1V39A

Dc26 mutant of vaccinia virus protein vp39 in complex with s-adenosylhomocysteine and m7g(5')pppg
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
297
structure length
291
Chain Sequence
MDVVSLDKPFMYFEEIDNELDYEPESANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specific protein recognition of an mRNA cap through its alkylated base.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Methyltransferase
molecule keywords VP39
total genus 103
structure length 291
sequence length 297
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 1996-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1v39A00
4AUKA 3M70A 4R8RA 3NWBA 2ORED 4AZSA 2JG3A 4C08A 2HR1A 2JHAA 5DTQA 5P8WA 1KYWA 3SSNA 2FPOA 3M33A 4AX8A 2JHCA 3A7DA 4OQDA 4OX9Y 1UIRA 4C05A 2ZBPA 2PGXA 1UFKA 5F2KA 2ZSUA 5E8RA 3GXOA 3X0DA 2AR0A 5E8JA 3CJRA 2ZIFA 1JQDA 1TW2A 3E05A 3P2KA 4KDRA 5FADA 4CXMA 1NW5A 1WXWA 4O29A 4K6MA 4QPPA 4GOLD 3UA3A 3B3JA 1JG2A 3Q7EA 1Z3CA 4RVGA 5LQJA 1SG9A 4BP3A 4DZRA 5HOQA 5F2NA 3LCVB 3UJDA 5DRTA 5F2OA 2NXJA 4L7VA 4QVKA 5EG5A 2QRVB 3HEMA 3NJRA 1SKMA 3G5TA 1IXKA 2FHPA 1O9GA 3OZTA 5E1MA 3GWZA 3BXOA 4KW7A 4QDKA 3I9FA 3T7SA 3SXJA 4EVIA 4MHTA 3AJDA 1M6YA 1EJ6A 3KR1A 4ER0A 1YUBA 4H0NA 3EGVA 3LHDA 1N7IA 1L3IA 4EKIA 3DULA 5ICFA 3AXTA 1DL5A 4X60A 3RIEA 3PB3A 5K0CA 4PCLA 2UYHA 4DKJA 2YR0A 1Y8CA 3HA3A 3HCDA 3L8DA 4F84A 4IWNA 3VC1A 4ER6A 5EHIA 5K0EA 3MERA 3MAGA 1M0EA 3HVIA 2CMGA 2I62A 2PVCA 3DOUA 1QAQA 3R24A 5D1HA 5DRYA 5D1NA 4PNEA 3ORHA 3GRRA 1ZKDA 3BKXA 4F85A 1INLA 2ZWVA 2YX1A 3EMBA 2JHPA 3OZRA 10MHA 1FP1D 3EVGA 1ZG3A 2Z6QA 3SSOA 3LECA 2ONZA 3GU3A 1P1CA 2QRVA 1NBIA 5DM0A 5KQSA 4C4AA 2ZW9A 5C0OE 4DMGA 4QPNA 4E31A 5GIOE 3NVMB 3DMFA 2P8JA 5LQRA 2NP6A 3HA7A 3CJQA 2XYVA 3GRYA 1JR4A 3BKWA 4GOMD 3I58A 2OXTA 1V39A 4MIKA 3F4KA 2DPMA 3EVBA 3CVOA 2PT6A 4HRAA 3C0KA 1RI3A 2JJQA 3DTNA 3OE5A 5CIYA 2G8NA 1R6AA 3FPGA 2PXXA 4JXJA 3OPNA 2GS9A 2UYQA 3DXYA 4GQBA 3UJ6A 4E32A 4R6XA 5M5BA 2FRXA 5MHTA 2QYOA 2PWYA 2O06A 1RI1A 5EKUA 4YUXA 5DWQA 1BOOA 3GCZA 5E1DA 1JTFA 5KVAA 1JSXA 3PLAE 2XVMA 1D2GA 4E2ZA 5GIPE 1VQ1A 4PYIA 4RX1A 3KQQA 5HIIA 3R3HA 7MHTA 2WA1A 5B1SA 2Y1WA 3K0BA 1EIZA 3FUXA 3P9CA 3BWBA 3EGEA 2HTEA 2KW5A 3G2MA 1KHHA 1KPHA 2GA9A 2K4MA 4FGZA 1F3LA 2OB2A 4CKCA 2BR4A 2OBFA 3V97A 1R00A 2PKWA 4GUAA 3QOXA 2Q41A 4YUYA 1XCJA 5K0FA 2B78A 5DXAA 4KVZA 5DXJA 4OBXA 2QE6A 3M6VA 5E9JA 2A14A 2EFJA 4ZTBA 1VBFA 3TRKA 4RTQA 4EMSA 2AOUA 3OE4A 3DXZA 2ZCJA 4Z2YA 3T7RA 2PY6A 5FA5A 3GRVA 4YUWA 1KPIA 5K01A 3C6KA 2F8LA 3IV6A 5EMKA 4M36A 5E2AA 3UZUA 5GM1A 3UJ8A 4B17A 1X1CA 5DX1A 1QZZA 4CTJA 3AY0A 4XUEA 1KIAA 3NWEA 3A26A 3ELYA 4P7FA 5DX8A 3AXSA 3LDGA 4PYQA 1KXZA 5CVVA 5DM4A 3KU1A 2CL5A 1PRYA 3REOA 5K0JA 1R8YA 3RODA 3CCFA 1NW3A 5EIWA 5DM1A 1G8SA 4PIMA 2ZZMA 3R0QA 4YMHA 3G2PA 3DMHA 2IDKA 5IH3A 2FK7A 5U4XA 3A27A 1G55A 3EMDA 1SQFA 4P7GA 5FCDA 5BP7A 4RVDA 2P3OA 4MQ4A 4PYKA 4YUZA 4PINA 1YFLA 3P9KA 4HTFB 2PXAA 3OCJA 2AZTA 4YMGA 1B42A 2NNWB 2UZ4A 2WK1A 3O7WA 4HGYA 1JG1A 4BY9E 1RI2A 3BWMA 4OA5A 1XCLA 1JSZA 2C7OA 2XVAA 1QANA 4X61A 2OPBA 3PVCA 1VP9A 5EZSA 4C07A 3TLJA 5HIMA 2CWWA 3C3YA 1KP9A 1AF7A 4YV1A 3LGAA 4M37A 5GWXA 4X63A 5E9QA 4PYLA 4C06A 4CKEA 2YXDA 3DMGA 3HCBA 2IBSA 2PX5A 3MB5A 1TPYA 2EG5A 4E2WA 1HMYA 3JWIA 2CKDA 2EX4A 3I5UA 5T67A 1NV8A 1XDZA 3G2QA 5K05A 4AZWA 2H1RA 4RTNA 1WG8A 5CCBA 4BLUA 3NDJA 4PYOA 1P1BA 5K0LA 2ZWAA 3BGIA 4GOOD 5LQNA 1YF3A 1Q0TA 1XTPA 2ZFUA 3H2BA 3GIWA 1O9HA 4OBWA 4PWYA 3HVJA 3PFGA 3HP7A 1NW7A 5CUQA 1X1AA 3ANXA 3PTAA 2I7CA 4FT2A 3HVKA 3KPWA 3KQVA 3LDUA 4KIFA 4CTKA 4CKBA 2IH4A 5EZQA 4ISCA 4YUVA 3P71T 3V8VA 5HIJA 1RI5A 2PX8A 5FULA 3KQPA 2H00A 3DR5A 9MHTA 3KPJA 2R6ZA 5DX0A 2IFTA 5FQNA 4MWZA 3CJTA 2YXLA 3FPEA 1R8XA 1NW8A 3EEYA 1RJFA 5E1OA 3T0IA 3T7TA 4OQEA 5E9WA 3SX0A 2UYOA 4C03A 3FPFA 1G6Q1 1IY9A 2AVNA 2PX4A 1L3BA 3R9XB 4OA8A 3TQSA 3UJAA 3FPHA 2B2CA 4RTPA 1NT2A 3FRIA 3C3PA 2AOWA 4E2XA 3JWJA 5HILA 4G56A 3SSMA 3BWYA 3FZGA 3HCFA 1SUIA 3EEOA 2O05A 3TKAA 4DCMA 2Z6UA 4PYNA 4HTFA 4QTUB 