1V2WT

Trypsin inhibitor in complex with bovine trypsin variant x(ssai)bt.b4
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSAIITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Understanding protein-ligand interactions: the price of protein flexibility
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 49
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2wT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2wT02
1A0JA 2XW9A 3P92A 1NU7B 1LVMA 1SQAA 2GKVE 3MU8A 1YC0A 1BHXF 1YGCH 1TGSZ 2VJ1A 2F9UA 4Y6DA 1GG6C 3MWIU 2FZZA 2OC1A 5PTPA 5A0CA 4ABFA 2D26C 2NU4E 1V3XA 2A2QH 1EB2A 1IQKA 1TPAE 2ODPA 3E3TA 3RXDA 1O3OA 2FS8A 3Q3KA 4YTAA 3WY8A 4FUCA 1YPKH 2HPQH 1JRSA 1O3HA 4D9RA 2THFB 1O5AB 2ZKSA 2OQ5A 3S0NA 5EG4A 5GXPA 3A86A 1Q3XA 1OWJA 5FPSA 3K6YA 1ARBA 1SR5C 4U2WA 2ZQ1A 4YT7H 3ZVAA 3STIA 1ZGIA 4DGJA 1RIWB 1C2IA 2WUBA 1NO9H 2PSYA 1P0SH 1A0HB 1FY8E 1ZTJA 2IPHA 1AHTH 2ZFFH 4UEHH 1NFXA 1O2RA 1SGIB 5DP4A 5L30H 1T4VH 3LGIA 2TGPZ 4FUEA 3W94A 4XSKU 4IN1A 4J2YB 3LGWA 2JH0D 3MH4A 1FDPA 1L1GA 3SU0A 5DO4H 1SGRE 4HFPB 1XVMA 2OTVA 1G32B 3T27A 1WQSA 1F5LA 1P2IA 1UHBA 3AAVA 2QC2A 2ZTZA 3GICB 1VITF 1MZAA 4OS2A 1ELVA 1EP6A 4I33A 2HOBA 1LMWB 1TB6H 4Z6AH 1O33A 1KYNA 3RU4T 7GCHG 2FO9A 3Q00A 1WQVH 3DA9B 5EPYA 1TBQH 2Z9KA 1O3JA 3ZVFA 5E2OA 5DG6A 2G51A 1ZRBA 2ZZUH 2A5AA 3EA9A 1QB1A 2O8WA 1ZLRA 3UQVA 1GHBG 2H9EH 3KF2A 1GCTC 3ZZ6A 5L6NH 4FUHA 1K1MA 3ITIA 1O5DH 3QDZB 1HLTH 4KGAA 1Y5UT 3MNSA 1TX6A 1ZSLA 1F0RA 3P70B 4MTBA 1SG8B 1NFWA 2WPMS 3EGKH 3V12A 3ATWA 2ZDLA 5FX5A 3PYHA 2BTCE 4X8SH 1TALA 1HB0B 1WTHD 4DCDA 3ZZ3A 1TAWA 2SFAA 2PUXB 3RXFA 1FZZA 2OCVB 2ZDKA 4NWLA 9ESTA 3MH5A 4X6PA 2ODQA 3M5LA 1SOTA 2H5DA 1G3CA 1W2KH 3GYMA 1ZHMA 2GZ8A 1O5GH 3BN9A 1THSH 1BBRK 1BHXB 2G5VA 3A88A 3RMLH 1MAYA 3P8OA 1GHAF 2H9HA 2PR3A 2GZ7A 1JXPA 1O35A 5E0JA 3P6ZB 3M7TA 4M7GA 5I46H 1KY9A 1T8NA 1O2VA 1GJ9B 1DWEH 4WH6A 5LPEA 1CE5A 1N8OB 1CGJE 1CA8B 2SGFE 1F0UA 1FY3A 2FDAA 1BZXE 3M7QA 5FCRA 1AWHB 1RFNA 2R0KA 2SGQE 3B9FH 2RA0A 1FQ3A 1O38A 1O2ZA 1XXDA 1F7ZA 1KDQA 3FVFB 1MTUA 5HM2A 1DM4B 1TX7A 1C2LA 3ZZAA 4JZFH 1Y3XA 5GPIB 4CBOA 3TVJB 3NK8A 4AG1A 1ANDA 4TYDA 2BX4A 4D76A 3RXSA 1CHOG 3GCHB 4MPWA 1C5SA 1P09A 1SHYA 3BTTE 1BRUP 3STJA 5F8XA 2ZDAH 3A7VA 1HAVB 3ELAH 1QBVH 1W8BH 4FXGH 3RLYH 4Y0ZE 3I77A 2J2UA 5AFZH 1C4U2 1QIXB 2K1QA 3T2NA 3BF6H 1XUKA 1E0FD 4DURA 1TMUH 2GCTB 4SGAE 4FUIA 1O3BA 1S5SA 2A2XH 2P94A 2ILNA 1C1MA 1C5YB 2AGGX 1C4V2 3PB1E 7GCHF 1NFUA 2XRCA 4TY7A 3S7KB 2OINA 1MKWH 2GTBA 2UUKB 5AVDA 2ODYB 4ABHA 5LPRA 4E06H 4XDEA 1UVTH 1YBWA 3VXEH 4DJZB 1DUEA 1LPKB 2QY0B 1H9IE 2FM2A 1AGJA 1P2KA 1C2KA 2Z9JA 1GJ4H 4Q2KA 2FMJA 2G5NA 1EB1H 1GHBF 3H5CB 1TNHA 3PO1B 1GVZA 4AFUA 1D6WA 1P9UA 1E36B 3TK5A 2FLBH 4YOIA 1EZQA 1UVOA 2J4IA 2ZU1A 8KME2 1AZZA 1DFPA 2AYWA 2BLWA 1AKSB 2ZGXH 2BDHA 3BTWE 1BBRH 4B75A 4R8TB 4IW4E 2C3SA 1YP9A 4Y71A 2XCFA 4VGCC 2ANYA 2CV3A 1RS0A 1YPMH 2OUAA 3PM3A 1SGPE 3IWMA 1W3CA 1GI6A 1PFXC 3HPTB 1O5BB 5E8EH 5FPTA 3GCTF 1DY8A 2Y5FA 2PGBB 3V7TA 1GJ7B 1H4WA 4X8VH 2ANMH 4AOQA 2TBSA 5DP3A 1ARCA 1IQFA 1HAYB 3P17H 4SGBE 2BY9X 3M3VA 1XVOA 1DWBH 1TWXB 1ZJKA 4B71A 3SZNA 1O3EA 1EJNA 1O3MA 2BD5A 4CBNA 1P02A 5HXFA 2PW8H 2ZU4A 2FOHA 2Z9LA 3P8NA 1YPEH 3RDZA 3RC5A 3UPEA 1SPJA 1HGTH 1AFQC 1UVUH 3TJVA 3P95A 1OPHB 1G2MA 2BY7X 2GGVB 2SNVA 3OY6U 4GLYA 1ZTLA 3LJOA 3LDXH 1BQYA 3KL6A 3SN8A 1TNKA 1VZQH 4ISHH 2M5TA 1UTPA 1GJ6A 1CO7E 1GMHG 2AERH 1SVPA 3VB4A 4CRBA 1C5ZB 3AW0A 1UJ1A 3SI4H 4U32A 2GCHG 3GDSA 3V13A 2BD7A 1IQLA 3ZV9A 5EPNA 4K8BA 3CENA 4KKDA 4XOJA 1WBGB 1DUAA 1P01A 9LPRA 5T6DA 1DANH 1AI8H 2I6QA 8ESTE 1BUIA 1CHOF 1JWTA 3MU0A 1E34B 2WPHS 1F0SA 4MNWA 2QA9E 2O8UA 1EASA 4Q7ZA 3ZV8A 1JMOH 1UTMA 3M5NA 1IQGA 6CHAC 2A7HA 1OP0A 4FU7A 2BDAA 1DSUA 1GBKA 5EW1H 1A3EH 1OSSA 2ZG0H 3M37A 4RSPA 4X1QU 2OP9A 3MTYA 1MAXA 1TGTA 4IGDA 1W14U 3F1SB 1O3PB 2AGIX 3M7UA 1BTPA 3FAOA 1HAPH 2Y82A 1BA8B 1O31A 4I8GA 1PPZA 3Q76A 2Q1JA 2TIOA 2BY6X 3A84A 1DY9A 1C2JA 4UE7H 1BIOA 3T26A 1NFYA 1ABJH 4GUXA 3TK9A 1C9PA 2FLRH 1K1OA 2PUQH 1O3NA 2Q6FA 3A7YA 4ZKSU 4UFEH 1EXFA 4NG9H 5ESTE 1G37A 4BNRA 5C1UA 5JBAS 1SLXB 3ODFA 2D2DA 4GHQA 4NFFA 1KTSB 1IQJA 1QJ6B 1SQOA 4KELA 4CH8B 4BAOB 3MI4A 2W7SA 2JETB 4FVDA 4A1TA 1MBMA 1J16A 4MNYA 1L2EA 3QX5H 3GY3A 3ZZ8A 1SGDE 1GMCG 1IQHA 4JZIA 1ELFA 1BTUA 2VWNA 4IMZA 3G01A 1SL3A 2BMGB 3A85A 1ZJDA 4QT8C 3LGTA 1OXGA 5LH8A 1MUEB 1S82A 1L1NA 4ABIA 1GBBA 1Z8RA 1RIWC 4CRCA 1N6YA 3EDXB 5FPYA 1ZSJA 1PQ8A 2AFQB 1O2NA 3LC5A 1O2JA 4NGAH 2ZC9H 2FOBA 2FWWA 1T4UH 1MH0A 1F5KU 5HMAA 2WV4A 4WF8A 3E6PH 3PMAB 3Q3XA 4LZ4B 3TITA 1A5HA 2R3UA 1J17T 1GJ8B 3OX7U 1NRQH 1G30B 3ZYEA 1WUNH 3QGNB 1LPGB 1HAHH 4I7YH 2ZU3A 4AB9A 2ZPRA 4AGKA 1SBWA 2OC0A 2BXTH 4D7GA 3KCGH 2CGAA 3EE0B 1DX5M 2LPRA 1C1PA 3QZQA 4A1VA 1VCWA 2Z3EA 3T5FH 3UFAA 1MMJN 3RXPA 5EOKA 2A32A 3D23A 4THNH 5JBTA 1NC6A 3LGYA 1AIXH 1NM6A 3RP2A 1EPTB 3RXLA 2B9LA 4Y8YA 3SO3A 4CH2B 1ZHRA 1IQNA 1TMBH 3T62A 1DPOA 2BLOA 1V2JT 4FU9A 1MTWA 3FZDA 1V2RT 2W5EA 1AFEH 2DE8A 2R9PA 1GI1A 3BG4B 1G36A 1F5RA 2BLQA 4FUDA 1H9HE 2BD4A 3MOCA 4U01A 2CJIA 3BTKE 3T29A 5T3HA 1O37A 1G3DA 4X2YA 