1V2VT

Benzamidine in complex with bovine trypsin variant x(ssai)bt.c1
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSAIITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Understanding protein-ligand interactions: the price of protein flexibility
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2vT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2vT02
3MWIU 4D76A 1SHYA 5TCCA 1KXDA 4E7RG 2FLBH 4KKDA 3QN7A 4FU7A 3OX7U 2VWMA 1QY6A 1FONA 2TGPZ 3S9BA 2WPJS 4XBDA 5F6MA 1Z71A 1MTUA 1OPHB 1W11U 2GCHG 2I6QA 2VIQA 4Z6AH 1HAGE 4AZ2B 4JZDH 1BCUH 5E2PA 1O5DH 4R8TB 4D7GA 1GPZA 3WY8A 3T29A 6GCHG 1GI1A 4FUEA 2BY6X 2BD5A 4X8TH 4NWLA 1O2HA 1H1BA 1SLUB 4X8SH 1EAIA 3MOCA 5IYTA 1B7XB 1TRMA 4CRGA 3TGJE 3GICB 5EPYA 3TK9A 2PWXA 1GCTC 3ZV8A 5DK1A 1K1IA 2TIOA 3BN9A 2B9LA 4OS4A 3PMJA 4I7YH 4YLUA 2BQ7B 3LKWA 4WH6A 1A46H 4X6NA 1HAZB 1IQHA 1BTXA 2V0BA 4BTUB 5E8EH 4ESTE 1KXBA 2GV7A 1YYY1 2ZPSA 4FUFA 1A4WH 3M36A 3SO3A 4E05H 1BDAA 1HJAC 1XKBC 1AB9B 3SNDA 2Y7XA 3LGTA 4X2WA 5JPMH 3VEQB 1OYTH 2A5AA 3A88A 1GJ8B 2FDAA 1W3CA 1B0FA 2OQ5A 1W7GH 4JZFH 3C27B 4GVUA 3ZZBA 2QCYA 2VIWA 2WPHS 4XSKU 1G9IE 2BLOA 1EAUA 4TWYA 3H7TA 2ASUB 2AIQA 2VVVA 1BQYA 1O3JA 1QR3E 2VVUA 1TOCB 5DG6A 1SB1H 2BDYA 3U9AH 2EI6A 4D8NA 3BIVH 1HXFH 3B8JA 1P2IA 1C9PA 2SGPE 4KTSA 3T2NA 1A5HA 2VU8E 2XXLA 4TPYA 1TOMH 5JB9S 1HJ8A 2PGQB 2VH6A 3LJOA 3TU7H 1AD8H 4B73A 3LDXH 4IGDA 3I29A 2D2DA 3P17H 4THNH 3KGPA 3W94A 3RLWH 4DCDA 1BT7A 1LHFH 2BVXH 1O3LA 5EGMA 3ZZ4A 3KCGH 1SGNE 2BDBA 1O5GH 1BITA 1AU8A 4IN1A 4YT7H 1O0DH 3TLOA 2Q6FA 1SGFG 3SOSA 1V2NT 3SNCA 1ANDA 1CVWH 1BTHH 1EOLA 1P57B 4NFFA 3LJJA 1DT2A 4Q7XA 1FY1A 3ZZCA 1QTFA 1YLCA 2F9VA 3NXPA 4GAWA 1CHOG 5ESTE 4XE4A 1UJ1A 1SOZA 4RN6A 2ZIQH 1P2OA 2CGAA 4ZHAA 2ZU5A 1O31A 3M61U 5JBBS 4B2CA 3MFJA 1D3DB 1D4PB 1C2EA 2VIDA 4IW4E 4MNYA 1HAVA 1EKBB 1DM4B 4LZ1H 4JYVH 1O37A 1P05A 9LPRA 1UTMA 1SC8U 3A7YA 3EA8A 1PYTD 4E06H 1YF4A 2B7DH 3LU9B 1QFKH 1DUEA 4J1YA 1S0RA 1ZYOA 4IMQA 1O5BB 1C5UA 1TNIA 3LOXA 2R2WU 3SORA 3O8BA 1EZUC 1L1GA 2ZFSA 3RMOH 4U2WA 1GBHA 2PGBB 1QJ1B 2G8TA 1FNIA 5BPEA 1C5VA 2RCEA 2Y82A 1MTWA 3V0XA 5C2ZA 1QRZA 1W13U 1CU1A 1DXWA 1F92A 3RXSA 4K8BA 5LPRA 1K9OE 3M7QA 2FTLE 2H9TH 1TE0A 1T8NA 3ELAH 4K1EA 2C93B 4ABEA 3F9GA 4X2XA 4MQAA 4LZ4B 3L3TA 2O8TA 4Y76A 1FPHH 3LIWA 2Y81A 1HJAB 2BY5X 4YM9A 1IQKA 3SNEA 1XUKA 3Q76A 1CQQA 2HPQH 1G32B 1C1UH 3KQDA 2VB0A 4WJG2 1SI5H 4NIYA 3VPKA 2B5TB 1AZZA 2LNCA 3M5NA 1M9UA 3T25A 3EA7A 2EC9H 1J17T 2QXHA 2QF0A 1NU9A 3ATWA 1HDTH 3UR6A 4KTUA 4KP0A 1P9UA 5DP3A 2KAIB 1JOUB 4ABGA 4DG4A 3GY8A 2FESH 1QA7A 1D3TB 4O3TA 1ZGVA 4OGXA 1BOQA 1F2SE 1XVMA 3V7TA 1QRWA 2F9PA 2FI5E 3K2UA 1PFXC 2DE8A 4CBNA 1IQMA 1HLTH 1RIWC 5PTPA 1C1MA 3A83A 4YOIA 1G3BA 3V13A 1Y3XA 4JCNA 4INLA 2BY9X 3A8DA 1ZSJA 2WINI 4HFPB 1SSXA 4TYDA 1GHXH 3LPRA 1TBZH 1YPKH 1ZRKA 1HUTH 1O2QA 5A8XA 2BXUH 1HJ9A 4CRFA 1HAVB 2ZHQH 5G4BA 5A8YA 1HV7A 1P09A 4BTTB 4Y0ZE 3SUDA 5A09A 4FUCA 4ABAA 2C8XB 2AGIX 3TJNA 4I32A 2A7HA 8LPRA 2VNTA 4I8KA 1C1TA 2A2XH 1ZPCA 4HTCH 1BB0B 4BAKB 1CHGA 3FP8E 1CGJE 2VGCC 1F7ZA 2J92A 3MU1A 4BAMB 2BVRH 4YTAA 3IG6B 4BOHA 3D49H 2AS9A 3SHAH 1H8DH 3GY4A 1D6RA 3RMLH 3T26A 1AO5A 3M7UA 3P70B 3GCHC 1RXPA 1SPJA 1TNJA 3I77A 1F5KU 3U1IB 4ABDA 1N1LA 2TGDA 2O8UA 1Z1IA 3ZZ6A 4X1PU 1P02A 1ZR0A 2FI4E 3SBKA 2WPKS 1AE8H 4JZEH 2WV4A 3GY7A 4AB9A 1D9IA 1UHBA 1ZJDA 1FLEE 2A32A 1P2NA 2Y80A 1TLDA 3GY2A 4ZXXH 3I78A 1LMWB 1GHAF 3SV6A 2CF8H 4BXSA 2PTNA 1OP8A 4MPXA 1UTJA 4PROA 1DVAH 3BIUH 3VXEH 2ZZUH 1AUJA 4AFUA 1AMHA 6ESTA 1FPCH 1IHSH 4AGJA 2JH5D 1S6FA 1SGPE 2BXTH 1GBEA 2VVCA 4K2YA 4MDSA 1JMOH 1ZSKA 1Z6EA 2AGGX 1RTKA 4X6OA 3AW0A 1W12U 3ZZ5A 4CR9A 4U01A 2BLVA 3DFJA 1SGFA 3A82A 1Z6JH 4X2YA 2SFAA 1GMCG 1O3KA 1DXPA 5CHAB 3TJVA 2ZFRH 1GG6C 3SN8A 2D1JA 5DP5A 1ZRBA 3RMNH 2UWLA 3BTGE 2GDEH 2H5DA 1ABIH 1MKXK 1O3GA 2FYRA 2GGVB 1H4WA 1GBLA 3GY6A 4WXIA 1GI4A 1BRUP 3CP7A 2WPLS 3LGYA 4X8VH 1AE5A 3MI4A 3BEIB 2G4UA 4DVAU 3UREA 2OC0A 3HGPA 3M3SA 4A92A 4VGCB 1A0JA 2LPRA 5EPNA 3LH1A 3RXBA 4UDWH 1WTHD 2ZGJA 4CHAB 3RXDA 1DS2E 2UWPA 1DWDH 5EXLA 3QDZB 2G51A 2THFB 1TAWA 2G00A 1INCA 1GHYH 3M5LA 1KXAA 5FBIA 1DY8A 1UTLM 2UUJB 2K1QA 3NPSA 4YLQH 2AIPA 5FCKA 5K7RA 3QLPH 4FU8A 3TGKE 1LHGH 1EQ9A 4O97A 1AWFH 2G4TA 4UE7H 1S84A 3SGAE 5AF9H 3E91A 1O35A 2A4RA 2PHBA 1NY22 1V2QT 1ZTKA 2FI3E 3VB6A 2CV3A 1O3EA 3H7OA 1PQAA 1UHBB 1LO6A 3BTFE 3ZVFA 1TA2A 1QBOA 5CMXH 4FUIA 1ELCA 4RSPA 2PSXA 1HIAA 1CGIE 5GJ4B 1SMFE 2GZ7A 4I8JA 1FAXA 1MAXA 1GL0E 1QB6A 1QGFA 2ANYA 3VB3A 5HYOA 1C1QA 4H6SB 2V3OH 1V6DA 1O3DA 2ALPA 1F0RA 2Z9LA 1KSNA 1EZSC 1EP6A 2W7UA 2VIPA 3RC6A 2Z6BD 1F0TA 2ZU4A 1UCYH 4SGAE 1GMDG 3SNAA 1SQAA 3OTJE 5FBEA 2J9NA 3A8AA 2OXSA 1BTPA 4M7GA 1RTLA 3V12A 4D9QA 4INHA 1ZTJA 4YZUA 1ZSLA 1AB9C 1UVOA 3GCTG 4K1TA 3W95A 5AFYH 1ID5H 5EXNA 1O5AB 1HRTH 2FO9A 1TFXA 4WMEA 1V2RT 1C5LH 2ZGXH 2HOBA 5FX5A 1P0SH 2EA3A 1TBRH 2XC0A 1NFYA 4Y8YA 4ZHMU 1ELBA 5ABWA 4CRAA 1GI2A 1ZZZA 1GVKB 2DUCA 1FY8E 1DLEA 1LDTT 3VB4A 3MO9A 3ZV9A 2FPZA 1ELFA 2VJ1A 4ABFA 1AVWA 2GT8A 1ESAA 2G5NA 1SGQE 1GBDA 1EOJA 4BAOB 4FUBA 1THSH 3SU4A 1D3QB 3RXIA 