2DULA 1BHJA 5FWAA 2BZGA 1OR8A 3E23A 2O0LA 4NECA 2ZIEA 3TMAA 5HEKA 1H1DA 3AWIA 3GRZA 4LWPA 3U81A 3KQMA 1YFJA 1IM8A 4X1OA 1MHTA 2VDVE 3DH0A 4RSRA 1DCTA 2I9KA 3MGGA 5BW5A 1YZHA 5E1BA 2G71A 4E30A 4FSDA 3TM4A 5EVJA 5JR3A 2NXCA 1X19A 3PT9A 4FT4A 1XJ5A 3KPVA 5LQUA 4FSXA 2GB4A 2ONYA 3IHTA 4PIPA 4EK9A 4ER3A 1N7JA 1ORHA 5LSAA 3G5LA 1PJZA 1G38A 3BZBA 4RV9A 1YB2A 3KR9A 3NTVA 1ZGJA 3DXXA 3E7PA 5EGSA 4M38A 3WSTA 2NXEA 5GINE 2PT9A 1L3CA 4RTKA 1QYRA 4U7TB 3TKYA 3HA5A 3TR6A 3HCAA 2B9EA 3SGLA 3KR0A 3A4TA 2NXNA 5HFJA 4XUDA 3UJCA 2V74B 2ZIGA 3A7EA 3FUVA 2GLUA 2O57A 1L1EA 4RWZA 2AOUB 1RJDA 1WXXA 2PXCA 3TOSA 1I9GA 4P7KA 5FA8A 5K8VA 2OZVA 3GGDA 1TW3A 3P97A 1JG4A 1X1BA 1X1DA 1EG2A 2BM9A 3GO4A 2AOTA 5FTWA 5K03A 4MTLA 3BWCA 5EMLA 2IDJA 3OU7A 4ER7A 4RYLA 4U7PB 1D2HA 1AQIA 1L9KA 5H02A 4WVLA 2Z6AA 1EQAA 5GOZA 2ZZKA 3FUWA 1WS6A 3CKKA 3THSA 2AOXA 1G8AA 2O07A 1N2XA 3KPUA 2GH1A 3KQWA 5ICCA 4GC9A 2PV0A 4GOND 4ER5A 5T64A 1P39A 4R6WA 1YZ3A 2XYRA 3DUWA 2PSSA 2AOTB 3MCZA 3O31A 2V7EA 4P7JA 2G1PA 3KKZA 2P3QA 3LDFA 4DF3A 2G70A 4RTLA 1DUSA 1BC5A 3FTCA 4RVHA 1RI4A 3HNRA 3O4FA 4R8SA 4IV8A 3LCCA 4FZVA 2YQZA 1RJGA 2UYCA 4PYJA 1U2ZA 1KPGA 3G2OA 2AS0A 2FK8A 1NW6A 2OB1A 3M4XA 5C9ZA 4RTOA 4A6EA 2B3TA 5KQRA 4GBED 5CVJA 1SVUA 3SVZA 2XYQA 3PFHA 4AZVA 2C7RA 2E5WA 1UWVA 5FHRA 3UJ7A 3ELDA 4YV0A 3CBGA 4R05A 3PX2A 4BLVA 4PONA 3KQTA 3LBYA 3LCUA 3BUSA 3FUUA 5CVDA 2AVDA 2OO3A 5LR6A 3BGVA 3B89A 5KS2A 4RTMA 3OU2A 2IH2A 1AV6A 3RW9A 5ICGA 2BR3A 3P2IA 4BLWA 1NBHA 1SQGA 4KWCA 3VYWA 1JQEA 1EJ0A 2R3SA 5DT2A 3G7UA 1NKVA 3FTDA 3P2EA 4HSGA 4LG1A 4EQZA 3LPMA 3S68A 2AN3A 5FHQA 4FR0A 2GPYA 2VZ9A 4P58A 3UJBA 3SM3A 3MQ2A 3DLIA 1SUSA 3TPZA 2G72A 4E70A 2AN4A 3QOWA 4PYMA 2FYTA 3EVZA 8MHTA 1O54A 3UBTA 3EVCA 2HWKA 3OFJA 5EOVA 5K0NA 4AZTA 4A6DA 4EKGA 2ADMA 3G8BA 2ZULA 3JWGA 3KR2A 5EMJA 3PS9A 2C7PA 2YTZA 3FUTA 3GJYA 1FJXA 4PGHA 1ZGAA 3EVEA 2PWPA 5CM2Z 3ME5A 5JUWA 3ER9A 5DLYA 1KR5A 1NV9A 1P91A 3ELWA 5E2BA 1VIDA 1VE3A 3THRA 3SMQA 4DM3A 3IYLW 3E8SA 3B5IA 3GNLA 3I53A 4FP9A 2LD4A 3MCTA 4KIGA 5EEHA 2IGTA 5BXYA 5IKMA 4WXHA 4DA4A 3R6TA 3G89A 1D2CA 2ZLBA 3FYCA 2ERCA 2PX2A 3KQSA 3UWPA 2YUIA 4QTTB 2YXEA 2C7QA 3OU6A 3FYDA 1R18A 1VLMA 4HG2A 3P8ZA 4QQKA 3B3GA 5EQJB 5EC8A 4F86A 4XUCA 3LL7A 3MTIA 1I1NA 1R74A 3Q87B 5LQCA 2CMHA 3UA4A 3FRHA 2OYRA 3OZSA 1ORIA 4KRGA 5DM2A 3LKDA 5T6BA 3FPJA 3KPYA 4KDCA 5EPEA 1WY7A 2IH5A 5LQAA 1ZQ9A 3C6MA 2PLWA 3HCEA 3HVHA 4GC5A 3TM5A 4BP1A 4DCGA 4YV2A 5HIKA 4V0RA 3M6XA 3FTEA 3G88A 1FPQA 2WA2A 4Y2HA 4DQ0A 1FP2A 1M6EX 1RJEA 4RTRA 4RTSA 4HGZA 3B3FA 2PBFA 4FS8A 3ELUA 4HH4A 4LWOA 4PCAA 4RVFA 5FQOA 1BKYA 1AQJA 5EIFA 3EVFA 1I4WA 3KHKA 3NW9A 2HNKA 3UFBA 4IV0A 1EAMA 5CVUA 2P7IA 2IIPA 5EHGA 5G02A 5CD1A 1ZHFA 1Q0SA 2FCAA 2ZTHA 2QY6A 3M6UA 3HM2A 4HC4A 3QV2A 4LECA 3P9NA 3EGIA 4E2YA 3P9IA 4PGGA 3VC2A 5DSXA 3MHTA 3ERCA 4ATNA 5DTMA 3CGGA 1HNNA 2OKCA 5K0BA 3BGDA 2HMYB 3KQOA 3HTXA 2P35A 5FWDA 1F38A 3EVDA 2NP7A 3NMUF 2H11A 1VPTA 2IP2A 1XDSA 3LKZA 3LSTA 5DTRA 1NE2A 3LX6A 2IPXA 5GM2A 3G8AA 5ICEA 5DPMA 5HZMA 2P7HA 3UJ9A 5K09A 3KQYA 5FUBA 2OY0A 3ID6C 1VL5A 2ZBQA 2ZVJA 2B25A 2VP3A 2P40A 4IKPA 4CWAA 5CVEA 2XBMA 4Y30A 1XVAA 5GP1A 3CC8A 2EJTA 3K6RA 4GF5A 1JQ3A 1XDUA 2AOVA 3EPPA 4QQNA 2BR5A 1KYZA 4QVGA 5C1IA 3FTFA 2VS1A 1QAOA 2P41A 1MJFA 2GAFA 2JH8A 2VDUE 3D2LA 3EVAA 5ERGB 5BW4A 3LBFA 1JG3A 3OFKA 3A25A 2HV9A 2BH2A 2P1DA 1VP3A 1G60A 5EEGA 2AN5A 4X41A 3MTEA 5CCXA 5EMMA 3B7PA 3GRUA 2JH9A 2ZZNA 1JTEA 4XCXA 3DP7A 1WZNA 3NVKI 1FBNA 2ZBRA 2Y1XA 1XXLA 3HCCA 5K0GA 2NYUA 2BM8A 3DLCA 2IBTA 4RTJA 4V0QA 3SR4A 2YVLA 2PJDA 2N47A 3M6WA 1QAMA 5LQKA 3BT7A 3PX3A 4POOA 4M7RA 2P3LA 4GEKA 5DSTA 4C04A 1T43A 2VDWA 4QDJA 3VSEA 4E33A 4UOEA 3JWHA 2I6GA 3ER8A 3NDIA 3IEIA 3GDHA 5EKXA 2QM3A 2ESRA 3TFWA 3I64A 2EJUA 5KYGA
chains in the Genus database with same CATH superfamily