2VIVA 4MG3A 5GDSH 3VPKA 5CHAB 1HAZB 4D9QA 3UNQA 1O3FA 4MPXA 1VGCB 1BB0B 1IQEA 2BQWB 2BD9A 2XC4A 3OTJE 4A1XA 4GAWA 1N6XA 2J95A 5EXLA 3NCLA 4I32A 4K1EA 1L1JA 1XMNB 2ZECA 4O3TA 2V0BA 4CRGA 1P04A 2P16A 1IHTH 1CA0B 1MD7A 4AFSA 3TGJE 1MTNC 2AMDA 1GHVH 2V3HH 1N8OC 1FXYA 1C5MD 1QL9A 2P93A 1V2KT 2XTTB 4H4FA 1C2MA 3TLOA 1GMCF 1SB1H 1HBTH 1HJAB 2QXHA 2J38A 1QRXA 1C1NA 1KLJH 2BQ6B 2OXSA 2ZP0H 1K1PA 4FUBA 1KXCA 4I8LA 3BV9B 3GDVA 3PLPA 1AUTC 4KTSA 4NSVA 2QXJA 2VB0A 1QQ4A 2QCYA 2QV1A 3MH7A 1OWKA 3TJOA 2ZEBA 1BTXA 1AY6H 1Z71A 1V2MT 3GCHC 4ZAEA 3SJOA 1QB9A 5BRRE 2ZQ2A 1O2MA 3U9AH 1PPFE 1SOZA 2UWPA 1GI5A 4NIWA 3DT0H 4ZROA 3ZZ5A 1HNEE 3FFGA 2XYAA 2G55A 4RKJB 4JZ1A 4A5TS 2AH4X 1NPMA 2B8OH 5IYTA 2AIPA 1C1QA 5DP8A 3M36A 4JK6A 3BTFE 1UK3A 4Y7AA 3F9FA 2GCTC 3SV9A 1YPHE 7LPRA 4OS7A 1BDAA 2ZF0H 5LPFA 3ATMA 3RMMH 4GCHG 1UTLM 1ELEE 1EP5A 2R2MB 3OYPA 4CHAB 3QZRA 4B74A 1GGDB 2G52A 5EQQA 4AFQA 1W10U 4WH8A 3ZVBA 2UWOA 1XM1A 4TPYA 4CRDA 1DT2A 1GHYH 3A81A 3HKIB 2F9OA 8LPRA 1B7XB 2CHAC 4OGXA 2BY5X 4ABAA 2ZHDA 2VWOA 4K3JA 2GDDA 3E16B 1B0FA 5L2YH 1HAGE 5FBEA 3VB5A 1K1LA 3PO1C 2ZHWH 4H6TA 2FP7B 4A92A 3F9GA 4BXWA 4IMQA 3RXQA 1ETSH 4KTCA 6GCHG 3I29A 4ZKOU 1NRPH 3JZ1B 3LH1A 1ESBA 1TGNA 1SMFE 1F2SE 1W7GH 5DP9A 1UTNA 1RXPA 2Y6TA 4ZKRU 1UHBB 3M3TA 3RLWH 2W26A 1NRSH 4D8NA 1T7CA 1MTVA 1DDJA 3MO6A 3ZYDA 1FN8A 2A45B 2G81E 1QHRB 3GY4A 1MKWK 4ABGA 2A4RA 4LK4A 1HXEH 5CMXH 3LIWA 2XBYA 1S81A 2J34A 4PROA 3LGVA 1BTZA 2FTMA 3RXIA 1BRCE 1AE5A 1NY22 1HPGA 2D1JA 4X1RU 1PJPA 5DP5A 5EQRA 4X6MA 3AAUA 1RTLA 2BVRH 4JK5A 4OGYA 3U1IB 1TRNA 2WPLS 4X1SU 1XUIA 2EEKA 1E38B 1FY1A 1GBEA 1MKXK 3SUFA 1DSTA 3TPIZ 2FI4E 3U8RH 3GOVB 3V3MA 4AORA 1P2NA 4FVBA 1KXDA 5FAHA 1D3TB 1VJ9U 2EI6A 2G4UA 5DP6A 2C8ZB 1AU8A 2VGCB 1EZSC 1GBHA 5GJ4B 2FX4A 1YLDA 3SU6A 3HGNA 3SU2A 3NZIA 5A0AE 5JB9S 1HRTH 2AMQA 1GBDA 4OS4A 1ZYOA 3CS0A 1ELAA 6LPRA 1FPCH 2FTLE 4ZKNU 3TJNA 1PPBH 3E91A 1C9TA 4WMEA 2BZ6H 4H42U 3K2UA 1A61H 4RKOB 1GJ5H 4TPIZ 1DITH 1YLCA 2WPJS 2KAIB 1AE8H 2V3OH 3SORA 1LDTT 4E7RG 1ESTA 2NU2E 3QWCH 4UFDH 1KXFA 1J9CH 1HIAB 1N1LA 1G3EA 2H9TH 1NS3A 1P10A 1O5EH 2F91A 2BDYA 2B5TB 1NTPA 1A2CH 3RXJA 1C5RA 1V2OT 1ELCA 4E7NA 1D4PB 2BQ7B 4MQAA 1FLEE 1YM0A 1C5PA 2CXVA 1WV7H 1GG6B 2C90B 2GT7A 2OD3B 4INLA 1YCPH 3F6UH 1UO6A 2OBQA 4INHA 5A8ZA 1H8IH 4ISOA 2VU8E 3VB7A 3S7HB 3VGCC 1MCVA 3SI3H 1KDQB 3A8BA 5JYIA 2OC7A 1IHSH 3UREA 5K0HA 1YKTA 4B73A 3KNXA 8GCHG 2XBXA 3RC4A 1AZ8A 2BB4A 1V2VT 3A80A 4OS6A 2Q6GA 2J92A 4NA7A 2XCNA 2B7DH 4Y8ZA 5E0GA 3U1JB 3MHWU 4BOHA 3BEIB 2JETC 1P57B 2AGEX 1CGHA 3SU5A 6GCHF 1FONA 2HPPH 4O97A 1K28D 1YPLH 3M5MA 4DVAU 3SNBA 5AHGH 4WXVA 2BDGA 1YPHC 2DUCA 1C1VH 3UQOA 3KQDA 1QRZA 3MU4A 1CU1A 2ALPA 3HKJB 4GVUA 1WTGH 4XBDA 1TMTH 3RXAA 1JOUB 3KQEA 1MKXH 1S6HA 1PQ7A 1V2ST 3CS7A 2GMTB 3NXPA 1UVPA 4UFGH 3B8JA 4DY7B 2UUJB 1O2OA 2ZA5A 3RXUA 4HTCH 1A46H 5C5OA 3RM0H 1WAYB 4YM9A 3UWJH 1ZPCA 1UK2A 2GD4B 3M5OA 1MQ5A 1RJXB 2OC8A 3W95A 2HNTF 4AB8A 1UCYE 3ZZDA 5EQSA 2XC0A 4DG4A 1YF4A 2PFEA 1Z8IB 3A8CA 1P9SA 3M61U 2J9NA 3ESTA 2AEIH 3PROA 3S69A 3NWUA 3SQHE 1Q2WA 3PV4A 3A7XA 1UVSH 1L4ZA 2ANWA 1GMDG 4XE4A 1TNIA 2BOHB 3K65B 4NSYA 1DVAH 2QYIA 1O3GA 3OSYA 4I8KA 4B2BA 3MNCA 3TNTA 1GL0E 3GY2A 4K2YA 2VIOA 1EQ9A 3L33A 1QTFA 3F68H 4WJG2 1T32A 1Y5BT 1H9LB 3HK6B 3NKKA 4HI3A 1UTKA 4XBCA 3NUMA 1VJAU 3A82A 1D6RA 1GBAA 1EPTC 2VNTA 2PWXA 1D9IA 1O2LA 1LHCH 1VITH 1J8AA 2A4OA 2UUYA 1BRAA 1ZRKA 1SFIA 1FPHH 1LVBA 2Z9GA 2ZU5A 2PTNA 2BXUH 2GP9B 3BG8A 2ZHFH 4XBBA 3AW1A 3BG4C 1A1RA 3SJ9A 2HALA 3PWCA 1O5CB 2VH6A 1FJSA 4AFZA 1V2LT 1V2NT 3LT3A 3RMOH 4ABDA 2H6MA 1O2QA 1O3AA 1BJUA 4JMYA 5CHAC 3SHAH 4NIYA 4I8JA 3EAJA 4JCNA 1GCDA 1OWDA 1V2PT 2ZWLH 1VGCC 1NRNH 1S84A 1PPCE 3ATKA 2OLGA 2QF3A 2WYGA 1IAUA 3SJIA 8GCHF 1RTKA 1AVXA 1EZUC 5C2ZA 2UWLA 4BTTB 1KLIH 1CA0C 3VB6A 3RMNH 3RXMA 1HAOH 3UOUA 1SLWB 1V2WT 3RXBA 3OU0A 1C5OH 1GBLA 1GI8B 5F03A 3R3GB 2W3IA 1ZTKA 2Q6DA 2TRMA 2P3TB 2FOGA 2HLCA 1HJAC 2P3UB 1DOJA 1AUJA 4IBLH 3GCNA 3QK1A 4X6NA 1C1TA 3BTEE 3E0NB 2WYJA 1DS2E 1QR3E 1AO5A 4UFFH 3ZVCA 1E35B 1O32A 1QBOA 1E37B 1Z6EA 2Y80A 3TGIE 3D65E 1UMAH 4O3UA 4TWYA 2FOAA 4Z0KA 1QGFA 1BJVA 5C5NA 5JB8S 2XXLA 4LZ1H 3VEQB 2D8WA 2Z3DA 1SGEE 4BXSA 1HXFH 2FOEA 1XKAC 2PKSB 1LHDH 1P8VC 1CT0E 2H1UA 1FNIA 1BT7A 1OS8A 1P12E 3ZZ7A 1P2JA 4ABJA 2JKHA 1HCGA 1GI4A 4JZEH 2AS9A 3GY5A 7ESTE 2QXIA 1HFDA 1LQDB 3VFEA 1JBUH 4D7FA 1O2HA 4ISLA 4X8TH 2P8OB 1GI3A 2PTCE 2ZU2A 3UOPA 5HYOA 3SUDA 4O03A 3SJKA 2IJOB 3U8TH 4Y10E 2FYRA 4JYVH 2FXRA 1KXBA 3R0FA 5FBIA 1GJCB 2BDIA 2HVXA 1TRMA 3MO9A 4JZDH 1GMDF 1G3BA 1K9OE 4B76A 4Y76A 4CHAC 1ELGA 1C5TA 2BZAA 2F9BH 1GGDC 1TX8A 1EATA 2V35A 2ZI2H 4ISIH 2ZCKP 3FP7E 4X8UH 1OX1A 4BAQB 1OP8A 1ETRH 1Y3VA 1Y3UA 5DK1A 1Z1JA 5EGMA 4X0WU 1QRWA 1W0ZU 1XUHA 4Q7YA 4MVNA 1SFQB 3RXRA 3URDA 7KMEH 1FN6A 4WMFA 1C5UA 3DFLA 1SGTA 2OBOA 3PMBB 3UUZA 1NESE 2PKAB 4YOJA 5C1XA 2EI7A 1RRKA 4NZLA 5DP7A 3LPRA 1GMHF 2O8MA 2XBWA 2Z6BD 1TRYA 5G4BA 3SV6A 4CRFA 1HYLA 1ORFA 2GCHF 2TGTA 3O8RA 2HGTH 2XWAA 4UD9H 1SGFA 4A6LA 3QLPH 2FI3E 1BMAA 3PMJA 4AGJA 1PPGE 1Z6JH 2Y81A 1S0RA 1ZGVA 4FUGA 4KP0A 3V0XA 