2QXIA 3D23A 3AAUA 2VIVA 2XWBI 4NSYA 5EODA 5T6DA 6CHAC 1VITF 1C5NH 2FOCA 3FANA 2BDGA 5EG4A 5DP8A 3BTDE 4R0IA 4MVNA 5HMAA 1TGCA 4AB8A 1K1OA 2HPPH 1FV9A 3LONA 2UUKB 4WWYA 3TITA 1KIGH 1NRNH 2B0FA 2PUQH 1O3AA 1C1OA 4IC5A 1UTQA 3SU2A 1WYKA 1E0FD 2ZU3A 1DSTA 3RM2H 2H2ZA 4MNXA 4Y11E 2FS9A 3CS0A 3P92A 1WCZA 1BHXB 1GHWH 1SGYE 1QCPA 3IITA 3EAJA 2BD7A 2PLXA 1VZQH 3MO6A 4AYVB 5LH8A 2GZ9A 1HPGA 1HIAB 2ODQA 2QXJA 2Y5GA 2BZ6H 4AFSA 4Y6DA 2PFEA 2R9PA 4ABHA 1GHZA 1DWEH 2Z7FE 2R3UA 3LGVA 1OP2A 1NRPH 1V2ST 1UK2A 1MBQA 2Z9GA 1XUFA 2XW9A 1DANH 3A84A 1UTNA 1ZPZA 1OWKA 2AEIH 5F8TA 1YCPH 1T7CA 2D26C 3TJUA 5SGAE 1AIXH 7GCHG 4BNRA 1XM1A 1UK3A 1BRCE 1MU6B 4KTCA 1YPHE 1TONA 1O2GH 2P59A 1NRQH 1BJVA 1FAKH 1C1PA 2V3HH 4FUGA 3SZNA 1GHBF 2A4GA 3UQVA 1W14U 1TQ0B 2BD4A 3U8OH 5EW1H 1DOJA 3B9FH 1MKWH 5DGJA 1P2JA 4Y8XA 4YT6H 2AFQB 4WMFA 1TRYA 3RXVA 1LVBA 1FY5A 3QK1A 1CBWC 4F4OC 2IOTA 3T27A 3UNRA 4UD9H 3PV4A 1ANBA 5H4IB 3OY5U 3CENA 4I8GA 1O3PB 5E0HA 1VGCC 4NA7A 1BRAA 6LPRA 1J8AA 1GMHF 2FXRA 1XVOA 1ZMLA 1PQ7A 3PO1C 4DURA 4OS2A 2XCFA 1O2LA 3RP2A 1YPEH 1B5GH 1YM0A 1KTTB 2PUXB 3LH3A 1LPGB 1PYTC 2HRVA 3BTWE 2ZKSA 4GCHF 2ZGBH 4TPIZ 1F5RA 2ZGCA 3Q3XA 1NM6A 2ZCLP 2ANWA 1GJDB 6CHAB 1O3MA 2BB4A 3MNBA 1O2NA 3ZVDA 4ZKSU 1N6XA 2PV9B 4I31A 3F9FA 1P12E 1BTZA 2A31A 1C2JA 1GJ5H 4XBCA 4AGKA 2GMTC 3ITIA 1UVPA 4OS5A 1K22H 3P8FA 3F1SB 2XC5A 1TA6A 3AW1A 1QA0A 2P94A 4TY7A 5JBCS 4ISNA 3E3TA 2ZI2H 2G5VA 1ZJKA 1ZPBA 2B8OH 1V2WT 1HAHH 4ZROA 4FU9A 4GLYA 5C1XA 2OC8A 2OC1A 4B74A 1NC6A 1KDQA 2G52A 1GI9B 1PPFE 2XYAA 1SGRE 1GJCB 2P3TB 1U6QA 4WMDA 2VINA 1CT0E 1V2KT 2FM2A 4AORA 4AX9H 1PQ8A 2WV5A 2ZTZA 4AFQA 1O33A 1C5OH 4A7IB 1O30A 5GPIB 4UFEH 2H6MA 2F9NA 2QY0B 2P3FH 1G2LA 2DE9A 3HKIB 1ARBA 3SJ8A 3T62A 1GWAA 2Z3DA 2ZFQH 2Z94A 3SGQE 2O8LA 2HGTH 4XFQA 3LGIA 1MAYA 2AMDA 3QO6A 3GISB 3DFLA 2FYQA 1Z1JA 2F3CE 5F8ZA 4WXVA 1EASA 2OC7A 1WBGB 2F91A 5IDKA 3SV9A 3MH6A 4NZLA 3PMHB 1G3EA 2XC4A 4X0WU 1XUJA 1O39A 2GV6A 4MPVA 4Q7ZA 1NZQH 1CT4E 1LTOA 2QC2A 2ULLA 1TNHA 2ZFPH 3SI3H 4ZHLU 1ZTLA 2FEQH 2ANMH 4IMZA 1EAXA 1KXEA 2A7CA 1O3FA 3ENSB 5F8XA 1G36A 1TMBH 2ZDMA 1K1JA 1TPAE 1IQIA 5LGOA 4Z0KA 3AASA 1J9CH 4NG9H 2XTTB 1CBWB 3L33A 2FX4A 3SU6A 1OYQA 4X1SU 1QJ6B 2FTMA 3VB7A 1SBWA 1FJSA 1ARCA 2EI7A 2ZTYA 3LC3A 5E0JA 1HAYB 1ZLRA 1EPTC 1C1VH 3EYDA 3KQCA 3BTKE 2O8MA 1Q3XA 2NU0E 4NIVA 1JIMA 1VGCB 1HYLA 2PSYA 3RXQA 1EB1H 3OSYA 1YBWA 1OXGA 2QAAA 1OWEA 3PO1B 1O5EH 4I33A 2BD8A 4B2BA 1LKBA 1PPEE 2GCHF 3EA9A 3V3MA 5DP4A 1EPTA 5AVDA 4I8LA 4OS6A 3SJKA 4WH8A 1IQGA 1UMAH 1D6WA 2RDLA 4X8UH 6GCHF 5GWZA 3DD2H 5CHAC 3R0FA 2XBWA 3U69H 1RTFB 5C5NA 4RKJB 3LC5A 2GCTC 1TRNA 1DITH 2FOAA 2Z3EA 3ATLA 2GTBA 3RXFA 3SU1A 2G55A 2GMTB 2ZU1A 4BANB 5EOKA 1ELDE 2CHAC 1EZQA 2JETC 4IS5A 4UFGH 1KDQB 3RUOA 3UNSA 8GCHG 1XUHA 4VGCC 1IQEA 1C4Y2 1WOFA 3UWIA 2HNTE 4CHAC 1G30B 1DLKB 1UVSH 1FZZA 2ZDAH 2BX3A 4RKOB 3M3VA 1QL9A 2FS8A 1JIRA 3PB1E 3OU0A 1THPB 2ZCHP 3NKKA 3TIUA 1K1PA 2TGTA 2C8YB 1ESBA 5FCRA 1XUGA 2WYJA 1GBJA 2Y5HA 1GI6A 2PKAA 2SNVA 5GCHG 5FX6A 3VGCC 4IC6A 1GJBB 1OOKB 5JBTA 4K1SA 3TGIE 1GL1A 1BTYA 1WV7H 2Z9IA 4NFEA 4ZKNU 2I6SA 3GY5A 1SGTA 1GJ4H 1QBNA 1EATA 2A5KA 3ATKA 3SJ9A 1T31A 1YPGH 2W3KA 1W0ZU 3KHVA 1XUIA 4AFZA 1G37A 3UOPA 2EEKA 3UIRA 1PPCE 1TYNA 1YKTA 1XXDA 1BBRH 2ZO3H 3HPTB 1TALA 4TWWA 2FLRH 3A89A 1GI0A 1MMJN 2GVFA 1Y3WA 3Q00A 3JZ1B 3NWUA 1WTGH 1LHEH 3LGUA 4XOJA 4B71A 5HGGA 1C5MD 1MCVA 2HLCA 4ISOA 4MNVA 3C1KA 3K65B 3FAOA 3KIDU 1C2KA 1X7AC 3FFGA 3Q3YA 1CHOF 3MHWU 1Y8TA 1BMNH 1LPKB 1V3XA 1AGJA 1TB6H 4Y8ZA 4NA8A 3TVJB 5JYIA 1Y5AT 1GI3A 1TNLA 1MCTA 3RXMA 1P10A 1EPTB 2D8WA 2H5CA 1OS8A 4FVDA 4ZKRU 1GGDC 2FOGA 2BDIA 1ELVA 1H9LB 2OQUA 2XWAA 5ESBA 1H8IH 2V6NA 4INKA 1SGIB 1MTSA 1SLWB 3SJOA 1W10U 1TPPA 3URCA 1F5LA 2Q1JA 2Z9JA 3FP7E 3ODFA 3RXGA 3RXRA 2PR3A 1AQ7A 4DOQA 1CO7E 5DJ7A 1YCPM 3Q3KA 4ISLA 2BY7X 1PJPA 1RD3B 2XBXA 2GCTB 2QV1A 1P8VC 2Y5FA 1C2DA 1JXPA 3SJIA 4H42U 1ORFA 2RA3A 4GHQA 1T8LA 2BD3A 5T6FA 1ZMJA 3UY9A 2ZNKH 2CHAB 1AY6H 2PKSC 4LOYH 3RMMH 2JETB 2FOMB 5EW2H 1EJMA 4GPGA 1TWXB 2ZWLH 2R0KA 1BHXF 4YOGA 2R0LA 2SGAA 2JKHA 5JBAS 2BDCA 3ZVEA 1NFUA 1UCYE 2GT7A 2H1UA 3HATH 2OBQA 1AZ8A 2WUCA 3RXPA 5EXMA 4AOQA 4K69A 1DWBH 3F9HA 2PKAB 1P3EA 2TBSA 3GDUA 2FZZA 1WQSA 2YOLA 2A1DB 3MU4A 4FXGH 1SHHB 4O9VA 3KQBA 2AMQA 1O5CB 4MPWA 4ASHA 3BTEE 3SUGA 2O8WA 4AN7A 4LXBH 1G3DA 2OBOA 5FPYA 4AG2A 5LPFA 1DX5M 3VGCB 1C1WH 4MG3A 1GDUA 1MZDA 1JRTA 1T4UH 1NRSH 1P11E 3F6UH 1P2MA 2O9QA 1TGNA 1TPSA 1S0QA 5DKMA 1SG8B 2J95A 2FMJA 1ZGIA 3E1XB 3F68H 5HXFA 1O2PA 1TIOA 1UCYK 1HXEH 4KELA 1HBTH 4Y0YE 1P9SA 1JRSA 4JK6A 2WUBA 1QJ7B 3ZYEA 4DW2U 1O36A 3TK5A 3TNSA 1ZHPA 5FAHA 1WU1A 3DUXH 3BEFB 1QL8A 4X2VA 1BIOA 1ETRH 3ZVAA 3K6ZA 8ESTE 3FZZA 4DGJA 3S9AA 1KTSB 4NIXA 2ODPA 3E0NB 1O3CA 1QQUA 3QWCH 3D65E 4X1RU 2ZHDA 2STAE 4WF8A 1Q31A 2OTVA 1SR5C 2J38A 1XXFA 1G2MA 2GDDA 1O2TA 1VITH 2ZPRA 3A80A 2FODA 2C8ZB 2FOBA 3M37A 4J2YB 2SGEE 1VR1H 1K2I1 1V2UT 3MNCA 1LVOA 5DPAA 1GGDB 2ZDNA 3MNXA 1L1NA 1EXFA 4FVBA 1UVTH 1C5PA 4JZ1A 4DIHH 5L2YH 1WUNH 1N8OB 3PMAB 1RRKA 1ELEE 3EGKH 2F9BH 1QBVH 4Y7AA 1AHTH 3DT0H 