1GDHA 2BGLA 4O8CA 4AUKA 2ZRGA 2E21A 4G1UC 5JEDA 4TS1A 4ND5A 5ALOA 3H3JA 5FNVF 4EG4A 2NPOA 4ALIA 1I14A 1UXGA 3WHIA 2F3RA 4W5WA 4BV2A 2XIJA 4L9SA 3X0DA 4FWTA 2IYNA 2KHZA 3SP1A 3I34X 3HRIA 3KV3O 4XI9A 4QLBA 2QR2A 4R68A 1SC1A 4AKEA 1ZMOA 4V02A 2HDOA 1PWEA 2YVUA 1JG2A 3ADDA 2GCOA 5CYPA 3OPVA 4OUKX 4US1R 1WXQA 3W4IA 1ONSA 1TEVA 5IJXA 4D80A 1CQXA 2Z08A 3LLVA 1ENZA 1ORVA 4AN0A 3T7KA 3G5TA 3I2FA 3L92A 2QD5A 4EUSA 3REQA 1U9CA 3OZTA 1PVDA 5K0GA 2E6UX 2AW5A 1SUBA 4KI7A 4NULA 3ROTA 5MN6A 1WPGA 4I66A 1J2EA 1Y6ZA 2BEVB 1A98A 1JEYB 3QVGA 4EEXA 3ASUA 5LM3A 1GFIA 3KM0A 4H0NA 4Y9TA 4D4LA 4EGCB 5J2TB 1L3IA 2EJCA 3AXTA 1C8LA 3DCJA 5HA5A 2AZDA 3LWBA 3IP5A 4RZSA 3RIEA 1GZ4A 4D0NA 4DKJA 2P2CA 1I4DD 2QYTA 1XZEA 3P2MA 2X6QA 2J3IA 4C0LA 1T3ZA 4PEVA 4RABA 3H3XA 5CT9A 5KVCA 3EWNA 4WBXC 5ALGA 3GK3A 3I9NA 1I3CA 1MNQA 2CHUA 3BERA 3KEQA 1KNXA 3O0DA 1RC1A 4LZPA 4V38A 5D1NA 4TT3A 5JDIA 1BHQ1 2H29A 3LTEA 1PR9A 2Z8YM 5DF1A 4C22A 4S0XA 1J5EB 2WPNA 1FP1D 1DJPA 1SVMA 1Z6QA 1GPWB 1W88A 2IELA 3ZWWA 4JI4B 4TS4A 3S28A 1C3EA 4REMA 1HE8B 4UZFA 4M99A 3HXTA 2CYCA 3H3FA 4J4TA 3RYIB 4Z3KA 3LVRE 1G4UR 1R0CA 5SZHB 1Q1NA 4FBGA 3PNBA 1J9EA 3VDRA 3NH6A 4B3CA 4F7DA 3Q3CA 4BU1A 1JU4A 4CV0A 2NP6A 3HA7A 3JQBC 3CJQA 5HF5A 1VB3A 1H8EA 4BVBA 4GLLA 2SKEA 4NH4A 1ZGZA 1FDIA 1PDWA 3DDSA 4P3NA 4QD3A 4BNKA 1GR0A 3F4KA 1EE9A 3LCRA 4GO1A 4XVRA 3MUFA 1BMQA 1UBCA 1VI6A 4JMLA 1PZFA 2ZUWA 1RZVA 1DB3A 2QB5A 4GP7A 1FDSA 5KWSA 2DT8A 1QIGA 1FNMA 1XKQA 3O74A 4MYRA 2BDUA 5ALLA 1KERA 1UZLA 4WADA 2O7NA 3B9PA 1JHRA 2R8YA 4U5XA 5F1KA 3DAOA 3UJ6A 1Y7HA 2P4UA 5LDDC 1AQNA 1PK8A 5DWQA 4BMSA 5EWJA 5EIEA 2R60A 1PQUA 1V1MB 1GTMA 5MFPA 1J2TA 2Q46A 1U04A 1Y80A 4LDPA 3TG8A 3UQZA 5TPWA 2AZ4A 2Y93A 3M6AA 1EIZA 1IXRC 2O23A 2E4YA 5AVKA 1FYEA 1J2UA 3DT9A 4WHMA 4Q7JB 4E21A 4D6XA 4YY3B 4G8JA 4LF7B 4QXOA 4L8WB 2OBFA 1T6YA 4NV0A 2A9FA 2RG7A 4HR7A 3QOXA 2IYUA 3ITNA 2Q5IA 3LQYA 1LBHA 2WIFA 2C8KA 2EBHX 4LHEA 3KRTA 2NU9B 4EFKA 2QE6A 2F00A 2WB4A 4RYDA 4DMUB 4UVGA 4YXWD 3KEOA 2Z57A 4HGOA 4IRUB 4QTYA 5CA1F 1L1RA 4TQ9A 4YEDA 4IV5A 5B2ZA 4DANA 2TRSB 3I09A 5EVCA 1LPOA 1U8EA 3FYSA 1SZCA 2CT8A 2ASVA 5AW2A 3LUKA 2D1TA 1ZLYA 2ST1A 4N6GA 1T1JA 3PWSA 3V00A 2CJXA 2PL5A 2QTAA 3LNTA 4JT2A 4OK6A 3V6MA 4LHVA 3G59A 3ZWAA 3SXUA 1F8UA 3W78A 2P4SA 2NO6A 4WY8A 4AWAA 5L6LB 1BGWA 1XZLA 1VYUA 3LU1A 4TLDA 4XIIA 3I6MA 4LC1A 3IIEA 1H23A 4OFZA 1Z5ZA 1XPJA 3UEOA 2CHQA 4QXMA 3R74A 2H52A 4BBAA 4DG8A 1NIJA 5FUVA 1IMOA 5JSFA 1MQAA 2JAQA 2B7BA 3DKIA 3NALA 1GQQA 1LBIA 4ZV9A 1A8IA 2F8TA 1FJHA 1OC4A 3A1UA 4GMGA 5A6VA 4ZYUA 4B3MB 1UH5A 2F1RA 4QUKA 4WECA 1N6IA 2P2NA 2XCLA 5FOSA 4PAOA 4UVEA 3ZHZA 2PLNA 4W6ZA 4B35A 3C1UA 2P2DA 2BKEA 2RJOA 1RFLA 1UBFA 3GRPA 2P90A 1UDBA 5DLEA 1YJXA 1PR4A 3W9SA 3C3BA 2BCGY 1ZMBA 4FHEA 1ZISA 3RUCA 3WKEA 1HDGO 3PD0A 4R41A 2ZYGA 2AA3A 2YXDA 1BROA 4HB3A 4YN3A 2XXBA 4MWSA 4OP3A 3BMOA 1NVMB 4M4SA 5DW0A 4ZTUB 1QVVA 1HR0B 5TQJA 1GZ5A 1OVMA 4FHZA 3TIXB 4G37A 3TLAA 3WRXA 3WDLA 1MAVA 2SECE 4R0NA 3EIOA 5EIBD 2DJIA 1R3UA 821PA 5A1TA 3KEMA 2HREA 4MV5A 1J70A 4BLUA 1O95C 3C4VA 4TZTA 1KZ1A 2HQSA 1HEUA 2J6HA 2NUTA 1B43A 4BFXA 3FSGD 2EV9A 2XNDD 2F43A 3HXOA 3QF4B 4LRUA 2FB9A 2GJ8A 3L4EA 3LE8A 2H1WA 2FP4B 2WYOA 1PT9A 2OKGA 3REGA 4NSNA 3T5MA 3KQVA 5JS7A 3RTEA 5J5CA 3IPXA 3QKTA 3WBBA 3B12A 2FSGA 2EC5A 1ILEA 2WE7A 5JAZA 2CSUA 4KIWA 5J2TA 1JLLA 1FNDA 1GA6A 2CXUA 3VU8A 1G5FA 4PZEA 2FFJA 4MWZA 1QK5A 3JTMA 1JT9A 4CKWB 3E9CA 3ECAA 4PHTA 1B74A 2H63A 3KS9A 2NZWA 4ZQEA 4DV4B 2JAPA 4L8FA 2XMGA 1G6Q1 2G0AA 1QQ5A 2PSJA 4J2OA 3NEYA 3GVCA 4AQ7A 2ZKLA 1WHTB 3T1OA 3CX4A 3DFMA 4OY3A 4AIRA 4BO1A 2A35A 4E2XA 1Y3IA 4DC0A 4Y2XA 5KREA 4WINA 1DBRA 5EHQA 2OMEA 3D1VA 4NRDA 2ODEA 5TMDA 4JWTA 4IEEA 4J9VA 4L5CA 3T5DA 1HURA 3W5IA 2CXSA 2W9XA 1IWOA 1H2AS 2HU2A 1LBSA 2M2IA 3CZCA 1IXZA 2X22A 1KYYA 3UN1A 2OGZA 4IS3A 3ZLJA 4R3UC 4PLZA 2ZRIA 4RA6A 5K4HA 1JDPA 1NUHA 2QLNA 3DMNA 4CQMD 3LT2A 4EH1A 1DIOB 3KTAB 5BMVF 4FE4A 4G1FA 1E1YA 1CX9B 2O0MA 1F1BA 3H75A 5CW2A 1JBEA 1L5LA 3EK2A 2HIAA 3IHTA 3ROFA 5E6RA 3RS7A 4UAVA 4UU1A 4F4FA 4ER3A 5REQA 1QMPA 3CX6A 2DBRA 4DSUA 5CJJA 5GV8A 3FTQA 4E1VA 1GNPA 3ZDCA 3HJGA 2G25A 4M38A 4KX5A 1GPKA 4MVJE 6GPBA 3UB4A 1LQUA 3OKAA 4UUQA 4IXMA 1JYSA 