3E0PB 1V2QT 1Y3WA 2BD2A 1T8MA 1QL7A 1T8OA 2BOKA 1VITG 1QCPA 3QGJA 1OYTH 1ELTA 2VVUA 1S6FA 5JPMH 1ELBA 3D62A 5FXLA 1UK4A 2ESTE 3RXHA 1F0TA 1LQEA 1AN1E 4X1NU 2NU3E 1GBIA 3LU9B 3K9XB 3BEFB 1TPPA 5EXMA 1MTSA 2WINI 2VINA 1O30A 2TGDA 3L6PA 4I31A 2C4FH 2ZFPH 3SV2H 2B0FA 3M3SA 4LOYH 2VGCC 1D3QB 4FUJA 2G00A 4AX9H 1KTTB 1O2SA 2A0QB 3SV7A 4Q7XA 1BOQA 1A5IA 2VH0A 4AG2A 3LH3A 2Z9IA 5EXNA 3MNBA 1VR1H 1UTQA 1C1WH 1XUGA 3ATLA 2WPKS 3S9BA 3FP6E 4ZHMU 1MU6B 4NZQA 5C67A 1PYTC 5FCKA 3SUEA 3TU7H 2BYAX 1J14A 1AVGH 2DE9A 1HUTH 3U8OH 1P2QA 3TJUA 5A0BA 2W3KA 4YO9A 3U69H 1O3IA 4K69A 1ZMLA 1MQ6A 2RA3A 3GY8A 1BTHH 3N7OA 1GHAG 3SU4A 3ZZ9A 5J4QA 5FHTA 4BAKB 3KQCA 1O2UA 1QL8A 5I25A 1O2XA 1GVLA 1ANEA 3SGAE 1QJ1B 1TFXA 2FOCA 4X2XA 1TNLA 3TH4H 1EAIA 2GT8A 2GZ9A 3RXCA 1V2UT 4IC5A 1CT2E 3ZVDA 5ABWA 5TCCA 2JH5D 1TLDA 2F83A 2OQUA 3LOXA 1BMNH 2HWLB 2VVCA 2CMYA 3BSQA 2VIQA 1K21H 4YLUA 3TK6A 3F9EA 1AVWA 2R0LA 2ZIQH 3UIRA 2ZDNA 2LNCA 4ZXXH 1Y59T 2A5KA 1IQMA 1L4DA 1O2WA 1UTJA 1ZMJA 2HNTE 4AYYB 1Y5AT 1W7XH 1QJ7B 5GCHG 3U98H 1CGIE 3K6ZA 1ZPZA 5DJ7A 4ZHAA 1O2IA 4R0IA 3BEUA 1W0YH 2ZFSA 4NIVA 1DWDH 1FI8A 1LVYA 2VWMA 2FOMB 2BVSH 1P11E 1SI5H 2FX6A 1TBRH 4FU8A 3C1KA 1UCYK 1SQTA 1IQIA 2JH6D 4AN7A 3ZVGA 4E05H 1TNGA 3LJJA 1YCPK 4Y79A 2ZNKH 1MU8B 3SNDA 1MZDA 1FY4A 1AB9B 4F49A 2GMTC 3SNCA 5C1YA 2ZPSA 1BTWA 1THRH 1JIRA 4ABEA 3I78A 5JBCS 5B6OA 1GDUA 1YCPM 4MDSA 4NA8A 3O8DA 4NIXA 1ZZZA 3MO3A 4FUFA 1J15A 3HGPA 2O8LA 5DKMA 4ASHA 2V6NA 1GHXH 3BTME 3L3TA 1HV7A 2C93B 3UR6A 3LGUA 2RG3A 1C5QA 3FP8E 3KHVA 3QN7A 1OWEA 2FOFA 1VCPA 5TCAA 3VXFH 1GL1A 3UWIA 1P2MA 1FIZA 2FS9A 3A7WA 2ZGJA 2PV9B 2WPIS 2XC5A 1OYQA 3UTUH 2R3YA 4K1TA 1DXWA 3TIUA 1ANCA 3RU4D 2ZDMA 4KTUA 1P05A 3SNEA 1O2YA 2SNWA 4CR5A 1V6DA 1O3LA 1OWIA 1C2DA 1OWHA 1TGBA 1C1SA 1LHFH 2ALVA 1L0ZA 1BTYA 3AVZA 3BTHE 4X2VA 1PQAA 1S85A 2RCEA 4MPVA 3SUGA 1LKAA 5HM9A 1WU1A 5EW2H 2A4GA 3GCTG 3B23B 3HK3B 1Z8GA 2TPIZ 1Y8TA 1TQ0B 3EYDA 4NA9H 1TQ7B 3GISB 1GVKB 4XFQA 5K7RA 2AIQA 3MU1A 1PPEE 1A5GH 2GDEH 2O8TA 2KAIA 2ZDVH 4MLFB 1TA6A 3IITA 4RN6A 1HIAA 3RXEA 1CBWB 2ZCLP 4NWKA 3E8LA 4YESB 1PYTD 4BTUB 1MTNB 3TNSA 3RUOA 2Z94A 5DPAA 3O8BA 1HAVA 1DWCH 4K60A 2A7JA 1THPB 3URCA 1C2FA 1SHHB 2A5IA 1LVOA 4O9VA 1WYKA 2A31A 1XUJA 4Y11E 1GJDB 4INKA 5T6FA 3RM2H 1GDQA 3EA7A 1OP2A 1UCYH 2ANKH 4U30A 1X7AC 4YZUA 1GI0A 3MMGA 1SSXA 2AMPA 1DE7H 4GCHF 5GCHF 1TE0A 1TA2A 1SGNE 2VIWA 1GI9B 1G2LA 5GWZA 2GVFA 1AD8H 3H7OA 4UONA 3CP7A 3E1XB 2NU1E 2GV6A 4OS1A 1GBTA 2Y7ZA 3BTQE 1EAXA 4DIIH 2BDCA 1S0QA 1TPOA 3DUXH 1XKBC 3Q3YA 4CREA 5AF9H 3JZ2B 1T31A 1QNJA 2EI8A 5EODA 4AZ2B 1H8DH 5F6MA 4J1YA 1SGFG 4GPGA 1AQ7A 1GJBB 1XX9A 1K1IA 2QN5T 3M35A 3A87A 2ZFQH 3UNRA 2PKSC 1GHZA 1C1UH 4BANB 1O2GH 4B1TA 2C8YB 3PMHB 5CE1A 3ENSB 2C8WB 5F8ZA 3ODDA 2HNTC 1D3PB 1EAUA 5TJXA 5T6GA 4NFEA 3RXKA 1AKSA 5GIBA 2STBE 1GJAB 1WOFA 2P8OC 1QA0A 1GBMA 4MNVA 3KGPA 2FPZA 5SGAE 3QO6A 2CHAB 4CR9A 4IN2A 3ATIA 3PLKA 1CQQA 1MD8A 4Q80A 2PSXA 1FMGA 1AWFH 1EOJA 4BAMB 1ZHPA 1O3KA 1FUJA 1NRRH 4TY6A 4ESTE 5AFYH 1BITA 1P2OA 1DXPA 5EU8A 1O36A 4ABBA 4ZH8A 3TH3H 5F8TA 2SGEE 3FZZA 1C5NH 5A2MH 3A7TA 4ZXYH 3SGBE 5LGOA 4NCYA 2NU0E 1TBZH 4K1SA 1TYNA 1ZSKA 1O2KA 1QA7A 3P8GA 5IDKA 1QY6A 5H4IB 1NZQH 2PHBA 5HGGA 3GY6A 3UY9A 2A7CA 2G8TA 2VIDA 2ZCHP 1O2TA 3A8AA 2ZPQA 1GCTB 1Z7KA 1EJAA 2ULLA 5DGJA 1TPSA 4BTIB 4H6SB 5A8XA 2Y5GA 1ANBA 4K8YA 5ESBA 1C5WB 2ZHQH 3VB3A 1EKBB 1YPGH 1LKBA 1HDTH 2SGPE 1FV9A 1QFKH 1RTFB 2ZTXA 2H5CA 1C2HA 4JYTA 3O8CA 1TOCB 2FIRH 4MNXA 1ETTH 2ZO3H 3RU4E 1EZXC 3QUMP 4WXIA 1KLTA 6ESTA 3IG6B 1LTOA 1ZPBA 3S9CA 1A7SA 2XNIA 1P03A 4DIHH 2I6SA 1TGCA 3LKWA 1Q31A 1ABIH 1P06A 1SGYE 3OY5U 1EAWA 1W12U 3EA8A 1A0LA 4UDWH 1QURH 3SJ8A 4TWWA 1S83A 5JBBS 1ESAA 4YT6H 1O34A 4LXBH 1NN6A 1MBQA 5BPEA 3QTOH 4MPUA 3F9HA 1O3DA 1SC8U 2FESH 5A8YA 1KIGH 2Y7XA 1F92A 1T8LA 3EQ0H 3S9AA 3PTNA 1DICA 1HJ8A 3UNSA 4JYUH 2QAAA 1P3CA 4DW2U 4B2CA 1AMHA 1H1BA 2NWNA 3BIVH 1GBFA 1NT1A 1K22H 1XXFA 5C20A 2BD8A 4X6OA 1V2TT 2G4TA 3SNAA 3RXTA 2J94A 2R2WU 1BBRE 2UUFB 1OKXA 1O5FH 3GCOA 1GI7B 2IN2A 5J4SA 1BMMH 3DFJA 3SU3A 1Y3YA 5E2PA 1KXEA 4ZMAH 3AASA 1C4Y2 3SU1A 1PPHE 1WSSH 3TH2H 1O39A 1K2I1 2SGAA 2STAE 2Z7FE 2RDLA 1C5VA 4A7IB 4Y7BA 5E0HA 1GBCA 2XWBI 2P3FH 3VGCB 1B5GH 1Z8JB 4F4OC 1IOEA 1CT4E 1Z1IA 2F9NA 3BIUH 2ASUB 1NROH 2IOTA 2BD3A 1EX3A 1MCTA 3A83A 3T28A 2Y5HA 2ZFTA 2ZGHA 3SHCH 1O2PA 2PGQB 3BTDE 3LONA 4IC6A 3MYWA 4DT7B 1BMLA 3T25A 4CRAA 4Y0YE 3GY7A 2GV7A 4IS5A 2QXGA 1TONA 3H7TA 3KN2A 3A7ZA 1SGCA 3BTGE 3MH6A 2P59A 3MNXA 4HZHA 2TGAA 2P95A 2ZFRH 3P8FA 1YYY1 3SQEE 3PTBA 2ZGBH 1JIMA 2BM2A 1UTOA 1VCQA 1DLKB 1A4WH 2ZHEH 1GDNA 1GHWH 2ZGCA 2BHGA 1EUFA 4BAHB 1GPZA 1LPZB 2PKAA 3ZZCA 1LHEH 2CN0H 2YNBA 3GYLB 3LC3A 2FI5E 1SLUB 3DHKH 1ID5H 2EA3A 4YOGA 2CF8H 5JDUB 3A89A 4K5ZA 1EJMA 3ZZ4A 1SLVB 2CF9H 2WV5A 4VGCB 2BLVA 3C27B 1TOMH 2C8XB 1YPJH 1AB9C 4DOQA 1NU9A 2WUCA 3KQBA 2GX4A 4I8HA 3Q77A 4HGCA 4Y8XA 1RGQA 3KIDU 2VIPA 1EPTA 5ETXA 5FX6A 3TGKE 2FYQA 1RD3B 1TIOA 1K1JA 1JRTA 2EC9H 4ZHLU 1A3BH 3ZZBA 3PWBA 2Z3CA 3HATH 1GWAA 3DD2H 3SBKA 2BY8X 1GI2A 3GDUA 3A8DA 3RC6A 2YOLA 1C2GA 1OOKB 4ZUHA 2PLXA 1ZMNA 3QTVH 1AFQB 2BDBA 2FEQH 1K1NA 3RXOA 1QB6A 1CSOE 1C2EA 2W7UA 3SGQE 2O9QA 2QIQA 1B0EA 4YLQH 1EOLA 2FODA 3UR9A 3FANA 1KSNA 3ZVEA 1BRBE 2A1DB 3MFJA 4WY3A 3NPSA 1O0DH 1LHGH 3KEEA 2XBVA 4GHTA 3SV8A 1TNJA 1QBNA 5L2ZH 1HAIH 1CVWH 3SW2B 3E90B 1FAKH 2SGDE 3D49H 1SGQE 3MU5A 2H2ZA 1C5LH 1QQUA 1HJ9A 1O3CA 1C1RA 1W11U 2YNAA 4WWYA 4WMDA 2BX3A 1KXAA 4WVPE 1P3EA 1GBJA 2BVXH 2F9PA 4ISNA 6CHAB 1G9IE 1FIWA 1BCUH 1XUFA 4GSOA 1U6QA 1LO6A 1C1OA 4B2AA 1CHGA 5C3NA 2VWLA 2VVVA 1LCYA 2ZTYA 1TABE 2QF0A 1ZR0A 1HAXB 2F9VA 1DLEA 1FY5A 2QGRA 1CBWC 1PQ5A 3PLBA 1C5XB 1ACBE 2F3CE 4X2WA 1WCZA 1INCA 5A09A 3SOSA 3RXGA 4AYVB 1W13U 2HRVA 1D3DB 4X1PU 2A4QA 1M9UA 1ZOMA 4OS5A 1FAXA 3RXVA 1ELDE
