1V37A

Crystal structure of phosphoglycerate mutase from thermus thermophilus hb8
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
171
structure length
171
Chain Sequence
MELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAELAGFSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLALD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphoglycerate mutase
publication title Crystal structure of phosphoglycerate mutase from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Isomerase
total genus 59
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 5.4.2.1: Transferred entry: 5.4.2.11 and 5.4.2.12.
pdb deposition date 2003-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1v37A00
3F2IA 1V7QA 2PA0A 3IT3A 3K4QA 4E3WA 1BQ4A 3O0TA 3PGMA 2QNIA 1IHPA 5CX4A 3GP3A 1EBBA 1H2EA 2A6PA 1QHFA 3FJYA 4JODA 3D8HA 4PZAA 5AK0A 2EKBA 3E9DA 3F3KA 3IT1A 2YN0A 1H2FA 1DKQA 3D4IA 2P2YA 5CDHA 4AROA 3GW8A 2P9FA 1FBTA 3IT2A 4TSRA 4D4JA 1XQ9A 3NFYA 4PZ9A 2A9JA 5HTKA 4IJ6A 2H52A 3BIFA 1RPAA 2AXNA 3K4PA 1RIIA 4EO9A 4JOBA 2HHJA 2WNIA 5AJWA 3KKKA 3EZNA 4IJ5A 2P2ZA 1K6MA 2HIAA 3DCYA 1QWOA 4HBZA 5AJYA 3GP5A 3E9EA 1V37A 2H4ZA 2HPAA 2F90A 2P6MA 1FZTA 3HJGA 2EOAA 1BQ3A 2H0QA 3QPWA 2P79A 3MBKA 4D4LA 2YN2A 1DKLA 1TIPA 2P9YA 4ODIA 1DKMA 5PGMA 1E58A 1ND5A 5HR5A 1ND6A 1NT4A 3R7AA 2P9ZA 3DB1A 1RPTA 3FDZB 1QFXA 3FDZA 2BIFA 2OWDA 2P78A 2GFIA 1SK8A 2DWOA 1C81A 1UJBA 1E59A 2OWEA 4ARUA 1SK9A 2RFLA 1SKBA 1YJXA 3EOZA 4GPZA 1DKOA 3LNTA 1C7ZA 3D6AA 3QPVA 2WU0A 1SKAA 2WNHA 1BIFA 1T8PA 4GPIB 2P30A 2I1VB 3ZHCA 4ARVA 4FDUA 2P75A 3OI7A 3E9CA 3LL4A 4ARSA 4JOCA 5AJVB 1C80A 3LG2A 1DKPA 2P77A 3NTLA 2H4XA 4FDTA 4QIHA 2ENUA 5AJZA 3MXOA 4MA4A 2IKQA 4EMBA 2ENWA 3QPUA 5CU7A 2P6OA 2EKZA 4PGMA 4D4MA 1YFKA 5AJXA 3IT0A 1DKNA 3C7TA 1UJCA 1CVIA 4D4KA 2DWPA
chains in the Genus database with same CATH superfamily
2HH9A 3I2IA 1T13A 3ZC3A 3VPDA 2V7PA 3RVNA 4EPXA 1V7QA 2HY7A 2Z4TA 5I4KA 2OHIA 1P91A 1Y5MA 3DKIA 5CD1A 2OCAA 3QXCA 1XP5A 3IBTA 1OXKB 2FEPA 3AMVA 3NS7A 2XLBA 5H8WA 1PJ2A 2LD4A 2DHDA 4Q16A 1GSIA 5LQSA 4MS3B 1FTSA 4JQZA 1FUYB 4CUZA 2IUEA 4YDQA 1H2FA 1XQ6A 4BRUA 5ARDA 1YDMA 5FULA 3T94A 1VA5A 2JFQA 3OQHA 2JFHA 3D3KA 3H7AA 4DB2A 5C8YA 1WHSA 2Z56A 3VPXA 1VBFA 2FSFA 3KJXA 3QJYA 5GWXA 3CPSA 3EZ7A 4PZ9A 3BCSA 1VC2A 3BMQA 1VKNA 3HHEA 4EMSA 2LIPA 1SZCA 4ND7A 3OT4A 1OXBB 7AT1A 1P4AA 2GPAA 4WW0A 1QIMA 2PKEA 3RWBA 4B3HA 1OIWA 3VDRA 4K6CA 1AU9A 2QQFA 3O75A 2YUTA 5EJMA 2PQ0A 3ICQB 4N1AA 1C41A 3L6UA 3MWEB 1NJ6A 4GSLA 1P62B 4JLPA 1UBLS 3QJ5A 1UJ5A 1XPRA 4L4XA 4XGQA 4ZYVA 3BXEA 2BM9A 1XJ0A 5EE3A 2JHCA 2G9RA 4M49A 4Q9IA 1KJZA 3LY5A 1EXVA 5K3DA 5FV7A 1ECFA 2AEJA 2OHFA 2P9QA 2IYQA 4CKXA 2HJ9A 1N1EA 1EIWA 1MORA 2DUJA 4G4JA 4H4EA 2ZU6A 3W5AA 1RNLA 2P9YA 1FQOA 1LF0A 5GJCA 3RQSA 1LW7A 1UBCA 4LXYA 3GI1A 4XA8A 3F1LA 2YS6A 5H9VA 5FWYB 3R7AA 3ZE0B 2JI6A 4P86A 2FSIA 2I80A 4QARA 2FFBA 4YXFA 2XYPA 3KL2A 1DIOB 3HB0A 3LLSA 3PC7A 4JKYA 1HG0A 4PFKA 1XEAA 4GI5A 2OWEA 4N65A 4RM2A 1JMYA 2CHFA 1IHUA 2CUNA 2GA9A 4UOQA 5JEDA 1E1QD 3DULA 5HM8A 2EW1A 4KYUA 3QPBA 2A5DA 2JB9A 5TIIA 3DUFA 4MRPA 2C9CA 1G8YA 5M34A 3K0BA 3UXHA 5LA6B 4HNSA 1TAGA 1WBDA 1C4WA 3L5OA 4RD2A 1Q15A 1NUAA 2H48A 1ODSA 4GP7A 3I64A 2ZR9A 4LJKA 4RFSB 3K2BA 4RD0A 2CZQA 5JZVA 4AMYA 3WRXC 1WW3A 2QAIA 3VR0A 5CFQA 1EVEA 1DWPA 2FW7A 2O20A 3SEFA 2QRVB 1MEEA 2Q6LA 3KR9A 1XLVA 2BFFB 4UCFA 2J3KA 4NR0A 3DQPA 1SD1A 3FF1A 3RIXA 2PJUA 3ZN2A 3HDQA 3PE6A 3GDGA 3FYDA 3QVMA 3VGJA 1WE2A 4N0PA 5KNCA 3GU3A 3T1TA 3GDFA 3HWSA 5CLHA 4B3CA 3JVVA 1HGXA 3L7KA 3KNZA 4IZHA 5FLYA 4KREA 1KY4A 2ETXA 3WGUA 1RAEA 4HNUA 2XWBF 2WHPB 3DO5A 3R6WA 4ZAGA 2ZI4A 1KK3A 1NNUA 1GXSB 3T61A 221PA 1K68A 4K9MA 5JD6A 2ERXA 3Q1LA 1EVZA 2Z6VA 2E1RA 1QS0A 1F8GA 3A9TA 4IBOA 4JS0A 3QUSA 3ECCA 4MKRA 4GL2A 2ZK7A 3B53X 1WJGA 4MVJM 1ZRMA 3GLRA 1PGJA 4OXQA 4IS3A 3QI2A 1H3NA 1Z4QA 2O2YA 2X0JA 3VR2D 2OHXA 3C8MA 1VIDA 3VFDA 1I24A 5AUNB 4B31A 4OQDA 1M75A 1N4DA 3KUKA 5EL0A 4ARIA 4FDVA 2Q6IA 3RIYA 3UWDA 1YTUA 4HYEA 3LT0A 4IPTA 2JH8A 4LHEA 3ONNA 4EB6A 1RFGE 1U0FA 3B1VA 4ALKA 1VBNA 1SD2A 3STHA 4ZZ0A 821PA 3C7CB 4RDHA 1CPYA 1X92A 3OOYA 5JRDS 3HWRA 3GVXA 4OL0A 1HQYE 4H35A 3DL4A 1JYEA 5KZMB 1F3LA 2RH9B 2Z4RA 3DZGA 3NLLA 3D7KA 1L8AA 3KKNA 2NGRA 1PFKA 4TN5A 3IEVA 2AJCA 4MUKA 3CZ9A 2D6FA 4HZUB 2P1RA 4XOUA 1KYQA 1WVMA 2EP8A 1RRFA 1E6MA 1SCUB 2FXIA 3ABIA 2FSGA 2YYAA 1M1ZA 3NCTA 3QUBA 4LSWA 4DMLA 5IDWA 2PUHA 2R1VB 3A11A 4PLPA 3HACA 4WLOA 4PAQA 3RKSA 4HAUA 3F7OA 2C3PA 2IZZA 2PO7A 3K0KA 1KK0A 4HCJA 4NV3A 1JJFA 2X86A 1ZN9A 3N2EA 3D6JA 3I4FA 2JPDA 5A4JA 1D2AA 1FJ2A 3IIIA 5FTLA 1OH6A 4C7OA 1TAUA 3CRVA 3AF0A 3OWXA 1KVTA 3B2EA 4YWHA 2F1JA 1FVOA 2WJIA 3INYA 2C3YA 4HS4A 4C08A 4F45A 4IHJB 4O3MA 1GQFA 4JOSA 5JAOA 3KVRA 1D6JA 1GGHA 3ND6A 4IJUA 4KXQA 4OMFG 5CB0A 5B1EA 2VTBB 2WK1A 1A5BB 1EWKA 1YBVA 1VECA 4RZHA 3SSAA 4FI3F 5MHTA 1KZ9A 2V58A 3GVCA 3ZZTA 2IOFK 1HDIA 1KVRA 4ZARA 1K98A 5BUZA 1Z6PA 1BFKA 2OCDA 2VAPA 3I6MA 5CIYA 4FFDA 5C8YF 1CUZA 1BIFA 2QHXA 1JMKC 3H4IA 5D3QA 5FPHA 3UWMA 3NIWA 3WMRA 4RJJA 1J6UA 1A95A 1IOLA 1MJHA 4KXYA 4YQFA 1X1EA 3ZHVA 3AEZA 1GITA 3JR7A 2D2IA 