3I01M 1PEAA 3RYFA 1FLNA 4YQEA 1WZ2A 1W4AA 4Z4GA 1ADBA 3QW4B 4BWVA 2C78A 1Z0IA 2Q1TA 1E7SA 4GBMA 4F21A 2AOUB 1YRQA 1RJDA 4G81A 3ZHTA 4DWJA 5JSZB 3E4DA 1FFYA 1P4GA 3NS7A 1L7XA 3QEMA 5ITVA 3OFVA 1FLAA 1CQJB 3H1EA 3IEKA 1TFRA 1KQNA 1XQYA 3GGDA 5JYEA 1E2LA 3THYA 3P97A 4NZZA 2BM9A 2QW8A 2X8BA 4BCBA 4ZIRA 5EE0A 5TIIA 2FY8A 2IDJA 2DM6A 4Q01A 4YCAA 4KYVA 1DS6A 4XWYA 2VRWA 1N4AA 3TX6A 5FV4A 4DDKA 3ZHUA 5GOZA 4W9NA 5HTKA 4A6XA 1VSTA 1P7YA 4RZUA 1BCRA 1PKXA 4IUCS 2C3YA 3LQFA 1E2FA 1CDEA 5GGXA 4KNYA 1CUGA 1FUEA 3EC2A 3KQWA 3TTXA 8OHMA 1T8SA 2I03A 3ZQJA 4ER5A 2WSMA 4B7ZA 1P73A 5CLHA 2M6LA 2V7EA 2VKQA 1VG0B 4JIGA 4XQEA 2VQ3A 3KKZA 2O2IA 1GNSA 1WMAA 3IQFA 2RCYA 4MRSA 1XMSA 2X9QA 1DUSA 1MFZA 1X87A 3ZTYA 5IF9A 4JR1A 3LCCA 2QD2A 1H6AA 1QGYA 3LF1A 4B3TB 3B1KA 3H0KA 3HV2A 4ESVA 2PRYA 1Q50A 2B3TA 2QDXA 4W1RA 4ISBA 1V7ZA 4N39A 2VHCA 5TQ2B 5JPIA 1NMEA 4KVFA 3DUFB 3I2KA 4R05A 4FZJA 3RSLA 2WFLB 3TSCA 3C1OA 3W5SA 2ECOA 2IGBA 4NYJQ 4BNFA 3C24A 4CV3A 3SVTA 1F4LA 1TU0A 2FR1A 3DVAB 3PR2B 4O1HA 4GPAA 1ECFA 1T0BA 4IFEA 2DUNA 2XODA 4RDHA 2Z2XA 1VHLA 4M9XA 1WV0A 3BC1A 4OXYA 2CUKA 3H83A 3QLJA 1W0KA 1BE8A 4FNOA 1BDMA 2C97A 1DQZA 5TLSA 3TI9A 4ZOLA 1REQB 2EF1A 3P94A 4EO4A 3QPBA 4D9BA 4GKKB 4H3SA 3RRYA 1W48A 1LK7A 4ARZA 4HQLA 2CHFA 5ITZA 1GTL1 4QYWA 1BW9A 4UUPA 2QNRA 2Q9CA 1CV2A 2UZ3A 3S8MA 2O8FB 1A9TA 1W25A 4NBLA 4N0EA 1YDHA 4O63O 4QHTA 3W7AA 5KTYA 4P3YA 3GEEA 4CI9A 4AZTA 1MP0A 1M2EA 4TLCA 1E58A 1FL9A 4RM2A 3U7JA 1Z63A 4EJSC 4MB0A 2JAOA 1KDYA 2VJAA 3GNTA 1YU9A 4NC9A 1P0FA 5L4SA 1XCGB 2A0XA 1ZMXA 3E9QA 2C5GA 3ME5A 4ZZ2A 3M89A 3A4IA 6Q21A 3CLSD 3UT6A 2PUEA 1TJ5A 1X7YB 3OKPA 4PTZA 3VGPA 4GBJA 4Y2SA 3RIHA 3TD6A 3UJNA 4LDJA 4TX1A 4AO6A 1XTUA 1Z75A 2VDJA 3BZUA 1O4WA 1ZUHA 2YUIA 5GZ1A 2RBKA 2OENG 1KBQA 2YBDA 1Z5WA 2YXEA 3EEQA 1VLMA 3GDFA 3HGTA 4OHRA 4DSAA 3M3PA 3L82B 1TPZA 3CE6A 4XDGA 3ZX5A 4D26A 2Q5LA 5G0VA 1HDYA 3E58A 3HACA 1E2HA 3MS4A 3UNXA 2XOXA 5DM2A 1EUCB 3N8DA 4C4ZA 1JBKA 1EXVA 2XGJA 4RKRA 3PVSA 1MIOB 4J0QA 3I0NA 3RRFA 5LQAA 4JI1B 1VCNA 3WZLA 1THZA 4E09A 5IZCC 1J8VA 3ZS9A 3GFSA 1GG9A 3DO8A 3Q15C 5HRCA 1WKCA 1R6DA 2I3AA 4PU0A 1M54A 1EVKA 3VISA 5DHAA 3KCNA 5DLQC 4B6JA 4ZK6A 3TLBA 5HJ7A 2XWJI 3B60A 3C70A 3SFTA 4C4XA 3C6BA 2FMKA 1EWKA 1K4MA 1YRBA 4OLJA 4MYHA 4EO7A 1NYRA 4KQ2A 5IBCA 5LXTB 1PZNA 4ZGGA 3UFBA 1I4WA 1C7ZA 3U3ZA 3MGAA 4PZ9A 4PHGA 2XZDA 3WO0A 1U7WA 2H1HA 2PT5A 4PVDA 3U48A 1F5NA 2BMWA 1YGPA 1GGKA 5FWNA 4MITA 2BZ0A 3DOOA 4LECA 3A4YA 5FJIA 3UB3A 1UPBA 3N2GA 4N12A 3R75A 1LGYA 4L7QA 1N1EA 3LP6A 5UKDA 2HWXA 1NY5A 1JDVA 5DLDA 2HMYB 3A06A 2ETXA 5FWDA 1WMBA 4JGGA 3RB8A 4Y1FA 2C82A 4B6RA 1A2OA 1EKXA 1NC1A 2GNPA 2AJBA 4V39A 5AFSA 5CNIA 1NY6A 3H1PA 1Q7TA 1TADA 1V9LA 2PH1A 4G36A 2O8CB 2PYZA 4NYMR 1NG9A 5ICEA 1E5TA 2P7HA 1A4UA 2X7JA 4CMGA 1YZFA 1IC6A 3DW3X 4LJ4A 4O1MA 5AT1A 2J3HA 5FR2A 5TARA 3RNOA 3DYIA 3ECCA 2IEZA 3JQ8B 1NC3A 1RPTA 4EPWA 3Q12A 4WNAB 3EPPA 1XDUA 4UW9A 2VP6A 6ABPA 4QPCA 2J09A 4DGQA 4PLWA 4CLEA 4LBZA 1S4QA 3PXBA 3LLUA 4X54A 2IYVA 3L3BA 5BYKA 3WP0A 1FU7A 1YA4A 1VCOA 3VPDA 4F2DA 5KYTA 3ORYA 1G20A 1WL8A 2QNBA 5EQTA 4DQLA 3FZEA 4JLAA 3ZIAD 2R1ZA 1JN0A 3KC2A 4XYMA 2HJWA 3GRUA 3OSZA 2DSTA 2WLSA 4ASUD 4LHYA 4YJ3F 1NQWA 3IC5A 3PC3A 3ZWXA 4EFDA 5ALEA 4BGDA 2NO7A 2VH1A 2GF2A 3IAXA 4V0QA 3SXPA 2Q0QA 3N0XA 4N3CA 3KG2A 2Z2JA 4AJKA 1QAMA 3N86A 3BRSA 2EQBA 3M4YA 3PDCA 4UCWA 3L0CA 5DHUA 3U3JA 2P3LA 2X5JO 2ZAYA 4NBUA 3QVGB 3IMFA 4YAOA 1FVFA 4UUAA 1D4FA 2WFMA 4E33A 4N9QA 2Y1CA 2Y77A 4UTNA 1VPWA 1WX1A 3ER8A 1QXSA 2IXAA 4O2BF 2OV1A 5TB5A 4TMTA 3WGTA 1R1DA 5CM9C 2JZOA 2YWFA 3BVPA 4JLSA 4FOTA 4DW8A 4R8RA 1JKFA 1KU0A 3INRA 5LC1A 2PFGA 3R7SA 1JKXA 3N53A 2MR5A 5DTQA 1KYWA 5DOZA 2CNDA 1FMCA 3A7DA 2F43B 2DFVA 6AT1A 3UF0A 5M04A 5KAPA 4MYSA 4QNMA 1GFSA 4S05A 3RK4A 3BRWA 3HHEA 4U2BA 1Z2NX 3RJ9A 1AF4A 5DP2A 3RS8A 3K5HA 1NT4A 4HB4A 4E22A 5IPFA 3WB9A 3I30X 3B3JA 4EITA 1NYQA 2C2HA 3BIWA 4Q3CA 4BVGA 4D0RA 2PUDA 1HZZC 1SN7A 3MT8A 1PTJA 1OU4A 2YINC 4LGCA 1EWRA 1ZL2A 1XRMA 2I80A 2VF4X 4QVKA 2BMDA 