1EP5A 3NUMA 3NK8A 1VCPA 3STJA 2WPMS 2P8OB 3PLBA 2FP7B 1GCDA 1NESE 1P01A 1G3CA 4KGAA 2ZHWH 4X1NU 4JK5A 1V2OT 3GOVB 1TNGA 1CSOE 5DP7A 2OINA 1Y5BT 2ZHFH 1C9TA 5BRRE 3GDSA 4ABBA 1C2HA 5I25A 1NTPA 2C4FH 3MMGA 2OP9A 4DY7B 1NS3A 1C2GA 1O32A 1BRBE 3UPEA 1Z7KA 1S6HA 1SVPA 2PKSB 3H5CB 3KL6A 1YLDA 2A2QH 3E8LA 3VXFH 3SV7A 3UQOA 3F9EA 4JMYA 1XKAC 1B0EA 3EDXB 5EQSA 3SHCH 1NFXA 1T4VH 3M35A 1C5QA 1QRXA 5GXPA 1TQ7B 3LT3A 3BF6H 3TH4H 2Q6GA 3S7KB 1OKXA 1VCQA 1ELAA 3CS7A 2ILNA 2UUYA 3ZZDA 1AWHB 3KN2A 2FX6A 1WSSH 5TCAA 1LVYA 2BQWB 1DPOA 4K5ZA 3RXEA 3FP6E 1VJ9U 1O2VA 3A8CA 5A0CA 2AH4X 3SI4H 1YCPK 2G81E 1P04A 2HWLB 1K1LA 2OUAA 3NCLA 3PTBA 1WAYB 1NROH 3SNBA 1IQLA 1AVGH 3DHKH 1O2XA 2BY8X 1S82A 3A8BA 4X1QU 2BX4A 4DT7B 1NPMA 1F0UA 1FDPA 2GKVE 2BVSH 1OWIA 1DFPA 1GMCF 3RXCA 3A7ZA 2R3YA 3BEUA 3O8RA 3A7TA 3E6PH 3EQ0H 1C2LA 4YO9A 3BG4B 1MKWK 3UNQA 4NGAH 5DO4H 3M7TA 3A7VA 1Y3UA 4ZXYH 1MD7A 5GIBA 2HVXA 1V2MT 1UTKA 1A7SA 5EQQA 1UTOA 3MH7A 5A0AE 4U32A 1GJ7B 1O2UA 1H9HE 1P2QA 5A2MH 3B23B 3DA9B 2W7SA 1HAXB 2OD3B 3P8NA 3SV2H 2VWNA 1NU7B 2FOHA 3A87A 2QXGA 4H4FA 1HCGA 1S83A 3QUMP 5GDSH 2WPIS 1MQ6A 1LHCH 3S9CA 4AG1A 5C3NA 1W7XH 4ISHH 1Y5UT 2SGDE 4IBLH 3G01A 1Q2WA 1RGQA 4FUHA 1YC0A 1O2MA 2QF3A 1GBAA 4BAQB 3PLKA 1ESTA 1KLJH 1P2KA 2W3IA 3IWMA 4F49A 5F03A 1LQDB 3RXUA 3ZZAA 2BD2A 2ZPQA 1AFQC 1NT1A 1BUIA 3FVFB 2BM2A 5TJXA 1DWCH 1F0SA 1EJNA 4JZIA 5CE1A 3SQHE 5ETXA 1NO9H 1J14A 3MNSA 4MLFB 4BXWA 1TMTH 2ZCKP 3RXKA 1KXFA 1O3IA 2ESTE 7LPRA 1FI8A 4A1VA 1Y59T 1GBMA 3RC4A 3RU4E 3S7HB 1EUFA 2J94A 2EI8A 2VH0A 2TGAA 1C4V2 3TK6A 1J16A 2PW8H 2QN5T 2FOEA 3SW2B 4FUDA 4AYYB 1O2YA 3AAVA 2JH6D 3HKJB 4BAHB 1GI7B 1YPJH 3ZVBA 2XRCA 2AGEX 4UONA 1EZXC 1GMDF 1TGSZ 1HAPH 1AKSA 2J4IA 1UK4A 1QNJA 3A85A 2KAIA 2A0QB 3RC5A 1FY4A 3BTQE 2WYGA 2GD4B 1C5YB 1CT2E 1GI5A 1WQVH 3E0PB 3U1JB 4K60A 3RXLA 2J2UA 1GHAG 3GCTF 3A7WA 3GYMA 2ZDVH 1ACBE 2V35A 3QX5H 1BZXE 3PLPA 4Y79A 1SLXB 1KY9A 1NRRH 1MD8A 1SQOA 1O3BA 1VJAU 3RXJA 1SQTA 1IQFA 3T5FH 4JYUH 3UFAA 1EB2A 1YPMH 1C1RA 1GBTA 2YNBA 3M5OA 1EX3A 2CN0H 1MTVA 1MTNC 2QYIA 3RM0H 1OX1A 2ZQ1A 3E90B 1QIXB 3RLYH 1LVMA 5L6NH 1FN6A 4DIIH 1DY9A 1A0LA 3SU0A 1TGTA 2XCNA 1P06A 1TBQH 4Q2KA 2Z9KA 1KLTA 4ZH8A 1S5SA 1SFQB 2ANKH 4BTIB 2IN2A 1SL3A 3Q77A 2CJIA 4MTBA 1OWHA 1C2FA 1O5FH 1QB9A 3QTVH 2GZ8A 4TY6A 4XBBA 1J15A 4Y71A 3SQEE 1GBKA 3PYHA 4A5TS 4CBOA 3D62A 5A0BA 5JB8S 4A1TA 2ZP0H 1O34A 4UFDH 1QHRB 1GCTB 2ZHEH 1QB1A 4CH8B 1JWTA 1SGCA 1K21H 2A7JA 2UWOA 1Z8RA 3RXAA 1DUAA 1HAIH 1E36B 3TH2H 4NA9H 5DP9A 2BD9A 3ZVCA 4B1TA 2BQ6B 1QURH 1SGDE 2ODYB 1GBBA 1MH0A 3SU3A 1O2RA 3FZDA 1K1MA 4DJZB 1AFQB 1MUEB 1Y3VA 1O3NA 2ZTXA 1FXYA 1YPHC 3BV9B 3SU5A 1BMMH 4MPUA 5HM2A 2ZDLA 1ETSH 4QT8C 3U8TH 2STBE 3MH5A 4D9RA 1O2SA 2GP9B 1PPGE 2W5EA 5AHGH 1DDJA 1PPZA 2A4QA 1BMAA 2PTCE 5HM9A 3RXHA 1DE7H 4A6LA 2TPIZ 1SFIA 1Z8JB 3LGWA 3P95A 1LKAA 1TABE 1ABJH 3ZZ8A 1BBRE 2Y7ZA 3NZIA 3PTNA 1AKSB 7GCHF 7KMEH 1C5TA 4GSOA 5DP6A 4JYTA 2ZDKA 4YOJA 1FIZA 1E34B 3JZ2B 1A0HB 5FPTA 5LPEA 1V2TT 3PMBB 2AMPA 3UUZA 1O2IA 3RDZA 2BOKA 1RS0A 2BLWA 4FUJA 2YNAA 4B76A 1ELGA 5EU8A 5C1UA 3SUEA 1V2JT 5I46H 2ZQ2A 2AYWA 1FUJA 2QA9E 1T8MA 1JBUH 2ZFFH 3ZYDA 1BBRK 2SGFE 1C5ZB 3U98H 3SGBE 1CGHA 1ZMNA 4NSVA 4NIWA 4ZAEA 3K6YA 3MH4A 2A4OA 3VFEA 4A1XA 1MBMA 3URDA 2VIOA 2VWLA 3AVZA 1LCYA 1MTNB 4GUXA 1ELTA 4I8HA 1V2PT 1KYNA 1O3OA 5L2ZH 1O38A 2P93A 1A5GH 4E7NA 3OY6U 1A3BH 2NU1E 3U8RH 3P8GA 1IOEA 4SGBE 3QZRA 1PPBH 1C5XB 3BG8A 2NU4E 1P3CA 2VWOA 1GJAB 1MQ5A 2BDAA 3GYLB 1MU8B 1GJ9B 1K28D 2BLQA 3GCOA 3QTOH 1FY3A 4UEHH 2BZAA 2XBYA 1BA8B 3RXOA 3MU8A 1YGCH 3HK3B 1CA8B 1GBCA 1GHVH 2C90B 3SUFA 1AN1E 3RU4D 3VB5A 1A3EH 2OCVB 2ZU2A 1DICA 4K8YA 4ABJA 1T32A 4D7FA 3PROA 1DSUA 2Y6TA 4ZMAH 1HB0B 3M3TA 1CE5A 1AFEH 1A61H 4GHTA 4NZQA 1C1SA 1VITG 2A45B 3RXTA 1C5WB 1FIWA 4CREA 3GDVA 2NU3E 4NCYA 4Q80A 1GBIA 5FXLA 3O8DA 1E38B 2P95A 1E35B 3KF2A 3KQEA 3BTME 1OWDA 3MTYA 1TPOA 1S85A 2A5IA 1O3HA 1N8OC 1C5SA 4UFFH 3ZZ3A 1P03A 2QIQA 1LHDH 5E2OA 4U30A 1TGBA 1H9IE 1YP9A 2ZEBA 4YESB 5C5OA 1W8BH 4B2AA 2P8OC 1C5RA 2F9OA 1UTPA 1CA0C 2CF9H 1L0ZA 1C1NA 2QGRA 3A81A 1HFDA 1HNEE 1UO6A 1O2KA 1XX9A 1GI8B 2BHGA 4HZHA 2ZA5A 4Q7YA 2Z3CA 3L6PA 4ABIA 1V2VT 3O8CA 2JH0D 3TH3H 1BJUA 2OLGA 1RIWB 2BOHB 2UUFB 2P16A 4H6TA 1ETTH 1O2ZA 4OGYA 2R2MB 1MZAA 1IQJA 2SNWA 3TNTA 1K1NA 1KLIH 4WY3A 1Z8GA 2P3UB 2CMYA 1A2CH 2ZFTA 2HNTF 4O03A 1FN8A 1BTWA 1L4DA 2F9UA 2AERH 4Y7BA 2FIRH 1BTUA 3S69A 3QZQA 3N7OA 1W0YH 1GHBG 3P8OA 1IQNA 2IPHA 1SOTA 2H9HA 4XDEA 4NWKA 3A86A 3ESTA 5J4QA 1L4ZA 2FOFA 2GX4A 3PWCA 1MKXH 2HNTC 4OS7A 3HK6B 1KXCA 1O2JA 4HGCA 2ZECA 2VGCB 4O3UA 2C8WB 2XNIA 5EQRA 3KNXA 2ZGHA 4X6PA 1RFNA 2J34A 1W2KH 1GMHG 1E37B 3BG4C 2BDHA 5C1YA 1C2IA 3GCNA 1AVXA 1NN6A 2BMGB 2Q6DA 2ZG0H 3GCHB 2SGQE 4ZKOU 2RA0A 3UTUH 1L1JA 2ZF0H 3K9XB 4GCHG 3UR9A 3ZVGA 1LPZB 2XBVA 8GCHF 4WVPE 2NU2E 4CRCA 1TX6A 4ISIH 1A1RA 2BYAX 1IAUA 3RU4T 4CR5A 1NFWA 3MU5A 1C2MA 5C67A 3PM3A 1PPHE 2NWNA 2RG3A 2HALA 3HGNA 1SGEE 5JDUB 7ESTE 4ZUHA 8KME2 2W26A 5E0GA 2ZC9H 3TPIZ 1N6YA 1D3PB 3OYPA 4CRBA 4IN2A 1FQ3A 5K0HA 3BSQA 1GDNA 1VCWA 1LQEA 3BTTE 5GCHF 3QGNB 3GY3A 1IHTH 2FWWA 3SV8A 5A8ZA 2F83A 4OS1A 5FHTA 1AI8H 3UOUA 2C3SA 3ATMA 1ANEA 1TX8A 1GDQA 3MO3A 1BMLA 1CA0B 1Y3YA 3A7XA 2H9EH 3ZZ7A 4MNWA 1PQ5A 3UWJH 1QQ4A 1V2LT 1UVUH 1GJ6A 3BTHE 4CRDA 1TMUH 3E16B 1C4U2 3MU0A 1Z8IB 3EE0B 3ATIA 1A5IA 4B75A 4X6MA 1GG6B 2CXVA 2BTCE 1HAOH 2ALVA 1HGTH 1AUTC 3PWBA 3MYWA 4HI3A 1RJXB 1T8OA 1TX7A 4K3JA 1OP0A 1SLVB 1YPLH 3S0NA 2M5TA 4CH2B 1TNKA 9ESTA 1OWJA 5J4SA 1XMNB 5T3HA 1FMGA 5FPSA 1S81A 1O2WA 2IJOB 3QGJA 4LK4A 1ANCA 1EAWA 4Y10E 3ODDA 2TRMA 3P6ZB 1GVZA 1ZHRA 1O2OA 5AFZH 1THRH 1QL7A 1GVLA 3ZZ9A 1L2EA 1ZOMA 5L30H 1EJAA 3T28A 1GBFA 5T6GA 3KEEA 5C20A 3M5MA 1ZHMA 3TJOA 3STIA 1OSSA 3R3GB 5B6OA