4NCKA 2YRFA 1N9ZA 3CPHA 4NYMR 4DAEA 1F8YA 4HDOB 4K9RA 5ALGA 3WXMA 4B83A 1QJ4A 3KUUA 1X14A 1B8VA 3I1FA 3LXMA 5A4KA 1J8MF 2YR0A 1YA4A 3PU6A 2O5RA 3SXUB 4YRZA 2J0QA 1XZIA 4OUDB 4ZTBA 2IEZA 1JDPA 4W7HA 5ETJA 3SI7A 4BYMA 5HFJA 4XKJA 4RJLA 4OFXA 4P35A 2WU4A 5FPQA 4MVYA 2I76A 1AZLA 2BKVA 1YJBA 4P0TA 3N28A 3NRCA 1GGFA 1QDUA 1WPRA 4MB0A 4UXJA 2ZB7A 3UB3A 3WP1B 3HB9A 1DKNA 1CF2O 1R4MB 2QVBA 3STXA 4CR8A 4WVFA 4OGLA 3WGKA 1WNTA 4GXQA 4A7PA 1PSWA 2NXJA 3AF5A 1ZBQA 3UF0A 4C3VA 4C7VA 3EGXB 4HSEA 4W5OA 4G0VA 1HZZC 1ZL0A 2GJSA 2PV7A 3L84A 1E4OA 3DXXA 4H7EA 2UUOA 4UHJA 3S40A 3ZBTA 3RJMA 4I99A 2BH9A 5CW2A 1RXWA 2HQBA 2PUCA 1X7WB 3KYBA 2HBRA 5CVTA 5ITWA 1JZTA 5IUJC 2BISA 3DXYA 3I3OA 3ECSA 3U3MA 1KOGA 2WHXA 3JPWA 3PFWO 1D6SA 1HE4A 4G0QA 4DRXA 3OIGA 1KNQA 2WI8A 3OTOB 3H05A 4AF8A 3H5AA 4TKVB 4CLOA 3IQHX 2PSDA 1PNQA 3EWSA 2JEOA 4Z1MA 1U1CA 2CFTA 2DKOA 2ST1A 4RHUA 3C3DA 1GEGA 2ZP1A 3GRPA 2XZTA 5DW0A 1LBEA 4INPA 3CLTC 3TIIA 3VKFA 1FSGA 1TF2A 3BIFA 3F8WA 1H9BA 3NGXA 3P71T 2ZBVA 3E35A 4XJTA 2YINC 2RI1A 1XTJA 1KR5A 2FF5A 4AICA 1LX6A 3N9IA 3KFLA 3F4KA 3UCEA 2FR0A 4ROTA 1P19A 4QUIA 4NOKA 3ZS9A 3W3ZB 4LYHA 3LDHA 3NI2A 5A4FS 2UUAB 1LDBA 4Q3DA 3RM3A 1NW7A 3A1NA 2ZVDA 4BO1A 4IIGA 4XGRA 1GZHB 1OI2A 4NF2A 5JDIA 4B7AA 1BS1A 3HWWA 5JVDA 3S70A 1FCJA 1LK7A 1T8RA 2W58A 2PD3A 2AT1A 3DKVA 4J0GA 4XGKA 5A6SA 1G6OA 3HB1A 3Q85A 4BQNA 3TNFA 3BDAA 2VWPA 3RK0A 3E9NA 1Z8DA 4QLBA 3AJAA 3EISA 2BM1A 2W8ZA 4LISA 2NACA 2WUEA 1URPA 4HDKA 1THTA 2WRZA 3A36A 1OT3A 4W8GA 3ZDYB 3DC7A 2BFOA 3NHSA 4GH5A 5BQXA 2A0XA 4MGIR 4CG0A 3LLUA 1I80A 4GXTA 4E4TA 3BWMA 1EFUA 2X22A 5CAEB 1T10A 2FW8A 4HRVA 1BU5A 1MHPA 2FPLA 5LCXA 3NT2A 1P2TA 4KVAA 1V48A 4WK6A 3KQPA 2YNMA 4HNGA 2RFLA 4PPYA 4KOEC 1UDCA 3A70A 3L7JA 4K8OA 1GUAA 4KQEA 4FHGA 4AO8A 4JXXA 2RB5A 1ILWA 2FSVC 4LVOA 3FPBA 2G8LA 4MWGA 2RDMA 1O9GA 2PGAA 2NG1A 2VBFA 5AVTA 4CF6A 4DQVA 2V6BA 4MIOA 3DHNA 5UKDA 1I7SB 1EBFA 4WZAB 2IIQA 2O2CA 3JVUA 3Q3CA 4JLDA 2GNPA 4OHFA 3T5AA 2RE8A 1Z4LA 4TQUS 4ZAYA 2PZEA 4QUDA 4FEGA 1Z5UA 3B7WA 5EE5B 5FPYA 1ZUWA 3ET4A 1KRHA 2CBZA 3NRJA 5KBYA 2RGNC 3PTAA 1DOZA 4D02A 2O2XA 1X7HA 3EZ6A 5TNXA 4L57A 4BVGA 1U7WA 4ESHA 3UW3A 5CDFA 2WQ6A 4TUYF 1FS4A 2K2QB 2XKBA 1QYVA 3C97A 3DE3X 1W4AA 3E3OA 4G8DA 2LKDA 4M2LA 4BO7A 2WMDA 5I01A 4ESVA 1NMZA 4UZFA 2NPFA 4YCNA 1R4AA 4OGWA 3VR3A 4IIXA 1ZXLA 5KOJA 2XQKA 3P9XA 1Z17A 4U1RA 4N8SA 4BAUA 5DLYA 1YVDA 4JJFA 3I4CA 3AP2A 4BWGA 1O94D 2HU2A 4JEMA 3RFFA 1QLJA 2RHJA 1XCGB 1Y37A 5JSQA 3K53A 1Z6YA 2FK7A 3PHJA 4FZ3A 4RZUA 3KSZO 2Q3MA 3DMDA 5DBEX 4E2YA 2HU7A 1BXZA 4F0JA 4MSUA 3GHHA 3O82A 1F4PA 1DWQA 2GPYA 3ZCTA 3GEHA 3CW8X 2KX7A 2VUSA 4QC2A 4E07A 5B57C 4AJOA 5IH7A 1N5RA 4TTIA 1FLNA 3IE1A 3K96A 3LTNC 1M7GA 2OCYC 2HSJA 4EHLA 2G40A 1EP1B 4FGZA 2IU6A 4AKTA 5EQJB 1E2BA 5D01A 2R751 3EBLA 1OXTA 2PKCA 2KWIA 2PANA 3L1JA 4H60A 5IRCD 2I3AA 3OCWA 4E22A 1XJQA 2FH5B 5AW7A 1ABEA 3VNAA 3EXFB 1YJAA 3TRHA 1JWBB 3FH0A 4HDQB 1UT8A 4AS1A 3N2NA 2YVKA 1NVWQ 2JFBA 2H07A 2HYIC 3DTVA 3SJCA 1CYDA 1XN4A 1K6MA 3TF5A 1TE2A 2Q1UA 3K30A 3O3OB 5I7OA 3WTCA 1FYEA 1Q83A 3NDJA 4J75A 3QF7A 5FOTA 4ZU6X 4IQ4A 3ROQA 4Y2PA 3GT7A 4UFPA 5JLJA 5LQKA 3KDPA 2ZPTX 2AEFA 3A04A 2FWPA 4B17A 3IP3A 1XDBA 3MOGA 1L6IA 3U40A 4YUWA 4OLHA 4L4RA 4RK5A 1CUGA 3QYFA 2QUJA 2AG0A 3SFZA 3F0TA 4QTZA 4UM5A 4OHPA 3RHTA 3AJEA 2B1GA 3I2GA 1ESZA 3UPDA 1R0YA 2PCLA 2B1JA 4JR1A 1UFKA 4QD3A 1AKEA 3ZG6A 4DSZA 1QAMA 4ZCMA 2C5LA 1II9A 5AM0A 2LCQA 5K0FA 1M6VB 2PLRA 4BNVA 4M6WB 4CTJA 4PG8A 2PUGA 1OFGA 1HLGA 2VPPA 1R3UA 2P62A 1K66A 3N87A 3WLJA 1GDDA 4PX9A 1ULZA 2N75A 1Z73A 4LC0A 2HB6A 1TMYA 4P2BA 4WA8A 4RSRA 8LDHA 1MOZA 1Z35A 2PVCA 1ACLA 2JZNA 1JQEA 4OD0A 2QA5A 1DAHA 1Z0DA 1LQ2A 4MQEA 4UHDA 3FVQA 4BAGA 4FFNA 2YZGA 4X95A 3DF9A 1V95A 2NO6A 2LIVA 2ZRAA 5L6LB 2C88A 1JNYA 3NXKA 1EHCA 1KZ4A 1WXEA 4LZPA 4IGFA 4LJ8A 4BKOA 5IASA 1G38A 5IULC 4DREA 5CM2Z 1T2CA 1FDIA 1VDZA 4D80A 2BGRA 1N3BA 1NLZA 2I1QA 4B79A 1CQJA 1DQSA 2GARA 3KKPA 3FGNA 1Q16A 4RO0A 1NSFA 3W06A 2D5AA 4A1OA 2AJBA 3E70C 3FCSB 2ONZA 1YNOA 1EG7A 4ES6A 4PQGA 1N0WA 5TGZA 3V9PA 1P44A 1T43A 4YLEA 2I78A 2BP7A 2PAFA 2Q9BA 1BX3A 4UAGA 5JVDF 1C9NA 3F8SA 3H2HA 2X8JB 1JTFA 3VTKA 3ZGVA 2GYVA 3JALB 4N5HX 3T9BA 4XX0B 3EIFA 2QOEA 1OI3A 4DLXA 2Q5QA 1J8QA 5EJ8A 3PEEA 1BXGB 3GCWA 1ZA2A 3O9ZA 5CA1B 1Z5NA 3ST7A 4MW1A 2VNIA 3QHAA 1AA6A 4MA0A 1SQSA 1W2HA 1U98A 1AD2A 2AUNA 5F7JA 5FUWA 4C0XA 1LSJA 3IVRA 4YCMA 2G9ZA 4YRQA 3VHQA 5JCJD 1WXXA 4PQYA 4WERA 2QG4A 3HDGA 5EI5A 4EL0A 4P7KA 3RC9A 3II6X 2RH4A 2WV7A 2YHBA 3C4JA 2ZREA 5BUQA 1TYCA 1S3SA 2FW6A 1K2WA 4YDSA 2QT1A 5G3ZA 2PUDA 4QOSA 3OE7A 1II8B 2R62A 3BD7A 3E9DA 1U3DA 2GEUA 1SXJE 1FYVA 3W6UA 3CLVA 1G1AA 3A1SA 3I1JA 1K2VN 4I8DA 4LYAA 3EAFA 2VDLB 4G24A 4U9UA 1YSCA 2CY0A 1K4YA 2OBMA 3TSZA 2ORED 1RS0A 2Z5LA 4JQCA 2CYBA 2P0AA 4ZT3A 1Q7BA 2I4MA 2GEDA 4DJEC 4RIGA 1GGNA 4HN4B 4LJ4A 3NFYA 3S1AA 4EITA 3SX4A 3L79A 3KBOA 5TXGA 1DAOA 2O54A 2RCYA 2G9NA 3ZE8A 4HAXA 2QF7A 3O03A 4OHCA 5TQ0A 3RUIA 5E6RB 3EPKA 1IJEA 2FWBA 1WULS 1OLXB 2VQDA 4RA6A 5HKOA 2CLDX 4AT1A 3IVAA 1K97A 2C77A 2ISQA 3L0IB 5FWDA 2O7SA 4KWHA 5BW5A 3A3NA 4TLCA 7GPBA 1AS2A 3ZZNA 