1V2WT

Trypsin inhibitor in complex with bovine trypsin variant x(ssai)bt.b4
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSAIITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Understanding protein-ligand interactions: the price of protein flexibility
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
molecule keywords Trypsin
total genus 49
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2wT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2wT02
1SC8U 3ZYDA 1IQEA 1S5SA 1O2PA 3UWJH 4ZHAA 2VIOA 4TWWA 1SB1H 4TYDA 3LGWA 4RSPA 1ETRH 4AFUA 3SUGA 1O39A 1IQNA 1C5SA 1BHXF 1A61H 1ZRBA 4Y6DA 3URDA 2ZTZA 2HNTC 4X6MA 4AZ2B 2A7CA 3SU1A 1J9CH 3EA9A 2FZZA 4BAKB 1MBQA 4IMQA 3IITA 5GCHF 6GCHG 2Y5FA 2GCTB 3TNTA 2FESH 1BCUH 3EYDA 2O8LA 2QXHA 4ZKSU 4CHAB 1FIZA 1TMBH 1KDQB 3TH2H 1FNIA 4FUCA 1P03A 4FUFA 3RMLH 3SNBA 1ETTH 3GY5A 2QCYA 1IHSH 4Q2KA 1IOEA 1KXFA 2VINA 3A8AA 1LPZB 4ABBA 1P3CA 1Z8RA 5C67A 5GXPA 2P59A 3M3SA 1RFNA 2A4OA 2AMQA 5FX6A 1FV9A 3FZZA 2UUJB 1A3BH 3P92A 4YT6H 1AI8H 3UQOA 4YOIA 2VIQA 3ODFA 2R2MB 3IG6B 1DX5M 1SOZA 3A88A 1TNIA 1XMNB 3SUFA 3ZVGA 1IQHA 5GDSH 2Z9GA 3F9FA 1NFUA 3G01A 1ABIH 1THPB 3TNSA 1GVLA 1WTHD 2G4TA 2BOHB 2W26A 1BMAA 1ELEE 1AO5A 1QL9A 2QXIA 2BOKA 1BMMH 1LQEA 5DP5A 1AFQB 1O5FH 3D62A 1ZPBA 1GHXH 4LXBH 5LPFA 2CHAB 4WVPE 4ZKOU 4ISIH 4BAMB 1IQJA 2PKAA 3E0NB 1AWHB 3Q00A 4NIYA 4B76A 2HPPH 2BQWB 1DDJA 2TGDA 5IDKA 1TPOA 1G3CA 1O2HA 4O3TA 3PLKA 1O2RA 3MH7A 1XUJA 1ELCA 1AMHA 2WUCA 2A1DB 3MMGA 2O9QA 3ZV8A 3GDVA 3K65B 4R0IA 2BXTH 2XBYA 1SL3A 3TK9A 3ENSB 5EXMA 1H8DH 1SSXA 2PKSB 2STBE 1AUTC 2C4FH 3M7QA 2VIWA 3SU5A 3HKIB 1GL1A 1TBRH 3KIDU 1NO9H 2A5KA 5JBCS 1CU1A 3A81A 1ZMNA 2AMPA 1GI3A 1K1LA 3PMHB 5CMXH 2ZQ2A 2AEIH 4WH6A 3RC4A 2XBXA 2PHBA 5FXLA 4D7FA 2Y81A 2FOMB 1MU6B 1ARCA 1GI0A 2P3FH 2J95A 1F0TA 4BTIB 1O3PB 2B5TB 1DFPA 1UVPA 4YOGA 2GP9B 4YOJA 1LPGB 1HAHH 1V2OT 5HMAA 2FOBA 4ZXYH 2CXVA 4O9VA 3SZNA 1MAYA 1A4WH 2DUCA 4XSKU 4ZH8A 3NK8A 2AGIX 3EDXB 4ISOA 4X1NU 3TVJB 2A4QA 2OP9A 1BBRK 2HWLB 4OGXA 4HI3A 2GT8A 1PYTC 1TALA 3A7ZA 1UTQA 3MFJA 1KIGH 4GPGA 3SJ9A 1OWDA 4BAOB 2ZPQA 1GBAA 3B9FH 2GCHG 1TGCA 1OPHB 2CMYA 1TGSZ 1EQ9A 1OYQA 2YOLA 4DIIH 3O8BA 4KTUA 1NZQH 3B23B 4NIWA 1O38A 1GGDC 1YKTA 2Z3DA 2R3UA 4TPYA 3R3GB 1J15A 1MD8A 2HVXA 4E7NA 1BOQA 3HATH 2H9EH 2FIRH 5B6OA 3TGKE 2UWPA 2P16A 2ZDAH 3FP8E 2NU2E 5J4SA 1YGCH 2EEKA 1IAUA 3ZZDA 2OBQA 1MBMA 5FHTA 2B0FA 2ANKH 1HIAB 5AVDA 3K6YA 2J2UA 2Z94A 2CF9H 1V2QT 2NU3E 2BDBA 1TNLA 4K60A 1SHYA 1ANDA 1E35B 6GCHF 2BD8A 3KQCA 1KTSB 1P01A 2WYJA 1C5NH 1SFQB 3RDZA 1LTOA 2WV4A 3M5OA 1Q3XA 2VWLA 3KQDA 4FU9A 3SQEE 1FONA 3LGTA 1D3QB 1DE7H 1HXFH 1XUIA 1CBWC 2P8OB 1KXAA 3QGJA 2TGTA 3RXAA 1C5PA 4YESB 1UO6A 1WTGH 1PPFE 1K1OA 4NZQA 1TBZH 2GZ7A 1T8LA 1XKBC 3A7YA 1ELTA 4KTCA 1H9HE 2ZKSA 3E0PB 2OC0A 1TNKA 1TRYA 2TRMA 4NA9H 3RXBA 2FWWA 3GCHB 1P9SA 1ZRKA 2Y80A 3Q76A 1P04A 4DJZB 1UTKA 3I78A 1Y59T 4XE4A 2GVFA 3BEUA 4FU8A 4O97A 4AORA 3D49H 4UE7H 5C3NA 3QTOH 1C2KA 4IBLH 4DVAU 1HJAC 1V2ST 1C5RA 4NSYA 2HGTH 1XXFA 1AD8H 1YLDA 3OSYA 3RM2H 5BPEA 1CHGA 2G5NA 1V2WT 3MH4A 2XCNA 2OTVA 4XBDA 1W3CA 3RXJA 1CA0C 1EJAA 5CHAC 1O5BB 4ZMAH 2CN0H 1EATA 1LMWB 1LVBA 1QCPA 2ZP0H 2ZI2H 2OINA 4JZFH 4NCYA 2A2XH 1Z8JB 3VGCC 1H9LB 3RM0H 1XUGA 4MDSA 2G52A 1BBRE 2ODQA 4UEHH 1MKXH 1F5KU 4WY3A 4Y0YE 1HFDA 1GWAA 5C2ZA 2J92A 1EXFA 1HYLA 1P2IA 3OYPA 1RTKA 3BTHE 3ZZ8A 1LVYA 1DS2E 1GMCG 1HAYB 4BXWA 1UHBB 1DWCH 4UD9H 3P6ZB 2SGEE 3AASA 4CH2B 2RA0A 3PMBB 4MPXA 1V2PT 2SGAA 1WU1A 1QJ7B 3DT0H 1HBTH 4SGAE 3MNBA 1GDUA 2SGQE 2J9NA 3HK6B 2GZ9A 2STAE 1S82A 2KAIA 1V2KT 1NU7B 1TLDA 3KEEA 1GMDG 3CS7A 1IQLA 3UR6A 1EASA 1ZHMA 1NRSH 5HXFA 2Z7FE 1DWBH 2W3KA 1K28D 1MCVA 2QY0B 2WV5A 2F9UA 3ATWA 2ZGXH 3E1XB 2PGQB 1YPHE 1DXPA 7KMEH 1IQGA 3MTYA 2ZU3A 4X1SU 1HAGE 1ELDE 1UK4A 1DPOA 1D9IA 2OLGA 1NY22 1Z8GA 3O8CA 5EGMA 1PFXC 1P2MA 1SGFG 1WV7H 1FY8E 2P3UB 1F5RA 1O3GA 2QV1A 2WPLS 3AAVA 2OCVB 4U30A 4X0WU 2Y7XA 3A7WA 4WF8A 3RMMH 1DLEA 3RXRA 5FBEA 4J1YA 1ZHRA 3MO3A 1Y3WA 2J34A 2AGEX 2VH0A 3P95A 1ZYOA 3IWMA 2P94A 1ZSJA 1HAZB 1VITF 1BQYA 1O3HA 1O2MA 1O3EA 1XVOA 3M3VA 4U01A 3RXQA 3SHAH 2ANWA 5G4BA 1UK2A 1JMOH 1G3DA 3BTME 3SJ8A 1CBWB 3AW0A 1EKBB 3PLPA 2VNTA 2ZHQH 3ELAH 2PKSC 2QAAA 1D6WA 3GY7A 1SQAA 1C5QA 2Q6DA 2G81E 3EA7A 1AGJA 3RXOA 4Z6AH 1SGNE 3LGIA 1SBWA 1WQSA 1GCTB 3PTBA 1XUFA 4R8TB 3SN8A 2ZHWH 1C4V2 1UTMA 5C1YA 4X2VA 3P17H 1DLKB 2VVVA 2W5EA 3MU0A 4HTCH 4AX9H 3BIVH 4XBBA 4AB8A 3MU8A 4WXIA 3PMJA 4LZ4B 1DM4B 1GJ9B 1RIWC 3HKJB 2A32A 3QN7A 3PMAB 2TPIZ 3SV2H 1N6XA 1LCYA 3RP2A 3SI4H 2PLXA 1T8MA 4AYYB 1OP0A 1C5LH 2OQUA 4CHAC 1O2VA 4A6LA 2Q1JA 4HZHA 1O3FA 3A89A 1EJMA 4YZUA 4AG1A 4CBOA 4Y8YA 1UCYE 4I33A 4D7GA 1O2JA 2O8UA 1K1PA 1KXDA 5EW1H 4A1TA 1HAPH 3SV6A 2FDAA 2IPHA 1QRZA 3HK3B 2CJIA 2ULLA 1P11E 3LH1A 1FLEE 1GL0E 1V2JT 3BEIB 1QBVH 3LOXA 4B75A 4WH8A 1SQOA 3LGUA 1DVAH 3P8NA 4GSOA 1C1WH 1MTWA 3SHCH 1HAVA 4FUJA 4ABGA 1EZSC 2AGGX 5A8XA 1EZXC 1C2LA 1ANEA 1QJ6B 1K21H 5F8ZA 2FO9A 2VWMA 2ZO3H 1GCDA 3RUOA 3QZQA 2JH0D 2AS9A 3T2NA 3W94A 2BD5A 3H7OA 1G36A 5DP4A 3VB7A 1C4U2 4ISLA 1C1QA 4B73A 