chains in the Genus database with same CATH superfamily
3MWIU 4D76A 1SHYA 5TCCA 1KXDA 4E7RG 2FLBH 4KKDA 3QN7A 4FU7A 3OX7U 2VWMA 1QY6A 1FONA 2TGPZ 3GS9A 2WPJS 3S9BA 4XBDA 3KYFA 3W1EA 5F6MA 1Z71A 1MTUA 1OPHB 1W11U 2GCHG 2I6QA 2VIQA 4Z6AH 1HAGE 4AZ2B 3ZIAD 4JZDH 1BCUH 5E2PA 1O5DH 4R8TB 2QE7D 4D7GA 1GPZA 3WY8A 3T29A 6GCHG 1GI1A 4FUEA 2BY6X 2BD5A 4X8TH 4NWLA 1O2HA 1H1BA 1SLUB 4X8SH 1EAIA 3MOCA 5IYTA 1B7XB 1TRMA 4CRGA 3TGJE 3GICB 5KEDA 5EPYA 3H09A 3TK9A 2PWXA 1GCTC 3ZV8A 5DK1A 1K1IA 2TIOA 3BN9A 2B9LA 4OS4A 3PMJA 4I7YH 4YLUA 2BQ7B 3LKWA 4WH6A 1A46H 4X6NA 1HAZB 1IQHA 1BTXA 2V0BA 4BTUB 5E8EH 4ESTE 1KXBA 3U28C 2GV7A 1YYY1 2ZPSA 5HIZA 4FUFA 1A4WH 3M36A 3SO3A 4E05H 1BDAA 1HJAC 1XKBC 1AB9B 3SNDA 2Y7XA 3LGTA 4X2WA 5JPMH 3VEQB 1OYTH 2A5AA 3A88A 1GJ8B 2FDAA 1W3CA 1B0FA 2OQ5A 1W7GH 4JZFH 3C27B 4GVUA 3ZZBA 2QCYA 2VIWA 2WPHS 4XSKU 1G9IE 2BLOA 1EAUA 4TWYA 3H7TA 2ASUB 2AIQA 2VVVA 1BQYA 3NRLA 1O3JA 1QR3E 2VVUA 1TOCB 5DG6A 1SB1H 2BDYA 3U9AH 2EI6A 4D8NA 3BIVH 3CNRA 1HXFH 3B8JA 1P2IA 1C9PA 2SGPE 4KTSA 3T2NA 1A5HA 2VU8E 2XXLA 4TPYA 1TOMH 5JB9S 1HJ8A 2PGQB 2VH6A 3LJOA 3TU7H 1AD8H 4B73A 3LDXH 3F2FA 4IGDA 3I29A 2D2DA 3P17H 4THNH 5GNDA 3KGPA 3W94A 3RLWH 4DCDA 1BT7A 1LHFH 2BVXH 1O3LA 5EGMA 3ZZ4A 3KCGH 1SGNE 2BDBA 1O5GH 1BITA 1AU8A 4IN1A 4YT7H 1O0DH 3EE7A 3TLOA 2Q6FA 1K0HA 1SGFG 3SOSA 2KM0A 1V2NT 3SNCA 1WXRA 1ANDA 1CVWH 1BTHH 1EOLA 1P57B 4NFFA 4B6FA 3LJJA 1DT2A 4Q7XA 1FY1A 3ZZCA 1QTFA 1YLCA 2F9VA 3NXPA 4GAWA 1CHOG 5ESTE 4XE4A 1UJ1A 1SOZA 2M2AA 4RN6A 2ZIQH 1P2OA 2WPDD 2CGAA 4ZHAA 2ZU5A 1O31A 3M61U 5JBBS 4B2CA 3MFJA 1D3DB 1D4PB 1C2EA 2VIDA 4IW4E 4MNYA 1HAVA 1EKBB 1DM4B 4LZ1H 4JYVH 1O37A 1P05A 9LPRA 1UTMA 1SC8U 3A7YA 2VBCA 1PYTD 3EA8A 4E06H 1YF4A 2B7DH 1W0JD 3LU9B 1QFKH 4OM9A 1DUEA 4J1YA 4P00A 1S0RA 1SKYE 1ZYOA 4IMQA 1O5BB 1C5UA 1TNIA 3LOXA 2R2WU 3SORA 3O8BA 1EZUC 1L1GA 2ZFSA 2J98B 3RMOH 4U2WA 1GBHA 2PGBB 1QJ1B 2G8TA 1FNIA 2L74A 5BPEA 1C5VA 2RCEA 2Y82A 1MTWA 3V0XA 5C2ZA 1QRZA 1W13U 1CU1A 1DXWA 1F92A 3RXSA 4K8BA 5LPRA 1K9OE 3M7QA 2FTLE 2H9TH 1TE0A 1T8NA 3ELAH 4K1EA 2C93B 4ABEA 3F9GA 4X2XA 4MQAA 4LZ4B 3L3TA 2O8TA 4Y76A 1FPHH 3LIWA 2Y81A 1HJAB 2BY5X 4YM9A 1IQKA 3SNEA 1XUKA 3Q76A 1CQQA 2HPQH 1G32B 1C1UH 3KQDA 2VB0A 4WJG2 1SI5H 4NIYA 3VPKA 2B5TB 1AZZA 2LNCA 1E1QD 1M9UA 3M5NA 3T25A 3OFND 3EA7A 2EC9H 1J17T 2QXHA 2QF0A 1NU9A 3ATWA 1HDTH 3UR6A 4KTUA 2WZQA 4KP0A 3SYJA 1P9UA 5DP3A 2KAIB 1JOUB 4ABGA 4DG4A 3GY8A 4YXWD 2FESH 1QA7A 1D3TB 3OTPA 1ZGVA 4O3TA 4OGXA 1BOQA 1F2SE 1XVMA 3V7TA 1QRWA 2F9PA 2FI5E 3K2UA 1PFXC 2DE8A 4CBNA 1IQMA 1HLTH 1RIWC 5PTPA 1C1MA 3A83A 4YOIA 1G3BA 3V13A 5CHBA 1Y3XA 4JCNA 4INLA 2BY9X 3A8DA 1ZSJA 2WINI 4HFPB 1SSXA 4TYDA 1GHXH 3LPRA 1TBZH 1YPKH 1ZRKA 1HUTH 1O2QA 5A8XA 2BXUH 1HJ9A 4CRFA 1HAVB 2ZHQH 5G4BA 5A8YA 1HV7A 1P09A 4BTTB 4Y0ZE 3SUDA 5A09A 4FUCA 1FX0B 4ABAA 2C8XB 2AGIX 3TJNA 4I32A 5KECA 2A7HA 8LPRA 2VNTA 4I8KA 1C1TA 2A2XH 1ZPCA 4HTCH 1BB0B 4BAKB 1CHGA 3FP8E 1CGJE 2VGCC 1F7ZA 2J92A 3MU1A 4BAMB 2BVRH 4YTAA 3IG6B 4BOHA 3D49H 2AS9A 3SHAH 1H8DH 3GY4A 1D6RA 3RMLH 3T26A 1AO5A 3M7UA 3P70B 3GCHC 1RXPA 1SPJA 1TNJA 3I77A 1F5KU 3U1IB 4ABDA 1N1LA 2EQNA 2TGDA 2O8UA 1Z1IA 3ZZ6A 4X1PU 1P02A 1ZR0A 2FI4E 3SBKA 2WPKS 1AE8H 4JZEH 2WV4A 3GY7A 4AB9A 1D9IA 1UHBA 1ZJDA 1FLEE 2A32A 1P2NA 2Y80A 1TLDA 3GY2A 4ZXXH 3I78A 1LMWB 1GHAF 3SV6A 2CF8H 4BXSA 2PTNA 1OP8A 4MPXA 1UTJA 4PROA 1DVAH 3BIUH 3VXEH 2ZZUH 1AUJA 4AFUA 1AMHA 6ESTA 1FPCH 1IHSH 4AGJA 2JH5D 1S6FA 1SGPE 2BXTH 1GBEA 2VVCA 2YMSD 4K2YA 5C94A 4MDSA 1JMOH 1ZSKA 1Z6EA 2AGGX 1RTKA 4X6OA 3AW0A 1W12U 3ZZ5A 4CR9A 4U01A 2BLVA 3DFJA 1SGFA 2CK3D 3A82A 1Z6JH 4X2YA 2SFAA 1GMCG 1O3KA 1DXPA 5CHAB 3TJVA 2ZFRH 1GG6C 3SN8A 2D1JA 5DP5A 2KR7A 1ZRBA 3PV5A 3RMNH 2L6OA 2UWLA 3BTGE 2GDEH 2H5DA 1ABIH 1MKXK 1O3GA 2FYRA 2GGVB 1H4WA 1GBLA 3GY6A 4WXIA 1GI4A 1BRUP 3CP7A 2WPLS 3LGYA 4X8VH 1AE5A 3MI4A 3BEIB 2G4UA 4DVAU 3UREA 2OC0A 3HGPA 3M3SA 4A92A 4VGCB 1A0JA 2LPRA 5EPNA 4DT4A 3LH1A 4XD7D 3RXBA 4UDWH 1WTHD 2ZGJA 4CHAB 3RXDA 1DS2E 2UWPA 1DWDH 5EXLA 3QDZB 2G51A 2THFB 1TAWA 2J5UA 2G00A 1INCA 1GHYH 3M5LA 1KXAA 5FBIA 3VG8A 1DY8A 1UTLM 2UUJB 2K1QA 3NPSA 4YLQH 1WDIA 2AIPA 5FCKA 5K7RA 3QLPH 4FU8A 3TGKE 1LHGH 1EQ9A 4O97A 2YMSB 1AWFH 2G4TA 4UE7H 1S84A 3SGAE 5AF9H 3E91A 1O35A 2A4RA 2PHBA 1NY22 1V2QT 1ZTKA 2FI3E 3VB6A 2CV3A 1O3EA 3H7OA 3PRDA 1PQAA 1UHBB 1LO6A 3BTFE 3ZVFA 1TA2A 1QBOA 5CMXH 3N7DA 4FUIA 1ELCA 4RSPA 2PSXA 1HIAA 1CGIE 