1MQAA 1TEHA 2EJBA 2IPOA 2W4MA 3IQIX 3UJBA 1H0KA 4UEJA 3ZV7A 2A9KA 2B35A 4ZVUA 2G77B 3HCEA 4Y1FA 1UBTS 4LWPA 3GLVA 3MCWA 3ZGZA 4CFYA 4IIYA 2FA9A 3DW1X 2AN3A 5D87A 1PJRA 1CQPA 3EF3A 3R7WA 4MVCA 2GBGA 4YP0A 3KRTA 3P27A 3JD0A 4KO4S 4V0OA 1A2OA 1JDBC 2BFMA 2XODA 2OXEA 3L9WA 2BUBA 5A0FA 3TQHA 4CE6A 3FD8A 4J91A 4EVIA 1W5BA 4FYIA 3MHPA 2CXSA 1OKKD 3IDZA 1TL7C 4QPJC 4LCBA 4KQ2A 4N3CA 3W9SA 2AJLI 3FIUA 2ES4A 2NO0A 1UJBA 4QDUA 4X7BA 1XZFA 5HE8A 3UHFA 1KC1A 1W46A 5JD5A 1DIBA 1RWQA 2REQB 1HDYA 4FK8A 1RWOA 2IDKA 2Q1SA 3U9SA 3WMEA 3WAKA 3DZHA 4XX1A 5KNLA 2AMVA 2BEVA 3M6XA 2PGJA 4J1TC 3KZNA 4YP1A 2IVZA 3ZJVA 1VXRA 3ZHCA 4DUPA 5FHQA 4Z5XA 4RIHA 4V0LA 4KQ9A 4GOJA 2B1QA 2Z5VA 4KE6A 2HCRA 4FEYA 2HJHA 4DIEA 1A82A 2WJ4A 5JRZA 2HL6A 3ENZA 5BW6B 1SHJA 5I3ZA 3PHHA 4HH3C 1CF4A 3G0HA 1RI2A 2MYUA 4YDHB 1M7BA 3IDAA 1OBHA 4OFBA 3TQQA 4RCZA 2WAXA 3UMCA 2GN8A 5E3JA 5CB4A 4FONA 4IXDA 1M5UA 2IOFA 3NBFA 3WGVA 4QYXA 3QX8A 1Q0QA 2Q2WA 3UAOA 3PX7A 3IPCA 4ND4A 5E1DA 3UO8B 1GV1A 2DPLA 1B0PA 4EZIA 4XASA 1TW3A 1UDBA 2GYYA 3IXLA 4IVQA 3SN6A 1JQLB 4AKGA 2RKWA 4EJSA 4TUYA 1ISFA 5BP7A 1XA4A 5DMHA 3DWFA 1SCIA 3VPBA 1I2DA 4RTSA 5E4TA 3LBAA 1OWNA 1Z4PX 1RP7A 3G23A 5KWIA 3QF4A 3WNQA 2GO1A 2WJYA 3UVEA 2VLBA 3K73O 1KE2A 2CYCA 3V8MA 2GB4A 4M0EA 2Y0PA 1H9CA 3AYZB 3AR8A 1P4JA 1FUEA 1J2TA 1FXSA 2ZRNA 2CLFB 5BR1A 2H7XA 2N3ZA 4QGFA 5IJ9B 4IDPA 4N6NA 1U0JA 3N8KA 4JLSA 4PLCA 4DOMA 2NO7A 1WDWB 4Q5IA 2WM9B 1L7PA 1S1CA 1YI1A 1YUMA 5JAMA 3IUJA 2IL1A 5CK5A 3FGOA 1IXYA 1OW3B 5HTOA 4Q19A 4YFYA 1CDOA 2GN2A 1SU8A 4I4TA 1ZBDA 2G83A 4X7MA 1OE0A 2JEZA 5KCMA 3KJEA 1T9CA 1G7RA 1NLMA 3O8BA 3QVWA 3WA6A 5B4UA 4C2BA 1TZJA 4NC9A 3RTGA 2X5NA 4US2R 4DCGA 1AM4D 4JGBA 1W19A 2D1RA 4IIVA 4MYDA 5M5BA 3U09A 2V96A 1VKOA 5D3MA 5KSPA 5HIAA 1XMPA 421PA 2FPMA 2XMPA 3JASB 3PQFA 4QAJA 5EOVA 1I2MA 1YDGA 2OXTA 3H9GA 1D6MA 4D57A 2H11A 1HH4A 3A14A 4QSHA 3IXMA 1X8KA 4ER6A 3IOCA 1E3WA 4G09A 2FMKA 3P9YA 1LSSA 1UK6A 4I55A 3ZE1B 1FW6A 3NAQA 4KK3A 1SKUA 5EKTA 3K4HA 1BOOA 1JFFA 4O2AA 2BKUA 3DB2A 2B9EA 4QULA 4HPXB 1LBTA 3ASZA 4RLFA 4FNAA 2PX0A 5IZ4A 3FHJA 4OHRA 2IOQA 1OXUA 1X1AA 3Q88A 4QVIA 1YAJA 1L5WA 2R84A 5KYGA 2P65A 3EG5A 1E4EB 3LCRA 3AVOA 3PLRA 4X41A 4AXBA 4OU4A 4DKJA 4KQKA 3S7ZA 3Q7PA 3PR3A 1KSJA 3VMMA 3DBHB 4NRDA 3AR5A 4O63O 4BNHA 4BX0A 3DDOA 1DXQA 1T6NA 3BQMB 3VPSA 1AKMA 3G88A 3WZMA 3HN7A 1L4KA 1NLUA 2BJWA 2QVXX 1GG2A 1KEZA 1T34A 1ZW6A 2E4UA 2GFQA 3G82C 4DGSA 2WB4A 5JZSA 1NMQA 1X8JA 4OMCA 3WGHA 2AFHE 5BR7A 4CTMA 5DRTA 4NSNA 2ZZMA 1A4RA 2BHRA 2AKEA 2P5SA 5TPZD 1J0XO 1NNLA 2BDUA 2YHSA 4IXMA 3UW1A 5F76A 4QHYA 3HJHA 3HVUA 2HO4A 3A9RA 3DVLA 1KS9A 1QF6A 2ANCA 3B89A 4MGKR 2J09A 3T7SA 2FAXA 5BW8A 4EI7A 4CIBA 1WZIA 3VVBA 1KPGA 1QE5A 1J21A 3WSWA 1OGYA 2WPDA 2YFYA 4MUEA 3T3OA 2I3GA 4C0LA 4IKEA 4QIHA 4CLXA 4EENA 2XVZA 3V1YA 1M0TA 1FQJA 2V3WA 3OE4A 4OLAA 1K5HA 5EJ4A 1XJ5A 2B4QA 3NOOA 4ICIA 3S2SA 1V96A 4M0DA 1IRIA 3C1UA 4BNDB 1QHNA 3FTEA 3RVOA 1RWWA 1LZLA 1I4LD 1WXFA 3WMXA 4DMFA 5BOVA 1N7GA 1QH1A 4GSKA 2NMVA 4EF4A 2G0AA 2IGBA 5JO0A 3UNXA 5BSEA 5JNVA 5TS2A 1SQ0A 3MWLA 4BGVA 5KYKA 2ROQA 3U5TA 4JOQA 2FOXA 1C50A 3H04A 5BV7A 5I48A 1E2PA 3V48A 5TMPA 2P9CA 2JLBA 5KO2A 1SVKA 3LQFA 3TQIA 1LWOA 1XCOA 1V45E 1E6UA 1A5SB 1SBNE 5B1HA 4CKCA 1C3JA 2P6PA 1BVYF 5BWOA 2REBA 4XYGA 1K6JA 3B20A 1ESCA 3V2GA 3KSRA 1T91A 3QA3E 3W8EA 1A2KC 2P7IA 1UPUA 2EBWA 3NV9A 1WRBA 2J41A 3MYRA 2WVGA 1DIRA 4D0NA 4TLLB 3UAVA 2D5LA 3THWA 1K7YA 2FJPA 2IZ1A 1BG6A 2I71A 2VNJA 3I6IA 3EZFA 2BUCA 3MELA 4PCAA 2YHIA 1PJSA 3B6ZA 5C53B 5DOZA 7ABPA 1ZESA 1Z4OA 2WKQA 3UYKA 1H1LB 4TT3D 5KEIA 4JJAA 3HU1A 5CB4F 3WMFA 3H5NA 5J40A 1B8UA 2BUAA 2V9CA 4AUMA 1U81A 4LF7B 4MGHA 4DABA 4ZAFA 1FE8A 4EW2A 1GGEA 3ZQ6A 2CDAA 2QJOA 3E5HA 3MUFA 4ND5A 4YUYA 2EOAA 5IMBA 5I4CA 1W96A 1LBSA 4R2WA 1V5EA 2BEUB 1IC6A 4N12A 2YCLA 4KQGA 5ERYA 2X5XA 4B5KA 2MR6A 4E5DA 4K9OA 5J59A 1A8HA 1X80B 4WNCA 1WP9A 4Y6QA 5P8WA 1KYIA 2ODBA 1BKYA 1VCIA 4MPJA 2B69A 3DB1A 3MCUA 3QKSB 4A9AA 3NAZA 2BGJA 1QFXA 1N6LA 3BRQA 1GNVA 1TLTA 2VDKB 3B1JA 3JYPA 3QOXA 3QX7A 4MV1A 5CEFA 1IUKA 4HLUC 3CX8A 1LA2A 1MF7A 4P3OA 3FR8A 2J87A 4M7WA 2ODEA 3HR4A 4Z49A 1KVQA 2GS9A 4RY0A 1HRKA 3N2GA 2QM8A 3E1SA 5T8KA 3ZLTA 3M9LA 4I4TF 5BT9A 5JAHA 4DF3A 1ZXBA 1ZMRA 5LDDC 4FBGA 4KXUA 1D0SA 3K94A 2JI7A 3D5TA 1ZGJA 1I1QB 3W5VA 5TC4A 4XQ0A 3WKAA 1GZ4A 2JJYA 5KKNB 4UEWA 2OL4A 2HXSA 3AQIA 3OSUA 1DAGA 4W1RA 1NC3A 3GIWA 1NUHA 2O3RA 2GPJA 1A9PA 1DV1A 3TQSA 3G8AA 3SQDA 2O8DB 4I5FA 4F38A 2JVJA 1HDXA 4XYBA 4A91A 1L3IA 1RLOA 2H31A 4F86A 4O2AF 3OQOA 3V1UA 5JYBA 5IBRA 2PGOA 3PR1A 1YIOA 2BHNA 3EB9A 4JP1A 3ZDEA 3TEJA 1T1EA 2VSXA 1XAHA 4U9HS 5LDGA 5A4MS 1MIOA 4O4HA 3QGMA 3ILVA 3IQGX 4QU0A 2JFZA 4QHSA 1T6BY 4MCJA 2X6TA 3AFHA 3RU9A 2W6CX 4FN4A 5L4NA 5AK4A 1T5DX 3H9CA 2WF5A 4I3HA 1YE5A 3R5HA 4QJIA 1SHUX 3FHLA 4L85A 1P1IA 1UXIA 3L8EA 4X1IB 1AKVA 4NENA 1E9RA 3IHKA 4Z99A 3IAAA 1P0PA 1M83A 2G4VA 4XM1A 1UP6A 2R87A 3E48A 3RVKA 3SC3A 4GL4A 3WL4A 4BE4A 4YRSA 5L3QA 4CGZA 1EFPB 1U2ZA 5CXSA 2FYTA 3D6VA 3TNDA 3ILHA 2UKDA 2VHQA 1Z0SA 3BHMA 4G2NA 4QYSA 4DJFC 3H5IA 1I1OA 1MH9A 2RGCA 5GPBA 4A36A 3HYNA 4I2NA 1JT2A 4ZDKA 3TOZA 