chains in the Genus database with same CATH superfamily
1A0JA 3OEED 2XW9A 3P92A 1NU7B 1LVMA 1SQAA 2GKVE 3MU8A 1YC0A 1BHXF 1YGCH 1TGSZ 2VJ1A 3KQ5A 2F9UA 4Y6DA 1GG6C 3MWIU 2FZZA 2OC1A 5PTPA 5A0CA 4ABFA 2D26C 2NU4E 1V3XA 2A2QH 1EB2A 1IQKA 1TPAE 2ODPA 3E3TA 3RXDA 1O3OA 2FS8A 3Q3KA 4YTAA 3WY8A 4FUCA 1YPKH 2HPQH 1JRSA 1O3HA 4D9RA 2THFB 1SQRA 1O5AB 2ZKSA 2OQ5A 3S0NA 5EG4A 5GXPA 3A86A 1Q3XA 2J5UA 1OWJA 2K0QA 5FPSA 3K6YA 1ARBA 1SR5C 4U2WA 2ZQ1A 4YT7H 3ZVAA 3STIA 1ZGIA 4DGJA 1RIWB 1C2IA 2WUBA 1NO9H 2PSYA 1P0SH 1A0HB 1FY8E 1ZTJA 2IPHA 1AHTH 2ZFFH 4TT3D 4UEHH 3MQKC 1NFXA 1O2RA 1SGIB 5DP4A 5L30H 1T4VH 3LGIA 4F55A 2TGPZ 4FUEA 3W94A 4XSKU 4IN1A 4J2YB 3LGWA 2JH0D 3MH4A 1FDPA 1L1GA 3SU0A 5DO4H 1SGRE 4HFPB 1XVMA 2OTVA 1G32B 3T27A 1WQSA 1F5LA 1P2IA 1UHBA 3AAVA 2QC2A 2ZTZA 5DSFA 3GICB 1VITF 1MZAA 4OS2A 1ELVA 1EP6A 4I33A 2HOBA 1LMWB 3EE7A 1TB6H 4Z6AH 1O33A 1KYNA 3RU4T 7GCHG 2FO9A 3Q00A 1WQVH 3DA9B 5EPYA 1TBQH 2Z9KA 1O3JA 3ZVFA 5E2OA 5DG6A 2G51A 1ZRBA 2ZZUH 2A5AA 3EA9A 3OAAD 1QB1A 2O8WA 4DT4A 1ZLRA 3UQVA 1GHBG 2H9EH 3KF2A 1GCTC 3FOAA 3ZZ6A 5L6NH 4FUHA 1K1MA 3ITIA 1O5DH 3QDZB 1HLTH 4KGAA 1Y5UT 3MNSA 1TX6A 1ZSLA 1F0RA 3P70B 4MTBA 1SG8B 1NFWA 2WPMS 3EGKH 3V12A 3ATWA 1H8HD 2ZDLA 5FX5A 3PYHA 2BTCE 4X8SH 1TALA 1HB0B 1WTHD 4DCDA 3ZZ3A 4RT1A 1TAWA 2SFAA 2PUXB 3RXFA 1FZZA 2OCVB 2ZDKA 4NWLA 9ESTA 3MH5A 4X6PA 1E1RD 2ODQA 2QF4A 3M5LA 1SOTA 2H5DA 1G3CA 1W2KH 3GYMA 1ZHMA 2GZ8A 1O5GH 3BN9A 1THSH 1BBRK 1BHXB 5C0UA 2G5VA 3A88A 3RMLH 1MAYA 3P8OA 1GHAF 2H9HA 2PR3A 2V7QD 2GZ7A 1JXPA 4XRNA 1O35A 5E0JA 3P6ZB 3M7TA 4M7GA 5I46H 1KY9A 1T8NA 3KYFA 1O2VA 1GJ9B 1DWEH 4WH6A 5LPEA 1CE5A 1N8OB 1CGJE 1CA8B 2SGFE 1F0UA 1FY3A 2FDAA 1BZXE 3M7QA 5FCRA 1AWHB 1RFNA 2R0KA 2SGQE 3B9FH 3FKSD 2RA0A 1FQ3A 1O38A 1O2ZA 1XXDA 5FL7D 1F7ZA 1KDQA 3FVFB 1MTUA 5HM2A 1DM4B 1TX7A 1C2LA 3ZZAA 4JZFH 1Y3XA 5GPIB 4CBOA 3TVJB 3NK8A 4AG1A 1ANDA 4TYDA 2BX4A 4D76A 3RXSA 1CHOG 3GCHB 4MPWA 1C5SA 1P09A 1SHYA 3BTTE 1BRUP 3STJA 5F8XA 2ZDAH 3A7VA 1HAVB 3ELAH 3N7DA 1QBVH 1W8BH 4FXGH 3RLYH 4Y0ZE 3I77A 2YMSB 2WV9A 2J2UA 5AFZH 1C4U2 1QIXB 2K1QA 3T2NA 3BF6H 1XUKA 5KGOA 1E0FD 1EFRD 4DURA 1TMUH 2GCTB 4SGAE 4FUIA 1O3BA 1S5SA 2A2XH 2P94A 2ILNA 1C1MA 1C5YB 2AGGX 2JDID 1C4V2 3PB1E 7GCHF 1NFUA 2XRCA 4TY7A 3S7KB 2OINA 1MKWH 2GTBA 2UUKB 5AVDA 2ODYB 4ABHA 3SZEA 4E06H 5LPRA 4XDEA 1UVTH 1YBWA 3VXEH 4DJZB 1DUEA 1LPKB 2QY0B 1H9IE 2FM2A 1AGJA 1P2KA 4TSFD 1C2KA 2RDEA 2Z9JA 1GJ4H 4Q2KA 2FMJA 2G5NA 2IJD1 1EB1H 1GHBF 3H5CB 1TNHA 3PO1B 5KECA 1GVZA 4AFUA 1D6WA 1P9UA 1E36B 5HIYA 3TK5A 4Z1MD 2FLBH 4YOIA 1EZQA 1UVOA 2J4IA 4ACAA 2ZU1A 8KME2 3UB0A 1AZZA 1DFPA 2AYWA 2BLWA 1AKSB 2ZGXH 2BDHA 3BTWE 1BBRH 4B75A 4R8TB 4IW4E 2C3SA 1YP9A 4Y71A 2XCFA 4VGCC 2ANYA 2CV3A 4P00A 1RS0A 1YPMH 2OUAA 3PM3A 1SGPE 3IWMA 1W3CA 1GI6A 1PFXC 3HPTB 3PRBA 1O5BB 5E8EH 5FPTA 3GCTF 3AK5A 1DY8A 2Y5FA 2PGBB 3V7TA 1GJ7B 1H4WA 5HIZA 4X8VH 1K0HA 2ANMH 4AOQA 2TBSA 5DP3A 1ARCA 1IQFA 1HAYB 3P17H 4SGBE 2BY9X 3M3VA 1XVOA 1DWBH 1TWXB 1ZJKA 4B71A 3SZNA 1O3EA 1EJNA 1O3MA 2BD5A 4CBNA 1P02A 5HXFA 2PW8H 2ZU4A 2FOHA 2Z9LA 3P8NA 1YPEH 3RDZA 2KCYA 3RC5A 3UPEA 1SPJA 1HGTH 1AFQC 1UVUH 3TJVA 3P95A 1OPHB 1G2MA 2BY7X 2GGVB 2SNVA 3OY6U 4GLYA 1ZTLA 3LJOA 3LDXH 1BQYA 3KL6A 3SN8A 1TNKA 1VZQH 4ISHH 2M5TA 1UTPA 1GJ6A 1CO7E 1GMHG 2AERH 1SVPA 3VB4A 4CRBA 1C5ZB 3AW0A 1UJ1A 3SI4H 4U32A 2GCHG 3GDSA 3V13A 2BD7A 1IQLA 3ZV9A 5EPNA 4K8BA 3CENA 4KKDA 4XOJA 1WBGB 1DUAA 1P01A 9LPRA 5T6DA 2JJ1D 1DANH 1AI8H 2I6QA 8ESTE 1BUIA 1CHOF 1JWTA 3MU0A 1E34B 2WPHS 1F0SA 4MNWA 2QA9E 2O8UA 1EASA 4Q7ZA 3ZV8A 1JMOH 1UTMA 3M5NA 1IQGA 6CHAC 2A7HA 1OP0A 4FU7A 2BDAA 1DSUA 1GBKA 5EW1H 1A3EH 1OSSA 2ZG0H 3M37A 4RSPA 4X1QU 2OP9A 3MTYA 1MAXA 1TGTA 4IGDA 1W14U 3F1SB 1O3PB 2AGIX 3M7UA 1BTPA 3FAOA 1HAPH 2Y82A 1BA8B 1O31A 4I8GA 1PPZA 3Q76A 2Q1JA 2TIOA 2BY6X 3A84A 1DY9A 1C2JA 4UE7H 1BIOA 3T26A 1NFYA 1ABJH 4GUXA 3TK9A 1C9PA 2FLRH 1K1OA 2PUQH 1O3NA 2Q6FA 3A7YA 4ZKSU 4UFEH 1EXFA 4NG9H 5ESTE 1G37A 4BNRA 5C1UA 5JBAS 1SLXB 3ODFA 2D2DA 4GHQA 4NFFA 1KTSB 1IQJA 1QJ6B 1SQOA 4KELA 4CH8B 4BAOB 4AC9A 3MI4A 2W7SA 2JETB 4FVDA 4A1TA 1MBMA 1J16A 4MNYA 1L2EA 3QX5H 3GY3A 3ZZ8A 1SGDE 1GMCG 1IQHA 4JZIA 1ELFA 1BTUA 2VWNA 4IMZA 3G01A 1SL3A 2BMGB 3A85A 1ZJDA 4QT8C 3LGTA 1OXGA 5LH8A 1MUEB 1S82A 4RT0A 1L1NA 4ABIA 1GBBA 1Z8RA 1RIWC 4CRCA 1N6YA 3EDXB 4YXWD 3F0PA 1VKYA 5FPYA 1SKYE 2KX4A 2WHXA 1ZSJA 1PQ8A 2AFQB 