGXH 7ESTE 2FWWA 2A7CA 2XC4A 3OX7U 1GJDB 1ZJDA 1GBCA 1HJ9A 4Y0ZE 1QL9A 3NUMA 1WQVH 2O8UA 2WUCA 4IGDA 1X7AC 2ZIQH 1GG6C 2TGTA 3E8LA 3QGNB 1UCYH 4O3UA 1DDJA 2ZO3H 3N7DA 3D49H 5ABWA 1HB0B 3MNBA 1TONA 3CP7A 2TBSA 3SNAA 3SV7A 2ZDNA
chains in the Genus database with same CATH topology
3GY8A 1S82A 4FUFA 2ZQ2A 5A0CA 2OLGA 1HYLA 1Q2WA 1NESE 1MD7A 4ESTE 2H9EH 4IMZA 4ABBA 3UNQA 3A88A 1K28D 4ABIA 1MTVA 1P04A 1ZOMA 4OGXA 1MCTA 2ZHDA 1C2JA 4BXWA 1AUTC 2P16A 3VB6A 1YC0A 1TX7A 4X1QU 3E16B 1LMWB 5HYOA 2VNTA 1DSUA 1EAXA 3VXFH 2XYAA 2NU1E 3WY8A 4ZXXH 1AKSA 4X2YA 4ISLA 1F0TA 1H8DH 1TGSZ 3RXCA 1C1WH 1OPHB 3T29A 4K69A 2C8WB 2TGPZ 2ZHWH 3A7YA 2XNIA 8GCHF 3MO3A 4I8JA 4CRFA 3AW0A 3I78A 1AKSB 1BTWA 1TIOA 2HPQH 3GDUA 1TBQH 4FVBA 3SJIA 2ULLA 5EG4A 2XXLA 2XWBI 3QTOH 1NN6A 2ODPA 4MTBA 1BIOA 3P17H 4BAMB 3GY3A 1XUHA 3TK9A 1F0RA 1HAPH 3M5NA 1ZJKA 2FOMB 1EB1H 3LH1A 1T4VH 5FCKA 1B5GH 1TPPA 2ZGBH 2Q6DA 2FDAA 1S0QA 1VCPA 1O5BB 4ISOA 4LXBH 3NWUA 3BTFE 2OTVA 2W3KA 1AO5A 2CF8H 1BOQA 2R3UA 1ESBA 2SNWA 3PROA 1Y3UA 1K2I1 1HAZB 1GHAG 2BXTH 1AVGH 1UVSH 2GKVE 4CH8B 3P70B 5LPRA 2UUKB 2A32A 9LPRA 1CHGA 2FOAA 5A09A 1DXWA 3BEIB 1FAXA 1DVAH 5E2OA 3UPEA 1FLEE 2HNTC 4KGAA 4CRCA 1N8OB 3ZVBA 1A2CH 1IQEA 1E36B 4A6LA 1V2WT 3LC5A 4WH6A 3PV4A 3RXVA 1EKBB 2RDLA 3MYWA 3UQVA 4NIYA 3M35A 2JKHA 4FUIA 1EZSC 1O3GA 1P2QA 1IAUA 1FMGA 1NS3A 2XTTB 3BEFB 4OS5A 5A2MH 1UTNA 1BHXB 1W0ZU 1K22H 1CQQA 2D2DA 4RN6A 1ETRH 3SU2A 2A4RA 1ZSLA 1GI6A 1P2NA 2SGDE 3RXEA 3S7KB 4E7NA 5DPAA 2EC9H 1S81A 1QJ6B 5DG6A 1YF4A 1W3CA 3A7XA 5AF9H 3ODDA 1SG8B 2BY6X 1EUFA 4DY7B 3GY4A 1SBWA 1QURH 5J4QA 4D7FA 5FXLA 2QF0A 1K1NA 4ZH8A 