1NF9A 2VT7A 4GKBA 1E2IA 1TO6A 3V00A 3VO8A 2IP2A 2FMIA 4NOLA 4PY2A 4N18A 2EFJA 3RUCA 2H1WA 3GPIA 3OEED 2ZQ5A 2BRUA 3T4XA 5JCXA 1L5YA 3IVXA 4OQLA 2B83A 4I4CA 2JBWA 3VR6A 3DMRA 3KTOA 1YZNA 4QFCA 2FSHA 4EG0A 4OGKA 3TMAA 1KYTA 3LX5A 5EVJA 1O2DA 3AHEA 3RBVA 4D9IA 1WUKS 4ZCRA 5AUOB 4CCYA 3R6DA 2CHQA 3B9RA 3FGZA 2CLLB 4V38A 3ZDCA 4F56A 2BGGA 2ZYHA 1XNHA 4FGUA 4JUFA 3CPEA 5CLIA 2CD7A 3TG8A 1WHSB 3OOHA 4BRSA 5HJ7A 4EGAA 1AURA 1XRNA 2WD8A 1XEXB 4UMEA 2F9FA 1GAXA 4RHFA 3BMQB 3DLAA 2D13A 5C8ZA 3DQZA 2B8EA 4U7FA 1I0IA 3L01A 3PXAA 4D5GA 1E3LA 4OXRA 4E31A 2YTZA 3AJ9A 5L4SA 3LBNA 1JH8A 1ZNQO 3LBFA 1PHRA 4KXWA 2JIZA 5J4LA 3VO9A 3W2EA 4MIKA 1TVCA 5FOUA 2VT3A 3AR7A 2DQKA 2QZZA 3L1KA 4I50A 4YIKA 5EHQA 4D74A 4DV0B 4AKHA 1FDRA 2HHAA 1DQZA 3ELYA 1DV2A 4RPGA 3WL5A 1C0IA 1SC6A 1SXJB 3EFOB 4MW6A 4EARA 2IOHA 2GDJA 2A1TS 3GBVA 1ESDA 2DBVO 1KSHA 1W34A 3P19A 4P22A 4UD2A 4OXKA 3TLGB 5BRJA 5K7SA 1JZSA 1K06A 3GFRA 1NQ5A 1KZ7B 2EC5A 3KEOA 4IMIB 5FUBA 3RFXA 3X1DA 4DCVA 1M2JA 5EUCA 3H4TA 4MP8A 5H1YA 2I4RA 2FWNA 3CIOA 4Z4HA 5LU9A 1MBZA 1CJCA 2Q6VA 1X38A 1ZX1A 2GILA 1I6MA 3MJRA 1YL6A 4KW7A 4PSAA 4Z9XA 3LXXA 4U7WA 3WYFA 3IAUA 3EXIA 5J5VA 3B38A 4NDZA 4XVQA 2IXTA 3HK2A 4Y9DA 5GTDA 2OBLA 1UMCB 2RGXA 4ZQCB 2YICA 2NQTA 1OR8A 1EQ2A 2PMDA 1AQNA 2YFKA 3BFVA 3ZTWA 5CB8A 3MD9A 4D98A 3DUFB 4C21A 3C85A 4PZ0A 3EA0A 3ZNQA 3VNQA 3HCPA 1IN7A 1FS5A 3O9VA 4REQA 1FNMA 3WL3A 4BP9A 4DSUA 4IQFA 3HVRA 3VR4H 1XHEA 2PAAA 4OKNA 5FOWA 3BCRA 4D3DA 1Y1LA 2DHEA 2XUGA 3SYNA 1VYTA 2BR5A 4PG4A 1V1JA 2ZE8A 1TTHA 1QP4A 4FYVA 1Q22A 3BFKA 5K8IA 2X4IA 2W7TA 4E11A 3GLGA 4GWGA 4HQ0A 1J39A 4OAQA 3IOBA 1K7EB 2Y2VA 4DDHA 4DA4A 1DC8A 1CY4A 4WJKB 1CJKC 4HATA 2Z8YA 3TJRA 5K0EA 1Z25A 2OZLA 2Z4SA 4BMPB 4C22A 3EY9A 2QRMA 1YZFA 3OUTA 3CVVA 1OTHA 1DAMA 4GZ6A 3TSYA 3LGSA 1WIWA 3LA6A 1M8JA 3IGFA 4DLYA 1QS0B 3WAJA 1XU4A 3T7IA 4D4HA 3S8EA 1DQRA 5G0TA 4CTOA 3W7AA 2QMYA 4HBGA 1WQ3A 3F4BA 4EATA 1ZONA 2A2ZA 3W2GA 4LCEA 3UGJA 1FPQA 4AF6A 1ML3A 1YCGA 3S4YA 3DNMA 2YOHA 3DO8A 3RQIA 3WJAA 4LUCA 4PFJA 2DQ4A 4M88A 3VZDA 5BW4A 3EZ2A 3HJBA 3RUAA 2A9QA 1F3OA 2FWAA 2Z8XA 4DLWA 1TT5A 1DKLA 1BGXT 1M6YA 3F46A 1X86B 3N7AA 4O4HF 1AKYA 5KTOA 1KEEA 3U62A 1MX5A 4A2WA 1QLWA 1RKBA 3GLHE 1PK9A 1QP8A 2V7GA 2XYGA 3AI3A 3NC1C 1VBMA 2PL9A 4JASB 5J47A 2PRSA 2HMYB 5AKIA 3T7TA 1ZAYA 4IL5A 3B1KA 3SMVA 2REOA 5FPPA 1USKA 4BGEA 1FDTA 4H3KB 2QTTA 3H4VA 3REQA 4MZXA 2O1SA 2CL0X 4FVTA 3UAGA 3K1JA 2ICAA 3HFRA 5FA8A 3UHPA 3NKVA 1JYSA 5JEEA 4LRSB 2NUTA 1Z4IA 2P1ZA 3HKEA 4M9SA 3DQQA 2Q4OA 3TDMA 4BXOA 4UUMA 1GZUA 2F3UA 1EWVA 4V03A 5BV1A 4PRLA 3NEPX 1I7NA 3JAKB 4EF6A 5KJFA 2D06A 3J81k 1XR3A 2HIGA 3CF2A 2O1EA 4WOPA 1VIYA 3LPNA 4OO3A 1EUCB 2GUWA 2QJFA 2R68A 5J2TF 4C7OB 3DCIA 3GH3A 1NUSA 2Q6TA 4G65A 3T7AA 1QOPB 3OJEA 4UQOA 4HFMA 4X61A 1CUJA 4NH4A 3DONA 3AR2A 4ZQGA 4K9NA 4ENUA 5LIPA 2CNNA 1H2YA 3AF2A 1E1CB 1YA8A 4C3OB 2W2VA 2Z1NA 4EIWA 3N2YA 4JC0A 4OU5A 4L5JA 1T3SA 1HM5A 3KV3O 1ZN8A 2G4LA 1SXIA 2GJ4A 2WSIA 3A37A 4E5PA 5ER9A 3WYAA 2RONA 3NJRA 3R40A 4L76A 5ALEA 2GAOA 4A4DA 4EUKA 4BEVA 1VKHA 3TLAA 1A8PA 4K28A 4KFRA 3KXKA 2ZYAA 1JWAB 4NBSA 4HG2A 1ADFA 4E5YA 1JIKA 5BMVA 2P9TA 3PL5A 1V3UA 3BIWA 3ENVA 5K4AA 3UA4A 3FZEA 1T4CB 2O2ZA 2NU6B 2PRKA 3GLTA 1DC3A 1P7VA 1YL7A 1Z3IX 4YRLA 3ZWXA 5HG0A 1GTL1 4RIEA 3DT9A 3P4YA 1Y6QA 3FPEA 4M1EA 121PA 1L4EA 3T3HA 4D26A 4LJ7A 2A9RA 1X7XA 3BZUA 3LAWA 4OI2A 4RK7A 5AW1A 1RYEA 2ZJAA 4I50F 4JKOA 1TTTA 4WZZA 2VL7A 2PX4A 1U4OA 2VXBA 4AZSA 3QEMA 2GYWA 3T8YA 3U5ZB 2C97A 1UWVA 1SG9A 3CVXA 4LZLA 2PRZA 3LUDA 5ICMA 1SG0A 5EERA 1UM9B 4RDCA 2ZI5A 3BMNB 4GM4A 5GADl 3DLPX 1TIKA 4ZTUB 1FK8A 4OFWA 1EP2B 3I9V6 3IR7A 3EVZA 2BEJA 2G5TA 1IAVA 1QG2A 5GJWC 3WVNA 4NY1A 1M66A 4UHCA 3VO2A 4AXXA 1EX6A 2F67A 2X13A 4HO1X 5KI6A 2DBQA 2Q5JA 1Y8RA 1B1CA 4A0FA 4UM9B 1ZOLA 3KPYA 2C7GA 2OD9A 2SICE 3K0CA 3DDSA 3GCDA 1X1CA 4AP6A 3KPUA 1GZ6A 2VBIA 2DE0X 5DIFA 2M98A 3J81A 2WSSD 4L02A 2BL4A 3TCNA 3VR2A 2CJPA 4L6AA 4BO9A 5JIBA 1PVOA 4IX1A 3MGGA 1UBOS 3F7NA 4D46A 4ABYA 4ILKA 3KR2A 1CD5A 1C7FA 1RP1A 2CXUA 3C3KA 1OC2A 4U7PB 5F5XA 4AG6A 4BOYA 2PEYA 2WTXA 2RHBA 1SUWA 1PWHA 3RG8A 2BSAA 3W3AH 3OZ7A 3D43A 3EFEA 2HBYA 3A6GA 3OCZA 3T9DA 4B7UA 4WH0A 3QP9A 1SBIA 1TECE 4HVAA 1FW8A 2QY9A 2GFIA 2AK3A 2ZJFA 4I3FA 3B1YA 3DCJA 2PH7A 1RVV1 4YJFA 3OQVA 4H7IA 5FOVA 3HP1A 4IG9A 1E2MA 4DPKA 1IEVA 2RARA 1CIVA 1J5PA 3MFQA 2ZXFA 3HCBA 4RPKA 3VDMA 5F35A 1M7HA 3JQ9A 5JVDB 4REOA 2CLHB 1ULTA 4QPZA 5AOBA 4L5AA 1LLQA 1NJ2A 1CZUA 5A6SB 4CF7A 5KINB 2Q3JA 2W8BA 5J3JA 5DLDA 2HTEA 4FPXA 2C7QA 3E3MA 4BNZA 4BQPA 1JILA 4HC4A 2MSKA 4HGYA 5E7IA 5FPSA 1LRJA 1NN1A 4HDKB 2W6NA 2WJPA 1WVGA 3E2IA 4Q3LA 2G25A 3B3FA 2JFUA 4ITRC 4LDQA 3TQFA 4ATNA 4IW3B 4V2UA 3UC5A 4NBVA 1GUYA 1V5GA 1W2WB 2N46A 1AMOA 4EY7A 4K3UA 2PKYX 1LBHA 1NRXA 4R1NA 3VDQA 4FFRA 4X7PA 5HZMA 2J3DA 3L0PA 2XDWA 3OZTA 4B4OA 4Z4IA 3OJOA 4ZYUA 1QDEA 3DLIA 2NZUG 1VFPA 2VDPB 1QANA 5BV0A 2ZRGA 2ACEA 3C8DA 3U26A 4UPEA 5JE8A 6GPBA 3FB4A 3D8RA 3CMMA 2H8GA 3LK7A 4QRDA 5F5LA 2GM9A 3TVDA 5I4BA 5JJLA 1E1KA 4M1SA 3OZDA 2B6NA 1D5WA 1RJGA 3SQMA 4BFZA 4C7MA 2V0GA 2HF8A 1Q1NA 1K88A 1NI4B 3EVBA 4JYPA 2BT4A 