1MU8B 3K2UA 1YP9A 2Z9LA 1SVPA 1HV7A 2VWOA 1TRMA 2IJOB 3BN9A 3S9CA 1IQKA 1GVKB 1C5TA 1HUTH 3NKKA 1PQ8A 1NPMA 2ODPA 3M3TA 2ZU2A 1S84A 1NFYA 2BTCE 1FY4A 2OC1A 2RA3A 2WUBA 1C2JA 1DY8A 1V2VT 3FANA 4H6TA 1S6HA 2FOEA 3E3TA 2FI4E 1C1TA 5I25A 4JK5A 1CT2E 4A1VA 1Y5UT 1DITH 3MOCA 1KY9A 2XXLA 1PQ5A 2FMJA 1TGNA 1ZTKA 1H1BA 4OS5A 1C2HA 1KSNA 3SJIA 2ZWLH 5ABWA 1C2GA 1UVSH 1SGRE 2J4IA 3BSQA 3GCOA 1YPLH 3KHVA 2VIPA 2QF3A 1RRKA 5CHAB 1PPBH 1ZMJA 3VXFH 1EB2A 4DURA 1AFQC 3PM3A 4ZXXH 1XM1A 1RJXB 2SNWA 3VGCB 4I8LA 1AQ7A 1DANH 1GJ6A 1ZPCA 1TE0A 1AUJA 4UFEH 3UNRA 4KGAA 2DE8A 2NU4E 5HM2A 4ZKNU 2H5CA 2Q6FA 1DUAA 4DOQA 3DFJA 2GKVE 1DSTA 3PV4A 1C5XB 4B74A 3TITA 4CR5A 5DP8A 1EUFA 5K0HA 1QB1A 3T5FH 1ETSH 2WPKS 1GHWH 4KKDA 1L4ZA 2H9HA 1ZTLA 3TGIE 5GJ4B 1W11U 1GGDB 3D65E 2JETC 3SV8A 5F6MA 3LIWA 4Y0ZE 1FPHH 2GT7A 2XWBI 2HLCA 1ABJH 4D9QA 1GBIA 1AVGH 1AWFH 2BQ6B 3Q77A 4FUDA 1OWEA 5TCCA 1FN6A 5A0AE 4BNRA 3Q3KA 2F9PA 1TA6A 4FU7A 1BITA 2D2DA 1TYNA 4KELA 5EQRA 1YCPM 2PR3A 3F6UH 5DP7A 1O2GH 1GBFA 1TWXB 1MZDA 3EA8A 1O2OA 2C8XB 4E05H 3KF2A 1CO7E 3VFEA 1FQ3A 1YBWA 2FM2A 3SU6A 5JB8S 1EZUC 2ZGCA 1S0RA 1V3XA 2GDEH 1GBLA 2PSXA 4IW4E 5H4IB 2VB0A 2PTCE 1C4Y2 1H9IE 2B8OH 1HJ8A 1MQ5A 4Q7ZA 2ZFRH 3RXTA 3CENA 5EG4A 3MNSA 1J17T 1YF4A 1W8BH 1GHAF 2BLQA 1TFXA 2F83A 1E34B 2V3HH 1HIAA 3E90B 3ZVEA 1P9UA 3E8LA 1VITG 2GGVB 4JZEH 2HNTE 2QF0A 1FPCH 2C8YB 4TY6A 5FBIA 1F0SA 1PPZA 3P8FA 3STIA 4GCHG 1B5GH 3OX7U 3RXDA 3ZV9A 2ZPRA 3S69A 4IN1A 3DA9B 3RXKA 1GG6C 2F91A 1QGFA 1O33A 1CQQA 1GI4A 2XC5A 3H5CB 1QL7A 4WXVA 1O2WA 1CHOF 2Z3CA 5FCRA 1SFIA 1BRAA 1QR3E 5DP6A 5JYIA 1BTZA 3ZVDA 3A8BA 1V2UT 4K69A 2XNIA 1O30A 2WPHS 2XRCA 3LGVA 3M35A 1TPPA 2THFB 1ZSKA 2ZFSA 1SLUB 1DOJA 1GBKA 5HYOA 1O34A 4WWYA 7GCHG 5DKMA 3SO3A 1L4DA 3RXGA 2G4UA 2QN5T 4MNYA 1GI9B 3U1JB 3T25A 3M36A 1TX6A 1PPGE 1ZJKA 2ANYA 2BLVA 3M5NA 4ABAA 4ESTE 3AVZA 1NTPA 1ZOMA 1V2TT 4Y8ZA 3SNEA 1BJUA 1QFKH 1SPJA 7LPRA 4NIVA 3TK5A 1G9IE 1IQMA 1JBUH 5L2YH 1DY9A 2FTLE 2BY8X 1G37A 3SW2B 2H6MA 5JDUB 1C5YB 4TWYA 1OX1A 2P8OC 2FP7B 1G32B 3SUEA 4AFSA 2BVRH 1GHBG 1O3MA 1O2QA 3EE0B 4IN2A 3ZVBA 3BG4B 3V0XA 4XBCA 4CRDA 2VGCB 1NRNH 4Y10E 3GCTG 1GPZA 3GY2A 1D3TB 5FCKA 1GI8B 1MMJN 2BD7A 4ABEA 3A7TA 3LU9B 4U32A 2BMGB 3TJVA 4CRGA 1KLTA 1NRQH 1LPKB 1AKSB 3A80A 4X2WA 4X6NA 2ANMH 1C1RA 2ALPA 1NU9A 4MPVA 5EW2H 1MH0A 2PV9B 3ODDA 4NWKA 3PB1E 5L2ZH 1BTHH 1CT4E 3UWIA 3SJKA 3HGNA 3KNXA 1O3BA 2KAIB 3MO6A 4IMZA 3RMNH 1QBNA 2BD2A 1NFWA 2ZHDA 1EPTA 2ASUB 1VCPA 2JH5D 1D4PB 1HDTH 3F68H 3AW1A 1TNHA 1SGIB 3SGBE 3LDXH 1CT0E 1O5DH 4QT8C 1BUIA 4DGJA 2QIQA 2FPZA 4JYTA 1LDTT 2QYIA 1O37A 4NZLA 2ZGJA 2ZECA 4FUBA 1YC0A 2SFAA 4WMEA 4X1RU 1SGCA 3ATKA 3QTVH 2Y5HA 1ESTA 3T29A 3OTJE 2LNCA 3BV9B 4K8BA 3F9GA 1GI5A 1O31A 2WINI 5FPTA 3SU2A 2HNTF 1XXDA 1BB0B 2EC9H 1B7XB 2O8TA 4AGKA 5ESTE 3ZZ7A 4NFEA 4XOJA 3OU0A 1W13U 3MU5A 1PPCE 4FVBA 4JZDH 4MLFB 5A0BA 1MTSA 1QQ4A 4AB9A 2C8WB 1SLXB 1LVMA 4GAWA 5IYTA 3L6PA 1UVUH 1ELBA 5HGGA 1TX7A 2BVSH 4IGDA 1P10A 4BTTB 1BRUP 1W2KH 2YNBA 4JYUH 2BY7X 3KQBA 4ZHMU 3ZZ4A 1GJ4H 3E91A 4THNH 3D23A 1MKWH 2G00A 5L30H 1DWEH 1THSH 2A2QH 3NCLA 3VB6A 5LPRA 1O2XA 2BXUH 1XVMA 1ZJDA 4KP0A 2F9OA 3NPSA 4OS7A 1L2EA 4K2YA 1SLVB 3QGNB 1O2YA 3GDSA 5JB9S 3UUZA 5E2PA 1F5LA 1C2EA 1TOMH 4K1TA 3T62A 5DP9A 1BA8B 4BAQB 3NXPA 4Z0KA 4B2BA 2H1UA 4B2CA 8KME2 2BD9A 1SR5C 3MYWA 1LHFH 1G3EA 2FLRH 1G2LA 4DCDA 2D8WA 2ZCHP 1EAIA 2VH6A 1E38B 3DFLA 3M37A 4JMYA 2FODA 1QRXA 1UVTH 3WY8A 2CV3A 3VXEH 3SNDA 2P95A 2XBVA 2FX6A 4I31A 4X1PU 3EQ0H 2BVXH 1A2CH 1P09A 1O3NA 3C1KA 5TJXA 1O2SA 2Z9KA 1TONA 1Z8IB 3V13A 1HCGA 3NZIA 3QUMP 1GI1A 1P02A 2DE9A 3VEQB 2GX4A 2V6NA 3V12A 1O35A 3DD2H 1CA8B 3O8RA 1CA0B 1KDQA 1C2IA 3UNQA 3L3TA 1SHHB 5SGAE 5TCAA 2AFQB 1W7XH 1TNJA 2EI8A 1Q31A 2NWNA 2SGFE 5CE1A 3ITIA 4CH8B 1UHBA 2TIOA 2FYRA 3SOSA 1TX8A 1HNEE 1ZPZA 1GMHG 1EJNA 3RXUA 1LKAA 3A83A 1OP8A 1CHOG 2FOCA 3GCTF 1K1NA 1PPHE 2ZQ1A 3QK1A 5E2OA 4NGAH 1UJ1A 5A0CA 3LJJA 5T6FA 2PFEA 2BDYA 1RXPA 3ZZ9A 4WJG2 3RXVA 2Y82A 1SGFA 3LJOA 4GLYA 3KCGH 2BB4A 1XUKA 2ZF0H 1ARBA 1VGCC 1W0ZU 1ZGVA 4CRFA 1BT7A 1ELAA 3QZRA 2OC7A 3S7HB 1GHAG 1QB9A 3UY9A 2A5AA 2HALA 4M7GA 2BHGA 2FEQH 4MTBA 3TH4H 4TPIZ 3RXCA 3BG8A 1C1VH 3RXEA 3BTFE 3ZVFA 1AN1E 1PQAA 1N6YA 1YCPH 1QA7A 1UTOA 3ZVAA 1LO6A 2FS9A 3UOUA 2BDGA 2G51A 4Y7AA 1NESE 1TGBA 2ZTXA 1NRPH 5EXLA 5LGOA 2HOBA 2ZDLA 1Y3VA 3RXHA 1P8VC 1P2JA 2VVCA 1TMTH 5JBBS 1LHGH 3GOVB 1C2FA 4UFDH 1KXEA 2FOFA 1GI2A 3P8OA 5DO4H 4CRCA 1O3LA 1EOLA 1Q2WA 2WYGA 3F9EA 3ZVCA 1JRSA 1F2SE 2WPIS 2PTNA 3E6PH 1BDAA 2BDHA 4FUEA 1SG8B 2O8WA 1QNJA 4JZ1A 2R0LA 1QIXB 1GG6B 2PGBB 2TBSA 2V0BA 1T4UH 2AERH 4X8UH 3ZYEA 1GBCA 1CGIE 5E0HA 3UNSA 3BTDE 1ESAA 1AVXA 3P70B 1XKAC 1RD3B 1VJAU 4CRAA 4FVDA 1O3JA 4D9RA 2J94A 3QO6A 4GHTA 1FY3A 2AYWA 2LPRA 2BDAA 2ZTYA 1GVZA 4H4FA 1AY6H 2XC4A 1FJSA 2H5DA 3RXLA 1HGTH 2H2ZA 1UTPA 4AFZA 2Y7ZA 1ELFA 1EP5A 2Y5GA 4YTAA 1GBBA 1L1NA 4K3JA 1T32A 3PTNA 2I6SA 4GUXA 1A5HA 2ZHFH 1KTTB 1EX3A 4A5TS 2NU1E 4ABIA 2FS8A 3RLWH 1SGDE 1JIRA 2BY5X 3SJOA 3VB4A 1F7ZA 1THRH 2ZGBH 1EOJA 3OY5U 1WAYB 1DSUA 1DXWA 2ZDMA 4OS6A 4D76A 4H6SB 3M7UA 