1V37A

Crystal structure of phosphoglycerate mutase from thermus thermophilus hb8
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
171
structure length
171
Chain Sequence
MELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAELAGFSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLALD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphoglycerate mutase
publication title Crystal structure of phosphoglycerate mutase from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Isomerase
total genus 59
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 5.4.2.1: Transferred entry: 5.4.2.11 and 5.4.2.12.
pdb deposition date 2003-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1v37A00
4PGMA 2F90A 2OWEA 3ZHCA 4AROA 1H2FA 2H0QA 2P9YA 3D4IA 4FDTA 2HHJA 2P79A 3K4QA 1UJCA 2QNIA 4ODIA 4D4LA 2RFLA 5AJVB 1H2EA 2P6OA 4JOCA 3OI7A 2ENWA 4PZ9A 1DKLA 2P9ZA 4JODA 3PGMA 4PZAA 1ND5A 1XQ9A 3F3KA 2WNIA 2A9JA 3NTLA 3QPWA 2DWPA 2H4XA 3C7TA 3LNTA 3FDZB 4ARVA 3BIFA 1TIPA 4TSRA 3E9CA 4EO9A 3HJGA 4D4MA 1FBTA 2H52A 2YN2A 3K4PA 1E58A 2IKQA 3GW8A 5AJXA 1NT4A 3QPUA 3DB1A 1BIFA 3GP5A 4IJ5A 4ARSA 1EBBA 1RPTA 2PA0A 2ENUA 2OWDA 2AXNA 5AJWA 3FJYA 2P6MA 1IHPA 3O0TA 2P77A 3NFYA 3E9DA 4GPIB 1SKAA 3IT2A 3R7AA 4D4JA 2A6PA 3EZNA 4E3WA 2WNHA 1SKBA 1YFKA 5CDHA 1DKQA 1CVIA 1RPAA 2GFIA 2P30A 4JOBA 1DKOA 3F2IA 1YJXA 1FZTA 1DKMA 1DKNA 1QFXA 1C80A 1RIIA 1QWOA 4GPZA 1V37A 2EKZA 4EMBA 1C81A 3GP3A 1K6MA 2HIAA 2BIFA 2P2ZA 1DKPA 4MA4A 5CX4A 3E9EA 2HPAA 3EOZA 5HTKA 3IT1A 3IT3A 4ARUA 1SK8A 2P9FA 1BQ4A 2I1VB 5PGMA 3MXOA 5AJYA 1UJBA 1SK9A 5HR5A 2DWOA 2WU0A 1ND6A 1C7ZA 2P75A 4QIHA 5CU7A 3D8HA 3LL4A 3FDZA 3D6AA 2EOAA 2YN0A 5AJZA 4D4KA 1E59A 2H4ZA 3LG2A 5AK0A 4FDUA 4IJ6A 3KKKA 1T8PA 2P2YA 3MBKA 4HBZA 1BQ3A 3QPVA 1QHFA 3IT0A 1V7QA 2EKBA 3DCYA 2P78A
chains in the Genus database with same CATH superfamily
4UUPA 3DAFA 1WUIS 1QLJA 5CHYA 4HUTA 2G9RA 4WW0A 4FE3A 1K4YA 1ZVQA 4OATA 2HCJB 3CR7A 2NO6A 3TZQA 3U16A 1S4QA 2RGBA 3U0VA 1JDNA 2KX7A 3D4IA 4R84A 3CF0A 5A2QA 4G65A 4CM9D 2P79A 2XMDA 1GNSA 5AM4A 1HM5A 3NGLA 2A1IA 1YB1A 2EWMA 1MUUA 1JUDA 1U9IC 3DZFA 1H2EA 3JQCA 4UBMA 2QT9A 4MB2A 2ISQA 4MSUA 1RQNA 2ENWA 3NATA 4MKGA 4YJGB 1PQWA 3GMSA 4ENSA 3G0BA 4AW9A 2XOXA 5EUCA 5JANA 2Q1WA 2V3WA 4NEQA 1Y7PA 3ZI0A 1WY7A 4NE2A 4YJDA 4E46A 2G83A 1Q1ZA 4Y2RA 4JB3A 4JLNA 3REFA 5KYYB 1X70A 2X41A 2WAXA 1KJNA 4DCJA 3FPLA 2DZDA 3PXDA 1IXYA 2M32A 2RI1A 3M9WA 5HS6A 1P45A 5IKEA 5A02A 1TJ3A 2EAUA 2JA2A 4I55A 4OYLA 1Z8DA 4TQUS 3SYRA 3W9SA 2AQ8A 1E2FA 1CETA 2L82A 3F6YA 3HJGA 2XZLA 2NNLD 3HYTA 2OHVA 2VJMB 4RF2A 4BTEA 1XTZA 1DOZA 5ECWA 4XCXA 4OD0A 2ODEA 3FBWA 4FC7A 3AEKA 1LPPA 4XUGB 1MIOA 3FJYA 3LY8A 4Z7QB 1GWNA 1KSHA 1WKVA 3A1TA 4Q9AA 5DYGA 1MQ9A 2PX2A 1CZNA 3DSRA 2VHZA 3B2QA 2RONA 3EGCA 3PPIA 3AL2A 3HO8A 1ZITA 4IDPA 5LZ8A 4QM6A 2OO3A 4B73A 1PP4A 1SNYA 4GYYA 4W7HA 3SIRA 1PEDA 3C5HA 3O91A 1U0BB 1RKQA 1TPZA 2MR6A 2J5KA 3QTLA 4MDYA 3KZKA 4HNVA 2JK0A 4BFWA 1JR2A 1RFLA 1N33B 5E7MA 1QVAA 4D0GA 2BMEA 3IILA 1VIAA 5ER6A 4MUXA 3PR2B 3KR0A 3U7QB 2EW8A 4W5HA 2VDKB 3N6RA 2WLSA 2DWUA 2O5CA 2E87A 4KKXB 5D1HA 4QLAA 2LUOA 4PYLA 1G7SA 3K9FC 3KB6A 5AKHA 4PNZA 3B38A 2JI8A 2BYTA 4RD3A 1RD4A 4LHXA 1U8TA 2UZAA 3CLUD 4IDGA 4O4LA 1FLAA 4GD3Q 4K03A 4NQRA 3SXUA 2V3CC 5EJ7A 2P9FA 1Z4QA 3KP1A 1P0MA 1Z2AA 2YFKA 3WB9A 1FMJA 1D2CA 2GZ3A 1K7XB 3DMTA 1OV6A 1SK9A 3P4YA 3JATA 2GH1A 3KLPX 2QSYA 4UPEA 4D6YA 5SV2A 1YD7A 4MRRA 1JQ3A 2QTLA 5H7XA 1SZJG 2O8EB 1GZUA 4MV7A 2QJFA 2CCJA 2PKXA 5ANRB 4ZVVA 3WXBA 1KYQA 2ZRGA 5KJ6A 3KVRA 2HR1A 3MWLA 4YP0A 1QYWA 2C3YA 4OTZA 4ALLA 2K87A 3AM1A 5DGIA 2X8LA 3ZHBA 1V1MA 3BJMA 1ZD2P 1P0IA 1SQFA 2QM7A 3ADOA 3K1AA 3SZGA 3S6JA 4CKBA 1ADFA 1E3WA 1M0EA 3QTTA 3VC1A 1IN8A 2JK1A 1V7CA 2WA2A 3ZLJA 3RT1A 3REOA 1QAQA 4N54A 1W4BA 1P7YA 3KSMA 1Q19A 2I1LA 3EF1A 1NVBA 1SCBA 2VNKA 3LSTA 4DGSA 5LZ2A 2ZWMA 1YHNA 4NE9A 3HUTA 4LYYA 4AC9A 1CUXA 3E05A 4L08A 5KTOA 4LVOA 3U56A 3D7SA 5AM0A 1GZVA 4Z1MD 3DONA 3LDHA 2IYLD 3MJSA 4D2IA 5T6BA 4TX1A 4J0IA 4WY2A 4GI7A 2ZUTA 1QGYA 3VR6D 3ZU5A 1IZZA 2OHJA 3R7DA 2QVZX 1HZZA 4M37A 1R8XA 1P0FA 1CS4C 1C3OB 2I87A 3GA7A 3ZV5A 3C7TA 1EXVA 3M33A 3QGMA 2WT8A 4B45A 2Y9PB 3I52A 3G85A 1Q6YA 3ZS8A 2PJRA 1LJLA 3OT4A 1IM2A 4RFSB 2GAFA 3L8HA 1VZ3A 3KVVA 3RVKA 1A9TA 3DOEA 4BVBA 4HCJA 3BK1A 4FHGA 3HGTA 1Y5LA 4MKXA 3GZ4A 4N7JA 4U8HA 3NBFA 4W9MC 4B7ZA 1ZRMA 5FF9A 3MBIA 4CQLA 1UM9B 2FZ4A 1TQ4A 2VP5A 4HYYA 4IZIA 1DBWA 4RO0A 1L4EA 1OZAA 2ZJAA 3BOSA 3RG2A 3T34A 1GY8A 1IOZA 1LB1B 1DEOA 3INYA 4TL8A 3Q0EA 4LN1A 4AY4A 4QFMA 3JQFA 4BQIA 2WJ6A 2FPOA 3FUUA 3NS7A 3U7RA 1JYSA 3IE1A 1XD2B 2CMKA 3EZ2A 2C4UA 3CW9A 1LVHA 3T4EA 4BX0A 1OH6A 5K3FB 2ZB2A 3GEBA 4IW3B 5U1PA 4ZYTA 1TK3A 5AVRA 1WBBA 3IVGA 3WOHA 4HS4A 4YIHA 4AQ7A 3MINA 1S2LA 1NURA 3V4FA 4DIOA 2IUSA 1T43A 5A5EA 3ESCA 3N2GA 2NQ2C 2XT0A 4D3YA 3KE8A 4A6XA 4MI6A 1MAHA 3OWOA 1J7JA 2VP0A 2WY2D 1WVIA 1R64A 1E5DA 4G63A 1ZUNA 1WXDA 1IE3A 5EL0A 5EUMA 3UMBA 1NBWB 4EFKA 3EXFB 4FHFA 1Z7BA 4J7XA 1RXWA 3A3KA 4UASA 3SKXA 4F9GA 3NOVA 3I45A 3S2ZA 3EK2A 4MWZA 4DCOA 4KO4S 3HXOA 5DTMA 2GK3A 3REQB 2CJXA 1K5PA 3RRNA 1QRTA 1H0SA 