2FI5E 4UEHH 1T8MA 1RTLA 5C2ZA 2ESTE 3SUGA 1O2VA 5ESBA 1ELTA 3A83A 2UUFB 2ODYB 2J9NA 4ZAEA 3DHKH 2FODA 5A8ZA 1T8NA 1EX3A 3PO1B 1IQLA 2ZFQH 4KP0A 2FS8A 3LGIA 3LOXA 1HXEH 2VH6A 4AG1A 1DUAA 2Z3EA 1U6QA 3PM3A 2FIRH 2JH0D 1SQTA 1G3DA 1KXDA 1SGRE 3TJNA 1O3IA 1PPZA 2CXVA 1NT1A 3D23A 3C1KA 1AVWA 3PO1C 4AB8A 4BAKB 1W7GH 4Y8XA 3RU4E 2I6SA 1KLIH 1UCYK 3PLBA 1C5OH 2HVXA 2ZPRA 1Z1JA 4ABFA 3O8BA 2Z3CA 2FOEA 1P10A 2VVVA 2XC0A 3RM2H 3LONA 2GT8A 2G8TA 2PUXB 3BTWE 3NPSA 3PWCA 4AFSA 1G3CA 4GUXA 3EE0B 3ZVEA 2TGDA 1P2OA 1YCPM 3PLPA 1P09A 1BUIA 3RXMA 2F3CE 1FY8E 2BY8X 2ANMH 2ZC9H 1O38A 2P95A 1QQ4A 1AUJA 3PMJA 1J8AA 1OYQA 4I8HA 2QXIA 4KTSA 3M7QA 2Y81A 1BITA 2A45B 2P3TB 2AGGX 3PTBA 4HTCH 1C1MA 1GHAF 4XSKU 5LPFA 3RMMH 1TA6A 1DUEA 1H9IE 2D1JA 4HGCA 3LKWA 2WPIS 3KQEA 5E0JA 1O2MA 2BLVA 2G4UA 2WUBA 2YNBA 4XOJA 3MU4A 4NCYA 3UWIA 1C2FA 1MKWH 3BIVH 3PMAB 3SHCH 3MTYA 3U8TH 2O8MA 4OS6A 1DITH 2J38A 1BA8B 1HFDA 1LKAA 3BSQA 4D7GA 4LK4A 5E0HA 1GMCG 4SGAE 4UFGH 1EZUC 4K8BA 1TNIA 1FQ3A 4INLA 4AYVB 3SJKA 1GCDA 2BM2A 1C1PA 3ZZBA 2OCVB 2C8XB 4CHAB 1OP2A 1CT0E 1XKBC 1C2EA 5C67A 2P3FH 3OY5U 2AEIH 3EA9A 1TGCA 4H4FA 1XVOA 2BX4A 3GY5A 2ZFTA 1MTWA 4YESB 3RP2A 4CHAC 2BY7X 3KQBA 1NFWA 4FUCA 4CH2B 1FPCH 1Y3YA 1C1TA 1LPKB 2A2XH 1GHBG 2GTBA 3OYPA 1LDTT 2VVCA 3TJOA 4NSVA 4XBBA 5EPNA 1O30A 6GCHG 2ZDAH 2ZF0H 2CHAB 1WQSA 2FOCA 4JZFH 2XBYA 4D9RA 1Y3XA 1V2VT 1B0FA 1ZGVA 1O2SA 1A7SA 2BD7A 1MUEB 4MDSA 4UE7H 2CHAC 3ZZ7A 3Q76A 2Z3DA 1G36A 1GHXH 3F9GA 4CRGA 3UOPA 1ZHRA 2Z9GA 3EQ0H 4FU8A 1QY6A 4FVDA 1FN8A 1J15A 5FX5A 1C2IA 4FUBA 4AOQA 1LPGB 1HUTH 2XC5A 1O3CA 4ZKOU 4O97A 2FM2A 1O2HA 4BAOB 4AN7A 