5GJ4B 1SMFE 2GZ7A 4I8JA 1FAXA 1MAXA 1GL0E 1QB6A 1QGFA 2EY4C 2ANYA 3VB3A 5HYOA 3N99A 1C1QA 4H6SB 2V3OH 1V6DA 1O3DA 2ALPA 1F0RA 2F4LA 2Z9LA 1KSNA 1EZSC 1EP6A 2W7UA 2VIPA 3RC6A 2Z6BD 1F0TA 2ZU4A 1UCYH 4SGAE 1GMDG 2HLDD 3SNAA 1SQAA 3OTJE 5FBEA 2J9NA 3A8AA 2OXSA 1BTPA 4M7GA 1RTLA 3V12A 4D9QA 4INHA 1ZTJA 4YZUA 1ZSLA 1AB9C 1UVOA 3GCTG 4K1TA 3W95A 5AFYH 1ID5H 5EXNA 1O5AB 1HRTH 2FO9A 1TFXA 4WMEA 1V2RT 1C5LH 2ZGXH 2HOBA 5FX5A 1P0SH 3KYGA 2EA3A 1TBRH 2XC0A 1NFYA 4Y8YA 4ZHMU 1ELBA 5ABWA 4CRAA 1GI2A 1ZZZA 1GVKB 2DUCA 3UB0A 1FY8E 1DLEA 1LDTT 3VB4A 3MO9A 2RDEA 3ZV9A 2FPZA 1ELFA 2VJ1A 4ABFA 1AVWA 2GT8A 1ESAA 2G5NA 1SGQE 1GBDA 1EOJA 4BAOB 4FUBA 1THSH 3SU4A 1D3QB 3RXIA 2QXIA 3D23A 3AAUA 2VIVA 2XWBI 4NSYA 5EODA 5T6DA 6CHAC 1VITF 1C5NH 2FOCA 2V7QD 2BDGA 3FANA 5EG4A 5DP8A 3BTDE 4R0IA 4MVNA 5HMAA 1TGCA 4AB8A 1K1OA 2HPPH 1FV9A 3LONA 2UUKB 4WWYA 3TITA 1KIGH 1NRNH 2B0FA 2PUQH 1O3AA 1C1OA 4IC5A 1UTQA 3SU2A 1WYKA 1E0FD 2ZU3A 1DSTA 3RM2H 2H2ZA 4MNXA 4Y11E 2FS9A 3CS0A 3P92A 1WCZA 3F3BA 1BHXB 1GHWH 1SGYE 1QCPA 3IITA 3EAJA 4TT3D 2HVYB 2BD7A 2PLXA 1VZQH 3MO6A 4AYVB 5LH8A 2GZ9A 1HPGA 1HIAB 2ODQA 2QXJA 2Y5GA 2BZ6H 4AFSA 4Y6DA 2PFEA 2R9PA 4ABHA 1GHZA 1DWEH 2Z7FE 2R3UA 3LGVA 1OP2A 1NRPH 1V2ST 1UK2A 1MBQA 1YY3A 1XUFA 2Z9GA 2XW9A 1DANH 3A84A 1UTNA 1ZPZA 1OWKA 2AEIH 4FOUC 5F8TA 1YCPH 1T7CA 2D26C 3TJUA 5SGAE 1AIXH 7GCHG 4BNRA 1XM1A 1UK3A 1OHHD 3F2HA 1BRCE 1MU6B 2IJD1 4KTCA 1YPHE 1TONA 1O2GH 2P59A 1NRQH 1BJVA 1FAKH 1C1PA 2V3HH 4FUGA 3SZNA 2F43B 1GHBF 2A4GA 3UQVA 1W14U 1TQ0B 2BD4A 3U8OH 5EW1H 3OEED 1DOJA 3B9FH 1MKWH 5DGJA 1P2JA 4Y8XA 4YT6H 2AFQB 4WMFA 1TRYA 3RXVA 1LVBA 4I86A 4Y71A 1FY5A 3QK1A 1CBWC 4F4OC 2IOTA 1YWUA 3T27A 3UNRA 4UD9H 3PV4A 1ANBA 5H4IB 3OY5U 3CENA 4I8GA 1O3PB 2J97A 5E0HA 2LP6A 1VGCC 4NA7A 1BRAA 6LPRA 1J8AA 1GMHF 2FXRA 1XVOA 1ZMLA 1PQ7A 3PO1C 4DURA 4OS2A 2XCFA 1O2LA 3RP2A 1YPEH 1B5GH 1YM0A 1KTTB 2PUXB 3LH3A 1LPGB 1PYTC 2HRVA 3BTWE 2ZKSA 4GCHF 2ZGBH 4TPIZ 1F5RA 2ZGCA 3Q3XA 1NM6A 2ZCLP 2ANWA 1GJDB 6CHAB 1O3MA 2BB4A 3MNBA 2QF4A 1O2NA 3ZVDA 4ZKSU 1N6XA 2XNDD 2PV9B 4I31A 3F9FA 1P12E 1BTZA 2A31A 1C2JA 1GJ5H 4XBCA 4AGKA 2GMTC 3ITIA 1UVPA 4OS5A 1K22H 3P8FA 3F1SB 2XC5A 1TA6A 3AW1A 1QA0A 2P94A 4TY7A 5JBCS 4ISNA 3E3TA 2ZI2H 2G5VA 3DSPA 1ZJKA 1ZPBA 4ZCNA 2B8OH 1V2WT 1HAHH 4ZROA 4FU9A 4GLYA 5C1XA 2OC8A 2OC1A 3N7EA 4B74A 1NC6A 1KDQA 1KMHB 1GI9B 2G52A 1PPFE 1COWD 2XYAA 1SGRE 1GJCB 2P3TB 1U6QA 4WMDA 2VINA 1CT0E 1V2KT 2FM2A 2K0QA 4AORA 4AX9H 1PQ8A 2WV5A 2ZTZA 4AFQA 1O33A 1C5OH 4A7IB 1O30A 5GPIB 4UFEH 2H6MA 2F9NA 2QY0B 2KX4A 2P3FH 1G2LA 2DE9A 3HKIB 1ARBA 3SJ8A 3T62A 1GWAA 2Z3DA 2ZFQH 2Z94A 3SGQE 3UAIC 2O8LA 2HGTH 4XFQA 3LGIA 1MAYA 2AMDA 3QO6A 3GISB 3DFLA 2FYQA 1Z1JA 2F3CE 5F8ZA 4WXVA 1EASA 2OC7A 1WBGB 2F91A 5IDKA 3SV9A 3MH6A 4NZLA 3PMHB 1G3EA 5FL7D 2XC4A 4X0WU 1XUJA 1O39A 2GV6A 4MPVA 4Q7ZA 1NZQH 1CT4E 1LTOA 2QC2A 3FN8A 2ULLA 2WSSD 1TNHA 2ZFPH 3SI3H 4ZHLU 1ZTLA 2FEQH 2ANMH 4IMZA 1MABB 1EAXA 5EIYA 1KXEA 2A7CA 1O3FA 3ENSB 5F8XA 1G36A 1TMBH 2ZDMA 1K1JA 1TPAE 1IQIA 5HKKD 5LGOA 4Z0KA 3AASA 1J9CH 3F0PA 4NG9H 2XTTB 1CBWB 3L33A 2FX4A 3SU6A 1OYQA 4X1SU 1QJ6B 2FTMA 3VB7A 1SBWA 1FJSA 1ARCA 2EI7A 2ZTYA 3LC3A 5E0JA 1HAYB 1ZLRA 1EPTC 1C1VH 3EYDA 3KQCA 3BTKE 2O8MA 1Q3XA 2NU0E 4NIVA 1JIMA 1VGCB 1HYLA 2PSYA 3RXQA 1EB1H 3OSYA 1YBWA 1OXGA 2QAAA 1OWEA 3PO1B 1O5EH 4I33A 2BD8A 4B2BA 1LKBA 1PPEE 2GCHF 3EA9A 3V3MA 5DP4A 1EPTA 5AVDA 4I8LA 3KQ5A 4OS6A 3SJKA 4WH8A 1IQGA 5B6LA 1UMAH 1D6WA 2KCYA 2RDLA 4X8UH 6GCHF 5GWZA 3DD2H 5CHAC 3R0FA 2XBWA 3U69H 1RTFB 5C5NA 4RKJB 3LC5A 2GCTC 1TRNA 1DITH 2FOAA 2Z3EA 3ATLA 2GTBA 3RXFA 3SU1A 2KCAA 2G55A 2GMTB 2ZU1A 4BANB 5EOKA 1ELDE 2CHAC 1EZQA 2JIZD 2JETC 4IS5A 4UFGH 1KDQB 3RUOA 3UNSA 8GCHG 1XUHA 4VGCC 1IQEA 1C4Y2 1WOFA 3UWIA 2HNTE 4CHAC 1G30B 1DLKB 1UVSH 1FZZA 2ZDAH 2BX3A 3AK5A 4RKOB 3M3VA 1QL9A 2FS8A 1JIRA 3PB1E 1BMFD 3OU0A 1THPB 2ZCHP 3NKKA 3TIUA 1K1PA 2TGTA 2C8YB 2W6ID 1ESBA 5FCRA 1XUGA 2WYJA 1GBJA 2Y5HA 5DN6D 1GI6A 2PKAA 2SNVA 5GCHG 5FX6A 3VGCC 4IC6A 2YMSC 1GJBB 1OOKB 5JBTA 4K1SA 3TGIE 1GL1A 1BTYA 1WV7H 2Z9IA 4NFEA 4ZKNU 2I6SA 3GY5A 1SGTA 1GJ4H 1QBNA 1EATA 2A5KA 3ATKA 3SJ9A 1T31A 1YPGH 2W3KA 1W0ZU 1YLNA 3KHVA 1XUIA 4AFZA 1G37A 3UOPA 2EEKA 3UIRA 1PPCE 1TYNA 1YKTA 1XXDA 2JDID 3PRBA 1BBRH 2ZO3H 1H8ED 3HPTB 1TALA 4TWWA 2FLRH 3A89A 1GI0A 1MMJN 2GVFA 1Y3WA 3Q00A 3JZ1B 3NWUA 1WTGH 1LHEH 3LGUA 5C0TA 4XOJA 4B71A 5HGGA 1C5MD 1MCVA 2HLCA 4ISOA 4MNVA 3C1KA 3K65B 3FAOA 3KIDU 1C2KA 1X7AC 3FFGA 5C0UA 3Q3YA 1CHOF 3MHWU 1Y8TA 1BMNH 1LPKB 1V3XA 1AGJA 1TB6H 4Y8ZA 4NA8A 3TVJB 5JYIA 1Y5AT 1GI3A 1TNLA 1MCTA 3RXMA 1P10A 1EPTB 2D8WA 2H5CA 1OS8A 4FVDA 4ZKRU 1GGDC 2FOGA 2BDIA 1ELVA 1H9LB 2OQUA 2XWAA 5ESBA 1H8IH 2V6NA 4INKA 1SGIB 1MTSA 1SLWB 3SJOA 1W10U 1TPPA 3URCA 1F5LA 2Q1JA 2Z9JA 3FP7E 3ODFA 3RXGA 3RXRA 1VKYA 2PR3A 1AQ7A 2W6JD 4DOQA 1CO7E 5DJ7A 1YCPM 3Q3KA 4ISLA 2BY7X 1PJPA 1RD3B 2XBXA 2GCTB 2QV1A 1P8VC 2Y5FA 4RT1A 1C2DA 1JXPA 3SJIA 4H42U 1ORFA 2LELA 2RA3A 4GHQA 1T8LA 2BD3A 5T6FA 1ZMJA 3UY9A 2ZNKH 2CHAB 1NBME 1AY6H 2PKSC 4LOYH 3RMMH 2JETB 2FOMB 5EW2H 1EJMA 2PP6A 4GPGA 