1O2NA 3LC5A 1O2JA 4NGAH 2ZC9H 3F3BA 2FOBA 2FWWA 1T4UH 1MH0A 1F5KU 5HMAA 2WV4A 4WF8A 3E6PH 3PMAB 3Q3XA 4LZ4B 3TITA 1A5HA 2R3UA 1J17T 1GJ8B 3OX7U 1NRQH 1G30B 3ZYEA 1WUNH 3QGNB 1LPGB 1HAHH 4I7YH 2ZU3A 5IK2D 2WSSD 1YLNA 4AB9A 2ZPRA 4AGKA 1SBWA 2OC0A 2BXTH 2QF5A 4D7GA 3KCGH 2CGAA 3DSGA 1DX5M 2LPRA 3EE0B 1C1PA 3QZQA 4A1VA 1VCWA 2Z3EA 3T5FH 3UFAA 1MMJN 3RXPA 3F0OA 5EOKA 2A32A 3D23A 4THNH 2L6OA 5JBTA 3UAIC 1NC6A 3LGYA 1AIXH 1NM6A 3RP2A 1EPTB 3RXLA 2B9LA 4Y8YA 3SO3A 4CH2B 1ZHRA 1IQNA 1TMBH 3T62A 1DPOA 3FO8D 2BLOA 1V2JT 4FU9A 1MTWA 3FZDA 1V2RT 2W5EA 1AFEH 2DE8A 2R9PA 1GI1A 3BG4B 1G36A 1F5RA 2BLQA 4FUDA 1H9HE 2BD4A 3MOCA 2KZ4A 4U01A 2W6JD 2CJIA 3BTKE 3T29A 5T3HA 1O37A 1G3DA 4X2YA 2VIVA 4MG3A 5GDSH 3VPKA 5CHAB 1HAZB 2J98A 4D9QA 3UNQA 1O3FA 4MPXA 1VGCB 1BB0B 1IQEA 2BQWB 2BD9A 2XC4A 3OTJE 4A1XA 4GAWA 1N6XA 2J95A 5EXLA 3NCLA 4I32A 4K1EA 4FETA 1L1JA 2JJ2D 1XMNB 2ZECA 4O3TA 2LP6A 2V0BA 4CRGA 1P04A 4ASUD 2P16A 1IHTH 1CA0B 1MD7A 4AFSA 3TGJE 1MTNC 2AMDA 1GHVH 2V3HH 1N8OC 1FXYA 1C5MD 1QL9A 2P93A 1V2KT 2XTTB 4H4FA 4I86A 1C2MA 3DSOA 3TLOA 1GMCF 1SB1H 1HBTH 1HJAB 2QXHA 2J38A 1QRXA 1C1NA 1KLJH 2BQ6B 2OXSA 2ZP0H 1K1PA 4FUBA 1KXCA 4I8LA 3BV9B 3GDVA 3PLPA 1AUTC 4KTSA 4NSVA 2QXJA 2VB0A 1QQ4A 2QCYA 2QV1A 3MH7A 1OWKA 3TJOA 2ZEBA 1BTXA 1AY6H 1Z71A 1V2MT 3GCHC 4ZAEA 3SJOA 1QB9A 5BRRE 3PV2A 2ZQ2A 1O2MA 3U9AH 1PPFE 1SOZA 2UWPA 1GI5A 4NIWA 4B6FA 3DT0H 4ZROA 3ZZ5A 1HNEE 3FFGA 2XYAA 2G55A 4RKJB 4JZ1A 4A5TS 2AH4X 1NPMA 2B8OH 5IYTA 2AIPA 1C1QA 2LELA 3M36A 5DP8A 4JK6A 3PV5A 3BTFE 1UK3A 4Y7AA 3F9FA 2J97A 2GCTC 3SV9A 1YPHE 7LPRA 4OS7A 1BDAA 2ZF0H 3ZIAD 5LPFA 3ATMA 3RMMH 4GCHG 1UTLM 1ELEE 1EP5A 2R2MB 3OYPA 4CHAB 3QZRA 4B74A 1GGDB 2G52A 5EQQA 4AFQA 1W10U 4WH8A 3ZVBA 2UWOA 1XM1A 4TPYA 4CRDA 1DT2A 1GHYH 3A81A 3HKIB 2F9OA 8LPRA 1B7XB 2CHAC 4ACBA 5GNDA 4OGXA 2BY5X 4ABAA 2ZHDA 2VWOA 4K3JA 2GDDA 3E16B 1B0FA 5L2YH 1HAGE 5FBEA 3VB5A 1K1LA 3PO1C 2ZHWH 4H6TA 2FP7B 4A92A 3F9GA 4BXWA 4IMQA 3RXQA 1ETSH 4KTCA 3DCLA 6GCHG 1YY3A 3I29A 4ZKOU 1NRPH 3JZ1B 3LH1A 1ESBA 1TGNA 1SMFE 3KYGA 1F2SE 1W7GH 5DP9A 1UTNA 1RXPA 3DSPA 2Y6TA 4ZKRU 1UHBB 3M3TA 3RLWH 2W26A 1NRSH 4D8NA 1T7CA 1MTVA 1DDJA 2KCPA 3MO6A 3ZYDA 1FN8A 2A45B 2G81E 1QHRB 3GY4A 1MKWK 4ABGA 2A4RA 4LK4A 1HXEH 5CMXH 3LIWA 2XBYA 1S81A 2IPQX 2J34A 4PROA 3LGVA 3WWFA 1BTZA 2FTMA 3RXIA 1BRCE 1AE5A 1NY22 1HPGA 2XNDD 2D1JA 4X1RU 1PJPA 5DP5A 5EQRA 4X6MA 3AAUA 1RTLA 2BVRH 4JK5A 4OGYA 3U1IB 1TRNA 2WPLS 4X1SU 1XUIA 1H8ED 1E38B 2EEKA 1FY1A 1GBEA 1MKXK 3SUFA 1DSTA 3TPIZ 2FI4E 3U8RH 3GOVB 3V3MA 2XOKD 4AORA 1P2NA 4FVBA 1KXDA 3U28C 5FAHA 1D3TB 1VJ9U 2EI6A 2G4UA 5DP6A 2C8ZB 1AU8A 2VGCB 1EZSC 1GBHA 5GJ4B 2FX4A 1YLDA 3SU6A 3HGNA 3SU2A 3NZIA 5A0AE 5JB9S 1HRTH 2AMQA 1GBDA 4OS4A 1ZYOA 3CS0A 1ELAA 6LPRA 1FPCH 2FTLE 4ZKNU 3TJNA 1PPBH 2AHME 3E91A 1C9TA 4WMEA 2BZ6H 4H42U 3K2UA 1A61H 4RKOB 1GJ5H 2KCAA 4TPIZ 3OTPA 1DITH 1YLCA 2V3MA 2WPJS 2KAIB 1AE8H 2V3OH 3SORA 1LDTT 4E7RG 1ESTA 2NU2E 3QWCH 4UFDH 1KXFA 1J9CH 1HIAB 1N1LA 1G3EA 2H9TH 1NS3A 1P10A 1O5EH 2F91A 2BDYA 2B5TB 1NTPA 1A2CH 3RXJA 5B6LA 1C5RA 1V2OT 1ELCA 4E7NA 1D4PB 2BQ7B 4MQAA 1FLEE 1YM0A 1C5PA 2CXVA 1QZ8A 1WV7H 1GG6B 2C90B 2GT7A 2OD3B 4INLA 1YCPH 3F6UH 1UO6A 2OBQA 4INHA 5A8ZA 1H8IH 4ISOA 5T1VA 2VU8E 3VB7A 3S7HB 3VGCC 1MCVA 3SI3H 1KDQB 3A8BA 5JYIA 2OC7A 1IHSH 3UREA 5K0HA 1YKTA 4B73A 3KNXA 8GCHG 2XBXA 3RC4A 1AZ8A 2BB4A 1V2VT 3A80A 4OS6A 2Q6GA 2J92A 4NA7A 2XCNA 2B7DH 4Y8ZA 5E0GA 3U1JB 2RFKC 3MHWU 4BOHA 3BEIB 5HKKD 2JETC 1P57B 2AGEX 3NRLA 1CGHA 3SU5A 6GCHF 1FONA 2HPPH 4O97A 1K28D 1YPLH 3M5MA 4DVAU 3SNBA 5AHGH 4WXVA 2BDGA 1YPHC 2DUCA 1C1VH 3UQOA 3KQDA 1QRZA 3MU4A 1CU1A 5C17A 2ALPA 3GS9A 3HKJB 4GVUA 1WTGH 4XBDA 1TMTH 3RXAA 1JOUB 3KQEA 1MKXH 1S6HA 1PQ7A 1V2ST 3CS7A 2GMTB 3NXPA 1UVPA 4UFGH 3B8JA 4DY7B 2UUJB 1O2OA 2ZA5A 3RXUA 4HTCH 1A46H 5C5OA 3RM0H 1W0KD 1WAYB 4YM9A 3UWJH 1ZPCA 1UK2A 2GD4B 3M5OA 1MQ5A 1RJXB 2OC8A 3W95A 2HNTF 4AB8A 1UCYE 3ZZDA 5EQSA 2XC0A 4DG4A 1YF4A 2PFEA 1Z8IB 3A8CA 1P9SA 3M61U 2J9NA 3ESTA 2AEIH 3PROA 3S69A 3NWUA 3SQHE 1Q2WA 3PV4A 3A7XA 1UVSH 1L4ZA 2ANWA 1GMDG 4XE4A 1TNIA 2BOHB 3K65B 4NSYA 4XD7D 1DVAH 2QYIA 3WW7A 1O3GA 5EIYA 3OSYA 4I8KA 4B2BA 3MNCA 3TNTA 1GL0E 3GY2A 4K2YA 2VIOA 1EQ9A 3L33A 1QTFA 3F68H 4WJG2 1T32A 1Y5BT 1H9LB 3HK6B 3NKKA 4HI3A 1UTKA 4XBCA 3NUMA 1VJAU 3A82A 1D6RA 1GBAA 1EPTC 2VNTA 2PWXA 1D9IA 1O2LA 1COWD 1LHCH 1VITH 1J8AA 2A4OA 2UUYA 4RI0A 1BRAA 1ZRKA 1SFIA 1FPHH 1LVBA 2Z9GA 2ZU5A 2PTNA 2BXUH 2GP9B 3BG8A 2ZHFH 4XBBA 3AW1A 3BG4C 1A1RA 3SJ9A 2HALA 3PWCA 1O5CB 2VH6A 1FJSA 4AFZA 2KM0A 1V2LT 1V2NT 3LT3A 1WXRA 3RMOH 4ABDA 2H6MA 1O2QA 1O3AA 1BJUA 4JMYA 5CHAC 3SHAH 4NIYA 4I8JA 3EAJA 4JCNA 1GCDA 1OWDA 1V2PT 2ZWLH 1VGCC 1NRNH 1S84A 1PPCE 3ATKA 2OLGA 2QF3A 2WZQA 2WYGA 1IAUA 3SJIA 8GCHF 1RTKA 1AVXA 1EZUC 5F53A 2UWLA 5C2ZA 4BTTB 1KLIH 1CA0C 3VB6A 3RMNH 3RXMA 1HAOH 3UOUA 1SLWB 1V2WT 3RXBA 3OU0A 1C5OH 1GBLA 1GI8B 3SYJA 5F03A 3R3GB 4Q63A 2W3IA 1ZTKA 2Q6DA 2TRMA 2P3TB 2FOGA 2HLCA 1HJAC 2P3UB 1DOJA 1AUJA 4IBLH 3GCNA 3QK1A 4X6NA 1C1TA 3BTEE 2CK3D 3E0NB 2WYJA 1DS2E 1QR3E 1AO5A 4UFFH 3ZVCA 1E35B 