1N5MA 4RXUA 3PQ5A 2A4MA 1RRKA 2A9PA 3A9WA 4COOA 4TQGA 3FPFA 5FORA 3LHFA 2OO3A 4EZEA 3BXZA 4J43A 4F4CA 1BHO1 3O84A 3C6YA 1XK6A 3U7RA 3UKOA 3R3WA 3QZUA 4EUHA 2BCEA 1ODKA 3OM9A 4LRWA 3H19A 3AEQA 3R44A 4FKBA 1WM1A 2W2XA 4ZV9A 5CXXA 3G2LA 4I81A 3TTWA 5DV9A 2XKAA 3DVSX 1ZGHA 1JVBA 2A84A 3OLYA 3PXXA 1TTQB 3MAGA 4BKQA 3I3SR 3QWFA 4WE3A 1JLMA 2JLSA 4AJPA 3AXSA 1ISRA 4HR7A 4W6QA 2UZ4A 1RC8A 1VG9B 4YQYA 3OJCA 2PXCA 3KKKA 1GTRA 3WLFA 4Q48A 4X93A 2D1YA 1QZXA 3QVJA 3KR1A 3FB1A 1EFCA 2A88A 4WZ6A 3SS7X 3A6PC 2XWPA 3T1VA 2IY8A 2Y1XA 4YQZA 4DHWA 4BY9E 1JPJA 5FWXA 3ECAA 4ER0A 2DJ5A 2DPYA 3C15C 3ND8A 4L8YA 5GIOE 4R0MA 1UEJA 4KWCA 4JUCA 1NVVR 1VRVA 1J97A 1FP4A 5KMGB 1I6WA 1JUDA 3EWAA 2IIPA 3SFTA 3FFXA 2IK8A 5DTRA 3L1IA 3IB6A 2JZOA 4A6XA 721PA 3T99A 5BPHA 2R8PA 1NQUA 2KB0A 1H22A 2B4RO 1LU9A 5H9WA 4DR6B 5CJ2A 1YRYE 3V2IA 1HFWA 3M83A 3U3RA 5K8TA 5DM60 2HCJB 3DTVB 3KHUA 1G2IA 2PH3A 3B5JA 5AMXA 2V8BA 5ED4A 5EMMA 2I8CA 1TJ3A 2OZEA 4K6HA 4XXHA 4ZCQA 1XSEA 4JBLA 1NE2A 2H7CA 3T35A 3GUUA 1WZUA 3PNVA 3JX9A 4DZRA 4TPKA 1CRZA 3E5NA 3I04M 4GPIB 4JJ8A 4NOMA 3LBYA 4L9RA 4OLJA 3ZZ0A 4E32A 5JXJA 1HA3A 4XD7D 2WAAA 1X13A 5TQVA 3ER9A 3ZVKA 4FHDA 2FX5A 3HKCA 4A5OA 2H1IA 2J5KA 1CU1A 1A2QA 1NP3A 1X19A 5AM5A 1XRRA 2IW1A 2ZSEA 3HI6A 5E7QA 4BBJA 2HBZA 4HNHA 4M0CA 2AZ4A 1Q2XA 3EYAA 4XI9A 3WOHA 3IO5A 5KYVA 4H17A 1XEFA 3T0GA 3BXOA 2NZ2A 2WUVA 4LC1A 3B3GA 1M6WA 2R47A 3JARA 3KUCA 1MH1A 2JJ1A 4EK9A 5AW6A 1W7AA 4EJSC 2J7PD 3ZWAA 4MTLA 4I2VA 1O6FA 2NSHA 1FRFS 2Q5IA 3K5PA 4PN7A 6NULA 1MEOA 3R4CA 2C7PA 5I6DA 1LK5A 3CUKA 5KWJA 1CHNA 2VJMA 4RS4A 4TWZA 1VSBA 3IAFA 2GEKA 4DWOA 4PCUA 1L1EA 2Y1WA 3C3PA 2JCGA 3E9RA 4I1VA 4MEAA 1P5HA 4YRAA 2IUSA 3MTDA 2WTBA 3HA2A 4L4YA 1PHPA 1QCZA 2OXIA 1CQJB 3DMFA 1DG1G 3LQ2A 5D5QA 1PSZA 1Z18A 2JFNA 4X8OA 3AUUA 3CRNA 3NHWA 5ED0A 2CNKA 2AX4A 2RC5A 1IDOA 2IV7A 2VH2A 2OA0A 1WLYA 3LF1A 1MNAA 4IOJA 4Y9SA 1TZCA 2BP7B 4XTCS 4MVJD 2WUWE 5HHTA 1L8LA 4OHXA 1HF3A 2EFDB 2VSOA 3NJ8A 5TSDA 4PX3A 1D6NA 2FFQA 3TTVA 1L4MA 3T06B 2O6HA 3S1LA 4URVR 1LK0A 3OBIA 4BUZA 3DOCA 4NBLA 2O7VA 2ECKA 1EHYA 5EMHA 2IEAA 4H7KA 4A92A 3DLTA 4YT4A 2GEVA 1C0LA 1U3FA 3MPOA 3FXAA 3BX1A 3QMPA 1JTVA 1MB9A 3E5MA 3OQIA 3GUYA 1KE1A 3P9NA 4DV4B 2YMQA 2Y6VA 1ZD1A 1JA0A 3JQEA 4IJ5A 4OB8A 2H63A 4P5DA 2Z95A 4U5QA 5ALIA 3CVWA 1UZMA 2WFAA 3G0CA 4LAFA 1HOTA 1O94A 1PZFA 1TQDA 1EWRA 2QZJA 1KDYA 3GA5A 2DUWA 1IVYA 3OFSA 4MQ4A 1LGYA 2YYSA 3MTQA 2EFYA 4P38A 1RYNA 4XARA 1DL5A 1EFRD 1I14A 1L7RA 1KDOA 1BQ3A 1D07A 1QYDA 2C3MA 1IUOA 2C00A 2HNAA 1PNVA 1HUQA 2EQ5A 2HJWA 4P58A 4PPQA 5AXAA 5GVRA 3QE0A 1FFWA 1Y3BE 3E8SA 3WLRA 3FWYA 2FCRA 1BGWA 1GTG1 3GMDA 3JZFA 5FBVB 3ABRB 4Z53A 4IIBA 3EGDA 4U0JA 3DBVO 3QRWA 2YXNA 4G07A 4GR9A 4CMEA 3LVFO 1SU7A 3PI7A 1QV6A 1Z63A 5B2ZA 4V39A 1HE8B 4YJ3A 4A0HA 1A9ZA 2GEFA 2VJQA 3AYXB 4Z4CA 5AVWA 2AZDA 2C5GA 3KOYA 3QBJA 3SIPA 1S2IA 4NJMA 1AK9A 4P4TA 5E9AA 2BHSA 2GBFA 1V3TA 1WCYA 2CCKA 2YWRA 3HJNA 4B3FX 1JKMA 5G0WA 4BBAA 1J56A 1HNWB 4OIMA 3WYBA 4PYNA 2XAUA 4P4LA 2XHEA 1UBSB 1KK2A 2XF2A 4Q1DA 2GAFA 3H2ZA 2FZLA 4PF1A 5EJAA 4I1PA 1P7PA 3NB0A 3R7WB 2RJOA 1NQTA 3HCFA 2QP9X 1H2RS 2G7MC 3SICE 2OGSA 3H11A 3H86A 3HYTA 2NPOA 1JZQA 1M33A 1IQUA 5ADHA 1KJQA 2QRKA 4HYQA 4UU7A 1TT7A 1HYBA 4AIRA 1OLSA 1G8HA 3BDVA 5AYVA 3R3YA 4CDMA 2NAFA 3ZHZA 1GOTA 4D8VA 2H17A 1I32A 1P2VA 1FTGA 4KBGA 1QRSA 2NYVA 2FEMA 2JL1A 1BXRB 1JHAA 1C9MA 3NDPA 1ZXXA 3P2MA 3PUIA 4KE7A 3SNKA 2CJXA 2QAGA 4OOEA 1N0VC 4PBTA 3SYKA 4LY9A 3VU1A 3JVDA 5K3EA 3BMOA 1GP2A 1QH0A 2C4TA 2QR3A 3DR3A 3IJ5A 3FFTA 1Z6ZA 3KYCB 4R0VA 3EULA 3IIJA 3LVBA 3HJAA 4LYEA 2VPTA 2I62A 3QUCA 4KVFA 2I7DA 1KI2A 4ZHQA 1BFDA 1RYHA 5ENDA 2PUVA 4X44A 1L1FA 3VPGA 2JH9A 3NHRA 4IDFA 2I66A 4LRXA 4EQ6A 2AI3A 2CLKB 4B74A 3GLHB 1FSZA 2EQAA 5HILA 1GN8A 3RAPR 1PBTA 1I9GA 3QLJA 4YYEA 4C5AA 4ZIRA 1QHFA 4HAIA 2ZETA 3HU3A 3VZBA 4M7RA 1FRNA 2OO5C 3ANSA 4BECA 4JUAA 4AULA 1LKZA 2C29D 2D0IA 5DN9A 1TADA 3MLEA 3BHJA 4Q34A 3DSRA 3DAPA 4LRYA 1E7WA 4RYLA 4Y2JA 1K8XB 2W6JD 3EUWA 1L7EA 5HOEA 2BI4A 3OKCA 1BX0A 3GLSA 3PTLA 4LRUA 4DZTA 2WWIA 4TYMA 3MILA 3O1IC 3ZHTA 3THOA 4F3RA 4LXIA 1T5BA 1QCDA 3TZBA 2GBPA 2VOJA 1E99A 3VYSB 4O4LA 2OBNA 4OBWA 1XDWA 1SHTX 4ZOEA 3KJQA 5F33A 1K6EA 3ZNNA 2JJ2D 2ZLBA 1QIEA 4UHKA 3RHSA 4ZYYA 1N2JA 3PI6A 3RADC 3JQ8B 2O8CA 3LYUA 5JMWA 4J7UA 5JCJA 3WIUA 2XVXA 4K6GA 1GAWA 3EOAI 3H1FA 1HC7A 1XL1A 3O2JA 3ZCPA 1W5SA 3GRKA 1AZWA 1ZJWA 3IE2A 4FC7A 2QD5A 1UBHS 3Q3GE 4ZRDA 1FDOA 4J7AA 5H4GA 1NVTA 5JU6A 4I1RA 5GV7A 4H77A 4PN3A 2WT4A 4TXNA 1JIJA 5EHZA 5KNCH 1ZY2A 2BPOA 2QM3A 2XB4A 1OLUA 1TA0A 3EOBI 3QPAA 2RBGA 2ZKIA 2B5WA 1YBMA 4ZDIA 3JRWA 1YMQA 1DHRA 3IODA 1J90A 3PUYA 4NMMA 4KUEA 2P9ZA 1TM1E 1IPFA 3G1UA 1Z38A 3DBRB 4OP1A 5C5DA 3JR3A 3JTEA 3WY9A 3AI2A 3A4VA 4L5IA 2FRVA 2VDQB 2X1LA 1N2HA 4XIFA 3RHZA 4AN0A 2G1UA 1NTOA 1E3WB 3DWIA 4MIYA 5BXQC 3E1GA 2OYSA 1CY0A 4HTFA 4X8MA 5CFZA 5LZ9A 1TCCA 1JFFB 1Z15A 4F2HA 4O2AB 3N8DA 4Y0NA 4MVJE 2REXB 4LOAA 1OZAA 3IV9A 3HXPA 3K8ZA 4CM9D 3A2KA 2W6QA 1QIHA 3CUWA 5HWSA 2PBLA 1PJQA 1ZR4A 3PNBA 3TM5A 1ZWKA 3UMGA 5B36A 3L7MA 3TW8A 5LD2B 4UNRA 1J23A 3N6RA 1L7AA 4HH1A 1FYFA 1VMEA 3KZMA 