2ZDNA 2CHAC 5EOKA 1QQUA 1Y3UA 4Y8XA 1HAVB 4XFQA 3UPEA 3HGPA 2Z9IA 4Q80A 1YLCA 1PYTD 2AH4X 2OQ5A 4DG4A 1XUHA 2UUFB 3Q3XA 2QXJA 1VCQA 4FUGA 1S6FA 1K22H 3HPTB 1WCZA 1KLIH 1AE8H 1A3EH 3M7TA 2UWOA 1G3BA 2J38A 4GHQA 2OBOA 1H8IH 2FOGA 1CGJE 3SV9A 3S7KB 5C1XA 2VGCC 3ESTA 4MPWA 1GDNA 2W7UA 1GJ7B 1QJ1B 1O5GH 3R0FA 3RLYH 1WQVH 5FPYA 1MAXA 3TJUA 1ANBA 3SGQE 3SI3H 1C1SA 1YPKH 1F0UA 1YPEH 2OD3B 4YO9A 3GY8A 2PKAB 1J14A 5F03A 3ZZ3A 2A7HA 1SGTA 2XBWA 2ZCKP 4MG3A 5PTPA 1WSSH 2A45B 1E0FD 2XC0A 8GCHG 1O2TA 3W95A 1BTYA 1LKBA 1UTNA 4VGCC 1V6DA 3UQVA 1GDQA 1MUEB 2AMDA 1MKWK 1D3DB 7ESTE 3FVFB 1VR1H 1O0DH 2GV6A 3SQHE 1GMHF 3BTQE 4X8SH 1CVWH 1FXYA 3NUMA 1BMNH 1EP6A 1O3CA 3GDUA 1P2QA 4I32A 4B71A 3KGPA 3SU3A 4ISNA 2FOHA 1BBRH 2QA9E 5DPAA 1C1UH 2D1JA 4ASHA 4JK6A 1ZMLA 1KYNA 3SV7A 3MNXA 1INCA 2BYAX 3TGJE 3PROA 1K2I1 3KN2A 1E37B 2EA3A 1TABE 4O3UA 3TJNA 1AHTH 1FUJA 4AOQA 3EGKH 2SGPE 3L33A 4KTSA 1RIWB 3RC5A 3A84A 3ZZCA 1CGHA 4YM9A 1TQ7B 1GHYH 2FXRA 3MU1A 1O5AB 2BY9X 1FAXA 4K5ZA 1Y5BT 3K9XB 3U98H 5I46H 1GI6A 1P2NA 4CRBA 4ABFA 2BLWA 2OC8A 4BAHB 5EU8A 1DUEA 4X2YA 2PWXA 2ODYB 2G5VA 1SQTA 1GHVH 2R9PA 2P93A 3U9AH 3RXSA 2XW9A 2A7JA 2PSYA 1EPTB 1ZGIA 2OXSA 4JCNA 2XWAA 1TRNA 3KL6A 1ZTJA 3QX5H 2A0QB 1ANCA 1SLWB 4O03A 2BM2A 1HAXB 1JIMA 1Z6JH 2ALVA 4OS1A 4H42U 8ESTE 2FOAA 1TNGA 4ZUHA 3CS0A 1AZ8A 3M5MA 2BZAA 3RXIA 4NSVA 4Y76A 1VITH 2SNVA 4WMFA 3KQEA 1RTLA 4UDWH 1O2KA 1QA0A 2ZGHA 4NFFA 1SMFE 1MTVA 1F92A 4AYVB 2WPJS 1C1PA 1TQ0B 4B1TA 4WMDA 1P57B 2BLOA 9LPRA 4UONA 3TJOA 8LPRA 5LPEA 2XTTB 1FIWA 3FP6E 3UOPA 3A7VA 3VPKA 3B8JA 1MZAA 3A8DA 1HRTH 3GY4A 2FI3E 4Y11E 1TMUH 4X6OA 1QL8A 2Q6GA 4F4OC 2UWLA 1S85A 4AN7A 1K1IA 3TLOA 1AFEH 1OXGA 3M61U 1AE5A 1LHCH 2C90B 5K7RA 3Q3YA 1K9OE 1GMCF 1W14U 1YPJH 3PWCA 1C1NA 1D6RA 6CHAC 1BRCE 3F1SB 3MI4A 4I8JA 4I8KA 1QRWA 1A1RA 3MNCA 2YNAA 4INLA 4VGCB 3BTWE 1UCYH 3LONA 3MO9A 1C9TA 5BRRE 1C5OH 2QC2A 3F9HA 2RCEA 1GJBB 2XYAA 2ZU1A 5F8TA 4X8VH 3UREA 3BTEE 1TIOA 5C1UA 3ZZ6A 3A87A 1FN8A 3FZDA 2ZZUH 2ZFTA 3OY6U 2ZG0H 1C5ZB 3T26A 1O5CB 4GVUA 4LOYH 8GCHF 1B0FA 1IHTH 1HB0B 5GIBA 2BY6X 5L6NH 1AVWA 2IN2A 1Z1JA 5LH8A 3RC6A 3VB3A 1V2RT 2AIPA 5AHGH 4YT7H 3E16B 5E8EH 1WUNH 4I8GA 4AGJA 3SGAE 1BMLA 1C5WB 2C3SA 1KXCA 1IQIA 1VGCB 5A09A 3QDZB 1BIOA 1WYKA 1MQ6A 1HXEH 1GBEA 1XX9A 1GJDB 3SNAA 1MTUA 1EAXA 2F3CE 4LK4A 7GCHF 2A31A 3SNCA 3S0NA 1QBOA 2EI7A 1D3PB 3LT3A 1O5EH 3SBKA 1MKXK 4D8NA 3U8TH 2A5IA 2ESTE 1SGPE 2PUXB 3DUXH 1O2IA 5F8XA 1BHXB 1O3IA 2QXGA 1NN6A 2BD3A 1JXPA 3PWBA 3SORA 1A5IA 5EPNA 3STJA 3BG4C 1HLTH 2VIVA 2W3IA 1QHRB 1GI7B 1C1MA 4RKOB 1TPAE 4GCHF 2VIDA 1U6QA 5DG6A 4MVNA 4NWLA 4Y7BA 2ZFQH 3LC3A 1OWHA 1QY6A 1Z71A 2C93B 1VZQH 2F9BH 1A0JA 1T7CA 3RU4T 1HAIH 2BX3A 4I8HA 1YYY1 1LVOA 1P12E 3JZ2B 1N1LA 3LH3A 3ZZBA 2GCHF 5E0JA 3EAJA 1SOTA 3LKWA 1A46H 1UTJA 1T4VH 2HRVA 3K6ZA 4MNXA 6LPRA 2ZC9H 4IC5A 1FAKH 1P2OA 5DP3A 3T28A 1HAOH 1PJPA 2A4GA 3GY3A 3FP7E 2TGAA 3BIUH 2BDCA 2VWNA 1O36A 1T31A 2Z9JA 1G2MA 1NROH 1BTXA 3ATMA 5JPMH 4Q7YA 1P05A 5GWZA 5AFYH 4CREA 1E36B 1GJCB 1K1JA 5ETXA 1OWKA 4OS4A 1T8OA 1GJ8B 3MHWU 2FTMA 2JH6D 1BRBE 3H7TA 3ATIA 3GCNA 3FAOA 2BDIA 4NA8A 5JBAS 5DGJA 4K8YA 4MNVA 3U8RH 1MTNB 3C27B 4B2AA 3M5LA 1BZXE 1S0QA 1EAWA 3UIRA 3MWIU 1GBMA 1O32A 1FZZA 5T6GA 2ZU4A 4RN6A 4DIHH 1N8OC 1SGEE 1RS0A 5DK1A 1OKXA 2F9VA 2R2WU 3BTGE 1HJ9A 2G55A 2ZHEH 4A7IB 4OGYA 2G8TA 3BTTE 2D26C 1QURH 5C20A 5J4QA 5HM9A 3LPRA 1MD7A 1H4WA 3MU4A 4MQAA 1UK3A 1QB6A 3A86A 4X2XA 3SU0A 1ZHPA 1PQ7A 1GHZA 1O2LA 4MNWA 3ZZ5A 1B0EA 1ZR0A 2F9NA 3SUDA 1UCYK 2H9TH 3BTKE 1AB9C 3GY6A 4BOHA 1CSOE 1LQDB 1UTLM 3RXMA 1ZLRA 1GCTC 4FUIA 4I7YH 2ZFFH 4YLUA 3PLBA 4ISHH 1Z7KA 1M9UA 1Y3YA 4K1SA 1GBDA 1ACBE 2A4RA 2P3TB 3N7OA 5A8ZA 4JYVH 1L1GA 5EQSA 3TIUA 3DHKH 2ZEBA 1C2DA 2UUKB 2V35A 1OOKB 2PW8H 5E0GA 3V3MA 2EI6A 3ZZAA 1P0SH 4TY7A 1ESBA 4E7RG 6CHAB 4U2WA 3I77A 4UFGH 2I6QA 1YPHC 2GMTC 2CF8H 1S83A 1ID5H 4X6PA 1P2KA 3UFAA 1T8NA 3SU4A 4X1QU 2PUQH 4RKJB 4BTUB 3ATLA 5C5NA 3GCHC 1O3KA 1ZZZA 1WOFA 1JWTA 1OP2A 4X8TH 4FUHA 1SI5H 5C5OA 4A92A 1C9PA 1O2NA 2B7DH 4IC6A 1JRTA 1RGQA 5EPYA 3V7TA 5A2MH 4LZ1H 1Z1IA 1LHDH 2GTBA 4ABDA 2VU8E 2GV7A 1AU8A 1OWIA 3TH3H 1CE5A 1DICA 1EAUA 4AFQA 3S9AA 1TAWA 1SGYE 4PROA 3RMOH 3GISB 2ZDKA 1A0LA 3TPIZ 5A8YA 4Y79A 1PPEE 3A8CA 5T6DA 3RU4D 1O3OA 1TB6H 1J16A 1Z6EA 4Y71A 4F49A 1ZSLA 4ZKRU 1A5GH 3RXFA 3T27A 1NS3A 2V3OH 3I29A 1C5VA 1O3DA 2AIQA 3U1IB 4ZROA 4DT7B 1W0YH 2FX4A 1FI8A 1BTWA 1NC6A 2ZA5A 3UR9A 2FLBH 2IOTA 1A7SA 4OS2A 1C1OA 1NFXA 2UUYA 1C5UA 2QGRA 2RDLA 1OS8A 1NRRH 1YM0A 3GYMA 3GICB 1Y8TA 1L0ZA 1BJVA 1UMAH 3PO1B 5FAHA 1NT1A 2Y6TA 3RU4E 2O8MA 2B9LA 2R3YA 4JZIA 2ILNA 1ORFA 1OYTH 1IQFA 3UTUH 4XDEA 3JZ1B 2ZU5A 3LGYA 4NA7A 5AFZH 1DT2A 5T3HA 1GJAB 4YLQH 1AKSA 1O2ZA 1FY5A 3S9BA 2ZNKH 4ABHA 4SGBE 2RG3A 2R0KA 2GCTC 2HPQH 2ZIQH 4Q7XA 3P8GA 5AF9H 1W10U 1YPMH 5EQQA 2SGDE 5DJ7A 2GD4B 1O2UA 4E06H 1X7AC 2GDDA 3A7XA 5GCHG 1V2NT 1K1MA 1AB9B 1F0RA 1JOUB 2ZPSA 1S81A 2ZCLP 3CP7A 2Z6BD 3PO1C 1GHBF 4IS5A 5EXNA 5FX5A 5JBTA 2GZ8A 1QTFA 3A82A 5EODA 1A0HB 1P06A 1HJAB 3U69H 4BANB 4CR9A 1UVOA 5ESBA 2ZDVH 1TPSA 1NM6A 4DY7B 4HFPB 1W7GH 2Z3EA 2W7SA 4A1XA 2GMTB 2BQ7B 1BTUA 1ELVA 1C2MA 2VJ1A 3RXPA 1TBQH 4NIXA 3AAUA 1BTPA 1KXBA 1DWDH 1OWJA 4ABJA 1TA2A 1VCWA 2WPMS 1SGQE 1Y3XA 2M5TA 4INKA 1J8AA 1RTFB 1C5MD 1L1JA 2XCFA 1TOCB 1FDPA 1O3AA 3VB5A 1EZQA 1MCTA 3FFGA 3GYLB 4INHA 1V2MT 3TU7H 3PYHA 4UFFH 5FPSA 1OSSA 2JKHA 1TGTA 1EPTC 4J2YB 1YPGH 1GBJA 1FY1A 2C8ZB 4K1EA 4DW2U 1HPGA 2CGAA 2K1QA 1FMGA 2NU0E 1WBGB 4MPUA 1GBTA 1AIXH 3BF6H 3A85A 4FXGH 3MH5A 4ZHLU 4ZAEA 2ZFPH 1YCPK 2BX4A 3MH6A 4NG9H 6ESTA 3QWCH 4HGCA 4CBNA 1N8OB 1P3EA 1ELGA 1AZZA 3QLPH 1G30B 3O8DA 1GBHA 1EB1H 1GMDF 1V2LT 4AG2A 2OUAA 2JETB 2FI5E 1W12U 2TGPZ 9ESTA 2VVUA 1KLJH 3NWUA 2FYQA 4BXSA 1GJ5H 1LHEH 1MTNC 2BZ6H 3U8OH 2BD4A 3BEFB 3LC5A 5GPIB 1Y5AT 3TK6A 3URCA 1VJ9U