2XPCA 3HEMA 1R9NA 1EK1A 3P0EA 1AA6A 4W1PA 1XR3A 4K6CA 1SO8A 2BJWA 3EIHA 2PKQP 2QUAA 3KJEA 4PV7A 1AKVA 5FO0A 4EGFA 4DLZA 2Y0CA 1VHTA 3O26A 3EGVA 5KAMA 4QL3A 1WMFA 2QLLA 1WDMA 2GKSA 3N7UA 4YIKA 1CETA 3SF8A 2BSXA 2XYHA 2ZETA 5KYYB 1G4AE 1YGYA 2BGNA 3B82A 1TK3A 2FTKE 1HGXA 2DPYA 4EABA 2C4WA 1XZNA 2XE7A 1MJGM 3BH0A 4PGAA 5DKFA 3FE2A 2X15A 4X95A 1SHTX 4D0SA 2M32A 2Q3DA 1ADJA 4XCQA 5DI3B 1NLUA 1K27A 1MENA 1PR3A 3TJMA 2ZWVA 2BRUA 2VA9A 1R5BA 3NH9A 4M9CA 3WL3A 1JAYA 3W5VA 3KOYA 3HI6A 3S7TA 2I76A 4LQDA 4BO6A 3LECA 2DFKB 2WJAA 2A4MA 2B0CA 3ETNA 2P2YA 1Z74A 4OGLA 1XQXA 4Q3KA 4KAJA 3NASA 2O2CA 3EARA 4LPSA 5L6MB 3QBEA 1PNQA 1XHLA 4E31A 4KLZA 4CRWB 1SB9A 4E94A 4JJ6A 1UQRA 2CLIB 1MJGA 3ENKA 3PT5A 4URUR 3ILXA 1B8NA 1S02A 3GRYA 1GITA 4L5YA 4R2MA 3ZDEA 1OYOA 4JXXA 2VNKA 1I3OA 1DRKA 1QU3A 1RI3A 5K7SA 2AC4A 1JHPA 3FB1A 3K0CC 4XQGA 4OOFA 3D8HA 1DJLA 4JVNA 1LI4A 3ED1A 3N8KA 4WIAA 3ZXSA 1FVHA 1HLDA 4C7OB 4NTZA 3S2GA 2CSXA 4KR9A 3GPCA 2Y0PA 4RY8A 3PCXA 5E1DA 3ZG6A 2PMWB 5I4BA 2XVMA 4LYDA 2F59A 3SJAA 1VQ1A 2V8BA 3L77A 2FDRA 2LVBA 1ZMTA 3P0HA 4NOKA 4Q4LA 4YRSA 2YZMA 1T13A 4D9GA 1X1RA 1AVTA 4HDSA 3LYAA 2ZSBA 3LLSA 3EGEA 1OKKA 3FPCA 3BCHA 3LXRA 4GM1A 1KEKA 3AVUA 5K8IA 2HQ1A 2R8RA 3CUSA 3DAGA 4B74A 4LNAA 2GFHA 4FYWA 3ZKAA 3OLXA 2A14A 3FRJA 4MRRA 1QLJA 1QHGA 4X3CA 3ZVNA 2ZSDA 2ZJ8A 2FJPA 2A1TR 4PFKA 4TTIA 1PJ2A 4K0RA 4PAWA 2XCTB 4G89A 2YOHA 1NM5A 2CLMB 1OAOC 2C77A 1SAYA 4EUEA 3BRCA 2PY6A 3T7RA 5KI6A 1OH8A 1JAHA 4FC6A 1FTWA 4E5DA 1Z06A 1BN7A 1Z34A 4XOUA 3G13A 4GXTA 1NKTA 3DZGA 2WU8A 1Z0DA 4JN6B 4ED9A 4BXOB 4JNCA 3D0QA 4NZNA 4ZMRA 2EZUA 4BMZA 1XKXA 3QKSA 4RBNA 1KXZA 4LN1A 5ALJA 3KU1A 2CL5A 3L1KA 4RQBA 1CB0A 5ER6A 1LC0A 4KMOA 1IOVA 3SDBA 5H1YA 2GWHA 2JPDA 1OXVA 1LEHA 1FXSA 2QAGA 3MJVA 3RS4A 3SC2B 4ADSG 3SC4A 2OCLA 3OOEA 4E5PA 3WHLA 4P7GA 5MN5A 4U9HS 1M6WA 1YT5A 4AJ9A 4YCMA 2WWYA 1YKSA 3C6XA 3Q41A 2VVTA 4J0GA 5JO9A 4B7CA 4ITVA 4H6VA 3I1YA 4QGFA 4B43A 1XZMA 3ZE2B 2AYYA 2R2AA 4HCJA 1UMCB 3I9MA 3KYIB 3R40A 1VA5A 2J3DA 4KBFA 4E6EA 4TWRA 3EYWA 5F23A 1YTUA 2I6QA 3SHFA 4NFHA 5EZSA 1W85A 3A1FA 2CWWA 3QPAA 4RHTA 3ZZTA 2H31A 1D5CA 2ZAMA 1QP0A 4CMHA 3R44A 5E9QA 3M34A 1K2WA 3AF3A 1YS1X 2X9LA 5D3MB 2PS1A 3DMGA 3FJ1A 4MZDA 4IG4A 4CPDA 4PX9A 5CBKA 3BJZA 1KMNA 1ESNA 4B3DA 1CQPA 1C7RA 1BXGB 4YRQA 1FSSA 1IY0A 1OBHA 3MZ0A 4AZWA 1I1HA 4UBOA 3MTQA 3RROA 2QMEA 3EA4A 1XZIA 3IOCA 1YF3A 2Z5GA 1SCKA 2A88A 2VUIB 4KRFA 4RSHA 4KV9A 2X0JA 1Z6ZA 4QX6A 3ZDDA 3TTSA 2PX3A 3IODA 4KXXA 3VNSA 4LOHA 2PD4A 2D06A 2HEIA 3V4VB 4H6PA 5AVOA 4EX7A 4HYTA 4YUVA 3NTXA 1QKJA 4NE2A 1VYTA 4BKOA 3OQMA 1EEXB 3EFEA 3GD7A 3GMIA 2P9YA 3UMFA 2NTJA 4LSZA 2EHJA 3LWZA 4OA8A 4BLPA 2RDMA 2QW1A 1DSSG 1LBQA 3I6IA 3RS2A 2VPQA 2ZJOA 2BDTA 1DG9A 3H4MA 3ROXA 3VBCA 4JFAA 2GZDA 3ANTA 1VMDA 3T34A 1P6XA 2D5LA 4LGVA 3F6RA 5DNCA 1YHZA 3AW9A 4D43A 1FX1A 3IQXA 3IESA 2W7TA 2D74A 4C5CA 2YWXA 3MT9A 3ZCPA 4Z9FA 4DY6A 1M1NB 1TVEA 3DBOB 2Y4OA 5LD2C 1XO1A 3I5AA 2VDVE 3Q6NA 5D01A 1QQBA 3QMWA 1YZUA 2QIPA 4F06A 5I6DA 5E1BA 4TWAA 1A4XA 5KJCA 3JXEA 3L7YA 1T4DA 3Q1LA 2NVOA 1C8VB 3FN4A 4LJLA 2ONYA 3AEKA 1FJGB 3SKVA 4OLBA 2YWCA 1OBVA 5DFAA 1UDXA 3NTVA 2QXTA 3PHJA 4II3A 4RKQA 2JARA 1YQWA 5I4CA 4Q0MA 2G7ZA 1X8XA 1QYRA 1UWCA 4ROSA 2HPAA 2H7VA 3PA6A 4FMDF 1GP2A 4X1IB 4MVJD 4J76A 2A1UA 3T9CA 3K31A 2OCKA 4IGEA 4BZXA 4M9ZA 5EZYA 4EB6A 3QVUA 2PWAA 2QWXA 5KYYA 5AUQA 2HCBA 5TF4A 2YDXA 1CR0A 2LGJA 1DEAA 5IDQA 1QE0A 4QULA 4JROA 4F72A 1NU6A 4Y2TA 2N0SA 2IHJA 4LKRA 2Q8PA 3TZLA 4Y0AA 2AOTA 3G8YA 3JWEA 4EECA 4ZQIA 2C95A 2G3YA 2BBSA 3ZN2A 1UXIA 5JANA 2JD1A 1VJ0A 3AGQA 2H59A 2WJWA 3IHLA 2GH1A 1XZDA 2GR9A 1O77A 1T6ZA 4LZAA 5HMLA 3DHWC 4ZYLA 4P4UA 4RMNA 5TY0A 3L5OA 3IIKA 5IHPA 1IN8A 1TCVA 3M6IA 2BEWB 3LRPA 2AEJA 2JGJA 5ICCA 1I0ZA 5AMXA 4RTLA 5BYAA 4XEUA 4UCQA 3V4PB 4RJKA 4HDNA 2EKPA 3HCPA 4G0MA 1L5GB 4R8SA 2AMYA 1UANA 3PKZA 4YR9A 4K9OA 1O87A 1XDBA 2NU6B 3BSWA 5I51A 2EWMA 1BXZA 1AS2A 1LVUA 3L8EA 3F5QA 3AR7A 1GSIA 2WTAA 3O8BA 3R0ZA 2JEOA 4OI2A 1HYEA 4I99A 3V33A 1HF3A 