2ATCA 1JLLA 2PZAA 1RYBA 3PUJA 4RY2A 1TA4A 3ZS8A 5LQMA 1P2FA 3C6BA 5JYDA 1VSVA 3UMVA 1GCIA 2V98A 3PQDA 1PWYE 3KOXA 4BJHB 4PG5A 5LJLA 4YY3B 1ADJA 1EUDB 1EIZA 1JHUA 1FVHA 1MJ5A 2O3QA 4Q82A 5E9WA 5K3BA 3ETJA 4PS1A 5JANA 1YDHA 2Y0DA 1OKKA 2R66A 4MJ7A 1CEEA 4IJQA 1MUUA 1X8XA 3ZXSA 5A3RA 2BFEA 5E6SA 3U7GA 3H9BA 4FR0A 5CVVA 1FDUA 1P9LA 2FJ0A 4TQ9A 1ZH0A 2H1CA 4IVPA 4O5OA 1W88A 1CIPA 4YAIA 3F6RA 3WGIA 2F00A 5IVPA 2JAWA 2ZYRA 1YBAA 4LQLA 2Q4TA 1DX9A 3QM1A 4MQ6A 4PAWA 1X9IA 3V1NA 1QP7A 4OX9Y 4D0SA 3T52A 2C7RA 2OEPA 1P31A 2XYQA 2B8JA 3TL3A 5FFFA 3VPAA 1P6XA 4YXWD 1E69A 2QNIA 1AGYA 2QJWA 4KAJA 3ROEA 3F4LA 5LQCA 3G2QA 1GKKA 2MMGA 2QN7A 3VHLB 5KC8A 4K9LA 4ZO6A 1Z56C 2A3RA 5DNEA 5ULLA 3FMGA 1K5PA 2HCTA 3K72B 2VH5R 3BOSA 2F55A 5ALMA 2IHVA 5E2BA 5JNUA 2F8LA 3UCFA 3MG9A 1A7KA 4V3BA 3RFCA 1QH1B 2XTNA 2EATA 3A05A 3MMPA 3RVQA 2E6UX 4BKMA 4IJ6A 1OXMA 5EWLA 2OCGA 3R6LA 4Z8YA 2FR1A 3V8EA 4Q7EA 5DOVA 1E5DA 1XGKA 2V4UA 3X0DA 4B44A 5BSKA 1FFCA 4UU1A 5BR8B 3L05A 2AV6A 1U8UA 3D7LA 5ALOA 4W5JA 2AC4A 5CLQA 3T6KA 2ONCA 2BBOA 1H6DA 1MLDA 2HDHA 4QTUB 5CH5A 1YR6A 3UK7A 1CZOA 3KB1A 5JXGA 2BCGY 1P1CA 2NU7B 4AY5A 4YMWA 5AKJA 1SCDA 4YP7A 1JEQA 2ZT7A 4CKCB 1F1JA 1SM4A 3QIAA 4AI6A 3M5WA 3RNLA 4KQHA 4L4UA 2GI4A 4D4LA 5KKAA 4ZEVA 3PE4A 2J3IA 4S1PA 3EVEA 1H05A 2P27A 4D3YA 1UIMA 1VP3A 3THWB 1V6SA 3G2JA 4JCCA 4ZHQF 2K4MA 2F4VB 4GKJB 4F2PA 5JFGA 4R84A 4JXJA 4CM6A 4TTPA 2V6IA 4UKDA 2H8KA 4A0SA 1IY9A 2YHIB 2HHHB 2VI5A 3L1UA 5HQ3A 2IE8A 4G37A 4HDAA 2DWOA 3R0ZA 5KUTA 4HXFB 2Q5FA 3AEYA 3CBGA 4Y2QA 1I7QB 1UBFA 2DYKA 3ESAA 2QT9A 2V45A 5HNKA 2X42A 2H29A 4DXDA 2CYAA 4BQIA 3KD2A 2EKQA 3C98A 5CLJA 3ZBUA 2WG1A 1SQ5A 3G49A 3USCS 1XQYA 3QEBZ 4FMDF 1YIAA 1VYHA 4D56A 2PGDA 1IVSA 3ND7A 1ORDA 2WD7B 2QRUA 2D2EA 4R7TA 4HEA1 4QM6A 1LVGA 1PZHA 2VP3A 1ORIA 3A1CA 3A4TA 4Q47A 4RZXA 4KIFA 1X0VA 5E6UB 5I7HA 1O7JA 2W2QA 3FNHA 2QK4A 3CWQA 4Y9RA 5CW1A 4GKKB 1Y7PA 4POAA 4UHHA 3QKWA 2QD4A 5G3YA 3ES9A 5I8WA 2ZIFA 3RTEA 1ZC4A 4FHCA 2C58A 3M4NA 5AJZA 5ENVA 1I6LA 5HJEA 5DT9A 1E77A 3IURA 4B9EA 4CG2A 2C99A 3E58A 3G5MA 3N2GB 2QS9A 2B61A 3HFSA 4EA7A 2VATA 4QLOA 4YONB 1YAHA 3QBTA 3LHKA 4DIKA 2QGNA 2AVNA 5HRUA 2OCLA 1R66A 2BMWA 2PMFA 4RLQA 1IHDA 4P9NA 2AJDA 4YT2A 1B4DA 1N34B 2H0RA 3NGMA 4UCQA 1US8A 1T3HA 2AN4A 2DBRA 2V0CA 4RZQA 5AOVA 2JFOA 4PPFA 4WKNA 4M87A 1B6TA 3RSLA 3SIRA 4J0QA 3V8PA 4K2AA 2CMGA 4KC0A 5TPZA 1E6WA 2XUHA 4JLNA 4IV8A 4W9NA 4EPWA 5K99A 5EJEA 5HOQA 1RYDA 1SBQA 3PGMA 4MR9B 2ZUVA 3EW7A 4URHA 2F2TA 3DFZA 4PZAA 4OAOA 1IIBA 3ZV4A 1N36B 5CFPA 2GCOB 3O3NB 4ND8A 1UXGA 4CT5A 5T4HA 3RROA 4CL0A 2WUGA 3UJ6A 2VQFB 1PEAA 2F8MA 3DKRA 3ZNOA 5KKCA 2YWCA 4B87A 3ZHOA 3GGJA 5D84A 3HU5A 2VG8A 3R5TA 5U9CA 5IAGA 2R6AA 2YZNA 1VSQA 1MIOB 3HC7A 4K40A 3FBTA 5COBA 4ZC1A 3OWOA 4OBEA 1OFIA 2DSNA 1UDRA 4S35A 5AKYA 1U8ZA 1TF7A 1MOSA 1P29A 1H9AA 4EJ6A 2Z2YA 2W70A 3T0FA 3O8OA 5CFMA 4K6KA 1R9JA 1IBRA 1NR1A 2EGGA 4HWRA 2ZAIA 2ODPA 1Z68A 1H4VB 1KKMA 4LSGA 5FJIA 4RKFA 3WFZA 2JK0A 2FP4A 1G19A 2DFKB 2LNDA 2XR1A 3ISVA 4XH9B 4YVFA 4DCUA 2P40A 3RV4A 4ZI2A 4Q4JA 5IKPA 5L3QB 1ZJ4A 4J7XA 2VRBA 4ENWA 5GINE 1QAQA 4KB5A 4XEUA 3QXJA 3FPCA 3ONFA 3V6LA 3TLZA 1U80A 2PRJA 3NC4A 4JB0A 1DFGA 3L6CA 3OIUA 4JAVC 4O0LA 3NBUA 4JQSA 1BE1A 5IDQA 1V7PC 2NOAA 3FPSA 3TSCA 5J2TB 1EDEA 1VE3A 5KYUA 2GPNA 3QYPA 4A03A 5L3VA 3FYHA 4FWTA 1DLJA 1WXWA 4DNOA 1KQGA 1WXIA 1R0RE 2FFHA 2F6RA 2YMMA 2FLVA 2GETA 1SQFA 3EXG2 3QQ5A 4GT1A 4MCHA 2OGWA 3IQFA 4ZKEA 2NO9A 3NVKI 1DPFA 3UJ7A 3ETLA 5SY9A 3B3QA 3IAEA 2VDWB 4AC9A 1CP2A 1H1TA 3BE4A 2PLAA 4YN3A 2PKQO 3L4KA 4O4IA 5DISB 1DGQA 4ER5A 1XOIA 3L7YA 2XKJE 3HRHA 1DO0A 3KO8A 5DVZA 1U2DC 1OHHD 3CLTD 4TT3A 2XOEA 1U8TA 3D6AA 4RESA 2Z2JA 4YO7A 5CITA 2O6LA 3GDWA 4B3RB 4FNGA 3I9OA 4GLLA 2D7DA 5CH8A 1PCXA 1W87A 4G4SO 4HFNA 3PDWA 3ONEA 1L3BA 1U28A 1K9VF 3N8NA 2XYHA 3O6VA 4LY6A 3MTGA 2OP0A 4GMHA 2YCBA 5JWHA 2ZWOA 1BW9A 2PS9A 5TQ2B 1KJWA 2EV9A 3KXPA 4ID9A 4P4SA 5BYKA 4RCYA 4EVSA 3BF7A 1NHGA 1HE3A 1Y6JA 2C0PA 3UUFA 1TM7E 3I4LA 1R8YA 1W48A 1N2CE 4P98A 1H2HA 4RVUA 4G1VA 4KGXA 3DGFC 4I50B 1AUPA 1SIUA 4ZEXA 1CUHA 3DDZX 3OPMA 2QSUA 3OTHA 1L4YA 1EVYA 2EG9A 4J76A 2CF5A 4PWYA 4S1NA 1GQYA 4BPRA 5JNWA 3N6VA 3HHPA 3AP3A 4UDYX 2NVUA 3WJ2A 1OB5A 4LHWA 1PNTA 1KJNA 2HXYA 5JJCA 1ANKA 4ADSG 1H0HA 2VZ8A 3KEFA 2CFOA 1W94A 1PUJA 1S7GA 3QFCA 2CL5A 2BFBA 2QL5A 4C4RA 1ZIOA 4G0OA 3ZWNA 4F5DA 4BGDA 2ZUFA 3NUGA 3CUYA 4HEA6 2HK9A 4PPNA 1UM8A 4OG2A 1B00A 5FBRB 1K6IA 1EBBA 2VP6A 2HRBA 3C0KA 4KLCA 4CIDA 4CYMA 1JDNA 3U7QA 1VJ1A 1DWOA 3EXIB 1CQIA 4GLFA 3FYSA 2YWEA 2B98A 1YGPA 3CO0S 5DX1A 1AH2A 1VMAA 1LWNA 1FMLA 3D7SA 3KJNA 4ZPXA 2VHXA 1CZKA 1JEEA 3LPMA 4XUDA 2A1TR 1EM8B 3KEGA 3O93A 4KEAA 1DG3A 3ZWOA 4AUNA 4Z7NB 2J5RA 2C9OA 2VEDA 4KXVA 4D7AA 5I51A 2ORYA 5HS4A 2WYVA 4HQOA 4NXMB 3EY4A 1C1XB 3L9XA 3PRJA 4CU5A 3IILA 1H4QA 1IAQA 4G41A 1EI9A 1QF9A 1U8XX 2JAQA 5AJHA 2A0WA 4IX9A 2P2ZA 4GX0A 3I72A 2A7QA 4XCQA 2BVNA 5JS8A 3AIOA 4DA6A 2VF2A 2XNDD 4PLVA 3OC6A 2J31A 5C2JB 1XV5A 1PT9A 1L4LA 2BGIA 3DV0A 3JD3A 4DE5A 5FIUA 5A1JA 5IZCC 2GAJA 2QTRA 3T4UA 5AIAA 1P9WA 3GJYA 4AU1A 2VJCA 4J2TA 2OZLB 4PG6A 4J0FA 1Z2EA 2GQ0A 3FVTA 