5IC5A 4OU4A 4HKTA 3A1FA 2W6NA 2IUYA 4HTFA 3HADA 1PFYA 4X7PA 1D8AA 3AVUA 1SZCA 5ALRA 4AYWA 2H1RA 1PU2A 4UCWA 5CT9A 2GBGA 3NIFB 5HBGA 4U0JA 3T3EA 4LWZA 5IN5A 3WYBA 3W78A 1KEKA 3AL3A 2VOJA 1Y1SA 2QRJA 2XIQA 3CSSA 3ZXXA 1E69A 5K8UA 5GADl 3UC5A 2I6QA 3C48A 4MA5A 4I8XA 3DDUA 4J2OA 1KXJA 2LP4Y 4LXYA 3L82B 4MV1A 5IZCC 4N39A 4PQGA 4D4KA 3FGNA 2FSIA 2INGX 1EVJA 3PFIA 4OXNA 2H85A 1JU3A 1FC0A 1Q77A 3B1VA 2P2YA 221PA 2CYCA 1L5HA 1KL7A 1BDBA 1XZAA 2E1RA 2X0DA 2F8SA 1OIWA 2EJCA 2OCAA 1IMOA 4EW6A 5LZ7A 3PKJA 4GECA 2PX6A 2VDOB 1IPFA 4BMZA 5DNWA 4JGIA 5J4KA 4AJJA 1OAOC 3RFVA 3UFXA 5HF5A 4BV9A 3CE9A 3JARA 4PCLA 1KE1A 3FNBA 4LE2A 1HF3A 3RGGA 1OLSA 4DQXA 5TT0A 3BD7A 4FGLA 4EB3A 2BMFA 5EPOA 1SVMA 3L41A 3KKMA 4HP8A 3Q3GE 5EXEA 2OPBA 3ZDFA 5IWCA 2ZBPA 4EJSB 3NV7A 3T38A 1XCOA 3JQQA 2H9AA 3L2OB 1U8EA 2AHRA 1JKMA 5NLLA 3ZQUA 3ITDA 4EYSA 3QX7A 4ZJYA 4Y2JA 4G0VA 4MS4A 3RAEC 4RPGA 3ROTA 5AK4A 2HFJA 5K99A 1NN3A 4MGKR 3T1OA 5KVSA 2HGSA 4KMRA 2R751 4EUFA 5CGQB 3MHPA 1ODIA 4CTJA 1A5ZA 1PVVA 1T1GA 2Q5IA 1TLLA 3E8XA 3P2KA 1EXNA 3CEAA 2J41A 2O3TA 3EIWA 3RE1A 2I6GA 4L5CA 3H8SA 4JVOA 4UTNA 4BKMA 3CURA 2GPSA 3HNOA 5IP5A 3M6XA 3WL8A 1Z37A 2OAP1 4HX5A 1IB6A 1KWGA 2I2BA 1J06A 2W83A 1GSAA 5D01A 4ZAYA 1L7XA 3DFIA 5CB8A 4WZBB 2B69A 4TVKA 1Y4AE 2Q1UA 5DBOA 4IBOA 1ZKDA 1NWHA 4B33A 5HMLA 4EHNA 3LTEA 5B6IA 2H1WA 1BRMA 3KKQA 3ZNQA 4PF1A 5ECDA 5LA6B 1YR6A 2VT2A 5FWYB 4HLUA 1HDRA 1UODA 3LHKA 4KVZA 4NG5A 4TMVA 3JQ7B 5EIAA 2ONYA 4D4JA 2R65A 3OUTA 3P1JA 4UW9A 3BXZA 3KJNA 2EG5A 4OHKA 3S4YA 4LXHA 4A16A 3ITNA 3OLZA 4K6MA 2FP4B 2IPAB 2W0MA 2XVYA 3OHSX 3PNMA 3NYWA 3RODA 3AYZB 3HV0A 4KAFA 4DLVA 4P35A 1MQAA 2AD5A 2QZ9A 2V1XA 3EDOA 3FYDA 3F6BX 4QPCA 4X44A 4DV4B 1G3QA 4DCPA 1OVMA 2ZR7A 3BHJA 1NVTA 3DO5A 3EG5A 3N2YA 1FCJA 2C5AA 2ODPA 2BC9A 4CT4B 4YT4A 4IDDA 5JMOA 2HIAA 4LF8B 3PFGA 1G3IA 1NE7A 3IP3A 2R6AA 3BGSA 1IPEA 1J0XO 4GMFA 3DOHA 3I2FA 3Q5GA 1DIAA 1VFPA 2ESRA 4FYJA 5GWXA 1K1EA 1REQA 2RHCA 1R6UA 3HDGA 3HCWA 3NC4A 2Z9CA 1PJCA 3I6BA 4AS3A 2XZPA 1H2XA 5J5CA 2A2ZA 1JVSA 3PNVA 4M22A 3QI2A 4QU9A 521PA 3O74A 1ECFA 2V0GA 1ZUIA 4BGEA 3R7WA 2QQFA 4BWVA 3BCRA 5G53C 1R7RA 2DMRA 2WWXA 3H4MA 3R4CA 2I3DA 1ODFA 4L4SA 2B21A 2EZUA 2GEUA 2O1WA 4CDGA 3NUGA 4DZTA 4P5DA 4ZV9A 2VATA 1SC6A 2P9GA 3Q41A 4OUDB 2AG8A 5DSXA 2WU1A 3TRIA 3RROA 1Z33A 1Z38A 3AZOA 2G6BA 2ORWA 3CNQS 4REOA 1U2PA 1AZTA 3PRJA 7ABPA 3DJYA 1DARA 1IRXA 4KXFB 2DECA 3PLNA 3ZGOA 2IP1A 3HZZA 3EGOA 2JLAA 2BFAA 2FVXA 2W6IA 2XHEA 3DZKA 3L7KA 3S2GA 4EEXA 5IULC 1NUUA 4R5HA 2A33A 2Z2YA 3LP8A 3OU7A 2F3QA 2IU0A 2XMBA 3C4QA 4K6FA 2FQ1A 2FQQA 2X5XA 1KFCB 1T2EA 4JC0A 4N6NA 4QTTB 3SDZA 3WSWA 4OA8A 4XAQA 3F7TA 3QFRA 3K35A 4DWWA 2OILA 3AC0A 3MYYA 1U9IA 2VJKA 1ACJA 3BQMB 3QNWA 3ZYZA 1SVOA 4K0KB 1PLKA 4OKNA 3QEMA 2O2GA 4IF6A 1T2AA 2G4LA 2W6JD 4JLAA 2QOEA 2EX1A 4MTLA 3OCUA 4J7UA 1XF1A 1QS0B 2IY9A 2SNIE 1JAHA 4NK5A 1GUBA 3SK0A 3RSHA 1TK9A 2Q5QA 2Q1XA 4Q3DA 1GT91 1FTYA 1N6RA 1Y9ZA 1MG0A 4JC4A 3MM4A 2Q1SA 2DT5A 2HTFA 2SKCA 2XUJA 4HYQA 4LJ5A 2AR7A 5FYQA 1UZMA 1I5RA 3EVBA 4KP7A 3ZDXB 3R9XA 3HUUA 2SECE 4YRSA 1WEKA 2R7AA 4W5JA 1C7FA 1KY3A 3TKYA 4EHJA 3FPSA 3IXMA 4FX5A 2H9YA 3REGA 2X4GA 3DKVA 4OK6A 4ZOQI 1DAMA 4BMSA 3AZPA 1N32B 4R2HA 4P84A 4XLLA 5HIAA 1KVUA 4ON9A 3NHSA 4DREA 4L3OA 4HVCA 3CG4A 1NOIA 3GLTA 3QYAA 1P3Y1 4URUR 3E70C 5KOIA 4OOEA 2H51A 3F6EX 1IQUA 4UE6A 3NWEA 5DJ5A 2CMDA 2ENUA 1BVUA 4OHCA 3T41A 3CCFA 2A9PA 2Z9DA 2TRSB 3MD9A 1L4GA 2YCBA 4K9PA 4KXVA 2PXAA 3FR8A 3SJAA 3ZW9A 2V5UA 1V4VA 2P3SA 4G5FA 3D5TA 1AF7A 1T0JB 4B84A 4C7KA 1L7QA 1YDFA 3B9PA 1NW8A 4XZ3A 4LDZA 2WD7B 3SHOA 4DY6A 1E7SA 1A88A 3WNBA 1YJ5A 3ZNOA 4RF5A 4IIUA 2CDNA 3BFXA 3OPYA 1D1SA 3FSRA 1HO3A 1W8IA 1FOEB 4EKDA 2OYCA 1IHUA 1T0IA 3MOSA 1KIFA 5AK3A 3WFJA 1G5RA 3CX3A 4WFQA 5FV7A 5LOVF 2GJ4A 4K0RA 3R7NA 1U3FA 1DOHA 4NBNA 3N2KA 2PYDA 3HJRA 5GZ1A 3LY5A 3QWFA 2MCFA 2W2QA 2Z8XA 1E9EA 4RENA 3U2QA 3M2TA 3Q7SA 4E15A 4WK0B 4RKEA 1UK7A 1JIVA 4UCFA 1BH6A 4CE6A 1E94E 1YZKA 5TARA 1AGRA 3GEHA 3RG8A 4X1OA 3I1IA 3R24A 1UJBA 3UB4A 4RTPA 1XZEA 3DPSA 3KT6A 2Q9CA 3RSGA 2HL6A 4BNVA 2V74B 2ZUSA 3I53A 5HPYB 1XMOB 5AW7A 4HZUA 2WQ7A 1XFDA 4C1NA 4R3NA 2EP7A 3FKJA 4JVSB 4QIHA 3GLGE 5LXTF 4FNGA 3WZ2A 2PG3A 3C45A 4RH3A 5AJZA 4I2VA 4QFDA 2C04A 1XQ6A 5AP9A 3E3LA 2OCPA 1DKUA 1HG0A 1GXSB 1FFSA 2ECPA 3PVZA 4UCQA 5ITVA 1ZGHA 1X1AA 3X2FA 3ASZA 3H3JA 3AR5A 1GSIA 1UWLA 1EFHA 1NKTA 3PL1A 4X1KB 1I2DA 4UVHA 3F47A 1U7OA 3UICA 5JIBA 1YXMA 2R4QA 5KWSA 4QARA 1IN7A 4QYIB 1AA6A 2B2NA 1MO3A 1GPBA 2HU2A 1YVPA 1RHRA 1TEHA 2V98A 5AI4A 3U7GA 1SB8A 4IJUA 2ZI4A 1AKMA 1NIJA 3ACBA 4DUPA 1U7DA 2C00A 2I4NA 4KLRA 1KZGB 1AKNA 3B48A 3LQ4A 3U7FB 3S2SA 1FNMA 1Z9BA 1HDIA 1HWYA 1UBFA 3EGDA 1P9NA 3HY4A 2ES4A 3L7OA 3PRYA 5FXMA 1VJ5A 2HSJA 2A58A 3KQWA 4UM5A 1WZCA 1PL6A 4NCJA 4R2JA 4L8GA 3IPCA 3MQ2A 1SQSA 3IPYA 2CFOA 3I5UA 4DE5A 1FP4A 2IDMA 4HT3B 3THWA 1LNQA 3AEQA 3AJEA 1QQ5A 4B74A 1HX7A 2PZGA 4FFLA 2JVKA 4DC1A 4DILA 4L8YA 1CE8B 2H2AA 2GXSA 2B3TA 1I4OA 2EZTA 3KQOA 4E03A 4F96A 2WTXA 1HE3A 1A0OA 1DEHA 1SCDA 3NNDA 2FDXA 4G4SP 5DYWA 2WUWE 2ZDHA 2DPYA 3EVNA 1I6MA 3RYIA 5LOVA 1FLDA 4EB8A 1NRIA 4XFDA 