2Q9UA 3ITKA 3UG6A 1DX4A 3JATA 2D8MA 3QENA 3GT3A 2Y71A 2JJ2A 1R9JA 3GP5A 3NPAA 2UYYA 2IXDA 2PPLA 3MWYW 4LY3A 5TQ0B 5I9IA 2IH2A 3E3NA 3D6AA 3S1LA 3LGXA 1DRUA 5H7XA 3TQOA 4EQ6B 2O59A 2FZ4A 2J07A 1Y1QA 1PW5A 5I7EA 4BDSA 4QUIA 1Z7GA 5LZ9A 4H1HA 2ZJZA 2E4VA 1SBCA 5LJLA 1M76A 4LQ4A 2Z3WA 4FXPA 2FZKA 4UU8A 5A0FA 2UUPA 3A9SA 1HT1E 1EGVB 2NLOA 2IRWA 1WUIS 2C7GA 2EP5A 2FG6C 3EGXB 2JCSA 4MW9A 4UBIA 4URYR 2J31A 5EIOA 3IPLA 5KTMA 4I55A 5DYNA 5I7OA 1DIBA 4NEGA 3T5GA 2NUPB 3B8HA 4U2DA 3CZQA 1X2BA 4FDUA 4B7AA 3D43A 3IAHA 2C7PA 1R6XA 1W0CA 3PS9A 2H0RA 1TT5B 1XNRB 1O97D 4YAFA 1GT6A 4F92B 2R8OA 4ZOLB 1G18A 2R62A 4MQ6A 4EPTA 5H9WA 2XDWA 3UICA 2VAVA 4HEJA 4MJ3A 1I7NA 3RSQA 3VU9B 3AVPA 4JCOA 2UAGA 1EWTA 4RPCA 1ANKA 2WJHA 1RP7A 4P80A 2Q3BA 2VUTA 3EZNA 3WIDA 1KDRA 1X8JA 2QS9A 2VT6A 2GPNA 4U6NA 4ZVKA 3J7TA 1RE0A 4J4BA 5JOQA 1GYRA 2A9OA 3P2YA 1GIAA 5LP6F 1Z07A 3T4PA 3B3GA 4F86A 1ZDMA 2HB6A 1X70A 1GG8A 3D7LA 4PR3A 3RG8A 3RVRA 1F2VA 2B83A 4P2BA 2OYRA 1G16A 3PQ3A 5ETJA 1L5HA 3MIZA 1G8HA 3NVAA 3GL9A 2E48A 2R8PA 3GFPA 3Q7TA 4P4LA 4K9KA 4R3NA 5BMOA 2ZUDA 2GUGA 3MWKA 4H0FA 3ZIAA 4DCGA 1ID8A 3QE3A 1NLFA 2OYSA 1WMSA 3J80A 4I3HA 4B6QA 4D3XA 1FPQA 2FGJA 3LYHA 4DUGD 1I33A 2QAGC 4J0HA 3SS7X 3B3FA 3HO8A 4LWOA 5A9RA 4ZCIA 4YACA 1E9BA 4OH7A 3EOZA 5ARDA 4I9GA 3VFDA 1KJIA 1WOYA 4JYMA 5A5FA 4D3SA 3E7FA 1NBWB 3RSFA 3ML1A 3HP4A 1D3AA 3WLMA 4EATA 5AW3A 5IUNC 5KDOA 1GV1A 1ENPA 1V4BA 2JCXA 3COJA 4GYJA 3TLGB 1VMKA 3VC2A 3GEGA 1KBZA 3WWDA 1N0WA 2WAXA 1V9SA 3P0JA 3JYOA 3T7CA 4QOFA 1XCOA 4OMDA 4UKDA 3NFYA 2B4TO 2WOOA 7GPBA 1RWBA 3JSAA 2W42A 1ZJ4A 3UHJA 1ZCZA 1Z26A 3VU0A 1XXHE 4HQ6A 2BTOA 3ZR4B 1S2IA 2P69A 3QXGA 4YJ2B 1QMGA 4L50A 4LC9A 4KPGA 4BMNA 2O8VA 1N3YA 4XX0A 1BHSA 4KO4S 5D3QA 5KWEA 1U2TA 4G5XA 4MP6A 4PANA 3DV9A 3TIVA 1JRLA 2ZRKA 1J90A 3UOGA 4FFDA 2GESA 4RPHA 2P65A 1GUAA 3PIIA 4QIHA 4DDHA 3VZDA 2BTEA 3VDNB 5GP1A 4RV4A 4Q7KA 2O2DA 2POCA 1LI7A 1RYHA 9LDBA 1U98A 1YBFA 4MW4A 1JQ3A 1UPFA 1LSUA 2DUJA 2R79A 4TLAA 5CK5A 1J21A 4QSHA 4OHWA 5G1PA 4BASA 4LY9A 2C5FA 4MUHA 3FR7A 5C2JB 1RAHA 1M2NA 4Z86A 3KB8A 4FDLA 5KNCD 5AI0A 4HBGA 1RRFA 3MOSA 4TL9A 5AI4A 4BOYA 4HSEA 5CT4A 3AIOA 3R3YA 3L6CA 2E7ZA 2BIFA 1E92A 3V3KA 1DI0A 1FBNA 3VU1A 3W6ZA 1K63A 4QE3A 4IM7A 2QZSA 1YKGA 2QL5A 1ADGA 3BS4A 1BYUA 3TIIA 2PDAA 4P4SB 1ZVKA 1QOPB 1TK9A 2FZ5A 4N6OA 3EXIB 4Q3OA 4GEKA 1B23P 3LAWA 3O4HA 3A6HA 5IANA 3CLHA 3EISA 1UBKS 2FFAA 2MYUA 4B2PA 3UY4A 4BB6A 4J0FA 4DHWA 4EHNA 4F56A 5HKKD 3LT4A 2BKAA 4IJMA 4JYBA 1NVXQ 2GK6A 2G9RA 1UBRS 2D5AA 2LUOA 5DBIA 2V6GA 2WTMA 3NWBA 2ORED 2XE8A 3R3WA 3IOEA 5I8ZA 3AMVA 5CH3A 3NWOA 4DMRA 2V9CA 1NIPA 1NHGA 2CNNA 5TNXA 3TZQA 5JTUA 4YBRA 5A9SA 3GXOA 3OE7A 3JX9A 3LPDA 3QIVA 5C4GB 4K88A 1TW2A 4IEFB 4YJ3A 3A9VA 3P52A 5F7XA 4CXMA 3WJ2A 1WXWA 1HLGA 2H4ZA 1C4KA 2COKA 3P9RA 1ZXBA 2VQDA 4MW2A 4O5AA 4RVGA 2WJGA 5LUAA 5DNUA 2NZJA 1L5ZA 1P2TA 3Q3IA 3BORA 1CQWA 4QDTA 3GELA 1CRQA 2CD9A 1V7CA 2EEPA 2OOKA 2J8ZA 1X8LA 3EUFA 3NQ41 4NU0A 4Y9DA 2UV8A 4EYEA 4CEIB 4B3JA 1L8AA 2FHPA 3EY4A 4M1MA 2AC2A 3GDWA 4IIJB 3NBYC 1CRLA 4TTTS 3TCXB 3Q40A 1P2GA 5JS1A 4TTVA 2VJPA 1AS3A 1MCZA 4S1VA 4TQGA 4MHTA 1ZD8A 1PJ4A 2VT2A 1GZUA 1FS5A 2GA8A 1OGJA 3AUXA 3JPYA 4YRRA 4CLXA 1LZLA 1OSNA 2VP2A 3BDIA 1CP2A 1GN9A 3DQPA 1Z36A 5J4HA 5LCXA 3UV3A 3U44B 1N6OA 3CR7A 4F4UA 3WZ2A 2GEUA 1NOJA 2NU6A 4N7JA 4S1NA 2AB0A 1MC8A 1XU7A 5KEIA 1TZKA 5FPQA 2XUHA 3NONA 4IOMA 1FW6A 3DAYA 3PNPA 3KWMA 1DIAA 3K5IA 3R24A 3AP2A 1TEXA 4X91A 3RV3A 3SNHA 2YOFA 1GPNA 1YE8A 1GAJA 1NURA 1N2JA 1GZ3A 4YAGA 4G4GA 10MHA 3IB6A 3GZNB 1SBIA 4BJHB 1E2EA 2TMGA 1YDMA 4MLZA 3SX4A 5JSZA 4ENUA 4TXHA 4UVDA 1CKEA 1D07A 3V48A 4M88A 1XVTA 5BWBA 4QDZA 3QBVA 4QJIA 2G09A 5CPBA 2CDBA 4QPZA 3O83A 1L8QA 3ZWCA 4PQFA 2IOFK 4D4MA 3DMFA 3PXAA 2D13A 1XRJA 2E5FA 4PNZA 5KNDH 3TSZA 2ZTVA 2HA4A 3CEMA 5ADWA 2C2MA 2H2GA 3ENQA 3RS0A 2IYAA 4N8EA 1E9SA 1OHHD 1NN1A 1T2AA 2NV2B 4FMBB 4HRAA 1NPTO 2JFXA 2JJQA 3DQQA 4CLOB 4O4IA 1W581 5FTJA 4DZTA 3AKCA 1XRSB 1JFVA 3OZXA 3E8XA 2W6QA 2HK7A 8AT1A 5BNFA 