1O32A 1QBOA 1E37B 1Z6EA 2Y80A 3TGIE 3D65E 1UMAH 4O3UA 4TWYA 2FOAA 4Z0KA 1QGFA 5KEDA 1BJVA 5C5NA 5JB8S 2XXLA 4LZ1H 3VEQB 2D8WA 2Z3DA 1SGEE 4OM9A 4BXSA 1HXFH 2FOEA 1XKAC 2PKSB 3PRDA 1LHDH 1P8VC 1CT0E 2H1UA 1FNIA 1BT7A 1OS8A 1P12E 3ZZ7A 5C94A 1P2JA 4ABJA 2JKHA 1HCGA 1GI4A 4JZEH 2AS9A 3GY5A 7ESTE 2QXIA 1HFDA 1LQDB 3VFEA 1JBUH 4D7FA 1O2HA 4ISLA 4X8TH 2P8OB 1GI3A 2PTCE 2ZU2A 3UOPA 5HYOA 3SUDA 4O03A 3SJKA 2IJOB 3F2GA 3U8TH 4Y10E 2FYRA 4JYVH 2FXRA 1KXBA 3R0FA 5FBIA 1GJCB 2BDIA 2HVXA 1TRMA 3MO9A 4JZDH 1GMDF 1G3BA 1K9OE 4B76A 4Y76A 4CHAC 1ELGA 1C5TA 2BZAA 2F9BH 1GGDC 1TX8A 1EATA 2V35A 2ZI2H 4ISIH 2ZCKP 3FP7E 4X8UH 1OX1A 4BAQB 1OP8A 1ETRH 1Y3VA 1Y3UA 5DK1A 1Z1JA 5EGMA 4X0WU 1QRWA 1W0ZU 1XUHA 4Q7YA 4MVNA 1SFQB 3RXRA 3URDA 7KMEH 1FN6A 4WMFA 1C5UA 3DFLA 1SGTA 2OBOA 3PMBB 3UUZA 1NESE 2PKAB 4YOJA 5C1XA 2EI7A 1RRKA 4NZLA 5DP7A 3LPRA 1GMHF 2O8MA 2XBWA 2Z6BD 1TRYA 5G4BA 3SV6A 2W6ID 4CRFA 1HYLA 1ORFA 2GCHF 2TGTA 3O8RA 2HGTH 2XWAA 4UD9H 1SGFA 4A6LA 3QLPH 2FI3E 1BMAA 3PMJA 4AGJA 1PPGE 1Z6JH 2Y81A 1S0RA 1ZGVA 4FUGA 4KP0A 3V0XA 3E0PB 1V2QT 1Y3WA 2BD2A 1T8MA 1QL7A 1T8OA 2PP6A 2BOKA 1VITG 1QCPA 3QGJA 1OYTH 1ELTA 2VVUA 1S6FA 5JPMH 1ELBA 3D62A 5FXLA 1UK4A 2ESTE 3RXHA 1F0TA 1LQEA 1AN1E 4X1NU 2NU3E 1GBIA 3LU9B 3K9XB 3BEFB 1TPPA 5EXMA 1MTSA 2WINI 2VINA 1O30A 2TGDA 3L6PA 4I31A 2C4FH 2ZFPH 4M9FA 1OHHD 3SV2H 2B0FA 3M3SA 3N7EA 4LOYH 1S6LA 2VGCC 1D3QB 4FUJA 2G00A 4AX9H 1KTTB 1O2SA 2A0QB 3SV7A 4Q7XA 1BOQA 1A5IA 2VH0A 4AG2A 3LH3A 2Z9IA 5EXNA 3MNBA 1VR1H 3F2FA 1UTQA 2J98B 1C1WH 1XUGA 3ATLA 2WPKS 3S9BA 3FP6E 4ZHMU 1MU6B 4NZQA 5C67A 1PYTC 5FCKA 3SUEA 3TU7H 2BYAX 1J14A 1AVGH 2DE9A 2WPDD 1HUTH 3U8OH 1P2QA 3TJUA 5A0BA 2W3KA 4YO9A 3U69H 1O3IA 4F48B 4K69A 1ZMLA 1MQ6A 2RA3A 3GY8A 1BTHH 3N7OA 1GHAG 3SU4A 3ZZ9A 5J4QA 5FHTA 4BAKB 3KQCA 1O2UA 1QL8A 5I25A 1O2XA 1GVLA 1ANEA 3SGAE 1QJ1B 1TFXA 2FOCA 4X2XA 1TNLA 3TH4H 1EAIA 2GT8A 2GZ9A 3RXCA 1V2UT 4IC5A 1CT2E 2YMSC 3ZVDA 5TCCA 5ABWA 2JH5D 1TLDA 2F83A 2OQUA 3LOXA 1BMNH 2HWLB 2VVCA 2CMYA 3BSQA 2VIQA 1K21H 4YLUA 3TK6A 3F9EA 1AVWA 2R0LA 2ZIQH 3UIRA 1MABB 2ZDNA 2LNCA 4ZXXH 1Y59T 2A5KA 1IQMA 1L4DA 1O2WA 1UTJA 1ZMJA 2HNTE 4AYYB 1Y5AT 1W7XH 1QJ7B 5GCHG 3U98H 1CGIE 3K6ZA 1ZPZA 5DJ7A 4ZHAA 1O2IA 4R0IA 3BEUA 1W0YH 2ZFSA 4NIVA 1DWDH 1E79D 1FI8A 1LVYA 2VWMA 2FOMB 5C0TA 2BVSH 1P11E 1SI5H 2FX6A 1TBRH 4FU8A 3C1KA 1UCYK 1SQTA 1IQIA 2JH6D 4AN7A 3ZVGA 4E05H 1TNGA 3LJJA 1YCPK 4Y79A 2ZNKH 1MU8B 5EJZA 3SNDA 1MZDA 1FY4A 1AB9B 4F49A 2GMTC 3SNCA 5C1YA 2ZPSA 1BTWA 1THRH 1JIRA 4ABEA 3I78A 5JBCS 5B6OA 1GDUA 1YCPM 4MDSA 4NA8A 3O8DA 2EQNA 4NIXA 1ZZZA 3MO3A 4FUFA 1J15A 3HGPA 2O8LA 5DKMA 4ASHA 2V6NA 1GHXH 3BTME 3L3TA 1HV7A 2C93B 3UR6A 3LGUA 2RG3A 1C5QA 3FP8E 3KHVA 3QN7A 1OWEA 1W0JD 2FOFA 1VCPA 5TCAA 3VXFH 1GL1A 3UWIA 1P2MA 1KMHB 1FIZA 2FS9A 3A7WA 2ZGJA 2PV9B 2WPIS 2XC5A 1OYQA 3UTUH 2R3YA 4K1TA 1DXWA 3TIUA 1ANCA 3RU4D 2ZDMA 4KTUA 1P05A 3SNEA 1O2YA 2SNWA 3W1EA 4CR5A 1V6DA 1O3LA 1OWIA 1C2DA 1OWHA 1TGBA 1C1SA 1LHFH 2ALVA 3CNRA 1L0ZA 1BTYA 3AVZA 3BTHE 4X2VA 1PQAA 1S85A 2RCEA 4MPVA 3SUGA 1LKAA 5HM9A 1WU1A 5EW2H 2A4GA 3GCTG 3B23B 3HK3B 1Z8GA 2TPIZ 1Y8TA 1TQ0B 3EYDA 4NA9H 1TQ7B 3GISB 1GVKB 4XFQA 5K7RA 2AIQA 3MU1A 1PPEE 1A5GH 2GDEH 2O8TA 2KAIA 2ZDVH 4MLFB 1TA6A 3IITA 4RN6A 1HIAA 3RXEA 1CBWB 2ZCLP 4NWKA 3E8LA 4YESB 1PYTD 4BTUB 1MTNB 3TNSA 3RUOA 2Z94A 5DPAA 3OEHD 3O8BA 4ZCNA 1HAVA 1DWCH 4K60A 2A7JA 1THPB 3URCA 1C2FA 1NBME 1SHHB 2A5IA 1LVOA 4O9VA 1WYKA 2A31A 1XUJA 4Y11E 1GJDB 4INKA 5T6FA 3RM2H 1GDQA 3EA7A 2JIZD 1OP2A 1UCYH 4FOUC 2ANKH 4U30A 1X7AC 4YZUA 1GI0A 3MMGA 1SSXA 2AMPA 1DE7H 4GCHF 5GCHF 1E1QD 1TE0A 1TA2A 1SGNE 2VIWA 1GI9B 1G2LA 5GWZA 2GVFA 1AD8H 2YMSD 3H7OA 4UONA 3CP7A 3E1XB 2NU1E 2GV6A 4OS1A 1GBTA 2Y7ZA 3BTQE 1EAXA 4DIIH 2BDCA 1S0QA 1TPOA 3DUXH 1XKBC 3Q3YA 4CREA 5AF9H 3JZ2B 1T31A 1QNJA 2KFWA 2EI8A 5EODA 4AZ2B 1H8DH 5F6MA 2HVYB 4J1YA 1SGFG 4GPGA 2L74A 1AQ7A 1GJBB 1XX9A 1K1IA 2QN5T 3M35A 3A87A 2ZFQH 3UNRA 2PKSC 1GHZA 1C1UH 4BANB 1O2GH 3VG8A 4B1TA 2C8YB 3PMHB 5CE1A 3ENSB 2C8WB 5F8ZA 3ODDA 2HNTC 1D3PB 1EAUA 5TJXA 5T6GA 4NFEA 3RXKA 1AKSA 5GIBA 2STBE 1GJAB 1WOFA 2P8OC 1QA0A 1GBMA 4MNVA 3KGPA 2FPZA 5SGAE 3QO6A 1WDIA 2CHAB 4CR9A 4IN2A 2EY4C 3ATIA 3PLKA 1CQQA 1MD8A 4Q80A 2PSXA 1FMGA 1AWFH 1EOJA 4BAMB 1ZHPA 1O3KA 1FUJA 1NRRH 4TY6A 4ESTE 5AFYH 1BITA 1P2OA 1DXPA 1FX0B 4Q4LA 5EU8A 1O36A 4ABBA 4ZH8A 3TH3H 5F8TA 2SGEE 3FZZA 1C5NH 5A2MH 3A7TA 4ZXYH 3SGBE 5LGOA 4NCYA 2NU0E 2QE7D 1TBZH 4K1SA 1TYNA 1ZSKA 1O2KA 1QA7A 3P8GA 5EJ1A 5IDKA 1QY6A 5H4IB 1NZQH 2PHBA 5HGGA 3GY6A 3UY9A 2A7CA 2G8TA 2VIDA 2ZCHP 1O2TA 3A8AA 2ZPQA 1GCTB 1Z7KA 1EJAA 2ULLA 5DGJA 1TPSA 4BTIB 4H6SB 5A8XA 2Y5GA 5CDFE 1ANBA 4K8YA 5ESBA 1C5WB 2ZHQH 3VB3A 1EKBB 1YPGH 1LKBA 3FN8A 1HDTH 2SGPE 1FV9A 1QFKH 1RTFB 2ZTXA 2H5CA 1C2HA 4JYTA 3O8CA 1TOCB 2FIRH 4MNXA 1ETTH 2ZO3H 3RU4E 1EZXC 3QUMP 4WXIA 1KLTA 6ESTA 3IG6B 1LTOA 1BMFD 1ZPBA 3S9CA 1A7SA 2XNIA 1P03A 4DIHH 2I6SA 1TGCA 3LKWA 1Q31A 1ABIH 1P06A 1SGYE 3OY5U 1EAWA 1W12U 3EA8A 1YWUA 1A0LA 4UDWH 1QURH 3SJ8A 4TWWA 3OFND 1S83A 5JBBS 1ESAA 4YT6H 1O34A 4LXBH 3F2HA 1NN6A 1MBQA 5BPEA 