1TWXB 2ZWLH 2R0KA 1BHXF 4YOGA 2R0LA 2SGAA 2JKHA 5JBAS 2BDCA 3ZVEA 1NFUA 1UCYE 2GT7A 2H1UA 5C17A 3HATH 2OBQA 1AZ8A 2WUCA 3RXPA 5EXMA 4AOQA 4K69A 1DWBH 3F9HA 2PKAB 1EFRD 1P3EA 2TBSA 3GDUA 2FZZA 1WQSA 2YOLA 2A1DB 3MU4A 4FXGH 1SHHB 4O9VA 3KQBA 2V3MA 2AMQA 1O5CB 4MPWA 4ASHA 3BTEE 3SUGA 2O8WA 4AN7A 4LXBH 1G3DA 2OBOA 5FPYA 4AG2A 5LPFA 1DX5M 3VGCB 1C1WH 4MG3A 1GDUA 1MZDA 1JRTA 1T4UH 1NRSH 1P11E 3F6UH 1P2MA 2O9QA 1TGNA 1TPSA 1S0QA 5DKMA 1SG8B 2J95A 2FMJA 1ZGIA 3E1XB 3F68H 5HXFA 1O2PA 1TIOA 1UCYK 1HXEH 4KELA 1HBTH 4Y0YE 1P9SA 1JRSA 4JK6A 3FO8D 2WUBA 1QJ7B 3ZYEA 4DW2U 1O36A 3TK5A 3TNSA 1ZHPA 5FAHA 1WU1A 3DUXH 3BEFB 1QL8A 4X2VA 1BIOA 1ETRH 3ZVAA 3K6ZA 8ESTE 3FZZA 4DGJA 3S9AA 1KTSB 4NIXA 2ODPA 3E0NB 1O3CA 1QQUA 3QWCH 3D65E 4X1RU 2ZHDA 2STAE 4WF8A 1Q31A 2OTVA 1SR5C 2J38A 2RFKC 1W0KD 1XXFA 1G2MA 2GDDA 1O2TA 1VITH 2ZPRA 3A80A 2FODA 2C8ZB 2FOBA 3M37A 4J2YB 2SGEE 1VR1H 1K2I1 1V2UT 3MNCA 1LVOA 5DPAA 1GGDB 2ZDNA 3MNXA 1L1NA 1EXFA 4FVBA 3SZEA 1UVTH 1C5PA 4JZ1A 4DIHH 1H8HD 1WUNH 5L2YH 1N8OB 3PMAB 1RRKA 1ELEE 3EGKH 2F9BH 5F53A 1QBVH 1E79D 4Y7AA 1AHTH 3DT0H 1EP5A 3NUMA 3NK8A 1VCPA 3STJA 2WPMS 2P8OB 3PLBA 2FP7B 1GCDA 1NESE 1P01A 1G3CA 4KGAA 2ZHWH 4X1NU 4JK5A 1V2OT 3GOVB 1TNGA 3MQKC 1CSOE 5DP7A 2OINA 1Y5BT 2ZHFH 1C9TA 5BRRE 3GDSA 4ABBA 1C2HA 5I25A 1NTPA 2C4FH 3MMGA 2OP9A 4DY7B 1NS3A 1C2GA 1O32A 1BRBE 3UPEA 1Z7KA 1S6HA 1SVPA 2PKSB 3H5CB 3KL6A 1YLDA 2A2QH 3E8LA 3VXFH 3SV7A 3UQOA 3F9EA 3OAAD 4JMYA 1XKAC 1B0EA 3EDXB 5EQSA 3SHCH 1NFXA 1T4VH 3M35A 1C5QA 1QRXA 3F2GA 5GXPA 1TQ7B 3LT3A 3BF6H 3TH4H 2Q6GA 3S7KB 1OKXA 4ACAA 1VCQA 1ELAA 3CS7A 2ILNA 2UUYA 3ZZDA 1AWHB 3KN2A 2FX6A 1WSSH 5TCAA 1LVYA 2BQWB 1DPOA 4K5ZA 3RXEA 3FP6E 1VJ9U 1O2VA 3A8CA 1SQRA 5A0CA 2AH4X 3SI4H 1YCPK 2G81E 1P04A 2HWLB 1K1LA 2OUAA 3NCLA 3PTBA 1WAYB 1NROH 3SNBA 1IQLA 1AVGH 3DHKH 1O2XA 2WHXA 2BY8X 1S82A 3A8BA 4X1QU 2BX4A 4DT7B 1NPMA 1F0UA 1FDPA 2GKVE 2BVSH 1OWIA 1DFPA 1GMCF 3RXCA 3A7ZA 2R3YA 3BEUA 3O8RA 3A7TA 3E6PH 3EQ0H 1C2LA 4YO9A 3BG4B 1MKWK 3UNQA 4NGAH 5DO4H 4P02A 3M7TA 3A7VA 1Y3UA 4ZXYH 1MD7A 5GIBA 2HVXA 1V2MT 1UTKA 1A7SA 5EQQA 1UTOA 3MH7A 5A0AE 4U32A 1GJ7B 1O2UA 4Q4LA 1H9HE 2WV9A 1P2QA 5A2MH 3B23B 3DA9B 5CDFE 2W7SA 1HAXB 2OD3B 3P8NA 3SV2H 2VWNA 1NBMD 1NU7B 2FOHA 3A87A 2QXGA 4H4FA 1HCGA 1S83A 3QUMP 5GDSH 2WPIS 1MQ6A 1LHCH 3S9CA 5EJ1A 4AG1A 5C3NA 1W7XH 4ISHH 1Y5UT 2SGDE 4IBLH 2J98A 4RI0A 3G01A 1Q2WA 1RGQA 4FUHA 1YC0A 1O2MA 2QF3A 1GBAA 4BAQB 3PLKA 1ESTA 1KLJH 1P2KA 2W3IA 3IWMA 4F49A 5F03A 1LQDB 3RXUA 3ZZAA 1UW7A 2BD2A 2ZPQA 1AFQC 1NT1A 1BUIA 3FVFB 2BM2A 5TJXA 1DWCH 1F0SA 1EJNA 4JZIA 3DSGA 5CE1A 3SQHE 4F48B 5ETXA 1NO9H 1J14A 3MNSA 4MLFB 1S6LA 4BXWA 1TMTH 2ZCKP 3RXKA 1KXFA 1O3IA 2ESTE 7LPRA 1FI8A 4A1VA 1Y59T 1GBMA 1QZ8A 3RC4A 3F0OA 3RU4E 1EUFA 2J94A 2EI8A 3S7HB 2VH0A 2TGAA 1C4V2 3TK6A 1J16A 2PW8H 2QN5T 2FOEA 3SW2B 4FUDA 4AYYB 1O2YA 3WWBA 3AAVA 2JH6D 3HKJB 4BAHB 1GI7B 1YPJH 3ZVBA 2XRCA 2AGEX 4UONA 1EZXC 1GMDF 1TGSZ 1HAPH 1AKSA 2J4IA 1UK4A 1QNJA 3A85A 2KAIA 2A0QB 3RC5A 1FY4A 3BTQE 2WYGA 4ACBA 2GD4B 1C5YB 1CT2E 1GI5A 1WQVH 3E0PB 3U1JB 4K60A 3RXLA 2J2UA 1GHAG 3GCTF 3A7WA 3GYMA 2ZDVH 1ACBE 2V35A 3QX5H 1BZXE 3PLPA 4Y79A 1SLXB 1KY9A 1NRRH 1MD8A 1SQOA 1O3BA 1VJAU 3RXJA 1SQTA 1IQFA 3T5FH 4JYUH 3UFAA 5T1VA 1EB2A 1YPMH 1C1RA 1GBTA 2YNBA 3M5OA 1EX3A 2CN0H 1MTVA 1MTNC 2QYIA 3RM0H 1OX1A 2ZQ1A 3E90B 1QIXB 3RLYH 1LVMA 5L6NH 1FN6A 4DIIH 1DY9A 1A0LA 3SU0A 1TGTA 2XCNA 1P06A 1TBQH 4Q2KA 2Z9KA 1KLTA 4ASUD 4ZH8A 1S5SA 1SFQB 2ANKH 4BTIB 2IN2A 1SL3A 2OK5A 3Q77A 2CJIA 4MTBA 1OWHA 1C2FA 1O5FH 1QB9A 3DCLA 2GZ8A 3QTVH 4TY6A 1J15A 1E1RD 4XBBA 1GBKA 3PYHA 3SQEE 4A5TS 4CBOA 3D62A 5A0BA 5JB8S 4A1TA 2ZP0H 1O34A 4UFDH 1QHRB 1GCTB 2ZHEH 1QB1A 4CH8B 1JWTA 1SGCA 1K21H 2A7JA 2UWOA 1Z8RA 3RXAA 1DUAA 1HAIH 1E36B 3TH2H 4NA9H 5DP9A 2BD9A 2KZ4A 3ZVCA 4B1TA 2BQ6B 1QURH 1SGDE 2ODYB 1GBBA 1MH0A 3SU3A 1O2RA 3FZDA 1K1MA 4DJZB 1AFQB 1MUEB 1Y3VA 1O3NA 2ZTXA 1FXYA 1YPHC 3BV9B 3SU5A 1BMMH 4MPUA 5HM2A 2ZDLA 1ETSH 4QT8C 3U8TH 2STBE 3MH5A 3OE7D 4D9RA 1O2SA 2GP9B 1PPGE 2W5EA 5AHGH 1DDJA 1PPZA 2A4QA 1BMAA 2PTCE 5HM9A 3RXHA 1DE7H 4A6LA 2TPIZ 1SFIA 1Z8JB 3LGWA 3P95A 1LKAA 1TABE 4TSFD 1ABJH 3ZZ8A 1BBRE 2Y7ZA 3NZIA 3PTNA 1AKSB 7GCHF 7KMEH 1C5TA 4GSOA 5DP6A 4JYTA 2ZDKA 4YOJA 1FIZA 1E34B 3WWFA 3JZ2B 3WW7A 1A0HB 5FPTA 5LPEA 1V2TT 3PMBB 2AMPA 3UUZA 4F55A 1O2IA 3RDZA 2BOKA 1RS0A 2BLWA 4FUJA 2YNAA 4B76A 1ELGA 5EU8A 5C1UA 3DSOA 3SUEA 1V2JT 5I46H 2ZQ2A 2AYWA 1FUJA 2QA9E 1T8MA 1JBUH 2ZFFH 3ZYDA 1BBRK 2JJ1D 3FOAA 2SGFE 1C5ZB 3U98H 2KFWA 3SGBE 1CGHA 1ZMNA 4HG6A 4NSVA 4NIWA 4ZAEA 3K6YA 3MH4A 2A4OA 3VFEA 4A1XA 1MBMA 3URDA 5EJLA 2VIOA 2VWLA 3AVZA 1LCYA 1MTNB 4GUXA 1ELTA 4I8HA 1V2PT 1KYNA 2KCOA 1O3OA 5L2ZH 1O38A 2P93A 1A5GH 4E7NA 3OY6U 1A3BH 2NU1E 3U8RH 3P8GA 1IOEA 4SGBE 3QZRA 1PPBH 1C5XB 3BG8A 2NU4E 1P3CA 2VWOA 1GJAB 1MQ5A 2BDAA 3GYLB 1MU8B 5HIYA 1GJ9B 4FETA 1K28D 2BLQA 3GCOA 3QTOH 1FY3A 4UEHH 2BZAA 2XBYA 3PV2A 1BA8B 3RXOA 3MU8A 1YGCH 3HK3B 1CA8B 1GBCA 5IK2D 1GHVH 2C90B 3SUFA 1AN1E 3RU4D 3VB5A 1A3EH 2OCVB 2ZU2A 1DICA 4K8YA 4ABJA 1T32A 4D7FA 3PROA 1DSUA 