3VR3A 1T5LA 2W2TA 3OTQA 2C42A 1BEUB 3DKIA 1ENPA 2JH3A 1TYCA 4OGWA 4UHDA 3WZLA 5JS7A 3SSNA 5BSGA 4IO0A 4ARZB 4E22A 2X7HA 3A4IA 3DVAB 1KHHA 2P2SA 2HHLA 1G21A 2HQBA 2HXSA 4RIIA 1U5BB 1KIMA 1KJJA 3P9ZA 1YB5A 5M5BA 1YJ8A 5CXUA 1W46A 4I6JA 5FWXA 2F3UA 1NSYA 5IK2A 1JIKA 5E7JA 4OM8A 3T3HA 2V7UA 2OQIA 4WGGA 2CV0A 3B85A 1IJKA 2I34A 3ZI7A 1TXGA 2X77A 3D6MA 2V6BA 4G41A 3JYOA 1LBQA 3EQ7A 5LXTA 4HK4A 4OQFA 4D9MA 5BWNA 1NP6A 3WFZA 1JIUA 1Q17A 3M0EA 1YZFA 2HA5A 4KV7A 2V7VA 4N18A 1L4NA 3RYFB 2O2ZA 1QVVA 5HFAA 2A3RA 1S9HA 4EL5A 3H18A 1E1DA 3JU3A 4MMZB 4I3GA 1H4SA 4TQAA 4QPDA 4WY8A 3BWMA 3PGXA 5TC4A 3IKLA 3ZVNA 3W2TA 1VKRA 1UK9A 3QJYA 3RSZA 5KCMA 5IHXA 4FYIA 3C5WP 1M5UA 4E2YA 2A9FA 2A94A 1QTNA 4JN6B 1TMOA 4PPFA 1WXWA 5IZCA 4FE4A 2AW5A 1BWSA 4H4CA 1TA9A 3D31A 4RZHA 4TKZA 1DG9A 3PEEA 1F1JA 5D3ZA 3UT0A 1VP9A 1PBNA 1Y82A 2Z0MA 4PLTA 3FETA 1C3EA 2RI6A 2RJ3A 4H4EA 3PXBA 2EJVA 1L5OA 4B8YA 2C7RA 1JJAA 5JMPA 4AVYA 2JJYA 3MWEA 1QM5A 4PIVA 4ENQA 4QUDA 3TQCA 2JLVA 1GKIA 4EH1A 3FDFA 5TF4A 1T9DA 4WFIA 4KRXA 5LQDA 5C8DA 2PZFA 1VCMA 2DUWA 3HYCA 1OT5A 2QI9C 1FFWA 2ZVPX 1D5WA 1K27A 5EHNA 4Q4DA 4A2WA 3ADCA 2XE6A 4MGEA 4XJVA 1L7AA 3FX2A 1YOVA 4R9SA 3DZBA 1DJQA 2R6R1 3JCZA 2PV0A 3IL2A 3AVPA 3JASB 2OD2A 5I9SA 5A3VA 3KXPA 4BKPA 4DA4A 4EPXA 1KEVA 3V1UA 4DDKA 1MOQA 1R0BA 3Q7RA 1LTHR 2VL7A 1BFDA 4K9DA 1I7QB 4EVIA 1JG3A 2JFWA 2NW6A 3VPXA 5BSVA 4C0JA 1OYWA 4YPFA 3ETNA 5DM1A 2QJOA 2W2MA 1EX7A 1KI6A 1W4ZA 4ZVKA 5B53A 3WLAA 3ZW8A 1UZAA 3CCCA 4G5HA 3TIIA 4X84A 2VR1A 2IS1A 4NBWA 4C1BA 1Z5ZA 4D0RA 4O0MA 3BXPA 2PUBA 2VSFA 3HU3A 3BAFA 3TJZA 4AO8A 1U0NA 4BB6A 4OM7A 3OJFA 3RK4A 4HQLA 3X1DA 4C4AA 4AL4A 2OXRA 5CBKA 3BIOA 3I2IA 1NVGA 2WSMA 3S27A 3FYUC 3QKRA 1RI5A 3N3BC 3AUKA 2Y1GA 3RJ5A 1DC6A 3W1WA 3P19A 1PT8A 3C3BA 4OJMX 3FZGA 1E3LA 2ZAIA 3ZV3A 1YQEA 4RIHA 4TSFA 5E6UB 5JYDA 2BFDB 3Q3CA 5BUCA 1CR2A 1YUNA 2WNHA 1FFDA 3HYSA 4P1ZA 1S0UA 3TKAA 4RSGA 3RSFA 1TVEA 4BJ3A 3UXEA 4UUAA 3RYCA 1CLEA 4YRLA 1TQHA 1H0RA 1QFXA 3L6RA 5AKGA 3HVUA 3OWHA 4CIWA 4FYPA 4IIVA 2TYSB 3E9YA 4IEIA 1T0PA 2QRZA 2XMZA 1R6BX 3EDRA 3IUPA 3L0YA 4WVLA 4FOSA 4Y1RB 5ALKA 2ZXFA 2JZNA 4RJTA 4IFBA 3E8MA 3F0TA 5A4DA 1PR3A 1YONA 5IF9A 4LXUA 3DE0X 1JG4A 1WA5A 1BDIA 1NNUA 4XYLA 2V7GA 3I09A 3PWKA 5EGNA 3FPGA 5EWJB 1RJ9B 5HE9A 3CW2A 4ENVA 1B2LA 3Q9UA 2YJNA 4DIDA 2G9ZA 2Q46A 2W6ID 3QFSA 3EISA 3LIPA 5JZ9A 2HPAA 2N0SA 4PHFA 4UVGA 4HADA 5LKRA 3QELA 4O63O 2MSEB 2X0RA 4FOPA 4YNBA 1UMBA 1YJQA 3SMVA 3EWSA 4EY4A 3FTEA 3OQIA 1ID8A 1G5IA 4KLNA 2IIVA 1XXHA 2DG2A 3C3DA 4G36A 3ZLBA 3QFFA 4WN9A 1FJXA 2VSOA 4G4SO 1GTMA 2GS9A 1AKRA 4UFOA 2JJ2D 3HBFA 5CDFA 1H8EA 1O9BA 3SLRA 3RIXA 2OB2A 4IVNA 3QPAA 2PQMA 4QPNA 4TYPA 5EIOA 2XQVA 3I2KA 3OTWA 3STHA 4DLBA 4RM3A 2XCLA 3KOZA 16PKA 3INTA 4MR8A 1FX1A 2H00A 2XKJE 2JLWA 3UV6A 2GARA 4M9ZA 4Q19A 4Q05A 3D7NA 4H3SA 4YRNA 3S8EA 4PEVA 4WL0A 1LPOA 1NXWA 2OBFA 4BVAA 3GARA 3HBNA 1NDQA 4L4YA 1MX1A 3KTDA 3G0GA 1PV2A 2X8JA 4MV4A 4ABYA 1KQFA 4LOKA 1Z56C 1PZGA 2R66A 3G2JA 3NT4A 4Q4HB 1D5CA 1L7PA 2P9TA 3HA5A 4MVYA 1U63A 5K3AA 1M2JA 4PWZA 2WICA 2IVZA 4GSLA 4KREA 5DGCA 4ZARA 1WCWA 1MQSA 3CVOA 4C03A 4ETNA 2CVHA 3VZRA 1SC1A 2FPMA 3H16A 3FPFA 4QUHA 1SQGA 3HWX1 1SY7A 2J09A 3B3GA 4FN4A 4NEHB 2ZRKA 2ZCUA 4LOIA 1M8PA 1ZCZA 3HCBA 4NZ9A 4GUAA 1Z2OX 3EOAI 1L8XA 4Z7NB 3NORA 1SXJC 2O19A 1NUHA 3VYTB 1AKUA 1G3UA 2QM0A 3JQBA 3CZMA 3E1SA 4JT2A 5I7OA 3ICVA 3VPAA 1VKZA 2J32A 3C3YA 4U2FA 4ZRMA 4PC6A 5AJHA 3K9GA 5AW6A 3X1KA 4NMXB 1RE0A 1XXLA 2WVJA 4EFNA 4L07A 2UZ1B 1O97C 3IUYA 3T12A 3T4PA 5L7TA 1NT4A 1YA4A 2BGMA 2VP9A 2PKRA 2XTAA 3TUJC 3ZE6A 5KB3A 3EUEA 3EXG1 4F9FA 4PFQA 4PO1A 3ILYA 2IS4A 4EHIA 4B3JA 4BJHB 2DULA 4X97A 1MEOA 2PQ2A 1DEAA 1UBOS 4OGKA 2D74A 2DCUA 1PJLA 1Z16A 4MQ6A 1R6XA 3ZU3A 3KK0A 1TT5B 3SYTA 1TEZA 1JECA 3MJCA 4YIKA 3TTUA 3VM6A 1EFRA 3FKSA 4P82A 5AKXA 2DJIA 1LV7A 3G1TA 1LNZA 2ILTA 5KJFA 4LF4B 1XQWA 3PVCA 3ZHZA 3ZJUA 1N2HA 1HQCA 3FF4A 2GCIA 3B6MA 1NLZA 4WA7A 5AXAA 4RESA 2A9KA 3PV0A 5DBEX 4JI1B 1X86B 1U7TA 1RAAA 2WIFA 4LHWA 4FQ7A 2QXUA 4QDUA 1JIIA 3DFFA 4CWAA 4LSGA 2WYUA 2E4YA 3AU9A 4AULA 1QG6A 1ZIPA 5IT0A 3PEWA 4H1VA 5KQMA 4RH1A 1TMYA 1UBEA 3DC7A 2AOVA 5DZSA 4Y6PA 4UMDA 4J0CA 1IN6A 5J43A 1LF0A 1GGFA 1NBMA 3L79A 4KDFA 3SEAA 5TE9A 4XX0A 3UMJA 3U7HB 3CX6A 4X54A 1Y98A 1YQ9A 1Z3CA 4TLMB 3HP4A 2H9IA 3CG0A 1B6RA 3GJZA 1L1EA 2HD4A 3F8WA 4RSMA 4XWOA 3CLKA 5IW8A 3VSCA 3A05A 2VDWB 3OOHA 3AHDA 2AOUA 3ROPA 1LLQA 1QGUB 1EMDA 2P1ZA 2FEKA 5CVJA 3TSZA 2FRVA 5D84A 2UVQA 1V71A 3L6EA 2OMKA 3ODPA 4N1AA 1S3GA 5KEIA 4C4YA 1ZM2A 3FZQA 1JFLA 3X1YA 1I7DA 5I4KA 1JKXA 1MB9A 2UAGA 3EOBI 5ISMA 4RXTA 4EARA 5I5EA 3EPPA 4R8VA 1Z0JA 3NTOA 3BL6A 5JNRA 3CGGA 4I9FA 1QE3A 3AFGA 4P3YA 5F98A 2Y66A 3KOUA 4D0NA 2Q8QA 2HU5A 1D0VA 1L5SA 2JDIA 1XCPA 1T1SA 4V3BA 4EKNB 4BNXA 3V55A 3Q2IA 1P2DA 2C8VA 3ON5A 4P4SA 2OECA 4LPKA 3SQLA 3W6OA 3BWCA 4CNBA 3KOXA 1A2QA 4DRYA 2Q4OA 2P40A 3UT5B 4A6PA 4MVXA 1NQAO 4TKUB 4OFXA 1BYIA 1P9RA 1UQTA 1E4VA 1XZBA 2H8KA 2ZSEA 1QHSA 2J7KA 4G0ZA 3WRWA 1I2MA 4LRXA 1FS4A 3GZTB 5EIEA 3O8QB 3CISA 4NULA 1Q0RA 2I4RA 1OGIA 4LSMA 2DHDA 2QI9F 1CR4A 4H2DA 4MQLA 4UCXA 2HF8A 3W1VA 1BMTA 5C5IA 