3QTOH 4MPUA 3F9HA 1O3DA 1SC8U 2FESH 5A8YA 1KIGH 2Y7XA 1F92A 1T8LA 3EQ0H 3S9AA 3PTNA 1DICA 1HJ8A 3UNSA 4JYUH 2QAAA 1P3CA 4DW2U 4B2CA 1AMHA 1H1BA 2NWNA 3BIVH 1GBFA 1NT1A 1K22H 1XXFA 5C20A 2BD8A 4X6OA 1V2TT 2G4TA 3SNAA 3RXTA 2J94A 2R2WU 1BBRE 2UUFB 1OKXA 1O5FH 3GCOA 1GI7B 2IN2A 5J4SA 5DN6D 1BMMH 3DFJA 3SU3A 3H09A 1Y3YA 5E2PA 1KXEA 4ZMAH 3AASA 1C4Y2 3SU1A 4HG6A 1PPHE 1WSSH 3TH2H 1O39A 3OE7D 1K2I1 2SGAA 2STAE 2Z7FE 2RDLA 1C5VA 4A7IB 4Y7BA 5E0HA 1GBCA 2GJGA 2XWBI 2P3FH 3VGCB 1B5GH 1Z8JB 4F4OC 1IOEA 1CT4E 1Z1IA 2F9NA 3BIUH 2ASUB 1NROH 2IOTA 2BD3A 2F4LA 1EX3A 1MCTA 3A83A 3T28A 2Y5HA 2ZFTA 2ZGHA 3SHCH 4B6EA 1O2PA 2PGQB 3BTDE 3LONA 4IC6A 3MYWA 4DT7B 1BMLA 3T25A 4CRAA 4Y0YE 3GY7A 2GV7A 4IS5A 2QXGA 1TONA 3H7TA 3KN2A 3A7ZA 1SGCA 3BTGE 3MH6A 2P59A 3MNXA 4HZHA 2TGAA 2P95A 2ZFRH 3P8FA 1YYY1 3SQEE 2K8IA 3PTBA 2ZGBH 1JIMA 2BM2A 1UTOA 1VCQA 1DLKB 2HLDD 1A4WH 2ZHEH 1GDNA 1GHWH 2ZGCA 2KCOA 2BHGA 1EUFA 5EJLA 4BAHB 1GPZA 1LPZB 2PKAA 3ZZCA 1LHEH 2CN0H 2YNBA 3GYLB 3LC3A 2FI5E 1SLUB 3DHKH 1ID5H 2EA3A 4YOGA 2CF8H 5JDUB 3A89A 4K5ZA 1EJMA 3ZZ4A 1SLVB 2CF9H 2WV5A 4VGCB 2BLVA 3C27B 1TOMH 2C8XB 1YPJH 1AB9C 4DOQA 1NU9A 2WUCA 3KQBA 2GX4A 1UW7A 3Q77A 4HGCA 4I8HA 1RGQA 4Y8XA 3KIDU 2VIPA 1EPTA 5ETXA 5FX6A 3TGKE 2FYQA 1RD3B 1TIOA 1K1JA 1JRTA 2EC9H 4ZHLU 1A3BH 3ZZBA 3PWBA 2Z3CA 3HATH 1GWAA 3DD2H 3SBKA 2BY8X 1GI2A 3GDUA 3A8DA 3RC6A 2YOLA 1C2GA 1OOKB 4ZUHA 2PLXA 1ZMNA 3QTVH 1AFQB 2BDBA 2FEQH 1K1NA 3RXOA 1QB6A 1CSOE 1C2EA 2W7UA 3SGQE 2O9QA 2QIQA 1B0EA 4YLQH 1EOLA 2FODA 3N99A 3UR9A 3FANA 1KSNA 3ZVEA 2F43B 1BRBE 2A1DB 3MFJA 4WY3A 3NPSA 1O0DH 1LHGH 3KEEA 4P02A 2XBVA 4GHTA 3SV8A 1TNJA 1QBNA 5L2ZH 1HAIH 1CVWH 3SW2B 3E90B 2OK5A 1FAKH 2SGDE 3D49H 1SGQE 3MU5A 2H2ZA 1C5LH 2VBCA 1QQUA 1HJ9A 2M2AA 1O3CA 1C1RA 1W11U 2YNAA 4WWYA 4WMDA 2BX3A 1KXAA 4WVPE 1P3EA 1GBJA 2BVXH 2F9PA 4ISNA 6CHAB 1G9IE 1FIWA 1BCUH 1XUFA 4GSOA 1U6QA 1LO6A 1C1OA 2KR7A 4B2AA 1CHGA 5C3NA 2VWLA 2VVVA 1LCYA 2ZTYA 1TABE 2QF0A 3WWBA 1NBMD 1ZR0A 1HAXB 2F9VA 1DLEA 1FY5A 2QGRA 1CBWC 1PQ5A 3PLBA 1C5XB 1ACBE 2F3CE 4X2WA 1WCZA 1INCA 5A09A 3SOSA 3RXGA 4AYVB 1W13U 2HRVA 1D3DB 4X1PU 5CHBA 2A4QA 1M9UA 1ZOMA 4OS5A 1FAXA 3RXVA 1ELDE
chains in the Genus database with same CATH topology
1A0JA 2XW9A 3P92A 1NU7B 1LVMA 1SQAA 2GKVE 3MU8A 1YC0A 1BHXF 1YGCH 1TGSZ 2VJ1A 2F9UA 4Y6DA 1GG6C 3MWIU 2FZZA 2OC1A 5PTPA 5A0CA 4ABFA 2D26C 2NU4E 1V3XA 2A2QH 1EB2A 1IQKA 1TPAE 2ODPA 3E3TA 3RXDA 1O3OA 2FS8A 3Q3KA 4YTAA 3WY8A 4FUCA 1YPKH 2HPQH 1JRSA 1O3HA 4D9RA 2THFB 1O5AB 2ZKSA 2OQ5A 3S0NA 5EG4A 5GXPA 3A86A 1Q3XA 1OWJA 5FPSA 3K6YA 1ARBA 1SR5C 4U2WA 2ZQ1A 4YT7H 3ZVAA 3STIA 1ZGIA 4DGJA 1RIWB 1C2IA 2WUBA 1NO9H 2PSYA 1P0SH 1A0HB 1FY8E 1ZTJA 2IPHA 1AHTH 2ZFFH 4UEHH 1NFXA 1O2RA 1SGIB 5DP4A 5L30H 1T4VH 3LGIA 2TGPZ 4FUEA 3W94A 4XSKU 4IN1A 4J2YB 3LGWA 2JH0D 3MH4A 1FDPA 1L1GA 3SU0A 5DO4H 1SGRE 4HFPB 1XVMA 2OTVA 1G32B 3T27A 1WQSA 1F5LA 1P2IA 1UHBA 3AAVA 2QC2A 2ZTZA 3GICB 1VITF 1MZAA 4OS2A 1ELVA 1EP6A 4I33A 2HOBA 1LMWB 1TB6H 4Z6AH 1O33A 1KYNA 3RU4T 7GCHG 2FO9A 3Q00A 1WQVH 3DA9B 5EPYA 1TBQH 2Z9KA 1O3JA 3ZVFA 5E2OA 5DG6A 2G51A 1ZRBA 2ZZUH 2A5AA 3EA9A 1QB1A 2O8WA 1ZLRA 3UQVA 1GHBG 2H9EH 3KF2A 1GCTC 3ZZ6A 5L6NH 4FUHA 1K1MA 3ITIA 1O5DH 3QDZB 1HLTH 4KGAA 1Y5UT 3MNSA 1TX6A 1ZSLA 1F0RA 3P70B 4MTBA 1SG8B 1NFWA 2WPMS 3EGKH 3V12A 3ATWA 2ZDLA 5FX5A 3PYHA 2BTCE 4X8SH 1TALA 1HB0B 1WTHD 4DCDA 3ZZ3A 1TAWA 2SFAA 2PUXB 3RXFA 1FZZA 2OCVB 2ZDKA 4NWLA 9ESTA 3MH5A 4X6PA 2ODQA 3M5LA 1SOTA 2H5DA 1G3CA 1W2KH 3GYMA 1ZHMA 2GZ8A 1O5GH 3BN9A 1THSH 1BBRK 1BHXB 2G5VA 3A88A 3RMLH 1MAYA 3P8OA 1GHAF 2H9HA 2PR3A 2GZ7A 1JXPA 1O35A 5E0JA 3P6ZB 3M7TA 4M7GA 5I46H 1KY9A 1T8NA 1O2VA 1GJ9B 1DWEH 4WH6A 5LPEA 1CE5A 1N8OB 1CGJE 1CA8B 2SGFE 1F0UA 1FY3A 2FDAA 1BZXE 3M7QA 5FCRA 1AWHB 1RFNA 2R0KA 2SGQE 3B9FH 2RA0A 1FQ3A 1O38A 1O2ZA 1XXDA 1F7ZA 1KDQA 3FVFB 1MTUA 5HM2A 1DM4B 1TX7A 1C2LA 3ZZAA 4JZFH 1Y3XA 5GPIB 4CBOA 3TVJB 3NK8A 4AG1A 1ANDA 4TYDA 2BX4A 4D76A 3RXSA 1CHOG 3GCHB 4MPWA 1C5SA 1P09A 1SHYA 3BTTE 1BRUP 3STJA 5F8XA 2ZDAH 3A7VA 1HAVB 3ELAH 1QBVH 1W8BH 4FXGH 3RLYH 4Y0ZE 3I77A 2J2UA 5AFZH 1C4U2 1QIXB 2K1QA 3T2NA 3BF6H 1XUKA 1E0FD 4DURA 1TMUH 2GCTB 4SGAE 4FUIA 1O3BA 1S5SA 2A2XH 2P94A 2ILNA 1C1MA 1C5YB 2AGGX 1C4V2 3PB1E 7GCHF 1NFUA 2XRCA 4TY7A 3S7KB 2OINA 1MKWH 2GTBA 2UUKB 5AVDA 2ODYB 4ABHA 5LPRA 4E06H 4XDEA 1UVTH 1YBWA 3VXEH 4DJZB 1DUEA 1LPKB 2QY0B 1H9IE 2FM2A 1AGJA 1P2KA 1C2KA 2Z9JA 1GJ4H 4Q2KA 2FMJA 2G5NA 1EB1H 1GHBF 3H5CB 1TNHA 3PO1B 1GVZA 4AFUA 1D6WA 1P9UA 1E36B 3TK5A 2FLBH 4YOIA 1EZQA 1UVOA 2J4IA 2ZU1A 8KME2 1AZZA 1DFPA 2AYWA 2BLWA 1AKSB 2ZGXH 2BDHA 3BTWE 1BBRH 4B75A 4R8TB 4IW4E 2C3SA 1YP9A 4Y71A 2XCFA 4VGCC 2ANYA 2CV3A 1RS0A 1YPMH 2OUAA 3PM3A 1SGPE 3IWMA 1W3CA 1GI6A 1PFXC 3HPTB 1O5BB 5E8EH 5FPTA 3GCTF 1DY8A 2Y5FA 2PGBB 3V7TA 1GJ7B 1H4WA 4X8VH 2ANMH 4AOQA 2TBSA 5DP3A 1ARCA 1IQFA 1HAYB 3P17H 4SGBE 2BY9X 3M3VA 1XVOA 1DWBH 1TWXB 1ZJKA 4B71A 3SZNA 1O3EA 1EJNA 1O3MA 2BD5A 4CBNA 1P02A 5HXFA 2PW8H 2ZU4A 2FOHA 2Z9LA 3P8NA 1YPEH 3RDZA 3RC5A 3UPEA 1SPJA 1HGTH 1AFQC 1UVUH 3TJVA 3P95A 1OPHB 1G2MA 2BY7X 