2Y6TA 4ZMAH 1HB0B 3M3TA 1CE5A 1AFEH 1A61H 4GHTA 4NZQA 1C1SA 1VITG 4B6EA 2A45B 3RXTA 1C5WB 1FIWA 4CREA 3GDVA 2NU3E 4NCYA 4Q80A 1GBIA 5FXLA 3O8DA 1E38B 2P95A 1E35B 3KF2A 3KQEA 3BTME 1OWDA 3MTYA 1TPOA 1S85A 2A5IA 1O3HA 1N8OC 1C5SA 4UFFH 3ZZ3A 1P03A 2QIQA 1LHDH 5E2OA 4U30A 1TGBA 1H9IE 1YP9A 2ZEBA 4YESB 5C5OA 1W8BH 4B2AA 2P8OC 1C5RA 2F9OA 1UTPA 1CA0C 2CF9H 1L0ZA 1C1NA 5EJZA 2QGRA 3A81A 1HFDA 1HNEE 1UO6A 1O2KA 1XX9A 1GI8B 2BHGA 4HZHA 2ZA5A 4Q7YA 2Z3CA 3L6PA 4M9FA 4ABIA 1V2VT 3O8CA 2JH0D 3TH3H 1BJUA 2OLGA 1RIWB 2JJ2D 2BOHB 2UUFB 2P16A 4H6TA 1ETTH 1O2ZA 4OGYA 2R2MB 1MZAA 1IQJA 2SNWA 3TNTA 1K1NA 1KLIH 4WY3A 1Z8GA 2GJGA 2P3UB 2CMYA 2QF5A 3OEHD 1A2CH 2ZFTA 2HNTF 4O03A 1FN8A 1BTWA 1L4DA 2F9UA 2AERH 4Y7BA 2FIRH 1BTUA 3S69A 3QZQA 3N7OA 1W0YH 1GHBG 3P8OA 1IQNA 2IPHA 1SOTA 2H9HA 2KCPA 4XDEA 4NWKA 3A86A 2AHME 3ESTA 5J4QA 1L4ZA 2FOFA 2GX4A 3PWCA 1MKXH 4Q63A 2HNTC 4OS7A 3HK6B 1KXCA 1O2JA 4HGCA 2ZECA 2VGCB 4O3UA 2C8WB 2XNIA 5EQRA 3KNXA 2XOKD 2ZGHA 4X6PA 1RFNA 2J34A 1W2KH 1GMHG 1E37B 3BG4C 2BDHA 5C1YA 1C2IA 3GCNA 1AVXA 1NN6A 2BMGB 2Q6DA 2ZG0H 3GCHB 2SGQE 4ZKOU 2RA0A 3UTUH 1L1JA 2ZF0H 3K9XB 4GCHG 3UR9A 5DSFA 3ZVGA 1LPZB 2XBVA 8GCHF 4WVPE 2NU2E 4XRNA 1TX6A 4ISIH 4CRCA 1A1RA 2BYAX 1IAUA 3RU4T 4CR5A 1NFWA 3MU5A 2K8IA 2IPQX 1C2MA 5C67A 3PM3A 1PPHE 2NWNA 2RG3A 2HALA 3HGNA 1SGEE 5JDUB 7ESTE 4ZUHA 8KME2 2W26A 5E0GA 2ZC9H 3TPIZ 1N6YA 1D3PB 3OYPA 4CRBA 4Z1MD 4AC9A 4IN2A 1FQ3A 5K0HA 3BSQA 1GDNA 1VCWA 1LQEA 3BTTE 5GCHF 3QGNB 3GY3A 1IHTH 2FWWA 3SV8A 5A8ZA 2F83A 4OS1A 5FHTA 1AI8H 3UOUA 2C3SA 3ATMA 1ANEA 1TX8A 1GDQA 3MO3A 1BMLA 1CA0B 1Y3YA 3A7XA 2H9EH 3ZZ7A 4MNWA 1PQ5A 3UWJH 1QQ4A 1V2LT 1UVUH 1GJ6A 3BTHE 4CRDA 1TMUH 3E16B 1C4U2 3MU0A 1Z8IB 3EE0B 3ATIA 1A5IA 4B75A 4X6MA 1GG6B 2CXVA 2BTCE 1HAOH 2ALVA 1HGTH 1AUTC 3PWBA 3MYWA 4HI3A 1RJXB 1T8OA 1TX7A 4K3JA 1OP0A 1SLVB 3FKSD 1YPLH 3S0NA 2M5TA 4CH2B 1TNKA 9ESTA 1OWJA 5J4SA 1XMNB 5T3HA 1FMGA 5FPSA 1S81A 1O2WA 2IJOB 3QGJA 4LK4A 1ANCA 1EAWA 4Y10E 3ODDA 2TRMA 3P6ZB 1GVZA 1ZHRA 5KGOA 1O2OA 5AFZH 1THRH 1QL7A 1GVLA 3ZZ9A 1L2EA 1ZOMA 5L30H 1EJAA 3T28A 1GBFA 5T6GA 3KEEA 4RT0A 5C20A 3M5MA 1ZHMA 3TJOA 3STIA 1OSSA 3R3GB 5B6OA
chains in the Genus database with same CATH topology
3MWIU 4D76A 1SHYA 5TCCA 1KXDA 4E7RG 2FLBH 4KKDA 3QN7A 4FU7A 3OX7U 2VWMA 1QY6A 1FONA 2TGPZ 3S9BA 2WPJS 4XBDA 5F6MA 1Z71A 1MTUA 1OPHB 1W11U 2GCHG 2I6QA 2VIQA 4Z6AH 1HAGE 4AZ2B 4JZDH 1BCUH 5E2PA 1O5DH 4R8TB 4D7GA 1GPZA 3WY8A 3T29A 6GCHG 1GI1A 4FUEA 2BY6X 2BD5A 4X8TH 4NWLA 1O2HA 1H1BA 1SLUB 4X8SH 1EAIA 3MOCA 5IYTA 1B7XB 1TRMA 4CRGA 3TGJE 3GICB 5EPYA 3TK9A 2PWXA 1GCTC 3ZV8A 5DK1A 1K1IA 2TIOA 3BN9A 2B9LA 4OS4A 3PMJA 4I7YH 4YLUA 2BQ7B 3LKWA 4WH6A 1A46H 4X6NA 1HAZB 1IQHA 1BTXA 2V0BA 4BTUB 5E8EH 4ESTE 1KXBA 2GV7A 1YYY1 2ZPSA 4FUFA 1A4WH 3M36A 3SO3A 4E05H 1BDAA 1HJAC 1XKBC 1AB9B 3SNDA 2Y7XA 3LGTA 4X2WA 5JPMH 3VEQB 1OYTH 2A5AA 3A88A 1GJ8B 2FDAA 1W3CA 1B0FA 2OQ5A 1W7GH 4JZFH 3C27B 4GVUA 3ZZBA 2QCYA 2VIWA 2WPHS 4XSKU 1G9IE 2BLOA 1EAUA 4TWYA 3H7TA 2ASUB 2AIQA 2VVVA 1BQYA 1O3JA 1QR3E 2VVUA 1TOCB 5DG6A 1SB1H 2BDYA 3U9AH 2EI6A 4D8NA 3BIVH 1HXFH 3B8JA 1P2IA 1C9PA 2SGPE 4KTSA 3T2NA 1A5HA 2VU8E 2XXLA 4TPYA 1TOMH 5JB9S 1HJ8A 2PGQB 2VH6A 3LJOA 3TU7H 1AD8H 4B73A 3LDXH 4IGDA 3I29A 2D2DA 3P17H 4THNH 3KGPA 3W94A 3RLWH 4DCDA 1BT7A 1LHFH 2BVXH 1O3LA 5EGMA 3ZZ4A 3KCGH 1SGNE 2BDBA 1O5GH 1BITA 1AU8A 4IN1A 4YT7H 1O0DH 3TLOA 2Q6FA 1SGFG 3SOSA 1V2NT 3SNCA 1ANDA 1CVWH 1BTHH 1EOLA 1P57B 4NFFA 3LJJA 1DT2A 4Q7XA 1FY1A 3ZZCA 1QTFA 1YLCA 2F9VA 3NXPA 4GAWA 1CHOG 5ESTE 4XE4A 1UJ1A 1SOZA 4RN6A 2ZIQH 1P2OA 2CGAA 4ZHAA 2ZU5A 1O31A 3M61U 5JBBS 4B2CA 3MFJA 1D3DB 1D4PB 1C2EA 2VIDA 4IW4E 4MNYA 1HAVA 1EKBB 1DM4B 4LZ1H 4JYVH 1O37A 1P05A 9LPRA 1UTMA 1SC8U 3A7YA 3EA8A 1PYTD 4E06H 1YF4A 2B7DH 3LU9B 1QFKH 1DUEA 4J1YA 1S0RA 1ZYOA 4IMQA 1O5BB 1C5UA 1TNIA 3LOXA 2R2WU 3SORA 3O8BA 1EZUC 1L1GA 2ZFSA 3RMOH 4U2WA 1GBHA 2PGBB 1QJ1B 2G8TA 1FNIA 5BPEA 1C5VA 2RCEA 2Y82A 1MTWA 3V0XA 5C2ZA 1QRZA 1W13U 1CU1A 1DXWA 1F92A 3RXSA 4K8BA 5LPRA 1K9OE 3M7QA 2FTLE 2H9TH 1TE0A 1T8NA 3ELAH 4K1EA 2C93B 4ABEA 3F9GA 4X2XA 4MQAA 4LZ4B 3L3TA 2O8TA 4Y76A 1FPHH 3LIWA 2Y81A 1HJAB 2BY5X 4YM9A 1IQKA 3SNEA 1XUKA 3Q76A 1CQQA 2HPQH 1G32B 1C1UH 3KQDA 2VB0A 4WJG2 1SI5H 4NIYA 3VPKA 2B5TB 1AZZA 2LNCA 3M5NA 1M9UA 3T25A 3EA7A 2EC9H 1J17T 2QXHA 2QF0A 1NU9A 3ATWA 1HDTH 3UR6A 4KTUA 4KP0A 1P9UA 5DP3A 2KAIB 1JOUB 4ABGA 4DG4A 3GY8A 2FESH 1QA7A 1D3TB 4O3TA 1ZGVA 4OGXA 1BOQA 1F2SE 1XVMA 3V7TA 1QRWA 2F9PA 2FI5E 3K2UA 1PFXC 2DE8A 4CBNA 1IQMA 1HLTH 1RIWC 5PTPA 1C1MA 3A83A 4YOIA 1G3BA 3V13A 1Y3XA 4JCNA 4INLA 2BY9X 3A8DA 1ZSJA 2WINI 4HFPB 1SSXA 4TYDA 1GHXH 3LPRA 1TBZH 1YPKH 1ZRKA 1HUTH 1O2QA 5A8XA 2BXUH 1HJ9A 4CRFA 1HAVB 2ZHQH 5G4BA 5A8YA 1HV7A 1P09A 4BTTB 4Y0ZE 3SUDA 5A09A 4FUCA 4ABAA 2C8XB 2AGIX 3TJNA 4I32A 2A7HA 8LPRA 2VNTA 4I8KA 1C1TA 2A2XH 1ZPCA 4HTCH 1BB0B 4BAKB 1CHGA 3FP8E 1CGJE 2VGCC 1F7ZA 2J92A 3MU1A 4BAMB 2BVRH 4YTAA 3IG6B 4BOHA 3D49H 2AS9A 3SHAH 1H8DH 3GY4A 1D6RA 3RMLH 3T26A 1AO5A 3M7UA 3P70B 3GCHC 1RXPA 1SPJA 1TNJA 3I77A 1F5KU 3U1IB 4ABDA 1N1LA 