3KFXA 2IXEA 2Y76A 1E9VA 1E66A 1M34B 4H16A 1GTZA 5D5HA 3LOQA 4H31A 3WJ2A 1Y3IA 2OP1A 1U02A 3KUKA 3QYFA 4J16A 2DCMA 1N0VC 4R7ZA 2YV1A 4RGQA 3H7AA 3FB1A 2DETA 4LFBB 4NFHA 1SKMA 2FKNA 3N0XA 3ONEA 2WF9A 4DMHA 3G8BA 5IK2D 1XDDA 2X40A 1PSDA 1OYOA 2G7ZA 2ZDQA 3KZCA 2I7TA 3FOBA 2CFIA 3HZRA 3KLNA 3PPXA 4Q1CA 4S1WA 1B42A 4C0KA 4TM7A 1BIFA 3H1FA 3D7LA 1Q22A 4I4IA 4AZVA 4J03A 3PQDA 5K3CA 2I22A 3LS2A 4OVKA 1GEGA 5JNWA 2CJWA 1NAHA 1Q92A 4HXEB 5EJ2A 2Q62A 2O7VA 4MAMA 4TTTS 5KIAA 4YAKA 2PBLA 1GAXA 4DJTA 1SULA 5TEVA 3BCSA 4QSHA 4XRRA 4YEDA 4E7OA 2XRZA 2OQ2A 1S9DA 3IMGA 4DV3B 4LK3A 2A3NA 5HG0A 1S2NA 3L0SA 5EJIA 4CLHA 1DJNA 2FFRA 3ZD6A 3W06A 2B4YA 3T7EA 4ZC1A 2Z30A 3RIYA 2DQSA 5KYNA 3DCJA 2NVWA 4WKCA 3PIDA 1W4RA 3PA8A 3DFZA 4JI4B 2F67A 4OJTA 3O4HA 5T5QA 3C7CB 3HCPA 3VNRA 1GN9A 3ETGA 3LV8A 4KQFA 5A7GA 5A2GA 5KHLB 4GLLA 5CURA 4YALA 5TPWA 2GB4A 4DV0B 5CYFA 4O3MA 2J6IA 2SKDA 2P0AA 1W2WB 2QTZA 1V1RA 3N2ZB 3H83A 4CCYB 1X2EA 2H0AA 4JXXA 2NMVA 1R8SA 4OJQA 5ULLA 4C4OA 1CQJA 3FVQA 5JCOA 3ZS9A 2PRYA 1JDUA 3A2LA 1WMBA 4DPKA 4V38A 1R8YA 1MX9A 3WFIA 3OICA 1U8CB 3QLTA 1EXMA 2GCOB 3HKCB 5FR2A 4MPRA 5I9IA 3MFYA 2YDXA 5A7FA 3CRNA 1YNOA 4Q37A 3D6AA 1G6Q1 1JT2A 2YRXA 3C8UA 2G28A 2WIAA 3LY7A 3WGGA 2ZQZA 3OLQA 1V39A 4JLSA 2X0IA 1GFWA 1CK4A 3STTA 3KVNA 3V8PA 1M10A 3BBLA 3OQOA 5FUBA 2OHIA 3DPIA 1EGQA 4M53A 1VSBA 2EDCA 4ARIA 1AO3A 4I08A 1UBRS 2BISA 2YW9A 2GZRA 2IPOA 5T3UA 3U4CA 5C80A 4Y6QA 3TDMA 2GZDA 2V7XA 2RGCA 3C3EA 5HJ2A 5KNDA 3L4BC 3KPWA 1KIAA 2XADA 3CR3C 3KXIA 4R9UC 2AYZA 2Y1OA 1OD6A 2BLNA 5I47A 4XIYA 2ZWIA 4L6IA 1G98A 2GVZC 3KOYA 2FMTA 5D87A 5KSYA 4MP8A 2BWJA 3OOJA 3JZDA 3QITA 4PZ9A 3UJ6A 4L8FA 4X8MA 1CU1A 4BNYA 5B6PA 2AWNA 3TQHA 1FE8A 1DPFA 1Q6ZA 3CONA 3MRSA 4EQ6B 4K05A 1C1DA 1R6VA 2PS1A 2OO7A 3WP0A 5LD2B 2QT0A 3TN7A 4BQEA 5K2MA 1NVMB 1QDEA 3EA0A 5K8LA 4QNRA 2XMCA 3F71A 3FROA 3OFNA 1R3UA 3K70D 4JXZA 3E23A 1F51E 4FOTA 3A58B 4L3VA 2P9JA 2Q5EA 1H5UA 4GP7A 3G0CA 4TTPA 4KPGA 3KWJA 2D3WA 4AY3A 2PMKA 1A7JA 1VGVA 1STOA 2XQIA 5I7VA 4NYIQ 2GCGA 4ZQBA 4Y3UA 1E58A 1N5JA 2A92A 3SHQA 2VDPB 2VS1A 4NLLA 4YUZA 2B94A 4L50A 4F91B 1Q20A 1U6IA 1L7BA 1P2TA 1G5HA 2ZR0A 4ZT5A 3FYUA 3GRFA 4GI2A 2CLOB 3AWIA 3PDHA 2Q45A 1F17A 4JJKA 3MUEA 5EQTA 2EJWA 1N4AA 1UZNA 3FCUB 1D7AA 5JWHA 3TL3A 4DTCA 1EWRA 3C7AA 4U3JB 5FNVF 5CR9A 1PJ3A 3HU2A 2FDRA 2NSYA 2VF5X 5C8YF 2ZCVA 3N3AC 1H5QA 4NXNB 4YRQA 3K94A 4D4HA 4Z5XA 3W5JA 1E7WA 3GIDA 4L15A 1Q7RA 1RDFA 1DAFA 4IIHA 4NSNA 4FJ1A 3BFPA 2OFXA 4N4AA 2GRAA 2PMBA 3CJRA 4G07A 3AHEA 4MI3A 2DKFA 1P31A 2GRJA 3KSZO 3V46A 1W88A 2NUPA 4BMPB 4E3ZA 1D2EA 2ZIEA 3FUXA 4IDBA 1IBRA 4KV9A 4DM4A 1JAIA 2PWPA 4W5WA 4BWGA 2GN9A 1P60A 1KY5A 2WWGA 4IRUB 4L0DA 2G5CA 1G63A 4HVAA 1RRCA 3PQ5A 2QLNA 4URXR 1FDIA 3O8BA 4IJMA 4PG6A 3U17A 2IW3A 3IP5A 3TK1A 1W52X 3K30A 3NYQA 4YP9A 3CH7A 1CUSA 4NABA 2D0DA 2EFGA 2JHCA 3GZJA 3OOWA 2XUGA 3KFVA 3PWSA 1T26A 4XGRA 5K20A 1GV1A 4LYFA 3NCHA 2GAIA 1KMHB 1YK1A 3OF2A 1M1YB 2QRUA 4JP3A 5DV9A 5HK8A 1G18A 3D8SA 5T4BA 1AQ6A 3U7IA 1JQAA 4A0GA 2WJZB 1VE1A 4PX5A 1NR7A 3FVWA 1NW3A 1JW9B 2CUKA 5CD1A 2BGUA 3IBYA 3KZXA 4XGIA 4W6ZA 3O6VA 2YINC 5AVJA 1TAHA 4YJFA 4R01A 1Z7GA 2ZIZA 2IL1A 4DR6B 1VI2A 1KJ8A 3AF4A 2C9BA 3DCYA 3UJ9A 3HI4A 1CUWA 3ZV7A 1P8AA 2MYTA 5FFMA 3QU7A 1NY5A 2OGZA 2CE2X 3BXGA 3GLVA 2VFAA 4R81A 5FI1B 5AUOB 2WJPA 3LC0A 4FMCB 4NCHA 2ZTLA 5CCDA 1KVQA 3UAYA 1YKGA 1N9ZA 3TDNA 4KR0A 3ZWCA 4HH4A 4I4NA 2AMFA 2VUSA 4OMUA 3DKPA 2H06A 1MC4A 5EXDA 4C78A 2PKEA 1N2ZA 3AU8A 4LY3A 1OSNA 4M9QA 3KYDA 7MDHA 1P1CA 4ZYXA 2CZCA 3MJDA 3P71T 1JHYA 2I7DA 3HRKA 4JU8A 4D56A 2I3AA 4TL6A 1OHHA 3DUWA 3COJA 5A5DA 1ML3A 1Y37A 2B8EA 3KHKA 4RDIA 4C7OB 1WOYA 2WIDA 1GA1A 3FFAA 5TQ2B 3U9LA 3HWWA 5E9WA 4J76A 4E07A 5H16A 1EFRD 3FKSD 4NRDA 2OXIA 4PCVA 1EGMB 5D51S 5BNFA 2ZZNA 2EJBA 1LW6E 4ND5A 2VPTA 3OWXA 4M0KA 5FNVA 2H3EA 1JHPA 1N6IA 3SU8A 5C8YA 4O2BF 4RY0A 4UM7A 2HI0A 4K9QA 2X9LA 1WCYA 1IULA 1MB3A 1Z0UA 2IYEA 3TW8B 2CKMA 4G0NA 4BV3A 3QLEA 4KYIB 4QBKA 2M6KA 5JAPA 3VNBA 3HP7A 4G1EB 4YP1A 3FFTA 4Z7OB 2IE0A 1PV4A 1NU8A 1XZHA 2BI8A 4IVRA 1EJBA 4HFMA 1OXUA 3HCFA 3F5SA 1Z6GA 4JITA 5AVUA 3VBEA 3SLGA 1RWBA 4JV5B 3ZVRA 1NE2A 1NBMD 4R40A 2WRZA 4DNOA 5TXGA 2YWXA 3HJUA 3ILSA 3PICA 2EXXA 4LRTB 1QGZA 1C7IA 1CHDA 2QNBA 1TT7A 4KZKA 2MSDB 4Q4AB 2DR2A 4BXOA 1NBAA 4YRDA 1WVGA 4MUYA 2OBXA 1VGRA 1JXOA 2R5NA 4BNLA 4IXTA 5C32A 2IPXA 4DM3A 3KJHA 4MARA 4YAWA 1B1AA 4QO7A 4RXUA 3BDAA 3QW4B 4YAEA 5H3CA 3T5MA 1LRLA 2ZT7A 2H92A 4YV1A 2NU7B 3JWIA 2DUMA 3QIAA 4I46A 2F55A 1YR8A 3SYKA 2XMSA 2COEA 2GAJA 4ZV7A 4LMBA 5JSZB 3C4JA 3K1TA 5CX4A 3DT6A 4XVUA 4LTDA 3WRXA 3RBZA 2H0RA 4R41A 2R87A 5BXYA 5CH3A 2JDID 1AURA 3FPBA 3A4TA 1Q0SA 2RH4A 3QWAA 4O1HA 3G13A 2BGGA 4FWBA 3TQQA 2C2OA 2CWDA 3AI3A 4RVUA 3VR5H 3O38A 1EU1A 3ZBTA 5IUNC 2DBZA 4RJLA 2LD4A 1ZN2A 5JDIC 4Q03A 2W2NA 3I9KA 2PIDA 4YO8A 4YXWD 2AB0A 3ZE0B 3NT5A 3JPYA 4HDKA 3W5HA 1GNVA 5EQFA 1A9QA 2OGSA 4D5GA 1X7YA 4GC5A 1RXIA 2I7VA 3AM3A 2BKVA 1J2JA 4K2AA 4FDUA 3G9QA 2QTFA 2X1VA 4OQZA 3U4AA 1RT9A 3V4ZA 3FLBA 4BP3A 4CFYA 5BV0A 1SCNE 3DV0B 2JANA 4OQQA 4MQEA 5FBRB 3IO3A 2GPJA 5IARA 1JKIA 1P4AA 3NONA 1XVLA 