chains in the Genus database with same CATH superfamily
1SC8U 3ZYDA 2WZQA 1IQEA 1S5SA 1O2PA 3UWJH 4ZHAA 2VIOA 4TWWA 1SB1H 4TYDA 3LGWA 4RSPA 1ETRH 4AFUA 3SUGA 1O39A 1IQNA 1C5SA 1BHXF 1A61H 1ZRBA 4Y6DA 3URDA 2ZTZA 2HNTC 4X6MA 4AZ2B 2A7CA 3SU1A 1J9CH 3EA9A 2EQNA 2FZZA 2WV9A 1MBQA 4BAKB 4IMQA 3IITA 5GCHF 6GCHG 2Y5FA 2GCTB 3TNTA 2FESH 1BCUH 3EYDA 2O8LA 2QXHA 4ZKSU 4CHAB 1FIZA 1TMBH 1KDQB 3TH2H 1FNIA 4FUCA 1P03A 4FUFA 3RMLH 3N7DA 3SNBA 3SYJA 1ETTH 3GY5A 2QCYA 1IHSH 4Q2KA 1IOEA 3WWBA 1KXFA 2VINA 3A8AA 2J5UA 1LPZB 4ABBA 4M9FA 1P3CA 1Z8RA 5C67A 5GXPA 2P59A 3M3SA 1RFNA 2A4OA 2AMQA 5FX6A 1FV9A 3FZZA 2UUJB 1A3BH 3P92A 4YT6H 3UAIC 1AI8H 3UQOA 4YOIA 2VIQA 3ODFA 2R2MB 3IG6B 2KFWA 1DX5M 1SOZA 3A88A 1TNIA 1XMNB 3SUFA 3ZVGA 1IQHA 5GDSH 2Z9GA 3F9FA 1NFUA 3G01A 1ABIH 1THPB 3TNSA 1GVLA 1WTHD 2G4TA 2BOHB 1BMAA 2W26A 1ELEE 1AO5A 1QL9A 2QXIA 2BOKA 1BMMH 1LQEA 5DP5A 1AFQB 1O5FH 2KCAA 1ZPBA 3D62A 1GHXH 4LXBH 5LPFA 2CHAB 4WVPE 4ZKOU 4ISIH 4BAMB 1IQJA 2PKAA 2VBCA 3DSPA 3E0NB 1AWHB 3Q00A 4NIYA 4B76A 2HPPH 2BQWB 1DDJA 2TGDA 5IDKA 1TPOA 1G3CA 1O2HA 3DSOA 4O3TA 3PLKA 1O2RA 3MH7A 1XUJA 1ELCA 1AMHA 2WUCA 2A1DB 2V7QD 3MMGA 2O9QA 3ZV8A 3GDVA 3K65B 2EY4C 2BXTH 2XBYA 1SL3A 4R0IA 3TK9A 3ENSB 5EXMA 1H8DH 1SSXA 2PKSB 2STBE 1AUTC 2C4FH 2IJD1 3M7QA 2VIWA 3SU5A 3HKIB 1GL1A 1TBRH 3KIDU 1NO9H 2A5KA 5JBCS 1CU1A 3A81A 1ZMNA 2M2AA 4Q63A 2AMPA 1GI3A 1K1LA 3PMHB 5CMXH 2ZQ2A 2AEIH 4WH6A 3RC4A 2XBXA 2PHBA 5FXLA 4F55A 4D7FA 2Y81A 2FOMB 1MU6B 1ARCA 1GI0A 2P3FH 2J95A 1F0TA 4BTIB 1O3PB 2B5TB 1DFPA 1UVPA 4YOGA 2JDID 2GP9B 4YOJA 1LPGB 1HAHH 1V2OT 5HMAA 3FOAA 2FOBA 4ZXYH 2CXVA 4O9VA 3SZNA 1MAYA 1A4WH 2DUCA 2KM0A 4XSKU 4ZH8A 3NK8A 2AGIX 3EDXB 4ISOA 4X1NU 3TVJB 2A4QA 2K0QA 2OP9A 1BBRK 2HWLB 4OGXA 4HI3A 2GT8A 1PYTC 1TALA 3A7ZA 1UTQA 3MFJA 1KIGH 4GPGA 3SJ9A 1OWDA 4BAOB 2ZPQA 1GBAA 3B9FH 2GCHG 1TGCA 1OPHB 2CMYA 1TGSZ 1EQ9A 1OYQA 2YOLA 4DIIH 3O8BA 4KTUA 1NZQH 3B23B 4NIWA 1O38A 1GGDC 1YKTA 2Z3DA 2R3UA 4TPYA 3R3GB 1J15A 1MD8A 2HVXA 4E7NA 1BOQA 3HATH 2H9EH 2FIRH 5B6OA 3TGKE 2UWPA 2P16A 2ZDAH 3FP8E 2NU2E 5J4SA 1YGCH 2EEKA 1IAUA 4XRNA 3ZZDA 2OBQA 1MBMA 5FHTA 2B0FA 3OTPA 2ANKH 1HIAB 5AVDA 3K6YA 2J2UA 2Z94A 2CF9H 1V2QT 2NU3E 2BDBA 1TNLA 4K60A 1SHYA 1ANDA 1E35B 6GCHF 2BD8A 3KQCA 1KTSB 1WXRA 1P01A 2WYJA 1C5NH 1SFQB 3RDZA 1LTOA 2YMSB 2WV4A 3M5OA 1Q3XA 2VWLA 3KQDA 4FU9A 3SQEE 1FONA 3LGTA 1D3QB 1DE7H 1HXFH 1XUIA 1CBWC 4P00A 2P8OB 1KXAA 3QGJA 2TGTA 3RXAA 1C5PA 4YESB 1UO6A 1WTGH 3PRDA 1PPFE 1K1OA 4NZQA 1TBZH 2GZ7A 1T8LA 1XKBC 3A7YA 3F3BA 1ELTA 2F4LA 4KTCA 1H9HE 2ZKSA 3E0PB 2OC0A 1TNKA 1TRYA 2TRMA 4NA9H 3RXBA 2FWWA 3GCHB 1P9SA 1ZRKA 2Y80A 3Q76A 1P04A 4DJZB 1UTKA 3I78A 1Y59T 4XE4A 2GVFA 3BEUA 4FU8A 4O97A 4AORA 3D49H 4UE7H 5C3NA 3QTOH 1C2KA 4IBLH 1FX0B 4DVAU 1HJAC 5HIZA 1V2ST 1C5RA 4NSYA 2HGTH 1XXFA 1AD8H 1YLDA 3OSYA 3RM2H 5BPEA 1CHGA 2G5NA 1V2WT 3MH4A 2XCNA 2OTVA 4XBDA 1W3CA 3RXJA 1CA0C 1EJAA 5CHAC 1O5BB 4ZMAH 2CN0H 1EATA 1LMWB 1LVBA 1QCPA 2ZP0H 2ZI2H 2OINA 4JZFH 4NCYA 2A2XH 1Z8JB 3VGCC 4Z1MD 1H9LB 3RM0H 1XUGA 1QZ8A 4MDSA 2G52A 1BBRE 2ODQA 4UEHH 1MKXH 1F5KU 4WY3A 4Y0YE 1HFDA 1GWAA 5C2ZA 2J92A 1EXFA 1HYLA 1P2IA 3OYPA 1RTKA 3BTHE 3ZZ8A 1LVYA 1DS2E 1GMCG 1HAYB 4BXWA 1UHBB 1DWCH 4UD9H 3P6ZB 2SGEE 3AASA 4CH2B 2RA0A 3PMBB 4MPXA 1V2PT 2SGAA 1WU1A 1QJ7B 3DT0H 1HBTH 4SGAE 3MNBA 1GDUA 2SGQE 2J9NA 3HK6B 2GZ9A 2STAE 2KAIA 1S82A 1V2KT 1NU7B 1TLDA 3KEEA 1GMDG 3CS7A 1IQLA 3UR6A 2IPQX 1EASA 1ZHMA 1NRSH 5HXFA 2Z7FE 1DWBH 2W3KA 1K28D 1MCVA 2QY0B 2WV5A 2F9UA 3ATWA 2ZGXH 3E1XB 2PGQB 1YPHE 1DXPA 7KMEH 1IQGA 3MTYA 2ZU3A 4X1SU 1HAGE 4YXWD 1ELDE 1UK4A 1DPOA 1D9IA 2OLGA 1NY22 1Z8GA 3O8CA 5EGMA 1PFXC 1P2MA 1SGFG 1WV7H 1FY8E 2P3UB 1F5RA 1O3GA 3PV2A 3ZIAD 2QV1A 2WPLS 3AAVA 2OCVB 4U30A 4X0WU 2Y7XA 3A7WA 4WF8A 3RMMH 1DLEA 3RXRA 5FBEA 4J1YA 1H8ED 1ZHRA 3MO3A 1Y3WA 2J34A 2AGEX 2VH0A 3P95A 1ZYOA 3IWMA 2P94A 1ZSJA 1HAZB 1VITF 1BQYA 1O3HA 1O2MA 1O3EA 1XVOA 3M3VA 4U01A 3RXQA 3SHAH 2ANWA 5G4BA 1UK2A 1JMOH 1G3DA 3BTME 3SJ8A 1CBWB 3AW0A 1EKBB 3PLPA 2VNTA 2ZHQH 3ELAH 2PKSC 2QAAA 1D6WA 3GY7A 1SQAA 1C5QA 2Q6DA 2G81E 3EA7A 1AGJA 3RXOA 4Z6AH 1SGNE 3LGIA 1SBWA 1WQSA 1GCTB 3PTBA 1XUFA 3KQ5A 4R8TB 3SN8A 2ZHWH 1C4V2 1UTMA 5C1YA 4X2VA 3P17H 1DLKB 2VVVA 1YY3A 2W5EA 3MU0A 4HTCH 4AX9H 3BIVH 4XBBA 4AB8A 3MU8A 4WXIA 3PMJA 3UB0A 3FKSD 4LZ4B 1DM4B 1GJ9B 1RIWC 2LP6A 2A32A 3HKJB 3PMAB 