1W0YH 5K0HA 4RSPA 3SW2B 5CHAB 1WCZA 4M7GA 1WV7H 3RXLA 1TMTH 5A0BA 3AAUA 1O36A 5L2ZH 1EOLA 3GCOA 1M9UA 3T25A 2BLQA 2UUYA 1QRZA 3BN9A 3DA9B 1GVZA 1HGTH 5IYTA 2H9TH 1TBRH 1ZTKA 2CGAA 1BMMH 1GL1A 1C5YB 1ELVA 5L30H 3F1SB 1P8VC 1KLJH 1L1JA 2W3IA 3F9FA 3B23B 4J1YA 3RXSA 1VGCC 1QHRB 5FPTA 1S6HA 4KTCA 1PPEE 4ABGA 5LPEA 5TJXA 1GBFA 2HLCA 2FXRA 1HIAB 5T6FA 1C1RA 3SU5A 4B75A 1QB1A 2WPJS 1OWDA 1PYTC 2ODQA 2ZCHP 1MTSA 3LPRA 4A5TS 2AMPA 1CA0B 2BLOA 2Y82A 1F0SA 3E0NB 2FO9A 3ZYEA 1YM0A 5AVDA 4FUJA 1F2SE 3A8CA 1MBQA 1C1SA 2FOBA 4AG2A 1V2RT 4K3JA 4Y11E 1CA0C 3AAVA 1RFNA 4NGAH 4Y8YA 3SI4H 3NCLA 4A92A 1IQMA 4FXGH 2Q1JA 1D3PB 4Q2KA 3MH5A 1ABIH 2D8WA 3IWMA 5FHTA 1GMCF 4NWKA 2PR3A 1GGDB 1NRPH 1TNGA 5DP5A 1SGFA 3E90B 4AGJA 1O2IA 3V7TA 3A89A 3LJOA 2F9PA 2YNAA 1GGDC 3R0FA 1YPLH 3JZ2B 1JBUH 1YYY1 3KQDA 4I7YH 1O3JA 1YPHC 2BDGA 1MKWK 4FUEA 1OS8A 1BTZA 5E0GA 1OYTH 5EU8A 1TQ7B 1UTLM 1Y5AT 2G51A 3DFJA 2BZAA 1GHBF 4TYDA 1ELBA 6ESTA 1BRUP 2BDHA 1L4ZA 3A8DA 1FV9A 2R3YA 4BTTB 6GCHF 1O0DH 2Y7XA 1O5EH 3ZVDA 1W11U 2UUJB 4THNH 2PFEA 1GJ8B 3ZZCA 1TA2A 3SU0A 2OBOA 1O3DA 1KXCA 2OD3B 4E06H 2V35A 3ATWA 2XCFA 4YTAA 1V3XA 2GZ8A 4ZMAH 1IQGA 2AGIX 4DW2U 3KF2A 5GJ4B 4X6PA 3NK8A 5EOKA 1HAIH 3HK3B 2ZTYA 2B9LA 3GCNA 1G2MA 1SGNE 4JZEH 1JRSA 4I33A 3TNSA 2GCTB 4YLQH 4TWYA 3AVZA 4WMEA 4X6NA 3T28A 1EATA 2BDCA 6LPRA 4X1NU 2ALPA 5AHGH 1DE7H 1ABJH 3SO3A 2GCTC 2R0LA 1FIZA 1J9CH 3SORA 4AFUA 1TNKA 1PJPA 1INCA 2VGCB 4FU7A 4MPVA 8KME2 1EAIA 2BDAA 2NU3E 4U01A 3P95A 3ZZ8A 2B0FA 1A0LA 3QX5H 2VGCC 1C2GA 1SGCA 2Y5HA 1UTQA 4TY7A 1EAWA 4U32A 2PLXA 1QL8A 1FY1A 5FPSA 1C5QA 5C3NA 1KY9A 2Z6BD 1H8IH 1D3QB 