2I7XA 5B5SA 1T5IA 2C5FA 3O92A 1VE7A 4D8XA 1LDMA 4PZZA 1E8NA 1WD7A 4HLCA 2PT9A 1QQ7A 1YS2X 4KOEC 7YASA 3WKCA 3UCXA 1ZI8A 5E8JA 4B75A 3F1LA 3VH3A 4CKCB 1JVBA 2RGXA 4HAVA 5JROA 1S6YA 1EFCA 3EVDA 3K4QA 5CLHA 4LWOA 4BFXA 1E99A 1LUAA 1D3AA 3VHQA 4KWCA 3EC7A 2PSDA 4O2BA 1BXGB 1Z34A 5BN3B 4DR7B 1G19A 1I33A 4G89A 1I4DD 2A9OA 2ACVA 4PAOA 2UU9B 1U7PA 1HYBA 1URPA 1NUPA 2QRGA 3IAS1 2XT9A 1DI0A 1MTOA 1KKLA 1VBNA 2IEZA 4JXKA 4X0EA 4WZAB 4PX9A 5LQSA 3VC7A 1NL3A 2UYGA 2HZBA 4H7HA 3VJRA 3ABRB 1YIOA 2YMPA 4IHJF 1JG7A 5CAEA 5IWAB 1Z63A 1M2FA 4EG8A 2ZSIA 4YQEA 4R7GA 2HMSA 1Z6QA 3FVRA 4BFUA 4XYBA 2QBYB 4EYQA 1L4BA 2Z2JA 1M74A 1UOEA 4PVCA 3IBGA 1XHEA 4M1TA 4BLUA 4QKQA 4JSTA 3KPYA 4LQ4A 4P5PA 1S5PA 1X3SA 3KHTA 4QECA 2J33A 1P4JA 4F0JA 4CEIA 3OU6A 2HB6A 4H1TA 4M1KA 4HLDA 1F3OA 3C3PA 1YDMA 1M7HA 1Y8RB 1Z6AA 3D6TB 3IDZA 5KX5F 4TT3A 2E21A 2XA1A 4IJ5A 3L1UA 1SWVA 1EBBA 2H7CA 4WTOA 1ZCJA 5JYCA 1GGMA 2FUNB 3HFRA 5LP6F 1IHPA 3UTDA 4D43A 1AV7A 3FYHA 8LDHA 3C8DA 3EFHA 3U62A 3E5MA 2Q50A 4PYQA 3HBLA 1J49A 4IJWA 4DLWA 4QJIA 1ICIA 4AUKA 2UXBB 5DIFA 4TYWA 4CEHB 3QOWA 3U81A 3DB2A 2VSYA 4QQNA 3FZYA 3ZGZA 3QPCA 4NH4A 4WNIA 2O59A 2FK8A 4KWHA 1ORVA 2CXSA 2LTAA 5LDDC 4WASA 3Q0TA 1QWOA 5FWAA 1ZK4A 4QBFA 5JJKA 3A25A 4NBRA 4W9RA 2PXCA 4OAPA 4U39A 3EF0A 4RJKA 4LKRA 4V0KA 2NTNA 3AEZA 1W5TA 2CEAA 3W4KA 4GM1A 3WDLA 2DE0X 4JFRA 4URZR 4DSTA 5K9ZA 3TAUA 3JAMA 1WZUA 3BF7A 4CLEA 1C9KA 2IZ5A 1B0AA 2JLXA 4DV7B 3BMNA 4ZJPA 2GRUA 3JALB 3HKEA 3M6MD 3IYLW 4HXYA 3MELA 4NPCA 4D8WA 3T3PB 2SKEA 3CCBA 3C3MA 2ZRLA 3ME5A 5ALOA 1FIUA 3I62A 1GR1A 8MHTA 1PR2A 1X1RA 5F2OA 5DHSA 3UOAB 1JTEA 2Q6KA 4ND2A 4B6SA 1TKAA 4DCCA 2DFKB 1QU3A 3PGJA 1WULS 1L0BA 4Z4HA 4P0QB 1BHSA 2C1XA 2GZSA 1AU9A 2WABA 3OJXA 4GBGA 4L5AA 3BIWA 1E1YA 2Q3DA 3W8EA 2VNAA 5HKAA 3IBSA 2G5GX 3IELA 3PI7A 4PC2A 1HLPA 4ENTA 2VJCA 3UN1A 1X80B 1EM8A 1QVWA 2PZLA 2FEAA 1CERA 5EFOA 1J0EA 1HDCA 1JZSA 3AHFA 2PSJA 1RWOA 4JL6A 3KBBA 3AIKA 1GAEO 3DL0A 4I4TA 2AFIE 3OFND 1LJ8A 1K4MA 2NZWA 1IEXA 1YSCA 1SHUX 1FFEA 2QPLA 3FTCA 3KR1A 5K8TA 5EYPA 5DHAA 1FLNA 1R00A 1ONOA 3F90A 3N7AA 1SVSA 4IHJA 1OFTA 1ZISA 1QCZA 4M1SA 1PDVA 1JDSA 4KQWA 4D4IA 4JJZA 5SZHB 1OV4A 2RSLA 4ACBA 1PT9A 2ETVA 2ZE7A 3BMCB 2Y1WA 3KG2A 1XTPA 3PCXA 5AKEA 3HPQA 4E30A 1VIMA 4Q3AA 1CZUA 1IAQA 3BSYA 2Y6UA 2Q7OE 1JEDA 1F2DA 5K0SA 1OJLA 5KX5A 1TKCA 4R8RA 2F3SA 3EWNA 3TEMA 1J00A 4EMTA 3QEBZ 3IKTA 4Z2YA 2WZCA 2AR0A 1FZQA 1DIOB 1ZOIA 2I62A 2QUZA 2LDBA 2XRFA 3FTDA 1U2GA 3AJ9A 4LQDA 1QH9A 4MVJP 4AMYA 1Y7IA 4X20B 4EA7A 1VMKA 2CVPA 4EX7A 1MF7A 3VV3A 2J87A 2JL1A 2P4EA 4XEUA 4X64B 1TIPA 2BTQB 4OGLA 1PI3A 4FFBB 1C0IA 2BHNA 4WESA 1KSJA 1C8KA 2B34A 1YC5A 3UYKA 1QRRA 1WWKA 4DJAA 5JNLA 3W05A 1CDOA 1LSUA 2OGTA 4B1FA 2BI7A 3IEPA 4WNAB 3GFFA 1FDRA 4K8OA 1SXJB 1K7EB 5C4IA 3QWBA 4WJKB 3IHKA 3B13B 4P38A 4FILA 4HGZA 3OZXA 1XD8A 4IGIA 4KRFA 1LVGA 1LLFA 1II8A 1WF3A 4O4JF 1A82A 3WYAA 2AW3A 3U3OA 1WO8A 2R3SA 3G7NA 4Q1DA 3ND9A 1EGHA 5FA5A 2FFHA 5JD4A 1NC3A 1ZUWA 2PDAA 4PLWA 4BLTA 2A6PA 2AEJA 3RFUA 1V5FA 4X1YB 1DC3A 3QI7A 1VG0B 2YHBA 4DFDA 2J9GA 2Y4NA 4K81B 3NAZA 1Q1BA 1E63A 2BHSA 4DRXB 4CKEA 2RAUA 3TEJA 3CMMA 5E3JA 1XN4A 4E33A 1OX5A 3G6KA 4UBIA 1Q83A 1FSFA 3EYAA 3H5VA 4OHFA 3UW3A 1V45E 4I0WB 1O0CA 4DOMA 5BUSA 4TLBA 5BPFA 1B73A 3K9NA 3Q88A 3OX2A 1N36B 2FX5A 3DDNA 2GCEA 5FA8A 1TFUA 1E96A 5CX1B 3UNXA 2H1LA 1XDZA 3TIFA 1QFMA 4Q9JA 1E5LA 2BEVB 3NUQA 4EEKA 4L6CA 5A5FA 5JAQA 1ENYA 4FCVA 4GH5A 4FYXA 2YJGA 4WX2B 4E5KA 2C2MA 3P2MA 2XVMA 2AFHA 1W4AA 1G20E 2P4HX 3F4LA 4MWDA 3JSAA 4I50B 1F6BA 5B3AA 3E61A 1MIHA 2F9MA 2JA1A 5HUHA 2VHEA 4Y6RA 5J2TA 1G66A 3RK0A 4RU1A 5HUJA 2GJ8A 3W2GA 2B7LA 1CJCA 1N2CE 1Y33E 2IYFA 5GIOE 2XW6A 1QR6A 2EFYA 3H5RA 2Q0QA 3KFLA 1ODLA 4FEYA 3M3PA 4FIZA 5E3HA 1OHHD 2DOKA 2XIJA 3SDSA 3STUA 1ZSVA 3I1YA 1ISFA 3F6RA 3HWRA 4OLJA 4HEHA 3K6SA 1A1VA 1WUJS 5EMNA 3QOYA 2R8ZA 3RJZA 2PU7A 1Y4UA 1W75A 1WCIA 1YUMA 3INGA 5CG2A 1GO2A 1U0LA 3P94A 3SJCA 4F4UA 1J21A 4M83A 4KQMA 3QLJA 1MABB 4DDWA 5LJIA 1LLCA 2L69A 2XDYA 4N8SA 2AV6A 4ZJUA 2P67A 3WGKA 3V8BA 1RM5A 4DG5A 1QRDA 1J8DA 3WTBA 1IG0A 3H2KA 5BMOA 4CMEA 1Z8HA 1QGAA 2XYHA 3QVKA 2FEWB 1QH1A 1E79D 3LP6A 5YASA 4RHFA 1ZRNA 3HC7A 4MH0R 4ZP1A 4IMIB 3FA2A 4O29A 5JPCA 3PNQA 4Q02A 2J48A 4EUKA 5TV2A 1S96A 3A1DA 4HEA6 1S02A 2HU7A 3WX0A 5IFLA 1CX9B 4CVNA 4TTRA 2BM8A 4O4JA 4R0MA 1UOPA 4V0RA 2BT4A 3A4VA 1U11A 3JYNA 4FGZA 1KC1A 1GRNA 1NUSA 1CDDA 2IZ0A 3KWFA 3DHWC 5KTYA 1YMVA 1YVDA 1UH5A 2PUFA 2VHTA 3E9CA 3S3TA 1K08A 2BKAA 3LCUA 4YDSA 5B7PA 2B61A 4EY6A 2H1IA 3AOEC 1HFJA 4P4NA 3A2MA 1YBAA 3TTYA 1LLUA 2J0UA 4V03A 1QSGA 3D7MA 3TXXA 3KHSA 3L0PA 4DLUA 4KEAA 5JJIA 2VK8A 3P20A 2CL0X 4BNWA 3FVVA 5K3EA 4MB6A 3AVVA 1XHFA 3ESZA 5AJWA 2OFWA 1KZ9A 2C9CA 3SGLA 3FMFA 3TSCA 2AOTB 3UK0A 4YVFA 2C07A 4B3SB 4C2UA 5CFOA 4DNFA 1G9SA 5EXTA 3I23A 3R1IA 2F1JA 2DSNA 5SZJA 1FXWF 3U13A 3QUQA 3MNFA 5DGHA 3IDSA 4ICIA 4ROSA 2BV3A 4EPVA 4NNOA 5C2JB 4ML3A 3SHVA 1UXIA 5ECYA 1JZTA 1R50A 1I7LA 1MH9A 1WXHA 2C4VA 2HWUA 2V6GA 2YIJA 3R09A 4QFCA 4ZVRA 3SC2A 3UV7A 4A7PA 1FDUA 4BKOA 4DLAA 1XZIA 2H18A 2ZYIA 4UEKA 5EWLB 2H5IA 2AKEA 3NHFA 2VNHA 3M4ZA 2HEGA 