3QN7A 2TPIZ 3SV2H 1N6XA 1LCYA 3RP2A 3SI4H 2PLXA 1T8MA 4AYYB 4DT4A 1OP0A 1C5LH 2OQUA 4CHAC 1O2VA 4A6LA 2Q1JA 4HZHA 1O3FA 3A89A 1EJMA 4YZUA 4AG1A 4CBOA 4Y8YA 1UCYE 4I33A 4D7GA 1O2JA 2O8UA 1K1PA 1KXDA 5EW1H 4A1TA 1HAPH 3SV6A 2FDAA 2IPHA 1QRZA 3HK3B 2K8IA 2CJIA 2ULLA 1P11E 3LH1A 1NBMD 1FLEE 1GL0E 2YMSC 1V2JT 3BEIB 1QBVH 3LOXA 4B75A 4WH8A 1SQOA 3LGUA 1DVAH 3P8NA 4GSOA 1C1WH 1MTWA 3SHCH 1HAVA 4FUJA 4ABGA 1EZSC 2AGGX 5A8XA 1EZXC 1C2LA 1ANEA 1QJ6B 1K21H 5F8ZA 2FO9A 2VWMA 2ZO3H 1GCDA 3RUOA 3QZQA 2JH0D 2AS9A 3T2NA 3W94A 2BD5A 3H7OA 1G36A 5DP4A 3VB7A 1C4U2 5CDFE 4ISLA 1C1QA 4B73A 1MU8B 3K2UA 1YP9A 2Z9LA 1SVPA 1HV7A 2VWOA 1TRMA 2IJOB 3BN9A 3S9CA 1IQKA 2KCYA 1GVKB 1C5TA 1HUTH 3NKKA 1PQ8A 1NPMA 2ODPA 4RT1A 3M3TA 2ZU2A 1S84A 1NFYA 2BTCE 1FY4A 2OC1A 2RA3A 2WUBA 1C2JA 1DY8A 5HIYA 1V2VT 3FANA 4H6TA 1S6HA 2FOEA 2KR7A 3E3TA 2FI4E 1C1TA 5I25A 4JK5A 1CT2E 4A1VA 1Y5UT 1DITH 3MOCA 1KY9A 2XXLA 1PQ5A 4ACBA 2FMJA 1TGNA 1ZTKA 1H1BA 4OS5A 1C2HA 1KSNA 3SJIA 2ZWLH 5ABWA 1C2GA 1UVSH 1SGRE 2J4IA 3BSQA 3GCOA 1YPLH 3KHVA 2VIPA 2QF3A 1RRKA 3W1EA 5CHAB 1PPBH 1ZMJA 3VXFH 1EB2A 4DURA 2RFKC 1AFQC 3PM3A 4ZXXH 1XM1A 1RJXB 2SNWA 3VGCB 4I8LA 1AQ7A 1DANH 1GJ6A 1ZPCA 2J97A 1TE0A 2RDEA 1AUJA 4UFEH 3UNRA 4KGAA 2DE8A 2NU4E 5HM2A 4ZKNU 2H5CA 2Q6FA 1DUAA 4DOQA 3DFJA 2GKVE 1DSTA 3PV4A 1C5XB 2W6JD 4B74A 3TITA 4CR5A 5DP8A 1EUFA 5K0HA 1QB1A 3T5FH 1ETSH 2WPKS 1GHWH 4KKDA 1L4ZA 2H9HA 1ZTLA 4RI0A 3TGIE 5GJ4B 1W11U 1GGDB 3D65E 2JETC 3SV8A 5F6MA 3LIWA 3OFND 4Y0ZE 1FPHH 2GT7A 2XWBI 3OEED 2HLCA 1ABJH 4D9QA 1GBIA 1AVGH 1AWFH 2BQ6B 3Q77A 4FUDA 1OWEA 5TCCA 1FN6A 5A0AE 5KECA 4BNRA 3Q3KA 2F9PA 1TA6A 4FU7A 1BITA 2D2DA 1TYNA 4KELA 5EQRA 1YCPM 2PR3A 3F6UH 2L6OA 5DP7A 1O2GH 1GBFA 1TWXB 1MZDA 3EA8A 1O2OA 2C8XB 4E05H 3KF2A 1CO7E 3VFEA 1FQ3A 1YBWA 2FM2A 3SU6A 5JB8S 1EZUC 2ZGCA 1S0RA 1V3XA 2GDEH 1GBLA 2PSXA 4IW4E 5H4IB 2VB0A 2PTCE 1C4Y2 1H9IE 2B8OH 1HJ8A 1MQ5A 4Q7ZA 2ZFRH 3RXTA 3CENA 5EG4A 2JJ2D 3MNSA 1J17T 1YF4A 1W8BH 2W6ID 1GHAF 1SKYE 2BLQA 1TFXA 2F83A 1E34B 2V3HH 1HIAA 3E90B 3ZVEA 1P9UA 3E8LA 1VITG 2GGVB 4JZEH 2HNTE 2QF0A 1FPCH 2C8YB 4TY6A 5FBIA 1F0SA 1PPZA 3P8FA 3STIA 4GCHG 1B5GH 3OX7U 5DSFA 3RXDA 3ZV9A 2ZPRA 3S69A 4IN1A 3DA9B 3RXKA 2F91A 1GG6C 1QGFA 1O33A 1CQQA 1GI4A 2CK3D 2XC5A 1QL7A 3H5CB 4WXVA 5C0TA 1O2WA 1CHOF 2Z3CA 2JIZD 5FCRA 1SFIA 1BRAA 1QR3E 5DP6A 5JYIA 1BTZA 1SQRA 3ZVDA 3A8BA 1V2UT 4K69A 2XNIA 1O30A 2WPHS 5IK2D 2XRCA 3LGVA 3M35A 1TPPA 2THFB 1ZSKA 2ZFSA 1SLUB 4ACAA 1DOJA 1GBKA 5HYOA 1O34A 4WWYA 7GCHG 5DKMA 3SO3A 1L4DA 3RXGA 2G4UA 2QN5T 4MNYA 1GI9B 3U1JB 3T25A 3M36A 1TX6A 1PPGE 1ZJKA 2ANYA 2BLVA 3M5NA 2PP6A 4Q4LA 4ABAA 4ESTE 3AVZA 1NTPA 1ZOMA 1V2TT 4Y8ZA 3SNEA 1BJUA 1QFKH 1SPJA 7LPRA 4NIVA 3TK5A 1G9IE 1IQMA 1JBUH 5L2YH 1DY9A 2FTLE 2BY8X 1G37A 3SW2B 2H6MA 5JDUB 1C5YB 4TWYA 1OX1A 2P8OC 2QF5A 2FP7B 4FOUC 1G32B 3SUEA 4AFSA 2BVRH 1GHBG 1O3MA 1O2QA 3EE0B 4IN2A 3ZVBA 3BG4B 3V0XA 4XBCA 4CRDA 2VGCB 1NRNH 4Y10E 3GCTG 3PV5A 1GPZA 3GY2A 1D3TB 5FCKA 1GI8B 1MMJN 2BD7A 4ABEA 3A7TA 3LU9B 4U32A 2BMGB 3TJVA 4CRGA 1KLTA 1NRQH 1LPKB 1AKSB 3A80A 4X2WA 4X6NA 2ANMH 1C1RA 2ALPA 1NU9A 4MPVA 5EW2H 1MH0A 4RT0A 2PV9B 3ODDA 4NWKA 3PB1E 5L2ZH 1BTHH 1CT4E 3UWIA 3SJKA 5KGOA 3HGNA 3KNXA 1O3BA 2KAIB 3MO6A 4IMZA 3RMNH 1QBNA 2BD2A 1NFWA 2ZHDA 1EPTA 2ASUB 1VCPA 2JH5D 1D4PB 1HDTH 3F68H 3AW1A 1TNHA 1SGIB 3SGBE 3LDXH 1CT0E 1O5DH 4QT8C 1BUIA 4DGJA 2QIQA 2FPZA 4JYTA 1LDTT 2QYIA 1O37A 4NZLA 2ZGJA 2ZECA 4FUBA 1YC0A 2SFAA 4WMEA 4X1RU 1SGCA 3ATKA 3QTVH 1ESTA 2Y5HA 3T29A 3OTJE 2LNCA 3BV9B 4K8BA 3AK5A 3F9GA 1GI5A 1O31A 2WINI 5FPTA 3SU2A 2HNTF 1XXDA 1BB0B 2EC9H 1B7XB 2O8TA 4AGKA 5ESTE 3ZZ7A 4NFEA 5EJZA 4XOJA 3OU0A 1W13U 3MU5A 1PPCE 4FVBA 4JZDH 4MLFB 5A0BA 3WW7A 1MTSA 1QQ4A 4AB9A 2C8WB 1SLXB 1LVMA 4GAWA 2KCPA 5IYTA 3L6PA 1UVUH 1ELBA 5HGGA 1TX7A 2BVSH 4IGDA 1P10A 4BTTB 1BRUP 2HVYB 1W2KH 2YNBA 4JYUH 2BY7X 3KQBA 4ZHMU 3ZZ4A 1GJ4H 3E91A 4THNH 3D23A 1MKWH 2G00A 5L30H 1DWEH 1THSH 2A2QH 3NCLA 3VB6A 5LPRA 1O2XA 2BXUH 1XVMA 1ZJDA 4KP0A 2F9OA 3NPSA 4OS7A 1L2EA 4K2YA 1SLVB 3QGNB 1O2YA 3GDSA 5JB9S 3UUZA 5E2PA 1F5LA 1C2EA 1TOMH 4K1TA 3T62A 5DP9A 1BA8B 4BAQB 3NXPA 4Z0KA 4B2BA 2H1UA 4B2CA 8KME2 2BD9A 1SR5C 3MYWA 1LHFH 1G3EA 2FLRH 1G2LA 4DCDA 2D8WA 2ZCHP 1EAIA 2VH6A 1E38B 3DFLA 3M37A 4JMYA 4HG6A 2FODA 1QRXA 1UVTH 3WY8A 2CV3A 3VXEH 3SNDA 2P95A 2XBVA 2FX6A 4I31A 4X1PU 3EQ0H 2QF4A 2BVXH 1A2CH 1P09A 1O3NA 3C1KA 5TJXA 1O2SA 1YLNA 2Z9KA 1TONA 1Z8IB 3V13A 1HCGA 3NZIA 2WHXA 3QUMP 1GI1A 1P02A 2DE9A 3VEQB 2GX4A 2V6NA 3V12A 1O35A 3DD2H 1CA8B 3O8RA 1CA0B 1KDQA 1C2IA 3UNQA 3L3TA 1SHHB 5SGAE 5TCAA 2AFQB 1W7XH 1TNJA 2EI8A 1Q31A 2NWNA 2SGFE 5CE1A 3ITIA 4CH8B 1UHBA 2TIOA 4I86A 2FYRA 3SOSA 1TX8A 1OHHD 1HNEE 1ZPZA 2V3MA 1GMHG 1EJNA 3RXUA 1LKAA 3A83A 1OP8A 1CHOG 2FOCA 3GCTF 2KZ4A 1K1NA 1PPHE 2ZQ1A 3QK1A 5E2OA 4NGAH 1UJ1A 5A0CA 3LJJA 5T6FA 2PFEA 2KCOA 2BDYA 1RXPA 3ZZ9A 4WJG2 3RXVA 2Y82A 1SGFA 3LJOA 4GLYA 3KCGH 2BB4A 1XUKA 2ZF0H 1ARBA 1VGCC 1W0ZU 1ZGVA 4CRFA 1BT7A 1ELAA 3QZRA 2OC7A 3S7HB 1GHAG 1QB9A 3UY9A 2A5AA 2HALA 4M7GA 2BHGA 2FEQH 4MTBA 3TH4H 4TPIZ 3RXCA 3BG8A 1C1VH 