2GGVB 2SNVA 3OY6U 4GLYA 1ZTLA 3LJOA 3LDXH 1BQYA 3KL6A 3SN8A 1TNKA 1VZQH 4ISHH 2M5TA 1UTPA 1GJ6A 1CO7E 1GMHG 2AERH 1SVPA 3VB4A 4CRBA 1C5ZB 3AW0A 1UJ1A 3SI4H 4U32A 2GCHG 3GDSA 3V13A 2BD7A 1IQLA 3ZV9A 5EPNA 4K8BA 3CENA 4KKDA 4XOJA 1WBGB 1DUAA 1P01A 9LPRA 5T6DA 1DANH 1AI8H 2I6QA 8ESTE 1BUIA 1CHOF 1JWTA 3MU0A 1E34B 2WPHS 1F0SA 4MNWA 2QA9E 2O8UA 1EASA 4Q7ZA 3ZV8A 1JMOH 1UTMA 3M5NA 1IQGA 6CHAC 2A7HA 1OP0A 4FU7A 2BDAA 1DSUA 1GBKA 5EW1H 1A3EH 1OSSA 2ZG0H 3M37A 4RSPA 4X1QU 2OP9A 3MTYA 1MAXA 1TGTA 4IGDA 1W14U 3F1SB 1O3PB 2AGIX 3M7UA 1BTPA 3FAOA 1HAPH 2Y82A 1BA8B 1O31A 4I8GA 1PPZA 3Q76A 2Q1JA 2TIOA 2BY6X 3A84A 1DY9A 1C2JA 4UE7H 1BIOA 3T26A 1NFYA 1ABJH 4GUXA 3TK9A 1C9PA 2FLRH 1K1OA 2PUQH 1O3NA 2Q6FA 3A7YA 4ZKSU 4UFEH 1EXFA 4NG9H 5ESTE 1G37A 4BNRA 5C1UA 5JBAS 1SLXB 3ODFA 2D2DA 4GHQA 4NFFA 1KTSB 1IQJA 1QJ6B 1SQOA 4KELA 4CH8B 4BAOB 3MI4A 2W7SA 2JETB 4FVDA 4A1TA 1MBMA 1J16A 4MNYA 1L2EA 3QX5H 3GY3A 3ZZ8A 1SGDE 1GMCG 1IQHA 4JZIA 1ELFA 1BTUA 2VWNA 4IMZA 3G01A 1SL3A 2BMGB 3A85A 1ZJDA 4QT8C 3LGTA 1OXGA 5LH8A 1MUEB 1S82A 1L1NA 4ABIA 1GBBA 1Z8RA 1RIWC 4CRCA 1N6YA 3EDXB 5FPYA 1ZSJA 1PQ8A 2AFQB 1O2NA 3LC5A 1O2JA 4NGAH 2ZC9H 2FOBA 2FWWA 1T4UH 1MH0A 1F5KU 5HMAA 2WV4A 4WF8A 3E6PH 3PMAB 3Q3XA 4LZ4B 3TITA 1A5HA 2R3UA 1J17T 1GJ8B 3OX7U 1NRQH 1G30B 3ZYEA 1WUNH 3QGNB 1LPGB 1HAHH 4I7YH 2ZU3A 4AB9A 2ZPRA 4AGKA 1SBWA 2OC0A 2BXTH 4D7GA 3KCGH 2CGAA 3EE0B 1DX5M 2LPRA 1C1PA 3QZQA 4A1VA 1VCWA 2Z3EA 3T5FH 3UFAA 1MMJN 3RXPA 5EOKA 2A32A 3D23A 4THNH 5JBTA 1NC6A 3LGYA 1AIXH 1NM6A 3RP2A 1EPTB 3RXLA 2B9LA 4Y8YA 3SO3A 4CH2B 1ZHRA 1IQNA 1TMBH 3T62A 1DPOA 2BLOA 1V2JT 4FU9A 1MTWA 3FZDA 1V2RT 2W5EA 1AFEH 2DE8A 2R9PA 1GI1A 3BG4B 1G36A 1F5RA 2BLQA 4FUDA 1H9HE 2BD4A 3MOCA 4U01A 2CJIA 3BTKE 3T29A 5T3HA 1O37A 1G3DA 4X2YA 2VIVA 4MG3A 5GDSH 3VPKA 5CHAB 1HAZB 4D9QA 3UNQA 1O3FA 4MPXA 1VGCB 1BB0B 1IQEA 2BQWB 2BD9A 2XC4A 3OTJE 4A1XA 4GAWA 1N6XA 2J95A 5EXLA 3NCLA 4I32A 4K1EA 1L1JA 1XMNB 2ZECA 4O3TA 2V0BA 4CRGA 1P04A 2P16A 1IHTH 1CA0B 1MD7A 4AFSA 3TGJE 1MTNC 2AMDA 1GHVH 2V3HH 1N8OC 1FXYA 1C5MD 1QL9A 2P93A 1V2KT 2XTTB 4H4FA 1C2MA 3TLOA 1GMCF 1SB1H 1HBTH 1HJAB 2QXHA 2J38A 1QRXA 1C1NA 1KLJH 2BQ6B 2OXSA 2ZP0H 1K1PA 4FUBA 1KXCA 4I8LA 3BV9B 3GDVA 3PLPA 1AUTC 4KTSA 4NSVA 2QXJA 2VB0A 1QQ4A 2QCYA 2QV1A 3MH7A 1OWKA 3TJOA 2ZEBA 1BTXA 1AY6H 1Z71A 1V2MT 3GCHC 4ZAEA 3SJOA 1QB9A 5BRRE 2ZQ2A 1O2MA 3U9AH 1PPFE 1SOZA 2UWPA 1GI5A 4NIWA 3DT0H 4ZROA 3ZZ5A 1HNEE 3FFGA 2XYAA 2G55A 4RKJB 4JZ1A 4A5TS 2AH4X 1NPMA 2B8OH 5IYTA 2AIPA 1C1QA 5DP8A 3M36A 4JK6A 3BTFE 1UK3A 4Y7AA 3F9FA 2GCTC 3SV9A 1YPHE 7LPRA 4OS7A 1BDAA 2ZF0H 5LPFA 3ATMA 3RMMH 4GCHG 1UTLM 1ELEE 1EP5A 2R2MB 3OYPA 4CHAB 3QZRA 4B74A 1GGDB 2G52A 5EQQA 4AFQA 1W10U 4WH8A 3ZVBA 2UWOA 1XM1A 4TPYA 4CRDA 1DT2A 1GHYH 3A81A 3HKIB 2F9OA 8LPRA 1B7XB 2CHAC 4OGXA 2BY5X 4ABAA 2ZHDA 2VWOA 4K3JA 2GDDA 3E16B 1B0FA 5L2YH 1HAGE 5FBEA 3VB5A 1K1LA 3PO1C 2ZHWH 4H6TA 2FP7B 4A92A 3F9GA 4BXWA 4IMQA 3RXQA 1ETSH 4KTCA 6GCHG 3I29A 4ZKOU 1NRPH 3JZ1B 3LH1A 1ESBA 1TGNA 1SMFE 1F2SE 1W7GH 5DP9A 1UTNA 1RXPA 2Y6TA 4ZKRU 1UHBB 3M3TA 3RLWH 2W26A 1NRSH 4D8NA 1T7CA 1MTVA 1DDJA 3MO6A 3ZYDA 1FN8A 2A45B 2G81E 1QHRB 3GY4A 1MKWK 4ABGA 2A4RA 4LK4A 1HXEH 5CMXH 3LIWA 2XBYA 1S81A 2J34A 4PROA 3LGVA 1BTZA 2FTMA 3RXIA 1BRCE 1AE5A 1NY22 1HPGA 2D1JA 4X1RU 1PJPA 5DP5A 5EQRA 4X6MA 3AAUA 1RTLA 2BVRH 4JK5A 4OGYA 3U1IB 1TRNA 2WPLS 4X1SU 1XUIA 2EEKA 1E38B 1FY1A 1GBEA 1MKXK 3SUFA 1DSTA 3TPIZ 2FI4E 3U8RH 3GOVB 3V3MA 4AORA 1P2NA 4FVBA 1KXDA 5FAHA 1D3TB 1VJ9U 2EI6A 2G4UA 5DP6A 2C8ZB 1AU8A 2VGCB 1EZSC 1GBHA 5GJ4B 2FX4A 1YLDA 3SU6A 3HGNA 3SU2A 3NZIA 5A0AE 5JB9S 1HRTH 2AMQA 1GBDA 4OS4A 1ZYOA 3CS0A 1ELAA 6LPRA 1FPCH 2FTLE 4ZKNU 3TJNA 1PPBH 3E91A 1C9TA 4WMEA 2BZ6H 4H42U 3K2UA 1A61H 4RKOB 1GJ5H 4TPIZ 1DITH 1YLCA 2WPJS 2KAIB 1AE8H 2V3OH 3SORA 1LDTT 4E7RG 1ESTA 2NU2E 3QWCH 4UFDH 1KXFA 1J9CH 1HIAB 1N1LA 1G3EA 2H9TH 1NS3A 1P10A 1O5EH 2F91A 2BDYA 2B5TB 1NTPA 1A2CH 3RXJA 1C5RA 1V2OT 1ELCA 4E7NA 1D4PB 2BQ7B 4MQAA 1FLEE 1YM0A 1C5PA 2CXVA 1WV7H 1GG6B 2C90B 2GT7A 2OD3B 4INLA 1YCPH 3F6UH 1UO6A 2OBQA 4INHA 5A8ZA 1H8IH 4ISOA 2VU8E 3VB7A 3S7HB 3VGCC 1MCVA 3SI3H 1KDQB 3A8BA 5JYIA 2OC7A 1IHSH 3UREA 5K0HA 1YKTA 4B73A 3KNXA 8GCHG 2XBXA 3RC4A 1AZ8A 2BB4A 1V2VT 3A80A 4OS6A 2Q6GA 2J92A 4NA7A 2XCNA 2B7DH 4Y8ZA 5E0GA 3U1JB 3MHWU 4BOHA 3BEIB 2JETC 1P57B 2AGEX 1CGHA 3SU5A 6GCHF 1FONA 2HPPH 4O97A 1K28D 1YPLH 3M5MA 4DVAU 3SNBA 5AHGH 4WXVA 2BDGA 1YPHC 2DUCA 1C1VH 3UQOA 3KQDA 1QRZA 3MU4A 1CU1A 2ALPA 3HKJB 4GVUA 1WTGH 4XBDA 1TMTH 3RXAA 1JOUB 3KQEA 1MKXH 1S6HA 1PQ7A 1V2ST 3CS7A 2GMTB 3NXPA 1UVPA 4UFGH 3B8JA 4DY7B 2UUJB 1O2OA 2ZA5A 3RXUA 4HTCH 1A46H 5C5OA 3RM0H 1WAYB 4YM9A 3UWJH 1ZPCA 1UK2A 2GD4B 3M5OA 1MQ5A 1RJXB 2OC8A 3W95A 2HNTF 4AB8A 1UCYE 3ZZDA 5EQSA 2XC0A 4DG4A 1YF4A 2PFEA 1Z8IB 3A8CA 1P9SA 3M61U 2J9NA 3ESTA 2AEIH 3PROA 3S69A 3NWUA 3SQHE 1Q2WA 3PV4A 3A7XA 1UVSH 1L4ZA 2ANWA 1GMDG 4XE4A 1TNIA 2BOHB 3K65B 4NSYA 1DVAH 2QYIA 1O3GA 3OSYA 4I8KA 4B2BA 3MNCA 3TNTA 1GL0E 3GY2A 4K2YA 2VIOA 1EQ9A 3L33A 1QTFA 3F68H 4WJG2 1T32A 1Y5BT 1H9LB 3HK6B 3NKKA 4HI3A 1UTKA