3FLAA 3OIWA 3QQPA 2H4WA 3PX2A 4IF4A 4LRTB 4HYYA 3LOUA 4RVFA 4CT0A 3UUGA 4P36A 1AUOA 1C14A 3S2GA 5DX0A 5D5HA 3HVKA 5JMPA 1SVUA 1AHIA 2Q8PA 3L7BA 4I8IA 4KGZA 3RS0A 4EG6A 4ZK6A 3R9XB 5JXHA 4DILA 3OZFA 4NS1A 5JD3A 3ID6C 3Q3VA 4YMVA 3B3JA 3EGIA 5TF4A 4CGYA 1J0EA 4RXTA 2B99A 5K8CA 3M82A 4JROA 5HKAA 5EZ5A 3RVJA 3KTAA 5DBGA 4DVJA 1LC0A 4WADA 5JECA 3C4VA 5JAPA 2NX2A 3GLIE 3PVSA 1OTYA 3V7WA 2Q1WA 2CSUA 3CW9A 3CJQA 3UJCA 3DJFA 1RTKA 2JAXA 1RKVA 5G0UA 2G9QA 2AHOA 3BBLA 2XEDA 3E9ZA 1NF8A 3EMBA 1HMPA 3OI7A 1T1SA 3BWXA 3FLEA 1KAGA 4GZMA 1UKYA 3UXMA 2C5HA 4MUNA 5K0JA 3ZVNA 3O92A 1XXHE 3V5NA 2XDQA 3HY4A 4QGAA 3B7PA 2BKLA 1EXDA 2PQMA 5B1IA 5FBWB 3IP9A 4EVRA 4KIGA 2ZSJA 5K0NA 2JIQA 1BE0A 2ZIEA 4L8LA 3HKEB 2EERA 3PJDA 5CEJA 3V32A 1LQTA 2GTPA 1CJMA 3QV1A 4WDRA 4ZPJA 5DYTA 2V5VA 4AD8A 4CVNA 4P53A 2C5EA 2HLDA 2P4UA 3SOZA 4K86A 2EJTA 3ZDDA 6PFKA 4IFEA 3IR6A 4BB5A 1FLDA 1XVIA 2CMFA 3EEQA 1E1RD 4HB4A 5LUBA 1ZNYA 3IAHA 2A30A 2EHJA 2H5JA 2VUUA 3K9QO 1ZMTA 3QTTA 2IV3A 1ZUHA 3TOVA 2FQXA 3D4OA 1AQIA 2O8EA 2I7CA 2ISCA 1BDMA 2FETA 4CIXA 4E2XA 1JTEA 3O0TA 3L8HA 4EAAA 1LEHA 4ZOLA 1J1UA 1NUPA 1W5TA 5BSUA 3DMYA 4O4IF 5AK0A 1XCLA 4EOGA 3LXUX 4RMJA 5T3YA 3BD8A 3EGOA 5JI3E 3I9MA 1D9ZA 4LOKA 3OZCA 1UKBA 1A9YA 1Y9EA 3AC0A 3OCCA 4FLFA 3D3WA 4U2FA 3CX3A 2JFPA 1NM5A 4NARA 1XZGA 2D8AA 3MINA 1F0PA 4ENQA 4OAPA 4A15A 1CY2A 1IZ7A 1VHLA 1TC2A 4RE5A 1NQOA 4DCCA 4MR8A 4JNKA 1V0JA 1N8SA 4YDRA 4UM8B 2C4WA 3B82A 4OHBA 4C2TA 2F1HA 4PR3A 5GVSA 4RAOA 3ROMA 2FU5C 4EPTA 4BU1A 3FKSA 1L5HA 2OXRA 1KETA 2EXXA 2B8TA 1GHTA 3CH6A 3MTJA 4GNKA 4H7DA 2OHGA 4GLJA 4OB6A 3WB9A 1DXYA 1NULA 3CSUA 1NBMD 3RUHA 4JJZA 3OWHA 4CKBA 1UK7A 4HDMA 2UVPA 4UXHA 4C1BA 2BJVA 3JD2A 3OY2A 5A0TA 5EINA 3O95A 5C4MA 5E2IA 1O4WA 3QEMB 1FXWA 1R0CA 4LYYA 5EZYA 2ZJZA 2FQ1A 4B09A 4RCVA 5IAOA 4K05A 1EX9A 2ZSUA 4C4OA 3KCNA 5SZIA 4CDNA 4HF7A 2FQQA 5ALFA 4DMUB 4EBFA 2OCKA 3SZGA 5HZKA 5JH7A 1Q20A 1R6TA 3SBOA 3RRZA 1NRJB 2I34A 2OP1A 5J5AA 5K0LA 3UJ3X 3MBIA 1UJNA 2JBHA 1SG6A 4PO9A 1V1RA 4IOKA 4RAQA 5A5FA 1ORWA 1HV8A 2MYPA 4K1XA 4HNTA 3A3PA 1HBJA 1I33A 5IAKA 1VJRA 4JP2A 4TZTA 1KEVA 3ZK8A 1ZKMA 3U80A 2WIDA 2HK8A 4RIFA 2GBCA 1EX1A 1G3MA 5IYZB 2OMKA 1Y8RB 5DK6A 5JBQA 1N5LA 1ST3A 2IUFA 1PI3A 4JN6B 1T36A 3FW1A 1USIA 4S1TA 1JKJB 3N0VA 3R24A 4MK4A 1PL6A 5HRAA 1CEYA 2QZSA 5JQWA 2E55A 2VJDA 5DDIP 2OOKA 3CZ5A 1EK5A 4BASA 4EJ0A 2W4IA 2IX3A 2GZAA 2FMFA 4OI1A 3TGWA 3EIEA 4ZZ3A 5B1YA 1E9SA 1B16A 3MB8A 1UBMS 1R0KA 3OHMA 1NQXA 5CYOA 4YECA 1KL7A 2GPTA 1DCTA 2C4NA 3K5WA 2UYOA 1CSEE 1G9TA 1ZD5A 2CMHA 2FZVA 1KI9A 3QLEA 3AHFA 4IG4A 1GPH1 4LY0A 1KH1A 5FOSA 3U48A 5C8XA 1ZOOA 2J48A 4H0FA 4FFSA 4YJFB 2X3FA 4G9EA 3ANLA 4GU5A 4FGSA 4MEBA 3RJZA 3AEXA 5A9SB 4PFSA 1YQGA 1E98A 3BUSA 1IZYA 3NAGA 4D8YA 1FC0A 1I4DD 2HSDA 3K09C 1L5RA 3PT5A 5J4YA 2PL1A 1FF9A 1O89A 1SXJC 2DR0A 5K3SA 3RU7A 3ORFA 1REQA 2W8BB 4HAVA 2MINA 2O48X 2C8LA 2ZG6A 1ZJ6A 4H1TA 2BTOA 2IELA 1IU9A 2JGKA 3BERA 3PKZA 3ZY2A 3PD1A 5BN5A 1K0UA 4L0QA 2YJGA 3F2IA 1MU0A 3ICWA 5DZSA 1B6RA 3K0AA 1VHTA 2Q3FA 4AUKA 1LVUA 4EM6A 3ICVA 3P26A 4NZOA 4RPCA 3MWKA 3RKRA 4ZJZA 3PF9A 2BKXA 1RYZA 1IBKB 1JSLA 1IB6A 1TQ2A 1XHLA 1W0KD 2VA8A 3ILYA 4LXHA 3LECA 4NBRA 4Q4AB 1O6CA 1P81A 2HT6A 4M83A 4F9GA 2E3JA 3ICCA 1T3LA 2E4WA 3FDIA 1EZ4A 4MKXA 3VJLA 1R0ZA 3B6KA 3LLVA 3OZIA 4MJLA 3TNJA 1XCPA 7ADHA 1XMVA 1CY1A 4EVQA 4QG7A 1NPDA 4KR9A 1UOEA 4M0PA 3NBQA 4ZRNA 4KZKA 4LDRA 5D2CA 1DEAA 3WK8A 2IHBA 5IBCA 2YHUA 3GAMA 1N6NA 1Z0ZA 2C5BA 2YRWA 4XB2A 1OA0A 3FSGD 4Y2YA 1CS0A 4JBGA 1J2EA 1W0CA 5F78A 5EE1A 3GROA 2FSUA 1O57A 5IABA 2O3JA 2LE0A 3IVCA 3UK1A 2XNJA 3DCYA 3LPCA 3LUPA 2CSXA 1VE6A 4HXEB 1N8KA 4G81A 4HDNB 4R8KA 3Q8LA 4H3HB 3ZYCA 1NBIA 3NNDA 1A4XA 3IIEA 1JHOA 3EHEA 5EIBC 1Q44A 1GQRA 1P72A 1ISMA 1XF1A 3C43A 4GPD1 5CX1A 5BVHB 4DEVA 2G07A 5TPWB 1YS2X 4CM7A 2R7MA 5JFTA 1N6OA 3AEQB 1EH5A 1SURA 1VQ1A 2ATEA 4YMIA 3G3EA 2Y05A 3O4VA 4LEIA 1C1HA 1QGYA 2JGLA 2WJAA 3LZCA 5JSFA 2VIIA 3GRUA 5HR5A 5BN3B 3AETB 1ZH6A 2R8RA 2WVJA 5M7EA 1J70A 3SJZA 5KX5A 2PKWA 3QX9A 4TMFA 3Q41A 4WNAB 2AZXA 1NI3A 4ZOLF 3KBBA 2H85A 4EDFA 1XZPA 4NCBA 1PZGA 4BMDA 1GGVA 4DPMA 1JIUA 1GPUA 3MS7A 3UQZA 1CFZA 3U4MA 2XXBA 1FUIA 1TVKA 2C2YA 1GNQA 1R9NA 2C42A 4P5PA 4F3NA 5FWXB 4BVBA 4FMCF 1RC0A 3OD5A 4X71A 3KAJA 2H1FA 4JHXA 5IKXA 1OCEA 1FP4B 1U5BA 2D7JA 2EF1A 1JQDA 1NVXQ 3IRVA 2H06A 4QRHA 3SHOA 4F84A 1QOZA 3RE1A 5K4GA 1JQAA 2L42A 4FOOA 4BLRA 1JAIA 2L0XA 5WRFA 3KV1A 1FJHA 4BE7B 3B36A 3P9PA 2WSSA 3WGNA 1Z12A 5DHAA 4JOCA 2R25B 2Z1DA 4F9TA 4Q00A 4AX4A 4CMHA 2UYHA 3NH6A 1XLTC 4FZVA 2VUIB 4JNCA 2JF0A 2BFWA 3R6TA 5A4AA 1LLDA 5JWOA 1KYVA 5IJZA 3CNQS 5KREA 5THKA 1NBME 5KOHA 1ZGGA 2I6UA 2ZE7A 1WCV1 3C6MA 3ITEA 2HLNA 5JJKA 4PZUA 3O74A 1H85A 2HQ1A 2X5JO 4HEHA 5EZYF 3QPUA 3W5CA 2ZUDA 4Y2UA 2TRSB 2X19A 2XGMA 4NG5A 4OBXA 2CLCX 3ZGOA 1ECLA 4G01B 4C06A 3L5KA 5E2AA 5BQPA 2BM0A 5JH7F 1UJCA 1DO8A 1BH2A 2WIAA 3DP7A 1N4AA 3ZGYA 3HKCB 4MA5A 1PS9A 5DGCA 4AMGA 4CHGA 2FFJA 2BZ0A 1MX3A 2OVFA 1MOPA 2WLSA 4JIGA 5COQA 3OFND 1Z2CA 2GEBA 4UM7A 1XCBA 2J5QA 3W2HA 5LBUA 3URKA 5DW3A 1XWWA 3UMFA 1QVWA 2ALJA 2YJ4A 2ZUBA 4LG1A 5T67A 3WX0A 3CWZA 