5EJLA 3RXEA 3BTFE 3ZVFA 1AN1E 1PQAA 1N6YA 5F53A 1YCPH 1QA7A 1UTOA 3ZVAA 1LO6A 2FS9A 3UOUA 2BDGA 2G51A 4Y7AA 4P02A 1NESE 1TGBA 2ZTXA 1NRPH 5EXLA 5LGOA 2HOBA 2ZDLA 1Y3VA 3RXHA 1P8VC 1P2JA 2VVCA 1TMTH 5JBBS 1LHGH 3GOVB 1C2FA 4UFDH 1KXEA 2FOFA 1GI2A 3P8OA 5DO4H 4CRCA 1O3LA 1EOLA 1Q2WA 2WYGA 3F9EA 3ZVCA 1JRSA 1F2SE 3CNRA 2WPIS 2PTNA 3E6PH 3N99A 1BDAA 2BDHA 4FUEA 1SG8B 2O8WA 1QNJA 4JZ1A 2R0LA 1QIXB 1GG6B 2L74A 2PGBB 1E1RD 2TBSA 2V0BA 1T4UH 2AERH 4X8UH 5C17A 3ZYEA 1GBCA 1CGIE 5E0HA 3UNSA 3BTDE 1W0JD 1ESAA 1AVXA 3P70B 1XKAC 1RD3B 1VJAU 4CRAA 4FVDA 1O3JA 4D9RA 2J94A 3QO6A 4GHTA 1FY3A 2AYWA 2LPRA 2BDAA 2ZTYA 1GVZA 4H4FA 1AY6H 2XC4A 1FJSA 2J98A 2H5DA 3RXLA 1HGTH 2H2ZA 1UTPA 4AFZA 2Y7ZA 1ELFA 1EP5A 2Y5GA 4YTAA 1GBBA 1L1NA 4K3JA 1T32A 3PTNA 2I6SA 4GUXA 1A5HA 2ZHFH 1KTTB 1EX3A 4A5TS 2NU1E 4ABIA 2FS8A 3RLWH 1SGDE 1JIRA 2BY5X 3SJOA 3VB4A 1F7ZA 1THRH 2ZGBH 1EOJA 3OY5U 5EIYA 1WAYB 1DSUA 1W0KD 1DXWA 2OK5A 2ZDMA 4OS6A 4D76A 4H6SB 3M7UA 2ZDNA 2CHAC 5EOKA 1QQUA 1Y3UA 4Y8XA 1HAVB 4XFQA 3UPEA 3HGPA 2Z9IA 4Q80A 5DN6D 1YLCA 1PYTD 2AH4X 2OQ5A 4DG4A 1XUHA 2UUFB 3Q3XA 2QXJA 1VCQA 4FUGA 1S6FA 1K22H 3HPTB 1WCZA 1KLIH 1AE8H 1A3EH 3M7TA 2UWOA 1G3BA 2J38A 4GHQA 2OBOA 1H8IH 2FOGA 1CGJE 3SV9A 3S7KB 5C1XA 2VGCC 3ESTA 4MPWA 1GDNA 5KEDA 2W7UA 1GJ7B 1QJ1B 1O5GH 3R0FA 3RLYH 1WQVH 5FPYA 1MAXA 3TJUA 1ANBA 3SGQE 3SI3H 1C1SA 1YPKH 1F0UA 1YPEH 2OD3B 4YO9A 3F2GA 3GY8A 2PKAB 1J14A 5F03A 3ZZ3A 2A7HA 1SGTA 2XBWA 2ZCKP 4MG3A 5PTPA 1WSSH 2A45B 1E0FD 2XC0A 8GCHG 1O2TA 3W95A 1BTYA 1NBME 1LKBA 1UTNA 4VGCC 1V6DA 3UQVA 1GDQA 1MUEB 2AMDA 1MKWK 1D3DB 7ESTE 3FVFB 1VR1H 1EFRD 1O0DH 2GV6A 3SQHE 1GMHF 3BTQE 4X8SH 1CVWH 1FXYA 3NUMA 1BMNH 5C94A 1EP6A 1O3CA 3GDUA 5HKKD 1P2QA 4I32A 4B71A 3MQKC 3KGPA 3SU3A 4ISNA 2FOHA 1BBRH 2QA9E 5DPAA 1C1UH 2D1JA 4ASHA 4JK6A 1ZMLA 1KYNA 3SV7A 3MNXA 1INCA 2BYAX 3TGJE 3PROA 3SZEA 1K2I1 3KN2A 1E37B 2EA3A 1TABE 4O3UA 3TJNA 1AHTH 1FUJA 4AOQA 3EGKH 2SGPE 3L33A 4KTSA 1RIWB 3RC5A 3A84A 3ZZCA 3FO8D 1CGHA 4YM9A 1TQ7B 1GHYH 2FXRA 3PRBA 1K0HA 3MU1A 1O5AB 2BY9X 1FAXA 4K5ZA 1Y5BT 3K9XB 3U98H 5I46H 1GI6A 1P2NA 4CRBA 4ABFA 2BLWA 2OC8A 4BAHB 5EU8A 1DUEA 4X2YA 5EJ1A 2PWXA 3GS9A 2ODYB 2G5VA 1SQTA 1YWUA 1GHVH 2R9PA 2P93A 3U9AH 3RXSA 2XW9A 2A7JA 2PSYA 1EPTB 1ZGIA 2OXSA 2F43B 4JCNA 2XWAA 1TRNA 3KL6A 1ZTJA 3QX5H 2A0QB 1ANCA 1SLWB 4O03A 2BM2A 2WPDD 1HAXB 1JIMA 1Z6JH 2ALVA 4OS1A 4H42U 8ESTE 2FOAA 1TNGA 4ZUHA 3CS0A 1AZ8A 3M5MA 2BZAA 3RXIA 4NSVA 4Y76A 1VITH 5FL7D 2SNVA 4WMFA 3KQEA 1RTLA 4UDWH 1O2KA 1QA0A 2ZGHA 4NFFA 1SMFE 1MTVA 1F92A 4AYVB 2WPJS 1C1PA 1TQ0B 4B1TA 4WMDA 1E79D 1P57B 2BLOA 9LPRA 4UONA 3TJOA 3F0PA 8LPRA 5LPEA 2XTTB 1FIWA 3FP6E 3UOPA 3A7VA 3VPKA 3B8JA 1MZAA 3A8DA 4B6EA 1HRTH 3GY4A 2FI3E 4Y11E 1TMUH 4X6OA 1QL8A 2Q6GA 4F4OC 2UWLA 1S85A 4AN7A 3OE7D 1K1IA 3TLOA 1AFEH 1OXGA 5C0UA 3M61U 1AE5A 1LHCH 2C90B 5K7RA 3Q3YA 5B6LA 1K9OE 1GMCF 1W14U 1YPJH 3PWCA 1C1NA 1D6RA 6CHAC 3NRLA 1BRCE 3OAAD 3F1SB 3MI4A 4I8JA 4I8KA 1QRWA 1A1RA 3MNCA 2YNAA 4INLA 4VGCB 3BTWE 1UCYH 1UW7A 3LONA 3MO9A 1C9TA 5BRRE 5GNDA 1C5OH 2QC2A 3F9HA 4TSFD 2RCEA 1GJBB 2XYAA 2ZU1A 5F8TA 4X8VH 3UREA 3BTEE 1TIOA 5C1UA 3ZZ6A 3A87A 1FN8A 3FZDA 2ZZUH 2ZFTA 3OY6U 2ZG0H 1C5ZB 3T26A 1O5CB 4GVUA 4LOYH 8GCHF 1B0FA 3WWFA 1IHTH 1HB0B 5GIBA 2BY6X 5L6NH 1AVWA 2IN2A 1Z1JA 5LH8A 2GJGA 3RC6A 3VB3A 3H09A 1V2RT 2AIPA 5AHGH 4YT7H 3E16B 5E8EH 1WUNH 4I8GA 4AGJA 3SGAE 1BMLA 1C5WB 2C3SA 1KXCA 1IQIA 1VGCB 4ASUD 3QDZB 5A09A 1BIOA 4TT3D 1WYKA 1MQ6A 1HXEH 1GBEA 1XX9A 1GJDB 3SNAA 1MTUA 1EAXA 2F3CE 4LK4A 7GCHF 2A31A 3SNCA 3S0NA 1QBOA 2LELA 2EI7A 1WDIA 1D3PB 3LT3A 1O5EH 3SBKA 1MKXK 4D8NA 3U8TH 2A5IA 2ESTE 1SGPE 3DCLA 2PUXB 3DUXH 1O2IA 5F8XA 1BHXB 1O3IA 2QXGA 1NN6A 2BD3A 1JXPA 3PWBA 3SORA 1A5IA 5EPNA 3OEHD 3STJA 3BG4C 1HLTH 2VIVA 2W3IA 1QHRB 1GI7B 1C1MA 4RKOB 1TPAE 4GCHF 2VIDA 1U6QA 5DG6A 4MVNA 4NWLA 4Y7BA 2ZFQH 3LC3A 1E1QD 1OWHA 1QY6A 1Z71A 2C93B 3KYFA 1VZQH 2F9BH 3F2FA 1A0JA 1T7CA 3RU4T 1HAIH 2BX3A 4I8HA 1YYY1 1LVOA 1P12E 3JZ2B 1N1LA 3LH3A 3ZZBA 2GCHF 5E0JA 3EAJA 1SOTA 3LKWA 1A46H 1UTJA 1T4VH 2HRVA 3K6ZA 4MNXA 6LPRA 2ZC9H 3KYGA 4IC5A 1FAKH 1P2OA 5DP3A 3T28A 1HAOH 1PJPA 2A4GA 3GY3A 3FP7E 2TGAA 3BIUH 2BDCA 2VWNA 1O36A 1T31A 2Z9JA 1G2MA 1NROH 1BTXA 3ATMA 5JPMH 4Q7YA 1P05A 5GWZA 5AFYH 4CREA 1E36B 1GJCB 1K1JA 5ETXA 1OWKA 4OS4A 1T8OA 1GJ8B 3MHWU 2FTMA 3VG8A 2JH6D 1BRBE 3H7TA 3ATIA 3EE7A 3GCNA 3FAOA 2BDIA 4NA8A 5JBAS 3N7EA 5DGJA 4K8YA 4MNVA 3U8RH 3F2HA 1MTNB 3C27B 4B2AA 3M5LA 1BZXE 1S0QA 1EAWA 3UIRA 1MABB 3MWIU 1GBMA 1O32A 1FZZA 5T6GA 2ZU4A 4RN6A 4DIHH 1N8OC 1SGEE 1RS0A 5DK1A 1OKXA 2F9VA 2R2WU 3BTGE 1HJ9A 2G55A 2ZHEH 4A7IB 4OGYA 2G8TA 5CHBA 3BTTE 2D26C 1QURH 5C20A 5J4QA 5HM9A 3LPRA 1MD7A 1H4WA 3MU4A 4MQAA 1UK3A 1QB6A 3A86A 4X2XA 3SU0A 1ZHPA 2JJ1D 1PQ7A 1GHZA 5T1VA 1O2LA 4MNWA 3ZZ5A 1B0EA 1ZR0A 2F9NA 3SUDA 1UCYK 2H9TH 3BTKE 1AB9C 3GY6A 4BOHA 1CSOE 1LQDB 1UTLM 3RXMA 1ZLRA 1GCTC 4FUIA 4I7YH 2ZFFH 4YLUA 3PLBA 4ISHH 1Z7KA 4ZCNA 1M9UA 1Y3YA 4K1SA 1GBDA 1ACBE 2A4RA 2P3TB 3N7OA 5A8ZA 4JYVH 1L1GA 5EQSA 3TIUA 3DHKH 2ZEBA 1C2DA 2UUKB 2V35A 1OOKB 2PW8H 5E0GA 3V3MA 