1XTVA 1JDBB 4S1OA 2BRUC 2C98A 2OV8A 5C1DA 1JPUA 4QUIA 3DC2A 1O6CA 1C5KA 5HP4A 2C29D 1NM5C 4C2AA 1XRRA 2H1SA 2X19A 5J5AA 2LZ0A 1JHVA 5L8VA 1JWLA 1VE6A 3NTQA 2A9RA 4JHXA 2Z2IA 1WPRA 2C57A 2ZEJA 2WB2A 2C5SA 3BH6A 1NFQA 1V25A 2QAIA 1QPGA 2OM2A 2VWGA 1L3BA 3MWGA 5L3ZA 1TDJA 2MMCA 1DQZA 3A06A 4PRKA 4QJ3A 4AKIA 1AGYA 1QIFA 3GI1A 1D09A 3JYHA 4QU0A 1ZNQO 2EWWA 4B43A 5C46F 2XWPA 3OETA 4BVLA 1YCGA 1D6MA 1A5TA 1EXWA 1LS1A 1VDZA 3DQZA 2FUG6 3GFQA 4ASUA 4ZHSA 1VKJA 3HTXA 4AI6A 4RW0A 3H6HA 3K5HA 3R0QA 4U02A 1OI3A 3EGXB 5J58A 4DCMA 3LFTA 3IVAA 1IK6A 2M6RA 1X1EA 2IXAA 2HXYA 2QJWA 1XCBA 3R6GA 1KH3A 1C30A 4QU8A 3I6QA 2ID8A 1KYVA 4N65A 3ML1A 1ANKA 2F6RA 4IJ6A 1P7PA 3MBKA 4F84A 3HB1A 3W8RA 2XMPA 5FOTA 1WZ2A 3IV7A 1A3CA 1XZLA 4DSOA 3QEKA 3A9VA 2ORYA 2YOHA 1PR5A 1OLXB 3V1TC 4KLAA 4M1WA 4BKUA 2Z4RA 1IU9A 5DNAA 2OG1A 2SCUA 2NU8B 2JGEA 4EG5A 1NMEA 4QWWA 1WM1A 2JLZA 1U7WA 5TGZA 1UMDA 2BF4A 1S8FA 1EFPA 1MIOB 1HFWA 3BGVA 4MWTA 1JVNA 2YWHA 3KAQA 3NRJA 4IV0A 2VAPA 3N07A 5A3JA 3LUKA 1DCFA 2R8PA 2WE8A 1AHIA 3G23A 5DSTA 1RIFA 3WLLA 3VJMA 1MGOA 2JBAA 1IATA 3H9GA 4PANA 5HSGA 3VX3A 2FP3A 3AERB 5JSQA 3TTTA 3HLTA 4HDRB 5D7NA 1M8GA 3LQYA 1E64A 1PAUA 3JZFA 3I92A 2DBQA 3O2NA 3P9QA 4QOSA 3ZWQA 4F06A 1CJSA 2XQJA 4E5UA 1JMYA 1LSOA 4L0QA 1LQUA 3ZU6A 2G25A 3JAWA 1PW5A 1T3HA 3VU3A 3ZOKA 4MKHA 1E20A 2AJLI 3VYVA 2QKYA 1PWYE 4ZA2A 3M70A 3I5YA 3CUTA 3PGLA 1MHTA 4CMIA 1NNEA 1FDVA 5JH7A 1M1NA 2Q99A 2VT7A 3IRUA 4JWTA 4TL7A 1JA9A 4BTLA 3VA7A 2QL5A 5EI5A 1HNNA 3OQPA 5FCDA 2Q0XA 3QLVC 4KO2S 4BYMA 2ZWVA 1HDXA 3W34A 5LQAA 3GPIA 2B83A 5ALSA 3GBVA 2B7BA 2XNDD 1KORA 4D80A 2Q28A 4G2TA 4L22A 2Z5LA 3M6UA 2VPZA 3QLUC 4TLCA 4PPYA 1S8OA 3ZY3A 3JATB 3PQCA 1JXAA 2GLXA 1RI4A 1GKLA 4X45A 2WUEA 4IJKA 3WXMA 4Q4CA 5C5EA 3U4MA 1SKAA 3D4PA 5HFNA 2G5TA 4CU5A 1OBCA 1FTNA 4R9VA 4C0XA 3QFCA 4EHKA 1DMRA 1HEUA 4DMFA 4BEWA 2Q9AA 4JOBA 1FNCA 3N53A 4CMJA 1O94A 3VO1A 1KKUA 4UU7A 4QLOA 3TRFA 1ICEA 1PG0A 1ZIXA 1B16A 1PJ8A 1V1MB 2V4MA 4KQCA 3A3YA 4KUGA 4LGVA 4BNMA 3WICA 1KDTA 1E3WB 2A1UA 3MOGA 4G8DA 5J1SB 1RPNA 3NVMB 5G1OA 2R47A 1DUSA 2Y9MB 3FCEA 1M2WA 1DMSA 5DWDA 5TPZA 3VNAA 4M99A 1IQPA 3BE4A 2BIFA 2QVXX 4TYQA 3LF2A 4ARCA 2NZJA 2HRDA 3PEYA 1CZLA 1S3FA 1Y3AA 2WYOA 1Q0UA 4FYKA 3WLHA 2GBFA 3HEBA 2RIPA 1LPNA 4Y2HA 1R0KA 2QX9A 3C24A 4JJ7A 1VA4A 1ZMXA 1EI9A 2JH9A 2J9RA 3M5PA 1YQXA 8OHMA 1CZOA 4KBYA 1XLTA 4QLBA 5TS2A 1W5AA 4IEFB 3AR4A 3KJQA 1O0BA 3MTBA 2ID4A 3E27A 4IIJF 5D3KA 4IXWA 4XB1A 5IJWA 1P1FA 4W99A 3PJFA 3OCVA 2RBGA 3N8KA 4EPYA 4QM7A 1QP7A 4C0SA 1PWEA 4UZSA 2A8YA 5ALGA 3BB3A 4FR5A 4PAQA 5ALFA 5REQB 3WTCA 4HLQB 1HY3A 1S3SA 4QOGA 5FTKA 3AUUA 3PXGA 1BTOA 1J5XA 1EUCB 1SQ0A 7ADHA 1NRXA 4IDFA 5ESWA 1M1UA 1OOEA 1FL9A 1RVDA 1XDWA 3KEQA 1SUDA 3O8LA 4IFEA 4YMHA 2ALJA 1ECLA 3HU1A 4ZHQA 3H2IA 1SHJA 3GGSA 4CQLB 4Q16A 1DWUA 5AVZA 2ZYUX 5EHGA 1SZDA 2F9LA 1ZH4A 2YV3A 1AS2A 2YVQA 2ZJ7A 3EIUA 3T0IA 4DNXA 5AW2A 1BX1A 1H2FA 5ELLA 4B6QA 2XA2A 4LDQA 1DPGA 1N0UA 2WFZA 3KYJB 4FLEA 4O1IA 1P4RA 1JR6A 1M7GA 3RR2A 1TE2A 1J5PA 1U9CA 3GVPA 3JQRA 3NVDA 1LD3A 3PHGA 5HCUA 4BQPA 5JTTA 4PLPA 1DS6A 2OCLA 1XEFA 3DR5A 5K0CA 2ZSUA 3AB8A 4YCCA 3HJHA 2Z6UA 1LY1A 3KL2A 2FY8A 1EJ6A 1K6IA 4I81A 1RYHA 2VI5A 4F71A 2R6HA 1KVSA 1ZNYA 5TY0A 4RE6A 3SF8A 3F8TA 3MUNA 5IKOA 1BKDR 3NWPA 2AKYA 4I9NA 4G5GA 4OJKA 4ZOLB 4NV3A 5ITZA 3RSSA 2XZOA 4YCJA 4CF5A 3H2GA 1QVZA 5J4HA 1WW3A 2W6PA 4F6RA 2K7FA 3EFEA 4I2NA 1P7ZA 4OMDA 4WOBA 4M7PA 1YWGO 2XRYA 3FWPA 3IBTA 3U6KA 1GAJA 4BO1A 1U0JA 1P6XA 2ONJA 3ADBA 2NV2B 4CG3A 4E1VA 4GM4A 5C4GB 5P8WA 2D3TA 3CSUA 4HTFB 2HCRA 1C1HA 2FG7C 2ZS7A 1ODKA 3AILA 3EW9A 1VXRA 4PICA 3TFWA 1KFJB 1KNXA 2MYNA 3C43A 4BECA 4DHWA 3K0FA 5HQTA 4PYNA 2AUMA 4W1QA 4L7VA 3K73O 2P5UA 3FGZA 4I14A 4TXMA 3ADDA 4BO0A 4P7FA 4G6ZA 2YXEA 3ZX4A 1QB7A 4X94A 4YMVA 4CL2A 2NVUA 3QRWA 1G5PA 3Q5EA 2ZIXA 1CCWA 1BDJA 1SUFA 3L05A 4GNKA 3WLPA 4F12A 2H1OA 4EGAA 3JD4A 5LVAA 2ZIVB 3MCUA 5BVHB 3P0HA 5ADVA 4QDOA 1KYTA 1O95C 2ZB3A 4CTMA 2BGTA 2AOXA 1QJCA 4WZ6A 2C2BA 3LUDA 3QVWA 3R9IA 1SELA 4MV3A 5BURA 4B9AA 3Q98A 3PNYA 4IIJA 3G0OA 1BDMA 3FDIA 2YNMA 1C7EA 1LJUA 2PVPA 5EN4A 4J0FA 3WLEA 2P2ZA 3MK31 1DX6A 2HK7A 2FWMX 2WUDA 2Z3WA 1PFWA 3CZ4A 4MWSA 2QUIA 1IWPB 3QUCA 1JMKC 3GPBA 1M9NA 4YRRA 3PUKA 5HDQA 5FO0A 3TLCA 4BEVA 5C8ZA 5B1SA 4BO9A 1UINA 2GI4A 1MW8X 3KKZA 1X42A 3DVRX 4D26A 1U3UA 2YZ7A 4EHDA 1M3SA 1BX0A 1T2UA 1UPCA 1N9GA 2ZRAA 2ZT5A 3CLSC 4GICA 4PGFA 3SIXA 4XX1A 3E9NA 3DOOA 3QVGB 5UKDA 4AYTA 2Z95A 4OHXA 2WWYA 1U0HC 2VQSA 3C6YA 4AG3A 1LDEA 3FSJX 4A0HA 2OORC 1XAJA 4JC8A 2IUUA 3U37A 3ZX5A 3LG2A 3NOXA 1Z83A 4A2CA 4IVQA 3ZR4B 2BFBB 3E0XA 1Y7TA 2AJ8A 4E70A 1R74A 5JO0A 4J1SA 1DDOA 1ZRSA 4KIWA 4KKVA 4KQ1A 4M8SA 4LYAA 5EZYF 3IUQA 2ZI7A 4L74A 3LXRA 2QP3A 4C08A 2IV3A 1R4MA 1CB0A 1UDBA 2I8CA 2CHEA 2Q0SA 2Z09A 1J2RA 1PKEA 3K0EA 1E0JA 2E6KA 3GK3A 1TB4A 2C84A 3KX2A 4MVJD 1TAQA 4NICA 1BJKA 2UVPB 3I5AA 2XDQB 1P81A 1QHHB 4TXJA 3HKBB 4JQZA 4WK6A 5L4LA 5L3VA 2QUBA 5JAIA 3JSXA 1KI2A 2P0EA 1JLKA 4M9RA 2I4TA 4ECAA 4A6DA 1M2VA 3HUFA 2C7VA 4BVJA 1T2NA 3ZWPA 3X2SA 2CXXA 1QE5A 3RT9A 3WISA 1SH7A 1NSTA 5T64A 1XLVA 3VNVA 1VM6A 1KDVA 4Q3BA 1JJBA 