5HGGA 2THFB 1DANH 1KXEA 5G4BA 1ZLRA 3FP6E 1BBRH 2WV4A 4B2CA 2OC1A 1LTOA 4AZ2B 1O2KA 1TGTA 3OY6U 4FU9A 1C2LA 4MNXA 1L4DA 4HFPB 1ZRKA 3V13A 1EZXC 1CSOE 1AB9B 1GJ5H 2GDEH 1V2LT 1JWTA 2VIWA 1QBVH 4ZROA 4IC5A 4OS1A 3U98H 1PPHE 1WSSH 3Q3XA 1GMDF 1AB9C 5H4IB 1K1OA 3LJJA 2QC2A 3L3TA 1AHTH 1C5RA 3AASA 1DWDH 1W7XH 3GDVA 4UFDH 4TY6A 2W7SA 3ZVGA 1PQ7A 1EPTB 1GG6B 1LCYA 1JIRA 3RC4A 1OP8A 1ZTLA 1C5ZB 3PMHB 5JB8S 1NZQH 1A0JA 4IS5A 2PUQH 1A5IA 2PW8H 1MU6B 5GPIB 1UJ1A 1EPTC 1OX1A 1EZQA 5JBTA 1AIXH 1UVUH 5C1UA 3M7TA 1GBKA 3GICB 3N7OA 2PTNA 2UWPA 1W14U 1AWHB 4JYVH 1TE0A 2ZI2H 3PLKA 1MMJN 3RM0H 1ANCA 2FI3E 1CA8B 3ATKA 1W13U 2AH4X 2SGQE 2VH0A 3RXRA 3LGWA 2GV7A 1AWFH 1P05A 1TMBH 4B74A 3SU4A 1XXFA 4X6OA 1LHGH 4Q7XA 2J4IA 2VJ1A 2HALA 2F9OA 2BVRH 3SNEA 2H6MA 1AZ8A 4OS7A 1A3EH 5L2YH 3A87A 2Y6TA 1LHEH 4I32A 3PTNA 2GCHG 3AW1A 4YLUA 3GCTG 4NSYA 1WUNH 3SNCA 3H7TA 1LVBA 1GBJA 4TWWA 1CT2E 4IBLH 1C5UA 1C4Y2 1V2NT 3D65E 1YPKH 1ZR0A 4B1TA 5TCCA 1IQNA 1SGIB 5EQRA 1EXFA 2Z9IA 2PGQB 2VVUA 1V2TT 1Y8TA 3ZYDA 4IMQA 2GZ9A 2HNTE 4GVUA 4NA7A 3MWIU 3KN2A 2PSXA 2RG3A 3KNXA 4UFFH 2ZGHA 3H7OA 1LPZB 3SUEA 4NFEA 1O3KA 1PPCE 3RXOA 4LOYH 5EW1H 1TLDA 3EYDA 2R0KA 1ZPZA 4YZUA 1D9IA 2O8WA 1UMAH 3ATIA 4E05H 3H5CB 2C8YB 3EDXB 2ZGJA 2RA3A 1CO7E 4X1PU 2GZ7A 1SFIA 1YBWA 3UR9A 1UTKA 2R9PA 4Y71A 1BTXA 1DWEH 3VB3A 5F6MA 1SMFE 4LZ1H 4ZXYH 3URCA 5HM2A 5I46H 2ZCLP 4D76A 1SGYE 2QYIA 1KXFA 3SU6A 1PQ8A 3MU8A 1P2KA 2STAE 1D4PB 3ZZ4A 3BV9B 3GYLB 1BBRK 4YOIA 4A7IB 4OS2A 4Z6AH 1TRNA 1SQOA 2BQWB 1P9UA 1DY8A 1PFXC 2XBXA 1JIMA 1O31A 1KSNA 1O3NA 5C1YA 5A8XA 4MPXA 2Z9JA 2HRVA 2AIQA 1FPHH 1G9IE 1C4V2 1E37B 