2EI6A 3ZZAA 1P0SH 4TY7A 1ESBA 4E7RG 6CHAB 4U2WA 3I77A 4UFGH 2I6QA 1YPHC 4F48B 2GMTC 2CF8H 1S83A 1ID5H 4X6PA 1P2KA 3UFAA 1T8NA 3SU4A 4X1QU 2PUQH 4RKJB 4BTUB 3ATLA 5C5NA 3GCHC 1O3KA 1BMFD 1ZZZA 1WOFA 4AC9A 1JWTA 3DSGA 1OP2A 1COWD 2KX4A 4X8TH 2AHME 4FUHA 1SI5H 5C5OA 4A92A 1C9PA 1O2NA 2B7DH 4IC6A 1JRTA 1RGQA 5EPYA 3V7TA 5A2MH 4LZ1H 1Z1IA 1LHDH 2GTBA 4ABDA 2VU8E 2GV7A 1AU8A 1OWIA 3TH3H 1CE5A 1DICA 1EAUA 4FETA 4AFQA 3S9AA 1TAWA 1SGYE 4PROA 3RMOH 3GISB 2ZDKA 1A0LA 3TPIZ 5A8YA 4Y79A 3F0OA 1PPEE 3A8CA 5T6DA 3RU4D 1O3OA 1TB6H 1J16A 1Z6EA 4Y71A 4B6FA 4F49A 1ZSLA 4ZKRU 1A5GH 1KMHB 3RXFA 3T27A 1NS3A 2V3OH 3I29A 1C5VA 1O3DA 2AIQA 3U1IB 4ZROA 4DT7B 1W0YH 2FX4A 1FI8A 1BTWA 1NC6A 2ZA5A 3UR9A 2FLBH 2IOTA 1A7SA 4OS2A 1C1OA 1NFXA 2UUYA 1C5UA 2QGRA 2RDLA 1OS8A 1NRRH 1YM0A 3GYMA 3GICB 1Y8TA 1L0ZA 1BJVA 1UMAH 3PO1B 5FAHA 1NT1A 2XOKD 2Y6TA 3RU4E 2O8MA 2B9LA 2R3YA 1H8HD 4JZIA 2ILNA 1ORFA 1OYTH 1IQFA 3UTUH 4XDEA 3JZ1B 2ZU5A 3LGYA 4NA7A 5AFZH 1DT2A 5T3HA 1GJAB 4YLQH 1AKSA 1O2ZA 1FY5A 3S9BA 2ZNKH 4ABHA 4SGBE 2RG3A 2HLDD 2R0KA 2GCTC 2HPQH 2ZIQH 4Q7XA 3P8GA 5AF9H 1W10U 1YPMH 5EQQA 2SGDE 5DJ7A 2GD4B 1O2UA 4E06H 1X7AC 2GDDA 4XD7D 3A7XA 5GCHG 1V2NT 1K1MA 1AB9B 1F0RA 1JOUB 2ZPSA 1S81A 2ZCLP 2QE7D 3CP7A 2Z6BD 3PO1C 1GHBF 4IS5A 5EXNA 5FX5A 5JBTA 2GZ8A 1QTFA 3A82A 5EODA 1A0HB 2YMSD 1P06A 1HJAB 3U69H 4BANB 4CR9A 1UVOA 5ESBA 2ZDVH 1TPSA 1NM6A 4DY7B 4HFPB 1W7GH 2Z3EA 2W7SA 4A1XA 2GMTB 2BQ7B 1BTUA 1ELVA 1C2MA 2VJ1A 3RXPA 1VKYA 1TBQH 4NIXA 3AAUA 1BTPA 1KXBA 1DWDH 1OWJA 4ABJA 1TA2A 1VCWA 2WPMS 1SGQE 1Y3XA 2M5TA 4INKA 1S6LA 1J8AA 1RTFB 1C5MD 1L1JA 2XCFA 1TOCB 1FDPA 1O3AA 3VB5A 1EZQA 1MCTA 3FFGA 4OM9A 3FN8A 3GYLB 4INHA 1V2MT 3TU7H 3PYHA 4UFFH 5FPSA 1OSSA 2JKHA 1TGTA 1EPTC 2XNDD 4J2YB 1YPGH 1GBJA 1FY1A 2C8ZB 4K1EA 4DW2U 1HPGA 2CGAA 2K1QA 1FMGA 2NU0E 1WBGB 4MPUA 1GBTA 1AIXH 3BF6H 3A85A 4FXGH 3MH5A 4ZHLU 4ZAEA 2ZFPH 1YCPK 2BX4A 3MH6A 4NG9H 6ESTA 3QWCH 4HGCA 4CBNA 1N8OB 1P3EA 1ELGA 1AZZA 3QLPH 1G30B 3O8DA 1GBHA 1EB1H 1GMDF 1V2LT 4AG2A 2OUAA 2JETB 2FI5E 1W12U 2TGPZ 9ESTA 2VVUA 1KLJH 3NWUA 2FYQA 4BXSA 1GJ5H 1LHEH 3U28C 1MTNC 2BZ6H 3U8OH 2BD4A 3BEFB 3LC5A 5GPIB 1Y5AT 3TK6A 3URCA 2J98B 2WSSD 1VJ9U
chains in the Genus database with same CATH topology
1SC8U 3ZYDA 1IQEA 1S5SA 1O2PA 3UWJH 4ZHAA 2VIOA 4TWWA 1SB1H 4TYDA 3LGWA 4RSPA 1ETRH 4AFUA 3SUGA 1O39A 1IQNA 1C5SA 1BHXF 1A61H 1ZRBA 4Y6DA 3URDA 2ZTZA 2HNTC 4X6MA 4AZ2B 2A7CA 3SU1A 1J9CH 3EA9A 2FZZA 4BAKB 1MBQA 4IMQA 3IITA 5GCHF 6GCHG 2Y5FA 2GCTB 3TNTA 2FESH 1BCUH 3EYDA 2O8LA 2QXHA 4ZKSU 4CHAB 1FIZA 1TMBH 1KDQB 3TH2H 1FNIA 4FUCA 1P03A 4FUFA 3RMLH 3SNBA 1ETTH 3GY5A 2QCYA 1IHSH 4Q2KA 1IOEA 1KXFA 2VINA 3A8AA 1LPZB 4ABBA 1P3CA 1Z8RA 5C67A 5GXPA 2P59A 3M3SA 1RFNA 2A4OA 2AMQA 5FX6A 1FV9A 3FZZA 2UUJB 1A3BH 3P92A 4YT6H 1AI8H 3UQOA 4YOIA 2VIQA 3ODFA 2R2MB 3IG6B 1DX5M 1SOZA 3A88A 1TNIA 1XMNB 3SUFA 3ZVGA 1IQHA 5GDSH 2Z9GA 3F9FA 1NFUA 3G01A 1ABIH 1THPB 3TNSA 1GVLA 1WTHD 2G4TA 2BOHB 2W26A 1BMAA 1ELEE 1AO5A 1QL9A 2QXIA 2BOKA 1BMMH 1LQEA 5DP5A 1AFQB 1O5FH 3D62A 1ZPBA 1GHXH 4LXBH 5LPFA 2CHAB 4WVPE 4ZKOU 4ISIH 4BAMB 1IQJA 2PKAA 3E0NB 1AWHB 3Q00A 4NIYA 4B76A 2HPPH 2BQWB 1DDJA 2TGDA 5IDKA 1TPOA 1G3CA 1O2HA 4O3TA 3PLKA 1O2RA 3MH7A 1XUJA 1ELCA 1AMHA 2WUCA 2A1DB 3MMGA 2O9QA 3ZV8A 3GDVA 3K65B 4R0IA 2BXTH 2XBYA 1SL3A 3TK9A 3ENSB 5EXMA 1H8DH 1SSXA 2PKSB 2STBE 1AUTC 2C4FH 3M7QA 2VIWA 3SU5A 3HKIB 1GL1A 1TBRH 3KIDU 1NO9H 2A5KA 5JBCS 1CU1A 3A81A 1ZMNA 2AMPA 1GI3A 1K1LA 3PMHB 5CMXH 2ZQ2A 2AEIH 4WH6A 3RC4A 2XBXA 2PHBA 5FXLA 4D7FA 2Y81A 2FOMB 1MU6B 1ARCA 1GI0A 2P3FH 2J95A 1F0TA 4BTIB 1O3PB 2B5TB 1DFPA 1UVPA 4YOGA 2GP9B 4YOJA 1LPGB 1HAHH 1V2OT 5HMAA 2FOBA 4ZXYH 2CXVA 4O9VA 3SZNA 1MAYA 1A4WH 2DUCA 4XSKU 4ZH8A 3NK8A 2AGIX 3EDXB 4ISOA 4X1NU 3TVJB 2A4QA 2OP9A 1BBRK 2HWLB 4OGXA 4HI3A 2GT8A 1PYTC 1TALA 3A7ZA 1UTQA 3MFJA 1KIGH 4GPGA 3SJ9A 1OWDA 4BAOB 2ZPQA 1GBAA 3B9FH 2GCHG 1TGCA 1OPHB 2CMYA 1TGSZ 1EQ9A 1OYQA 2YOLA 4DIIH 3O8BA 4KTUA 1NZQH 3B23B 4NIWA 1O38A 1GGDC 1YKTA 2Z3DA 2R3UA 4TPYA 3R3GB 1J15A 1MD8A 2HVXA 4E7NA 1BOQA 3HATH 2H9EH 2FIRH 5B6OA 3TGKE 2UWPA 2P16A 2ZDAH 3FP8E 2NU2E 5J4SA 1YGCH 2EEKA 1IAUA 3ZZDA 2OBQA 1MBMA 5FHTA 2B0FA 2ANKH 1HIAB 5AVDA 3K6YA 2J2UA 2Z94A 2CF9H 1V2QT 2NU3E 2BDBA 1TNLA 4K60A 1SHYA 1ANDA 1E35B 6GCHF 2BD8A 3KQCA 1KTSB 1P01A 2WYJA 1C5NH 1SFQB 3RDZA 1LTOA 2WV4A 3M5OA 1Q3XA 2VWLA 3KQDA 4FU9A 3SQEE 1FONA 3LGTA 1D3QB 1DE7H 1HXFH 1XUIA 1CBWC 2P8OB 1KXAA 3QGJA 2TGTA 3RXAA 1C5PA 4YESB 1UO6A 1WTGH 1PPFE 1K1OA 4NZQA 1TBZH 2GZ7A 1T8LA 1XKBC 3A7YA 1ELTA 4KTCA 1H9HE 2ZKSA 3E0PB 2OC0A 1TNKA 1TRYA 2TRMA 4NA9H 3RXBA 2FWWA 3GCHB 1P9SA 1ZRKA 2Y80A 3Q76A 1P04A 4DJZB 1UTKA 3I78A 1Y59T 4XE4A 2GVFA 3BEUA 4FU8A 4O97A 4AORA 3D49H 4UE7H 5C3NA 3QTOH 1C2KA 4IBLH 4DVAU 1HJAC 1V2ST 1C5RA 4NSYA 2HGTH 1XXFA 1AD8H 1YLDA 3OSYA 3RM2H 5BPEA 1CHGA 2G5NA 1V2WT 3MH4A 2XCNA 2OTVA 4XBDA 1W3CA 3RXJA 1CA0C 1EJAA 5CHAC 1O5BB 4ZMAH 2CN0H 1EATA 1LMWB 1LVBA 1QCPA 2ZP0H 2ZI2H 2OINA 4JZFH 4NCYA 2A2XH 1Z8JB 3VGCC 1H9LB 3RM0H 1XUGA 4MDSA 2G52A 1BBRE 2ODQA 4UEHH 1MKXH 1F5KU 4WY3A 4Y0YE 1HFDA 1GWAA 