1GRRA 1UAGA 4K2HA 1G8GA 3U44A 1M75A 3G89A 2H2HA 4MXDA 4W1SA 4K7JA 3TR5A 3VZDA 2PUDA 3I61A 2R6DA 2CF5A 5KKAA 1M1ZA 2QTMA 1KDOA 4LMPA 1A8UA 1Y1PA 5H59A 5TRTA 1YRLA 5HJ7A 3LE8A 5LBTA 3O3CA 1VCHA 3OFKA 5BSHA 4EY5A 1ST2A 1U3VA 4XR9A 3UBTA 1RPZA 4HZGA 4JUIA 3H8WA 2PHZA 1PHPA 1HDOA 3LBFA 2YN2A 1D03A 2HV9A 1ZGAA 3NJ8A 3R4VA 1REQB 2F1RA 4EENA 5K6RA 3ZDBA 4QL3A 4B7UA 3FPHA 4YBRA 3V8QA 2J9FA 4YUVA 1IVNA 3SBOA 5LDHA 3J7AC 5LFAA 1P91A 2OBBA 3QA3E 2GBLC 3R3SA 5TVKA 4U7DA 4K9KA 2FWJA 4Q7KA 1F48A 5BSFA 4NH0A 4E5SA 3HK2A 1ABEA 2H5JA 1DIHA 1WOMA 1HZJA 2IOFK 2GZAA 2RHBA 5FBHA 4Z0NA 5CB4B 4REQA 5LQMA 1V6AA 4LJ4A 1PV1A 2R1TB 5EMKA 2PH5A 1KS9A 1LI4A 3TLZA 2ZYSA 3Q2OA 2G1AA 1NBOA 3OLCX 2VH5R 5E95A 5E4YA 4ASUD 4DPMA 3FCOA 2V97A 3HM2A 4OI0A 1U8YA 3QKSA 2BRUA 1CJVC 3KJFA 4GOJA 3TZKA 2J30A 5IM4F 1QG4A 4D25A 2OPHA 4GXTA 2ZRHA 3GA0A 3ZCRA 5CK4A 4D1YA 3TZHA 3RBVA 1RWMA 4BNUA 1NOJA 2DQYA 1I30A 1VL5A 1MEEA 2ZBGA 4NOKA 5IXSA 821PA 1MRSA 2HJSA 2WLTA 4JB0A 3VO9A 2QJRA 1A97A 3OQBA 3AEXA 3VO2A 4WAUA 3GPDG 1QQTA 3H65A 2VHCA 3QEMB 2ODAA 4UE2A 1WB5A 4MDEA 2P69A 4P8RA 4N3AA 4RIFA 3GGPA 1Z25A 3DE3X 2OQRA 2IEYA 3KWMA 2DR3A 4GT1A 1W30A 3DE5X 4MUHA 1J09A 3A27A 2OQVA 1KAOA 3SKVA 3DW1X 3PWTA 3TW0A 4A73A 3NJ4A 3MGKA 3G7UA 3ZV6A 3KQTA 2PGLA 5A06A 2X6RA 1MZVA 1PEYA 2AK3A 3TIVA 4C7VA 3T3GA 2EG9A 3PR3A 5SY4A 1RHQA 1QHFA 2Q6VA 2W2KB 2JD0A 3AKEA 4U2GA 2H4HA 4P7JA 3RUDA 1IVSA 2WMYA 4HNRA 4JJ8A 1E3IA 4LS3A 1D7OA 2GUGA 3L77A 1MDFA 1U8XX 4XQGA 2GKGA 4ZT7A 1KOLA 3RABA 2XB8A 2MSCB 1ODTC 5LMCA 1JDTA 1JIJA 3PG5A 3RV3A 4AZWA 3PTAA 1E2NA 3T99A 3VNSA 3GVHA 3MPUA 1I10A 1JJFA 4D9EA 3TM4A 4XJTA 2GT1A 1RSZA 4AKSA 4Y6OA 3ZXUB 2IDJA 5KNCD 2WF8A 1OWPA 4ZI7F 4WEOA 1IMJA 4N82A 1ZWLA 3I2HA 3KUCA 2ZJYA 1KK0A 2HSGA 4RF3A 4R2MA 4XM1A 2FUEA 1RYEA 1OB2A 5G40A 2KHZA 1OF1A 4IDAA 1ZWKA 3C8HA 4CCWA 3TUZC 3FNFA 2GD6A 1PQUA 2XGMA 4YRTA 1ZHOA 4RTNA 4MROA 2WIKA 3MSXA 5P21A 4J07A 4JA2A 3IAAA 3JWGA 4CMHA 1SCIA 3C3XA 3UH0A 3NHAA 5CW1A 2XNHA 2P2CA 1O94D 2OXFA 5A1TA 1IY0A 5CTJA 2QMZA 4K86A 4ZYVA 5TLSA 1WDTA 4IIBA 3T1QA 4FWIB 5JV5A 1NOKA 2D1YA 3P2IA 4UDXX 4B71A 4MV9A 2XCQA 3HJAA 1N8SA 4MV8A 4AU1A 5BSKA 1H6DA 4JUCA 5ALPA 3E7WA 2QZJA 2XUAA 4ID3A 5HOEA 5TPZD 3KCQA 1RZVA 4JSYA 4OQXA 5IM4A 1DC8A 2FKAA 1HRDA 3WK7A 1W581 4MUJA 5DLEA 4C7BA 2QR2A 1UPUA 2JIMA 4OU5A 4E2ZA 4NDAA 4GL2A 3UJBA 1JN0A 2BM9A 1R6TA 1BVRA 4R1SA 4YJ3F 1TJPB 4KWEA 4C22A 1TI7A 2TMYA 4HZUB 4QEZA 3E22B 1VL6A 2YYSA 2PD3A 3PB3A 3R0JA 4KQ2A 2CDBA 4TMXA 3M83A 4PAGA 4E5YA 2A0WA 1UK8A 1P2UA 1USKA 2O2XA 5IDVA 3IEUA 1N5RA 3V34A 4RZ3A 3DEHA 4M89A 1XMVA 3WYGA 4FCCA 3Q7EA 2WA1A 3R6DA 2JI7A 1RXYA 3OH8A 4CIVA 4LRWA 1YL5A 3K16A 4HUJA 2IHKA 3LK6A 1B41A 2V7EA 4LOJA 4FWTA 3NBKA 5IVKA 4QDTA 3SOPA 2FYTA 3ROEA 1GGJA 1Y80A 3KTFA 3HABA 4N3GA 4JYAB 4D3DA 4ZYLA 1G5FA 1IFXA 3RSOA 3T0GA 2FF5A 3BCUA 3VU9B 3LYAA 3H5AA 2CVOA 4BQNA 5BMVF 3WG9A 5DULA 2XRMA 1NF9A 3DBHA 4TVOA 1K7YA 2EFHB 3CPSA 1O87A 2BSQA 2WJ4A 1N57A 4JI5B 2JJ1A 4KQHA 3VZBA 3KAJA 4OHUA 1O9HA 1ZAYA 2XE4A 3ZCUA 2IHUA 5AOBA 4Q7LA 6GPBA 1A4UA 4R05A 1CY7A 3OZIA 4AZ0A 4EGFA 4QT4A 3ZZMA 2VRBA 5FI5A 3IR5A 5B7NA 5ALDA 4DBVO 1H1LB 1SO8A 4IIYA 5B1YA 3FOZA 1FP4B 3GNLA 3MZ0A 1IHOA 4E21A 4ZI7A 2ODNA 2Y2UA 1I3LA 3DTVD 3I0NA 4MW7A 3CVYA 1B8VA 2JD1A 1SHZA 2VXCA 1C2TA 1U0SY 1ZU4A 1ZVMA 5CXSA 4CG0A 3AJRA 4TWIA 3T4UA 2QTNA 2W6CX 3RS9A 3EJWA 4HVTA 4MQFA 5FWNA 3RKUA 4QODA 2N1BA 5IZ4A 3PE3A 2BD0A 2GXUA 3TX2A 1OLUA 4D42A 5IYZF 2BEJA 1CNFA 2O6HA 5C4MA 1Z4PX 4OQLA 5IHPA 4LIPD 3HO1A 2X5OA 1FFYA 8ABPA 2VT3A 3FNRA 4EA6A 4V1CI 4ZQIA 1ISPA 2CLDX 1DIRA 4UJ5A 3SI7A 4R6XA 3FCXA 5DK6A 2DYKA 3IESA 3R5TA 5DWQA 4G4IA 5FDFA 2IW1A 3OEEA 1TO2E 4GXQA 4HNQA 4Z8YA 3U3KA 1XIVA 3HDJA 1BSVA 3X1WA 3COYA 4HQFA 2R2GA 1G21B 2GR9A 2HIMA 4CMKA 3MWDA 4PYJA 4H60A 2BFPA 2GM3A 4DHEA 4B2PA 1JLRA 4ND7A 1ZN7A 2J9YB 1ADJA 2VN8A 3TW6A 4YJ3A 3WV4A 1I2ZA 1M6EX 2HCTA 2M9MA 2REQB 3C3AA 3ESQA 4GGMX 4XUEA 4KH0A 4BDSA 4CODB 4YUYA 1GV0A 2VDQB 3S81A 2PO5A 3KSDO 4TWBA 1E32A 3EXIA 2HYIC 3RCBA 4KUHA 1KZHA 3W6NA 5GMOA 5GV7A 3B1FA 2BBWA 1RWVA 1Y63A 4PYRA 5KOHB 4BVKA 2IU4A 3I9V6 2Z4TA 3RW9A 2Z2XA 5JXJA 3BT7A 1BN6A 3CWCA 3ONDA 3ZWNA 2FR1A 1Z4IA 1XZPA 2YNMD 3KS9A 4MUKA 2CD7A 4MV5A 3KVYA 3K8ZA 4Y2TA 1RPTA 4NNPA 3I64A 4MX8A 4I5EA 5DNDA 3SZUA 1GZSA 1PT5A 1MN6A 2JI4A 3P45A 5CBPB 3VDNB 3S1SA 4QRHA 2FEMA 1EQ2A 3IBCA 3ZHTA 3P9XA 5MGNA 4TRNA 4XYGA 3WQQA 5KWIA 4NV1A 1G38A 1ISJA 1E62A 4CCSA 2HGZA 2VDRB 3MS2A 2NLOA 1MC5A 1RNLA 1YRHA 4ALKA 4C87A 4WXYB 1V48A 1DO2A 5BMVA 1I4WA 1HE8B 5F1OA 2WIGA 1GLGA 1TGVA 2IEBA 1D0IA 2IOYA 3UENA 1LCIA 5JAUA 1RHKA 1DBPA 3VNUA 4RTSA 4GX1A 4NCKA 2QTBA 3MUFA 2ATVA 4C5AA 4KE8A 4MO9A 2IPNA 2YWCA 4Y2GA 4N7BA 3UYLA 4EI2A 5LYYA 4CV2A 3ISJA 1ZMRA 3X43A 4Q34A 4TL9A 3RF6A 2IH4A 1SJ9A 3NAMA 1E2MA 2CV2A 3MGCA 1S7GA 3HMQA 5D7BA 1XEXB 2NU6A 3PC4A 5DYNA 1RJEA 1WL8A 1M7BA 3KM0A 1I9GA 2O8FA 1DFGA 3BBPA 1U9JA 5JVDA 2D6FA 5DB4A 1TM4E 1M6HA 1ND6A 4DZZA 4C30A 1COZA 1ZC3A 3L04A 5EZYB 1ZOOA 5IYZA 3TLEA 1ISHA 3GRUA 2P4SA 4F6LA 1FMFA 3GFBA 3DEAA 2H4ZA 2PM8A 4PLCA 4X9XA 2I65A 1CR0A 1OLOA 5EEHA 4E4YA 4OHYA 3SC3A 2UKDA 3W2FA 4LWQA 