1QNJA 3DFLA 1GHYH 3SUDA 1S85A 2VIQA 4X1SU 1THPB 4MNWA 3SV8A 2OXSA 1KXBA 1SLUB 1L1GA 3T2NA 8LPRA 1AY6H 4A1XA 4DURA 4FUGA 1DM4B 5GCHG 4UD9H 3Q3KA 2K1QA 3Q77A 4BTUB 4ZKRU 3GY2A 3RLWH 3S9CA 2FX4A 1RJXB 1A46H 1BTPA 1OWHA 3LDXH 1AN1E 2ZFPH 2ZKSA 3BTTE 2AFQB 1QJ1B 1G37A 3P8FA 4ASHA 4K2YA 4YO9A 5EXMA 3A8BA 3RXUA 3E91A 2AMDA 5EXLA 5DO4H 1V2JT 2GCHF 3GCTF 2WV5A 5JBCS 4Y6DA 4TPIZ 1YPMH 1IQJA 3RXBA 1BTUA 1SLXB 2ZZUH 5DP3A 1OOKB 3SV2H 2TIOA 4FUDA 2FOFA 1E35B 1XUGA 1LHDH 1HV7A 2W26A 1DY9A 4NA8A 4Q7ZA 1P3EA 2BD4A 1AMHA 1Z8JB 1RTFB 2J92A 1ZHMA 1MKXH 1QBOA 1AQ7A 2F9NA 2BHGA 5DP9A 1RRKA 4CBNA 1KTSB 3MHWU 2JH5D 1UK3A 4WXIA 3TJVA 2VWOA 3GISB 1C9TA 3RXFA 5JPMH 2EA3A 3KEEA 2ZTXA 2TGAA 1SGEE 3ESTA 1KLTA 2OQ5A 2Q6GA 2PKAB 3PMBB 3GCHC 1EJMA 1FIWA 1GBDA 2WPLS 1TPOA 1Q31A 2FOHA 5JB9S 4X8UH 2EEKA 1GBTA 4J2YB 1DLEA 2BD5A 2OQUA 3A85A 2ILNA 3Q00A 3R3GB 1QB9A 1MH0A 3LT3A 2OC7A 3E0PB 2XWAA 2QCYA 4BAQB 3RXHA 3SU1A 2IPHA 5HMAA 1HXFH 3MMGA 1EB2A 3CS7A 3MU0A 2PKSC 4ZHMU 3ENSB 3RXGA 4O03A 5LGOA 3ZV9A 1AFEH 1EJAA 1WYKA 2BD3A 4ZHAA 1GJCB 3SV6A 1ZSKA 1AFQB 5DP8A 2ZHQH 2BYAX 1MAYA 3P8GA 2BD8A 4MPWA 4WH8A 5FBEA 2ZU3A 2C8ZB 2NU4E 1GHVH 3HKIB 1F5RA 2PTCE 2LNCA 1AFQC 3K6YA 1ZGIA 2AS9A 3ZZ5A 2ZHEH 2G5VA 1BRAA 5EQSA 3RUOA 1FAKH 4B76A 1GHWH 2BTCE 1MU8B 5T6DA 4NZQA 4GAWA 1IQIA 3M5LA 1DT2A 1E34B 5GCHF 2M5TA 2IOTA 1HJAB 1QFKH 1TYNA 3A84A 3O8RA 1QJ7B 4WMFA 2VIVA 1NM6A 2BXUH 1C1NA 1C5MD 1SGTA 1YLCA 1ARCA 2FTLE 3TITA 1HNEE 1O3AA 1GDNA 5DKMA 1HJAC 2A0QB 3K9XB 2A4GA 3O8DA 2FLBH 3W95A 4MQAA 1ESTA 1V2UT 4KELA 4D9QA 4AGKA 1T31A 3FAOA 1T8OA 1G3BA 2Z9KA 1N1LA 3TK6A 2ZFRH 1TOCB 2BDBA 1QBNA