5C2ZA 2J92A 1EXFA 1HYLA 1P2IA 3OYPA 1RTKA 3BTHE 3ZZ8A 1LVYA 1DS2E 1GMCG 1HAYB 4BXWA 1UHBB 1DWCH 4UD9H 3P6ZB 2SGEE 3AASA 4CH2B 2RA0A 3PMBB 4MPXA 1V2PT 2SGAA 1WU1A 1QJ7B 3DT0H 1HBTH 4SGAE 3MNBA 1GDUA 2SGQE 2J9NA 3HK6B 2GZ9A 2STAE 1S82A 2KAIA 1V2KT 1NU7B 1TLDA 3KEEA 1GMDG 3CS7A 1IQLA 3UR6A 1EASA 1ZHMA 1NRSH 5HXFA 2Z7FE 1DWBH 2W3KA 1K28D 1MCVA 2QY0B 2WV5A 2F9UA 3ATWA 2ZGXH 3E1XB 2PGQB 1YPHE 1DXPA 7KMEH 1IQGA 3MTYA 2ZU3A 4X1SU 1HAGE 1ELDE 1UK4A 1DPOA 1D9IA 2OLGA 1NY22 1Z8GA 3O8CA 5EGMA 1PFXC 1P2MA 1SGFG 1WV7H 1FY8E 2P3UB 1F5RA 1O3GA 2QV1A 2WPLS 3AAVA 2OCVB 4U30A 4X0WU 2Y7XA 3A7WA 4WF8A 3RMMH 1DLEA 3RXRA 5FBEA 4J1YA 1ZHRA 3MO3A 1Y3WA 2J34A 2AGEX 2VH0A 3P95A 1ZYOA 3IWMA 2P94A 1ZSJA 1HAZB 1VITF 1BQYA 1O3HA 1O2MA 1O3EA 1XVOA 3M3VA 4U01A 3RXQA 3SHAH 2ANWA 5G4BA 1UK2A 1JMOH 1G3DA 3BTME 3SJ8A 1CBWB 3AW0A 1EKBB 3PLPA 2VNTA 2ZHQH 3ELAH 2PKSC 2QAAA 1D6WA 3GY7A 1SQAA 1C5QA 2Q6DA 2G81E 3EA7A 1AGJA 3RXOA 4Z6AH 1SGNE 3LGIA 1SBWA 1WQSA 1GCTB 3PTBA 1XUFA 4R8TB 3SN8A 2ZHWH 1C4V2 1UTMA 5C1YA 4X2VA 3P17H 1DLKB 2VVVA 2W5EA 3MU0A 4HTCH 4AX9H 3BIVH 4XBBA 4AB8A 3MU8A 4WXIA 3PMJA 4LZ4B 1DM4B 1GJ9B 1RIWC 3HKJB 2A32A 3QN7A 3PMAB 2TPIZ 3SV2H 1N6XA 1LCYA 3RP2A 3SI4H 2PLXA 1T8MA 4AYYB 1OP0A 1C5LH 2OQUA 4CHAC 1O2VA 4A6LA 2Q1JA 4HZHA 1O3FA 3A89A 1EJMA 4YZUA 4AG1A 4CBOA 4Y8YA 1UCYE 4I33A 4D7GA 1O2JA 2O8UA 1K1PA 1KXDA 5EW1H 4A1TA 1HAPH 3SV6A 2FDAA 2IPHA 1QRZA 3HK3B 2CJIA 2ULLA 1P11E 3LH1A 1FLEE 1GL0E 1V2JT 3BEIB 1QBVH 3LOXA 4B75A 4WH8A 1SQOA 3LGUA 1DVAH 3P8NA 4GSOA 1C1WH 1MTWA 3SHCH 1HAVA 4FUJA 4ABGA 1EZSC 2AGGX 5A8XA 1EZXC 1C2LA 1ANEA 1QJ6B 1K21H 5F8ZA 2FO9A 2VWMA 2ZO3H 1GCDA 3RUOA 3QZQA 2JH0D 2AS9A 3T2NA 3W94A 2BD5A 3H7OA 1G36A 5DP4A 3VB7A 1C4U2 4ISLA 1C1QA 4B73A 1MU8B 3K2UA 1YP9A 2Z9LA 1SVPA 1HV7A 2VWOA 1TRMA 2IJOB 3BN9A 3S9CA 1IQKA 1GVKB 1C5TA 1HUTH 3NKKA 1PQ8A 1NPMA 2ODPA 3M3TA 2ZU2A 1S84A 1NFYA 2BTCE 1FY4A 2OC1A 2RA3A 2WUBA 1C2JA 1DY8A 1V2VT 3FANA 4H6TA 1S6HA 2FOEA 3E3TA 2FI4E 1C1TA 5I25A 4JK5A 1CT2E 4A1VA 1Y5UT 1DITH 3MOCA 1KY9A 2XXLA 1PQ5A 2FMJA 1TGNA 1ZTKA 1H1BA 4OS5A 1C2HA 1KSNA 3SJIA 2ZWLH 5ABWA 1C2GA 1UVSH 1SGRE 2J4IA 3BSQA 3GCOA 1YPLH 3KHVA 2VIPA 2QF3A 1RRKA 5CHAB 1PPBH 1ZMJA 3VXFH 1EB2A 4DURA 1AFQC 3PM3A 4ZXXH 1XM1A 1RJXB 2SNWA 3VGCB 4I8LA 1AQ7A 1DANH 1GJ6A 1ZPCA 1TE0A 1AUJA 4UFEH 3UNRA 4KGAA 2DE8A 2NU4E 5HM2A 4ZKNU 2H5CA 2Q6FA 1DUAA 4DOQA 3DFJA 2GKVE 1DSTA 3PV4A 1C5XB 4B74A 3TITA 4CR5A 5DP8A 1EUFA 5K0HA 1QB1A 3T5FH 1ETSH 2WPKS 1GHWH 4KKDA 1L4ZA 2H9HA 1ZTLA 3TGIE 5GJ4B 1W11U 1GGDB 3D65E 2JETC 3SV8A 5F6MA 3LIWA 4Y0ZE 1FPHH 2GT7A 2XWBI 2HLCA 1ABJH 4D9QA 1GBIA 1AVGH 1AWFH 2BQ6B 3Q77A 4FUDA 1OWEA 5TCCA 1FN6A 5A0AE 4BNRA 3Q3KA 2F9PA 1TA6A 4FU7A 1BITA 2D2DA 1TYNA 4KELA 5EQRA 1YCPM 2PR3A 3F6UH 5DP7A 1O2GH 1GBFA 1TWXB 1MZDA 3EA8A 1O2OA 2C8XB 4E05H 3KF2A 1CO7E 3VFEA 1FQ3A 1YBWA 2FM2A 3SU6A 5JB8S 1EZUC 2ZGCA 1S0RA 1V3XA 2GDEH 1GBLA 2PSXA 4IW4E 5H4IB 2VB0A 2PTCE 1C4Y2 1H9IE 2B8OH 1HJ8A 1MQ5A 4Q7ZA 2ZFRH 3RXTA 3CENA 5EG4A 3MNSA 1J17T 1YF4A 1W8BH 1GHAF 2BLQA 1TFXA 2F83A 1E34B 2V3HH 1HIAA 3E90B 3ZVEA 1P9UA 3E8LA 1VITG 2GGVB 4JZEH 2HNTE 2QF0A 1FPCH 2C8YB 4TY6A 5FBIA 1F0SA 1PPZA 3P8FA 3STIA 4GCHG 1B5GH 3OX7U 3RXDA 3ZV9A 2ZPRA 3S69A 4IN1A 3DA9B 3RXKA 1GG6C 2F91A 1QGFA 1O33A 1CQQA 1GI4A 2XC5A 3H5CB 1QL7A 4WXVA 1O2WA 1CHOF 2Z3CA 5FCRA 1SFIA 1BRAA 1QR3E 5DP6A 5JYIA 1BTZA 3ZVDA 3A8BA 1V2UT 4K69A 2XNIA 1O30A 2WPHS 2XRCA 3LGVA 3M35A 1TPPA 2THFB 1ZSKA 2ZFSA 1SLUB 1DOJA 1GBKA 5HYOA 1O34A 4WWYA 7GCHG 5DKMA 3SO3A 1L4DA 3RXGA 2G4UA 2QN5T 4MNYA 1GI9B 3U1JB 3T25A 3M36A 1TX6A 1PPGE 1ZJKA 2ANYA 2BLVA 3M5NA 4ABAA 4ESTE 3AVZA 1NTPA 1ZOMA 1V2TT 4Y8ZA 3SNEA 1BJUA 1QFKH 1SPJA 7LPRA 4NIVA 3TK5A 1G9IE 1IQMA 1JBUH 5L2YH 1DY9A 2FTLE 2BY8X 1G37A 3SW2B 2H6MA 5JDUB 1C5YB 4TWYA 1OX1A 2P8OC 2FP7B 1G32B 3SUEA 4AFSA 2BVRH 1GHBG 1O3MA 1O2QA 3EE0B 4IN2A 3ZVBA 3BG4B 3V0XA 4XBCA 4CRDA 2VGCB 1NRNH 4Y10E 3GCTG 1GPZA 3GY2A 1D3TB 5FCKA 1GI8B 1MMJN 2BD7A 4ABEA 3A7TA 3LU9B 4U32A 2BMGB 3TJVA 4CRGA 1KLTA 1NRQH 1LPKB 1AKSB 3A80A 4X2WA 4X6NA 2ANMH 1C1RA 2ALPA 1NU9A 4MPVA 5EW2H 1MH0A 2PV9B 3ODDA 4NWKA 3PB1E 5L2ZH 1BTHH 1CT4E 3UWIA 3SJKA 3HGNA 3KNXA 1O3BA 2KAIB 3MO6A 4IMZA 3RMNH 1QBNA 2BD2A 1NFWA 2ZHDA 1EPTA 2ASUB 1VCPA 2JH5D 1D4PB 1HDTH 3F68H 3AW1A 1TNHA 1SGIB 3SGBE 3LDXH 1CT0E 1O5DH 4QT8C 1BUIA 4DGJA 2QIQA 2FPZA 4JYTA 1LDTT 2QYIA 1O37A 4NZLA 2ZGJA 2ZECA 4FUBA 1YC0A 2SFAA 4WMEA 4X1RU 1SGCA 3ATKA 3QTVH 2Y5HA 1ESTA 3T29A 3OTJE 2LNCA 3BV9B 4K8BA 3F9GA 1GI5A 1O31A 2WINI 5FPTA 3SU2A 2HNTF 1XXDA 1BB0B 2EC9H 1B7XB 2O8TA 4AGKA 5ESTE 3ZZ7A 4NFEA 4XOJA 3OU0A 1W13U 3MU5A 1PPCE 4FVBA 4JZDH 4MLFB 5A0BA 1MTSA 1QQ4A 4AB9A 2C8WB 1SLXB 1LVMA 4GAWA 5IYTA 3L6PA 1UVUH 1ELBA 5HGGA 1TX7A 2BVSH 4IGDA 1P10A 4BTTB 1BRUP 1W2KH 2YNBA 4JYUH 2BY7X 3KQBA 4ZHMU 3ZZ4A 1GJ4H 3E91A 4THNH 3D23A 1MKWH 2G00A 5L30H 1DWEH 1THSH 2A2QH 3NCLA 3VB6A 5LPRA 1O2XA 2BXUH 1XVMA 1ZJDA 4KP0A 2F9OA 3NPSA 4OS7A 1L2EA 4K2YA 1SLVB 3QGNB 1O2YA 3GDSA 5JB9S 3UUZA 5E2PA 1F5LA 1C2EA 1TOMH 4K1TA 3T62A 5DP9A 1BA8B 4BAQB 3NXPA 4Z0KA 4B2BA 2H1UA 4B2CA 8KME2 2BD9A 1SR5C