3BTVA 3UUFA 4PINA 4B3DA 2DY0A 5B1IA 1GCUA 5EE0A 5TJHA 3GT0A 1B6GA 3U3XA 4ZCMA 1T9KA 2A59A 4ZOCA 5G2OA 3GR6A 3WGNA 1DUIA 4D9BA 4KHPB 1OWOA 2I2WA 3QKRB 3SXJA 5BQ3A 1O9GA 4RHTA 2IXFA 4DV5B 5HM8A 1NN0A 4II7A 2HMWA 5FJIA 3L0ZA 3HVKA 5EKSA 2K2WA 2C95A 2HMYB 4CEIB 1ULSA 1A4IA 5HFJA 2UV8A 2GILA 1UBGA 2Q49A 3EAGA 5A6SA 4EL0A 1PNTA 2PMWB 1RCTE 2ZT6A 3RYCB 4MOWA 3PXEA 1WABA 4FE7A 3W5VA 1NN1A 1QIEA 3K53A 4GM0A 4Q1FA 4AF8A 3IQIX 5BWMA 1FSGA 2H11A 2VK4A 2OV2A 4UEQA 1N2BA 4GPBA 1GA6A 4A1FA 3B12A 3HHPA 1ULHA 4OI4A 1A4RA 4IGFA 4ZWNA 5J2UF 4Z3KA 4E4TA 3LYLA 1JIXA 1C4KA 1C0LA 1KJYA 1UMCB 3PHIA 5IPFA 1L6RA 2ZUUA 4OCZA 3IHLA 1FDWA 1SQ6A 5JNUA 4AS2A 4BGDA 1XNRB 2WFAA 5SYNA 4EG0A 2B1RA 3QX3A 1WBJB 3B89A 4L02A 3K3PA 1EUYA 1RM0A 3EIEA 3G68A 1HK7A 3SR3A 2FRDC 5K3SA 3RYHB 2GBLA 3HJNA 3MSCA 1PGQA 3WK9A 3SYLA 3QELB 1F2UA 3IURA 3A36A 2G82A 1BCSB 3LCRA 4Z6KA 3TECE 1KERA 1IBKB 3SFZA 4A91A 3WGJA 4AICA 2POQX 1XXHB 3ED5A 4O5OA 3V4LA 2KLHA 4CIAA 1NA5A 4U7TB 4HNGA 2VCEA 3WA7A 3TVDA 3B6JA 4PPNA 1ZP6A 3H5WA 3QK7A 4RKFA 3U3JA 4MO2A 2HRBA 1D6NA 1KH2A 3VDMA 1SVNA 3R3ZA 2BOVA 5FFNA 1KBOA 2E37A 1DKMA 1D04A 1H23A 1W6UA 1X7WB 1RP7A 4B3HA 1MEJA 3WVNA 4B3XA 4AJLA 2E1PA 1YIDA 1G1MA 2ID7A 5D86A 4AXXA 1JILA 1R1DA 3N6XA 1A9RA 2EKQA 2OV3A 1NULA 1MXHA 2FMUA 5BQXA 3LRPA 4PVDA 2Q3HA 4KFUA 3KLOA 1BXRA 2X8JB 4UBNA 2CNWA 1JAZA 1WETA 2WAYA 2R0QC 4OXQA 2FMFA 3H2ZA 1ZJ6A 3S7TA 3CNEA 4P32A 4QDZA 3LF1A 3B1ZA 1OXVA 4XH9B 2D8MA 1JEAA 2FZEA 3CM0A 5EIFA 1JH8A 3A4MA 3C3JA 4GLOA 2Q4BA 4UDYX 1QCDA 2HJHA 2PMFA 3T35A 4F04A 1E2BA 4KR7A 1UIRA 3U7EB 1JXQA 1TC1A 2BBSA 4Y9DA 5JPDA 1X14A 5ICGA 2E0IA 3UJNA 1DC7A 1P1JA 1ZIOA 3O03A 3ANMA 3BWDD 2PH1A 3PEVA 3M1YA 4ND3A 3RTCA 4FYYA 1CYDA 3Q3VA 4LHEA 1E59A 4RWZA 1WHTB 3CRQA 3F9IA 4M0PA 1EB9A 2D4HA 2Z8YM 2ZXEA 1JLLA 1HLFA 1ZJ5A 3IKVA 4Q3CA 5KYVA 4BIIA 4E2XA 4EJFA 1EFDN 1U2DA 5EY5B 4GI3A 2QLTA 2NPOA 1K86A 4BE4A 2WM9B 4PIPA 3UWSA 3IXQA 3DG9A 4AROA 2GSWA 2HLNA 4GP9A 1BMDA 4LJ8A 4YI3A 5FTWA 1RM4A 3THXA 3C87A 1K75A 1OFUA 4RLSA 1H42A 2AI3A 2C96A 4NS1A 3RTGA 5TDHA 2YQ5A 1NASA 1NMZA 2PUVA 1RZRD 1Z39A 3IQFA 2I55A 2HHAA 3KQHA 3K0AA 3ZN2A 1OX4B 4PC7A 2VZLA 3DXZA 1SIWA 4ER0A 4OYYA 3PX3A 4FFRA 1K63A 1QOZA 1CIVA 1YB2A 2FN7A 3GOHA 2ZTUA 2C20A 3O7WA 1L8QA 4HDSB 2ZJOA 3TSAA 3AKDA 2PY6A 4QG7A 1GG9A 2OUKA 3W5CA 5CCXA 4JGGA 2G3YA 1H2WA 1R0XA 2ATIA 2PUGA 2I71A 1DRJA 1ZO8A 2EFCB 3O31A 1LXCA 3IPRA 3DOJA 4BO2A 3FUCA 3N5KA 4OHWA 3SEFA 3G8DA 3UWOA 4ZOAA 2QYHA 2C2KA 3Q8KA 5K2OA 5I8WA 1QCYA 2IZOA 4YY3B 3TTWA 3UHOA 2UYYA 1G2QA 1U31A 4C76A 1X2BA 3GW8A 2FR0A 3BE6A 3WL5A 1IVYA 1KZ7B 2O7RA 3GIWA 3MJFA 5H0IA 4BUZA 4D44A 2FOLA 1L3CA 1Q7EA 3EQZA 5E0KB 1IB0A 1V16B 4F1WA 5KOJA 1GADO 5EJ6A 1I6LA 2WFLA 1H6BA 1N8NA 3JYLA 121PA 3QBEA 2PMCA 3FVTA 3NFYA 4M9UA 2ZR8A 2PGNA 4YACA 2C78A 1YACA 3C98A 1X7ZA 2JJ1D 4CT0A 3CVJA 4UQLA 5KYWB 1A96A 2PEZA 4FFVA 4DMGA 4JT4A 3WIOA 5HZGA 1QTIA 3NKLA 5JCXA 2B82A 1YBVA 1PG2A 2AZ4A 1SURA 1QLHA 3BRSA 5L7WA 5GONF 2YMLA 2BJHA 3ANSA 1NYRA 2JIZA 1F4VA 4JL5A 1FVHA 3OJEA 3NFRA 3AH8A 3TINA 3NAGA 4JI7B 3R74A 1T4CB 4XVCA 5LQJA 1IK4A 1NT2A 4KSBA 3NIWA 3WGMA 1XTUA 3VC2A 2C9MA 2VUIB 4OQMA 2ZBQA 2K6GA 1NQOA 2FXVA 1OI2A 3RFXA 3STXA 4LW8A 1UKCA 3EBLA 4YPVA 1E6UA 2V96A 3LYUA 4RFVA 3A3PA 1OIXA 3AJDA 3C3KA 4NBTA 3VYWA 1JU9A 2ET6A 3L8YA 5E2AA 4AUEA 1W85A 4F9EA 4ZEMA 3PKIA 5KINB 4II2A 1E77A 1UWCA 3UBMA 3FYTA 5L4SA 2QGFA 3R8XA 3VOBA 2CT8A 2F8LA 3K15A 2H1CA 5DSZA 3IV6A 5ICMA 3DNMA 1IZ8A 1JDJA 4M7RA 3IP9A 4PSAA 4ZQHA 3T7KA 2DFLA 2JARA 4GGPA 3FM9A 3T5GA 4BO5A 1AN0A 5CDFE 3QUAA 1QHNA 4DEXA 5DKFA 3OG9A 1OA0A 4CN8A 1MQ8B 3OEED 3D4OA 5HRAA 5IJ0B 1NQWA 4CMBA 1L7OA 2RHWA 1YBFA 3EZGA 1DWOA 1ZW6A 3JXEA 5JG7A 3HXLA 1GAQA 2WPDA 4HYEA 1HNWB 5F4BA 3OBIA 1X1CA 4ZODA 5EAIA 1N77A 1M6YA 5G3ZA 5CM8B 1FQKA 2WSLA 5HIIA 3G9XA 1PT7A 3HKDB 2XR1A 2MINA 3MILA 4KRGA 1JQJC 2JAPA 3V7YA 4QICA 4DAOA 2QRNA 4HV4A 2C3UA 2ZLBA 3IP1A 2JGRA 4BX8A 2C7GA 2CJWB 2P27A 3AP2A 3BD8A 3OQNA 3QV2A 4JLOA 3KOMA 5AVOA 1RTTA 1ZL0A 2FZKA 2LKCA 3RWBA 1Z13A 3IKJA 4M0MA 4ZCSA 4YHBA 4CFZA 3PX7A 3R5FA 3A28A 4Q1AA 3LOUA 3C5CA 3H9BA 1EG7A 3R3HA 4GMDA 3RC7A 1OYYA 3VZCA 3EPJA 2OCYC 2HM7A 2HWXA 1SXIA 2NV0A 3GWGA 4NFSA 2WNIA 3PJRA 1I8TA 1FDTA 2PCLA 3KT8A 4FMDF 1LVUA 1VIDA 4G1BA 4MV6A 4RZIA 1HDYA 1RQXA 4Y67A 1UWVA 1WDKA 5AKLA 4KXLA 3RVQA 3SHFA 1LNSA 3G2PA 4O1MA 4K1XA 3PNLA 1B1CA 4FW9A 1OBOA 1CFZA 3BORA 1H6CA 2RBKA 3VC3A 1NPDA 3HR7A 4M46A 4MCAA 4PGGA 5EHXA 3RSCA 4S3MA 1WB6A 1SUCA 1JQDA 4GOLD 3OZSA 1JEJA 1R9NA 1X7XA 1FNSA 4FP9A 4Z8XA 1XEWY 1Z6XA 4FD3A 4XRGA 2Z5GA 1T8TA 721PA 4IIGA 1F7UA 1A2OA 1M8JA 3TS1A 3PLRA 3WKBA 4FMBB 1CQJB 1YZUA 4OH7A 3SD7A 5KTNA 3FXAA 2RKBA 2ZDGA 4YRAA 4R9RA 3I8OA 2OBNA 2IS6A 4I4CA 2HJVA 4PQYA 1QK3A 5A0FA 1DUVG 2R7KA 3NT2A 2QN3A 4OXKA 4ZCRA 5KQSA 2QZ4A 3CVWA 4KIGA 3D7RA 3W9UA 5H4HA 4DBLC 2RHJA 3W7AA 2Z8ZA 1RP1A 2Q5OA 1T8RA 1XTRA 4XJXA 2OYRA 4DPLA 4ZVSA 4OLAA 4YAOA 1CJUC 1MPTA 4P7GA 1RW4A 1V5GA 3IEXA 5CUQA 4CM6A 2WAMA 2JKZA 3HCDA 3Q15C 4HUQA 3D43A 4AAYA 1O6BA 3FMVA 3FN4A 1UPBA 3OUZA 4MMXB 5H9VA 5H68A 4LV8B 2DAPA 3EEFA 3R76A 2F3RA 2ZSHA 5I7AA 1WRBA 4TUYA 4ZAZA 3FFWA