5ESDA 5G2OA 2GM9A 3E84A 1DOAA 2YRWA 4P34A 3ZXUB 1NFQA 4LRQA 3ZJUA 3Q5GA 4AMZA 4L9RA 3VAZA 3MELA 1TA4A 3ZDAA 1IXSB 1EFCA 1BXKA 5K0SA 1GQSA 3K35A 3C7CB 3OICA 5CBPB 4HQFA 1GCOA 1S2DA 3SYRA 5IXJA 3P9CA 4H7PA 3N39C 1IBMB 5LLTA 3ZWOA 1ZWLA 2B1RA 3JRXA 1MB9A 1SKAA 3T5BA 1HX7A 3WNVA 3OY2A 3GUCA 3C8HA 1V8DA 4FJ1A 1Z5OA 3N58A 2GN1A 3SHVA 3UQYS 3QTLA 4HNUA 1GCAA 4YA6A 1VBFA 4TT3D 2YYSA 1WY5A 3W90A 4IUDS 2K7ZA 2CWDA 3AJRA 4AAYA 3O8LA 4IJVA 1W8DA 2RGNA 3DV2A 4AJIA 1JUDA 1KY4A 1HYQA 1RJ9B 1U7UA 2LKDA 2Q8QA 2XMBA 2YZ2A 4N0MA 5JZSA 1MAWA 2JGRA 2PQ6A 2O8EB 1XZKA 3Q8KA 1XEWY 3ND7A 4M36A 4Q82A 1D4AA 3ZV4A 4BFUA 1Z6PA 1SBQA 4AQDA 1FYDA 3MK31 3RARA 1SOWA 1UJBA 1SOVA 1V6SA 2JJ1A 4JB8A 3REOA 3S1AA 1Z83A 4JLMA 4YAWA 2YW9A 2OGSA 1KHTA 4ZPXA 2YHIA 1KXJA 3CWQA 2GD1O 1F51E 2ZS8A 4P4SA 5JNSA 1DELA 2FSVA 1II0A 1S8NA 5DGHA 3LG2A 1CIPA 3MIIA 4TROA 5EXEA 4AWXA 4OX9Y 1XTJA 5IUJC 1WQ3A 2H9YA 4ZREA 3K9HA 5JS8A 3PUZA 4I9FA 5JAIA 2ZXEA 5JZ9A 4IVPA 2LP4Y 2WZCA 4BY9E 2ZRNA 1AKEA 1DIGA 4W99A 1IY2A 3WG9A 2C83A 1L5RA 1K98A 3IEMA 3OZVA 3K5PA 1VP9A 1PL8A 5EJ7A 5EHXA 1ZD5A 2G0NA 2O2JA 2UVPB 4A10A 4IQ8A 4XTRA 1AF7A 3Q4GA 5J2TF 4RACA 2IL1A 3O4RA 3H9EO 2VRNA 4UTRA 4KWHA 1QC5A 5EPUA 4B40A 1IOZA 4EI8A 4UMVA 5L51A 4KR6A 2KM1A 4C30A 5JYDA 2CLHB 4AROA 3NEPX 1QH8B 3MB5A 16PKA 1HSZA 1DDIA 1ZN8A 2MSCB 1QONA 2Q9AA 2VDQB 3JWIA 1U7DA 3M5WA 3ZCXA 1Q0LA 1XDZA 2O0KA 2H1RA 2RE8A 4DDUA 1MOPA 3DNPA 3G9TA 3H11B 1FDOA 3OTWA 5C7LO 3BB1A 5I4IA 3TCNA 3AERB 4OK5A 5JMPA 5BURA 4A16A 5INTA 2QU8A 1DVRA 3GMSA 3SYLA 4TKLA 4QFDA 1GADO 3MGCA 4L57A 4RDXA 2VPZA 1JJVA 1NW7A 1W35A 1JMKC 5KNBD 5TPZA 4CTNA 1Q16A 1QHXA 3NGLA 4PN7A 3GBVA 4HDKA 4YJHB 2W6MA 2VLIA 1CB7A 3NATA 4ROTA 2WNSA 5EZQA 1MOQA 4P5DA 4BNTA 4AZ3A 4MX8A 3B9RA 5FTKA 1YUMA 4YLEA 3KQPA 4C3UA 4EUFA 3EFBA 2UXCB 2ZWIA 1SKBA 3AG6A 4L5AA 1U0JA 3AHCA 1SVNA 3GUUA 5DBHX 2OD9A 3NHWA 1Q83A 2D7JA 1M2VA 3HUDA 4D2IA 4R9NA 2QUJA 2PX4A 2J9XB 3ZDFA 4BO2A 2C96A 1MHPA 4EKYA 1U6KA 1X3SA 3BFVA 3AR8A 3GEBA 1EXMA 1I2MA 4L15A 2Y1KA 1W5SA 2FFQA 3CT4A 3E2PA 3EEOA 1DC3A 4DCCA 4AKSA 3O9MA 4GR9A 1G64A 4MV7A 3M4NA 1R6VA 3G6KA 3E23A 1T35A 4NECA 5EXTA 5IJWA 3OHPA 1H9CA 1AQUA 4M1OA 4DAOA 5CMLA 4ZKDA 5HQ3B 1Z6YA 2OWDA 4K86A 3I2JA 4NBTA 2XB4A 2QX8A 1H8HD 3DH0A 1BTOA 1W4ZA 5D84A 1Z38A 1V1RA 3LBAA 4GOXA 4O25A 1TVKB 3P0IA 1HC7A 1XJQA 4MGEA 4PNPA 3U39A 1OTHA 3DAHA 4OG2A 3H84A 1XQVA 2OD2A 4Q4AA 2PRJA 4I1OA 2YJ4A 1J2YA 1DEOA 4FZRA 1PJZA 3I1FA 3BZBA 1YASA 2Z5LA 3VR3A 1YB2A 2BI4A 1CRPA 4Q05A 3AKDA 3LC1O 5IN5A 4OQZA 3TKYA 1E62A 3C98A 4OKSA 5JAHA 1R0KA 4OVKA 4Q3LA 2B9EA 3SGLA 4J0JA 1AOXA 3B52X 2N3ZA 1QNLA 2QQEA 3GV0A 4XM1A 4XUDA 3V46A 4G5OA 1WTCA 2HF2A 5K4GA 4OXKA 5K3DA 2ZE6A 1L1EA 4IIBA 3JQRA 4K9PA 4QATA 3U44A 4Y0NA 2DSNA 2P67A 2Q2WA 3GCWA 4L6AA 3WMRA 3AHDA 5KPJA 5DJ5A 2ZJAA 3EN0A 3ACCA 3K6KA 3KZKA 4L22A 4RHFA 2JHFA 2VRBA 2BDEA 4WXYB 2ISSD 4KE8A 3SJCA 2QEQA 1L4KA 3VNBA 4OHOA 4PYRA 3KDPA 3ZW8A 3U4DA 2FPLA 4F6RB 4MQBA 1JR3D 4W5HA 1J2RA 1D2HA 4HAVA 1Q7BA 5J40A 1L9KA 4QGGA 4U2FA 1G41A 2NIPA 2QP3A 3O5AA 4Y9UA 2OBXA 3FUWA 3IUMA 4HMPA 5EZYB 5TJHA 1NI4A 3W7BA 1T0HB 1WUYA 4QYXA 2E1PA 1PJLA 2B36A 4H6WA 1CY6A 1P9WA 3FR8A 4FYHA 3TRIA 4R1QA 5CEJA 1E1MA 4QAJA 2GPSA 1M1YB 1PJQA 4HZGA 1NQXA 4I4TA 3RVMA 1P39A 3GAAA 4QA9A 4J3FA 2D62A 3OCXA 4P7JA 3ET5A 1GDDA 1U6IA 4DSOA 3FOEC 5LWHA 2VFAA 3P4YA 4DF3A 4D9FA 4CF3A 3PEYA 1IG0A 3DVAA 3EXHC 3QJYA 2OQRA 5CTJA 1EM8B 5KVQA 1MQ8B 3W4KA 2WMYA 1OYVA 4NG4A 5L4NA 3A70A 2LTAA 4J1NA 4AKTA 3GFTA 2QUKA 2WWIA 1GAWA 4AF7A 3I9KA 4PO3X 2NU7B 4BIMA 5AI8A 5JARA 4IO0A 2P0EA 1PSDA 4LWQA 4ABTA 2C7RA 5FOVA 3FVVA 3VJLA 3OLYA 5JFTA 2JRLA 3C3XA 2ID7A 3EIXA 5IULC 2W2MA 4H3HB 5LNK6 4HEA1 5IXYA 1N0VC 1LFAA 1BFUA 1IK4A 2BFBA 3LCUA 1CLEA 5LR6A 2ECFA 1U6JA 2IWRA 2AMFA 2HNAA 3UUWA 1M1XB 1ZGCA 2IVFA 4ZYWA 4U7DA 2ACWA 3NYWA 1E94E 3TNJA 4F7WA 1NNEA 4KWIA 2WWHA 3OX3A 2W00A 4HXYA 1AQ6A 4CDMA 3KQNA 5K3SA 3AKZA 1U0EA 4OO3A 3LQKA 4B0OA 2XEXA 3CLRD 4S0ZA 4Y9RA 4YQYA 3TZCA 2J3JA 3TZHA 3DLIA 1EVIA 2XCQA 