2TGDA 2O8UA 1Z1IA 3ZZ6A 4X1PU 1P02A 1ZR0A 2FI4E 3SBKA 2WPKS 1AE8H 4JZEH 2WV4A 3GY7A 4AB9A 1D9IA 1UHBA 1ZJDA 1FLEE 2A32A 1P2NA 2Y80A 1TLDA 3GY2A 4ZXXH 3I78A 1LMWB 1GHAF 3SV6A 2CF8H 4BXSA 2PTNA 1OP8A 4MPXA 1UTJA 4PROA 1DVAH 3BIUH 3VXEH 2ZZUH 1AUJA 4AFUA 1AMHA 6ESTA 1FPCH 1IHSH 4AGJA 2JH5D 1S6FA 1SGPE 2BXTH 1GBEA 2VVCA 4K2YA 4MDSA 1JMOH 1ZSKA 1Z6EA 2AGGX 1RTKA 4X6OA 3AW0A 1W12U 3ZZ5A 4CR9A 4U01A 2BLVA 3DFJA 1SGFA 3A82A 1Z6JH 4X2YA 2SFAA 1GMCG 1O3KA 1DXPA 5CHAB 3TJVA 2ZFRH 1GG6C 3SN8A 2D1JA 5DP5A 1ZRBA 3RMNH 2UWLA 3BTGE 2GDEH 2H5DA 1ABIH 1MKXK 1O3GA 2FYRA 2GGVB 1H4WA 1GBLA 3GY6A 4WXIA 1GI4A 1BRUP 3CP7A 2WPLS 3LGYA 4X8VH 1AE5A 3MI4A 3BEIB 2G4UA 4DVAU 3UREA 2OC0A 3HGPA 3M3SA 4A92A 4VGCB 1A0JA 2LPRA 5EPNA 3LH1A 3RXBA 4UDWH 1WTHD 2ZGJA 4CHAB 3RXDA 1DS2E 2UWPA 1DWDH 5EXLA 3QDZB 2G51A 2THFB 1TAWA 2G00A 1INCA 1GHYH 3M5LA 1KXAA 5FBIA 1DY8A 1UTLM 2UUJB 2K1QA 3NPSA 4YLQH 2AIPA 5FCKA 5K7RA 3QLPH 4FU8A 3TGKE 1LHGH 1EQ9A 4O97A 1AWFH 2G4TA 4UE7H 1S84A 3SGAE 5AF9H 3E91A 1O35A 2A4RA 2PHBA 1NY22 1V2QT 1ZTKA 2FI3E 3VB6A 2CV3A 1O3EA 3H7OA 1PQAA 1UHBB 1LO6A 3BTFE 3ZVFA 1TA2A 1QBOA 5CMXH 4FUIA 1ELCA 4RSPA 2PSXA 1HIAA 1CGIE 5GJ4B 1SMFE 2GZ7A 4I8JA 1FAXA 1MAXA 1GL0E 1QB6A 1QGFA 2ANYA 3VB3A 5HYOA 1C1QA 4H6SB 2V3OH 1V6DA 1O3DA 2ALPA 1F0RA 2Z9LA 1KSNA 1EZSC 1EP6A 2W7UA 2VIPA 3RC6A 2Z6BD 1F0TA 2ZU4A 1UCYH 4SGAE 1GMDG 3SNAA 1SQAA 3OTJE 5FBEA 2J9NA 3A8AA 2OXSA 1BTPA 4M7GA 1RTLA 3V12A 4D9QA 4INHA 1ZTJA 4YZUA 1ZSLA 1AB9C 1UVOA 3GCTG 4K1TA 3W95A 5AFYH 1ID5H 5EXNA 1O5AB 1HRTH 2FO9A 1TFXA 4WMEA 1V2RT 1C5LH 2ZGXH 2HOBA 5FX5A 1P0SH 2EA3A 1TBRH 2XC0A 1NFYA 4Y8YA 4ZHMU 1ELBA 5ABWA 4CRAA 1GI2A 1ZZZA 1GVKB 2DUCA 1FY8E 1DLEA 1LDTT 3VB4A 3MO9A 3ZV9A 2FPZA 1ELFA 2VJ1A 4ABFA 1AVWA 2GT8A 1ESAA 2G5NA 1SGQE 1GBDA 1EOJA 4BAOB 4FUBA 1THSH 3SU4A 1D3QB 3RXIA 2QXIA 3D23A 3AAUA 2VIVA 2XWBI 4NSYA 5EODA 5T6DA 6CHAC 1VITF 1C5NH 2FOCA 3FANA 2BDGA 5EG4A 5DP8A 3BTDE 4R0IA 4MVNA 5HMAA 1TGCA 4AB8A 1K1OA 2HPPH 1FV9A 3LONA 2UUKB 4WWYA 3TITA 1KIGH 1NRNH 2B0FA 2PUQH 1O3AA 1C1OA 4IC5A 1UTQA 3SU2A 1WYKA 1E0FD 2ZU3A 1DSTA 3RM2H 2H2ZA 4MNXA 4Y11E 2FS9A 3CS0A 3P92A 1WCZA 1BHXB 1GHWH 1SGYE 1QCPA 3IITA 3EAJA 2BD7A 2PLXA 1VZQH 3MO6A 4AYVB 5LH8A 2GZ9A 1HPGA 1HIAB 2ODQA 2QXJA 2Y5GA 2BZ6H 4AFSA 4Y6DA 2PFEA 2R9PA 4ABHA 1GHZA 1DWEH 2Z7FE 2R3UA 3LGVA 1OP2A 1NRPH 1V2ST 1UK2A 1MBQA 2Z9GA 1XUFA 2XW9A 1DANH 3A84A 1UTNA 1ZPZA 1OWKA 2AEIH 5F8TA 1YCPH 1T7CA 2D26C 3TJUA 5SGAE 1AIXH 7GCHG 4BNRA 1XM1A 1UK3A 1BRCE 1MU6B 4KTCA 1YPHE 1TONA 1O2GH 2P59A 1NRQH 1BJVA 1FAKH 1C1PA 2V3HH 4FUGA 3SZNA 1GHBF 2A4GA 3UQVA 1W14U 1TQ0B 2BD4A 3U8OH 5EW1H 1DOJA 3B9FH 1MKWH 5DGJA 1P2JA 4Y8XA 4YT6H 2AFQB 4WMFA 1TRYA 3RXVA 1LVBA 1FY5A 3QK1A 1CBWC 4F4OC 2IOTA 3T27A 3UNRA 4UD9H 3PV4A 1ANBA 5H4IB 3OY5U 3CENA 4I8GA 1O3PB 5E0HA 1VGCC 4NA7A 1BRAA 6LPRA 1J8AA 1GMHF 2FXRA 1XVOA 1ZMLA 1PQ7A 3PO1C 4DURA 4OS2A 2XCFA 1O2LA 3RP2A 1YPEH 1B5GH 1YM0A 1KTTB 2PUXB 3LH3A 1LPGB 1PYTC 2HRVA 3BTWE 2ZKSA 4GCHF 2ZGBH 4TPIZ 1F5RA 2ZGCA 3Q3XA 1NM6A 2ZCLP 2ANWA 1GJDB 6CHAB 1O3MA 2BB4A 3MNBA 1O2NA 3ZVDA 4ZKSU 1N6XA 2PV9B 4I31A 3F9FA 1P12E 1BTZA 2A31A 1C2JA 1GJ5H 4XBCA 4AGKA 2GMTC 3ITIA 1UVPA 4OS5A 1K22H 3P8FA 3F1SB 2XC5A 1TA6A 3AW1A 1QA0A 2P94A 4TY7A 5JBCS 4ISNA 3E3TA 2ZI2H 2G5VA 1ZJKA 1ZPBA 2B8OH 1V2WT 1HAHH 4ZROA 4FU9A 4GLYA 5C1XA 2OC8A 2OC1A 4B74A 1NC6A 1KDQA 2G52A 1GI9B 1PPFE 2XYAA 1SGRE 1GJCB 2P3TB 1U6QA 4WMDA 2VINA 1CT0E 1V2KT 2FM2A 4AORA 4AX9H 1PQ8A 2WV5A 2ZTZA 4AFQA 1O33A 1C5OH 4A7IB 1O30A 5GPIB 4UFEH 2H6MA 2F9NA 2QY0B 2P3FH 1G2LA 2DE9A 3HKIB 1ARBA 3SJ8A 3T62A 1GWAA 2Z3DA 2ZFQH 2Z94A 3SGQE 2O8LA 2HGTH 4XFQA 3LGIA 1MAYA 2AMDA 3QO6A 3GISB 3DFLA 2FYQA 1Z1JA 2F3CE 5F8ZA 4WXVA 1EASA 2OC7A 1WBGB 2F91A 5IDKA 3SV9A 3MH6A 4NZLA 3PMHB 1G3EA 2XC4A 4X0WU 1XUJA 1O39A 2GV6A 4MPVA 4Q7ZA 1NZQH 1CT4E 1LTOA 2QC2A 2ULLA 1TNHA 2ZFPH 3SI3H 4ZHLU 1ZTLA 2FEQH 2ANMH 4IMZA 1EAXA 1KXEA 2A7CA 1O3FA 3ENSB 5F8XA 1G36A 1TMBH 2ZDMA 1K1JA 1TPAE 1IQIA 5LGOA 4Z0KA 3AASA 1J9CH 4NG9H 2XTTB 1CBWB 3L33A 2FX4A 3SU6A 1OYQA 4X1SU 1QJ6B 2FTMA 3VB7A 1SBWA 1FJSA 1ARCA 2EI7A 2ZTYA 3LC3A 5E0JA 1HAYB 1ZLRA 1EPTC 1C1VH 3EYDA 3KQCA 3BTKE 2O8MA 1Q3XA 2NU0E 4NIVA 1JIMA 1VGCB 1HYLA 2PSYA 3RXQA 1EB1H 3OSYA 1YBWA 1OXGA 2QAAA 1OWEA 3PO1B 1O5EH 4I33A 2BD8A 4B2BA 1LKBA 1PPEE 2GCHF 3EA9A 3V3MA 5DP4A 1EPTA 5AVDA 4I8LA 4OS6A 3SJKA 4WH8A 1IQGA 1UMAH 1D6WA 2RDLA 4X8UH 6GCHF 5GWZA 3DD2H 5CHAC 3R0FA 2XBWA 3U69H 1RTFB 5C5NA 4RKJB 3LC5A 2GCTC 1TRNA 1DITH 2FOAA 2Z3EA 3ATLA 2GTBA 3RXFA 3SU1A 2G55A 2GMTB 2ZU1A 4BANB 5EOKA 1ELDE 2CHAC 1EZQA 2JETC 4IS5A 4UFGH 1KDQB 3RUOA 3UNSA 8GCHG 1XUHA 4VGCC 1IQEA 1C4Y2 1WOFA 3UWIA 2HNTE 4CHAC 1G30B 1DLKB 1UVSH 1FZZA 2ZDAH 2BX3A 4RKOB 3M3VA 1QL9A 2FS8A 1JIRA 3PB1E 3OU0A 1THPB 2ZCHP 3NKKA 3TIUA 1K1PA 2TGTA 2C8YB 1ESBA 5FCRA 1XUGA 2WYJA 1GBJA 2Y5HA 1GI6A 2PKAA 2SNVA 5GCHG 5FX6A 3VGCC 4IC6A 1GJBB 1OOKB 5JBTA 4K1SA 3TGIE 1GL1A 1BTYA 1WV7H 2Z9IA 4NFEA 4ZKNU 2I6SA 3GY5A 1SGTA 1GJ4H 1QBNA 1EATA 2A5KA 3ATKA 3SJ9A 1T31A 1YPGH 2W3KA 1W0ZU 3KHVA 1XUIA 4AFZA 1G37A 3UOPA 2EEKA 3UIRA 1PPCE