2MIIA 3W4KA 2F64A 1GRQA 1EK6A 1KPHA 3K9WA 4KYVA 3BK2A 3JARB 3DOOA 1JALA 4NAVA 2RHMA 4PSVA 3R0JA 4FILA 1ULHA 3W04A 3C87A 3CLHA 1UIRA 1ZVKA 2BMJA 5BN4A 4FQ5A 4R8SA 2ZYIA 3MT9A 2VP2A 3KQNA 5I7RA 3VC7A 4DT1B 3S29A 3LRPA 4WRRA 1QSGA 1F2VA 1KYYA 2C7BA 1USVA 3AL3A 3DOEA 3ZHBA 3OETA 3AH8A 3F5FA 2WIFA 2PD4A 5BWBA 3OMWA 2FGJA 4OGGA 2I91A 2O59A 3S44A 2YWGA 3OQBA 4J29A 4ZQEA 1FNSA 1I1HA 4CDGA 2DLNA 3TW0A 4YPVA 5G0SA 4X1KB 1KVSA 3Q40A 2VHJA 2VYND 1W9HA 3AF3A 3TCKA 1JHZA 3TZEA 3U9TA 4BN5A 2X1VA 2C4VA 4PTYA 4C07A 2PO5A 4K9KA 1UJMA 4RABA 3ENQA 5T4EA 3UV6A 4FWIB 3IULA 3L7AA 4HJXA 3TXXA 4EUFA 1N2CB 3CKKA 3PQ7A 3TTYA 1M0EA 2XRYA 3WYEA 1WSDA 2O0KA 1RZVA 3TR0A 3LTEA 1ZICA 1S8OA 2HQRA 3GN1A 3K2EA 1G59A 1FA9A 1LV7A 1ZAKA 1FRQA 5K0CA 2IODA 1U0GA 4ZZ2A 1M1YE 5ALDA 5GGXA 3W4IA 4KWEA 3LC1O 2EWMA 4OGFA 3NP9A 2Y93A 3D2AA 3IEKA 1PKXA 1JBEA 3UT5A 4O4JA 1UFVA 2XGOA 3DZFA 4CR7A 2OM6A 3VC1A 1S2DA 1V9CA 3OIVA 3RSQA 3H18A 1LW6E 2R6CA 4RSMA 2XUKA 3Q8KA 4PIVA 3OX1A 1O95D 3MA0A 5CPBA 4PZYA 4RF3A 1L1QA 4QJ3A 3M81A 3FI0A 5REQA 5ALUA 3ZZ1A 4NCXA 1I51A 4UE2A 4HQNA 5F64A 1AOXA 3AUJB 3GIDA 1XMJA 2J5XA 3PDCA 4O29A 1QUEA 1SCQA 2VDUE 5ILGA 2CLOB 5AVXA 4EYGA 1M6EX 4KACA 4J0IA 4WFKA 4NBTA 4IKPA 4AAYA 2MTBA 5BT8A 2OQ2A 2ZTHA 4I6GA 3T1NA 3AU8A 4KRFA 1Z22A 1UKEA 1AUXA 2N9UA 1E7YA 3VSDA 4G5OA 3CF6R 3S2FA 1KJYA 2ISSD 2VWQA 1QQBA 1RZRD 3C3JA 4MVJG 2O2DA 3F97A 2ZIXA 2P77A 3DVAA 5TV2A 4QGGA 3K6JA 5LP6A 2O23A 5C34B 5J1SB 2EFHB 4KRGA 1G17A 4NJMB 1IMOA 4Q05A 4AUEA 2O0JA 2GHTA 2FUKA 2EKDA 1KXJA 3GBPA 4TMVA 4V0NA 3VR6H 4RZIA 3SC2A 4URFA 5TMDA 1ECJA 1H5UA 1DRKA 1W0JD 2QGZA 3PUKA 3LWBA 2AW3A 4GI7A 2CT8A 1VG8A 1YXMA 1L5ZA 3FY4A 3QBEA 1VIVA 2AE2A 5AW3A 1OLOA 1L8QA 5JFOA 3OZUA 3H6GA 3QOYA 1Y5IA 4GXRA 4HGNA 4P82A 4DY6A 2Z57A 3A9UA 4BFLA 4CLRB 1K3FA 3H11B 1Q74A 4DJJA 1TKRA 4EB3A 5KVAA 2CXRA 5KX5F 3U9LA 2FN3A 5CDTA 1F7UA 3QKUA 3QI7A 1W76A 5KQMA 1OLSB 4CR6A 1Y5NA 1P7WA 3D4BA 1KIMA 2NU9A 1UPFA 1YJCA 1NL3A 3TD9A 5C7LO 1DOHA 2O8FB 4XYMA 5LQRA 1T6YA 1TOAA 2F1RA 4HH0A 2UUPA 4TVOA 2J9FA 5ADUS 3BMOB 4KV7A 3W5IA 3D1VA 2QRPA 4HMPA 4OXYA 4G67A 1KEUA 2J85A 2EYUA 1UKVY 1EVIA 4QUEA 4TXHA 4O2BF 5JCOC 2XMDA 3E27A 4ZICA 4KQ6A 1WS6A 3A6LA 2A9FA 4D81A 1UP4A 4ZHQB 3F5QA 1M1NA 3OM0A 2Y1EA 3BG5A 3NVAA 1PR4A 2IYLD 1ZOSA 2CJWA 1YKSA 3OLXA 5AW5A 5KOIA 1BQEA 4YRMA 1PZEA 2DH6A 4Y18A 5KQSA 1UAYA 4M89A 1HEUA 5IKEA 1JPVA 1WEKA 5LP1A 1KMHA 4D41A 2H5EA 3ESBA 3PRYA 4JCOA 4K3VA 5C32A 3EF0A 1VLZA 3A4IA 3GJ4A 4GYWA 3AV0B 1P9NA 4F92B 3C41J 1MVOA 3QPWA 3FGPA 2H2GA 1RBMA 2YJ6A 1COZA 3ANNA 4M9QA 2G8NA 4ERXA 5AXDA 1U9ZA 4F8YA 5DASA 5J4HA 4X92A 3V4ZA 1BDJA 2B20A 2QX7A 3BH0A 4FMDB 1CRLA 1YH3A 1VDMA 4BLPA 5A62A 4OK6A 2V6FA 3M1AA 3BGWA 1TTPB 2X40A 3TOSA 1R6XA 1V26A 3QE9Y 3SP1A 2OCBA 3JZMA 3AOEC 5HMLA 2V5UA 1N9KA 3B85A 3HJCA 3LT1A 2M6LA 2WYUA 2Z0MA 1WKVA 3CG4A 3GPLA 4S24A 1XU9A 1F17A 3AERB 3M49A 4J6FA 4QPCA 4II3A 2L17A 2WFLB 1K63A 4DYDA 2O8CB 4IIEA 4JLWA 3UJAA 1RRVA 1AKUA 1YQUA 3FVRA 3HGMA 4HLQB 5LLTA 3BT7A 1K8ZB 3E8MA 1OVMA 3NHKA 3GL9A 3DOIA 1AS3A 3O3MB 2XBUA 2H4FA 3FUUA 3G5LA 5EHGA 3TH5A 5KYYB 2FFRA 1T9GR 4X64B 4GI3A 3AKZA 5G1NA 2C9ZA 2UVDA 4RS3A 2NADA 4F4JA 4ZOBA 1OLUB 3RDPA 3KTDA 2IE0A 3BTVA 1KFCB 1QYIA 1BE8A 1SUAA 4UHBA 1EFRA 5DN6D 5ARBA 5JADA 2PGXA 2HSWA 1P3DA 2PPVA 3SKXA 5BV2P 4RK1A 1YJ5A 4GPBA 2MJLA 4GR4A 4M1TA 3CEAA 4RKWA 1YBHA 4AJIA 4BRZA 4FLMA 1DC4A 1YUBA 2O4UX 4O1MA 4TM8A 1P33A 4R83A 3I32A 3FLBA 3NANA 3V55A 5FWNA 1DB3A 4YLYA 5DCYA 4LJRA 3C3CA 1XVUA 2BELA 1FP1D 4RK6A 4HYTA 3CS3A 4AYTA 3M6FA 1DBSA 3B2QA 4FFLA 3NX4A 5CTJA 4DA8A 2WM8A 3QEAZ 1U4NA 2VJYA 3OZEA 1RLUA 3QYAA 4GQIA 3WNDA 3AF1A 5BRAA 4KWIA 4L1KA 1K0FA 2YBDA 1CDZA 3UICA 2C78A 3HKBB 3G8CA 3UANA 1YZUA 3H1BA 5EN4A 2OQRA 2XLCA 4I1YA 3LU1A 5CBPA 4NPAA 1FSPA 1JLLB 2XT6A 4OVKA 4W9NC 3FYUA 3HXQA 4YRRA 1YV9A 4NL4H 2FVXA 4W9MC 4O4JF 3VV3A 3DYVA 4DBLE 1J1IA 4QUGA 5CH3A 4EPVA 1WKBA 5LWQA 2J5BA 1H2EA 2JHPA 4LZWA 4DSNA 4A16A 4X3CA 2W98A 3RRNA 4BMXA 2BEWB 1R37A 2XUPA 3LO5A 4LYFA 2FRDA 3RS2A 2QR2A 2XTJA 1YASA 3ETGA 3F6CA 1KTIA 2BFEB 3MRSA 5ALNA 5BMOA 2QZPA 2EU8A 5CP8A 3OD1A 3PWSA 4MVJI 4M9RA 5U1PA 4YAKA 3RFUA 4JU9A 4E2WA 3BFJA 3EWIA 4B3BA 4TVSA 5KTNA 1U7HA 4II7A 4MCIA 2UZ3A 5BWMA 1XMXA 5AKKA 1GZSA 3WFJA 3ZK7A 4E1BA 3C7AA 1KJ9A 5LP6F 2O8VA 4HZIA 3KWJA 4KXLA 2D4AA 2R48A 4XCVA 1OAKA 1YRAA 1QO0D 2QTAA 3PCTA 3D81A 4HAWA 1MGOA 2WSMA 5IK2A 1N7JA 4HDRB 3MT0A 5BORA 1SFRA 1QZZA 2ATVA 1YMUA 1QYWA 5K6TA 1I3OA 2WF6A 4DANA 2RHDA 2J4CA 3I0ZA 3IUBA 2YJNA 2PSEA 3D8BA 4YMGA 3K2IA 4BEBA 4MPTA 3X44A 5E4JA 3ZJYA 5KVSA 1ZMXA 3WBKA 4IP0A 4QOJA 4DCSA 3PFIA 3A27A 1Z45A 4GMKA 5LNK6 1CQZA 2H1OA 3OPYA 2V7VA 3KSAC 2W6JA 1CUXA 4XRGA 1BCSA 4PHHA 3ROKA 3WADA 1TQ8A 5K8UA 2HRQA 2DFLA 4LTDA 1RVDA 2ZE6A 5LC1A 3LUJA 4IOMA 1EFHA 1HDCA 1HK7A 3PNMA 5LYYA 4B33A 3BICA 4JX9A 2WV9A 1QZ3A 4P7JA 1E9EA 2YZMA 3VTAA 1Q3KA 3MT8A 4D9FA 4EKEA 2IP1A 1W30A 2DFNA 4YJGA 3KIPA 4CEJB 2HMAA 3H0EA 3NHYA 3JWGA 1JEQB 3N3BC 2NVWA 1PAUA 2G1AA 2EBUA 1BEZA 3CUEF 1B15A 4ISBA 3BSYA 1F60A 2Q46A 3SHQA 1GN9A 2AOVA 4H0NA 4TWAA 1HDZA 1SPXA 3O2QB 3JWPA 1KORA 4Q3BA 1K89A 1MFZA 3PNOA 3OEWA