4LXXA 2HDWA 3HPRA 4EAAA 1KRXA 4IF6A 4QQ8A 1Y34E 1DADA 1GCIA 1N5DA 5IUKC 3SC2A 1JDZA 2YASA 4WFKA 3DF9A 2JCVA 1OTYA 2HA0A 1G17A 4N5IX 5CA0B 3G2NA 3LS2A 3LPLA 2YTZA 3PNLA 2IYRA 2WHQA 3I6BA 3CZ9A 4GLOA 1ZI9A 3H11A 1E98A 1YZTA 1DC4A 1IL0A 3DE6X 1NF2A 4A2QA 3O2JA 5IDYA 1YB4A 3A2KA 1ULHA 2ZT7A 4O08A 3JQ8A 1VRVA 1AGXA 4NNOA 2O7SA 4UTOA 1U8ZA 1F8FA 1H0KA 2XBLA 4LJKA 3TX2A 4DLSA 3RIMA 3F7NA 4UXHA 1T10A 1YL6A 2GQ0A 4WH0A 1ZNWA 4M0EA 1NJ6A 1JP7A 2OUKA 3IBCA 1L1QA 4HG2A 2PZ8A 3HJFA 1WETA 5EC8A 1Z16A 2CF5A 1RRPA 2B1GA 2J32A 3IV9A 2ISQA 1R74A 4KK3A 4XUCA 5DYGA 1K7EB 5L3QA 4RPKA 5LZ7A 3U1BA 4R54A 4MSUA 1JEAA 4FHFA 3THWA 1K86A 2OFWA 3ZWYA 4JEMA 4NMWA 4TMVA 1XD9A 1YNOA 2LDBA 4N7BA 3I62A 1F17A 1CHDA 3C8UA 4KFTA 2C59A 4B4DA 4C7VA 4F9EA 2AE2A 3JZFA 4GD3Q 1AK9A 5G40A 5AH0A 4YV2A 4LF5B 1B76A 1BW9B 4LHXA 3PIRA 3VDMA 1QCDA 1IZ0A 2F8SA 1QC5B 4MRPA 4BBPA 4HH4A 4YS6A 3TZKA 5B55A 4NICA 3USES 4LXTA 4CI0B 2PL1A 2OL4A 4MPJA 4I4LA 1NI3A 2KYRA 2Q2OA 4NAHA 4RA9B 5L40A 1OOEA 1U7OA 2VXCA 3W3AH 1W8IA 3KSAC 2XX3A 1Z88A 4PGGA 1V16B 5EQDA 1R0BA 1BDBA 2NZYA 1JYFA 3JALA 1ZITA 2HT1A 1PR0A 5ESWA 2C1ZA 2CEKA 2OXFA 2VG8A 3KWFA 4V3CA 2EBWA 2WAYA 3BGDA 3CLTD 2RHGB 1XFAA 4L5JA 4B4VA 4B48A 1DXYA 3OEHD 3DZIA 4HF7A 4RIIA 4X84A 3S40A 5FLXA 2AR9A 2QN1A 1BA2A 2WHPA 5DBFA 3AYZB 1U8AA 2ILVA 3GD5A 3AJAA 3KJNA 4M89A 3VHXA 2I2CA 3WP1B 3ZJ5A 1ENYA 2IPXA 5GM2A 3G8AA 1RYEA 3E2IA 4BQEA 5A2QA 1QYXA 2VT7A 3GR6A 5K09A 4YP9A 4IHAA 4MCHA 4DCPA 5C4IA 5KWJA 2CBZA 4Q7MB 3WHKA 4RC9A 1MJNA 3TRJA 1Z25A 5LB4A 3HYRA 1G0NA 1EFHA 1NTRA 1PNVA 1VXOA 4HX9A 4I8XA 3P9XA 1T8YA 3T9FA 4PZYA 4GF5A 3IDZA 4NBNA 3BICA 4X45A 2R6JA 1OU0A 2NQTA 3K30A 4MAFA 3S8EA 1GHTA 3KYDA 3UJBA 3PLAE 1W52X 2V0NA 4Z9BA 4HBZA 1E3IA 2J30A 1X2EA 1WP4A 2I3GA 2JIRA 2NO0A 3H2ZA 4RE5A 3OJOA 4UZEA 2B6NA 2XTNA 2GSWA 2ZUSA 4OFXA 5IZ4A 4MPRA 2IZOA 2X2OA 3Q9LA 5L3ZA 4S3MA 3R2JA 3T12A 4B3HA 5DGDA 3IVCA 1U3FA 3DE7X 1FMLA 4OMCA 1I24A 2FGKA 4XD2A 1DUVG 1G8PA 1H2RS 2H5JA 2PJDA 3CEJA 2VJDA 3M6WA 3NANA 5JD3A 5HS4A 5ALWA 3L6OO 2C42A 4BO7A 1YO6A 3RRMA 1AMUA 3BOSA 3QTBA 2WINI 3JWHA 4TTQA 2PD6A 4XA8A 2ZSAA 4ZVQA 4OQQA 3UAGA 3ZC3A 4J4HA 4ZHQB 1W36B 1GEGA 2PRIA 3IBSA 3IEIA 4NOLA 5EKXA 3U7QA 3IILA 3QU5A 5IDVA 4D82A 3M4ZA 2EJUA 1WIWA 2HNBA 3D0KA 1MB3A 4FKBA 1P4HA 1AK2A 4JHXA 3DV0A 4V0NA 1IY1A 3E1SA 3GLGB 2JG3A 1M2FA 5CXSA 3KUUA 1AE1A 1TIPA 2RH4A 3VZCA 2IU3A 2YRXA 1Z7BA 5GQSA 2IU0A 4QLAA 3GMTA 4M87A 3GLRA 5FWYA 4HH3C 4DLAA 2A6PA 1OASA 1VHQA 1CQIB 2PEYA 2VSYA 3K4QA 1I3LA 4N47A 1CR1A 2AJTA 3CJRA 4Q12A 1XZJA 5AK6A 3O73A 4MCAA 5C7IO 3UMMA 3NHJA 4OHKA 2FDXA 2VLBA 4QU8A 4C20A 4BFCA 2UXDB 2W2KB 3UKJA 1JZTA 2CEAA 4QPPA 2C00A 4AI6A 1XK7A 4BV8A 1LZKA 3G79A 3TLCA 2H1SA 3ZU2A 3HA2A 3LCVB 3TBFA 1E1RA 2FPKA 3PEUA 4P0TA 3B20A 4MUBA 3S3TA 4H7DA 1U0TA 2P6NA 1BRMA 1M5UA 3GWZA 4FFPA 2AQIA 4KW7A 2NOAA 3I9FA 2WWTA 3FMGA 4K05A 2A5GA 4GFDA 1GY8A 1XN1A 4GX1A 2QQFA 4D8XA 1M0WA 4YRCA 5AK0A 3VUEA 4V0SA 3VH1A 1G21B 3EZFA 2KQUA 3NETA 1F2TA 2UYHA 2FSUA 5IP5A 1JIUA 2Z58A 3D8UA 4MKGA 1CJTC 1HFWA 3BSFA 3X44A 1QH9A 4AICA 1BAPA 4IWNA 4YVFA 3VC1A 1FOEB 5JRJA 2FE4A 4QARA 5FYDA 1O7JA 3KZNA 1J5PA 2HXYA 5A6SB 5DXFA 2C07A 2H9IA 3MYRA 4EY6A 2XQFA 2G9UA 1QKKA 1PF7E 2BGRA 2YFQA 4DCOA 3D3QA 2JHPA 1K3FA 2MMGA 1TAGA 4QFBA 3RUAA 4KR2A 1ZONA 4EY8A 2GDZA 5EMNA 1NBMA 4UE6A 2B8TA 1MMFB 1O57A 1XP5A 2QL6A 3AM5A 4Q6WA 3P5BA 4KOEC 2QLJA 3RF6A 5AM1A 1NWHA 1R50A 2C5AA 2H7XA 3F98A 4C4AA 2HSZA 3H65A 4KE7A 3K9QO 4WLFA 2CV2A 1F5SA 3GJ5A 2ZYAA 3DNMA 3NVMB 4UHKA 3GCGA 1QZXA 4YYZA 4MUJA 3QFHA 5BVGB 3BMXA 1DQPA 2I29A 4QXAA 4R1UA 4R8LA 3K1TA 4D79A 4EWLA 4AN4A 3CGWA 5CK4A 1C1YA 3SAJA 4ASUA 3AF0A 4UDOA 3EVBA 1TUBB 4XKJA 2PT6A 1ZM9A 3O8DA 1SM4A 3C0KA 5IM4A 3DD1A 5AW0A 3M4JA 2AJDA 2WHYA 5AI6A 5CB4F 4B82A 1R6AA 5COQA 4MRVA 4QLOA 3FPBA 2Q4TA 3SU8A 1YK0A 3A1EA 3E5MA 3V55A 2G5CA 3EX7C 3VX4A 2O06A 5G0WA 3ZHCA 2AI1A 1QE5A 2C20A 3LUBA 1SCQA 2REQA 2XIQA 4AX4A 2YFYA 1XA4A 5DBGA 2VYFA 4QTZA 2BFFB 2VDOB 1LFDB 3JYHA 5K0ZA 4ZT7A 2O20A 2PS0A 4B81A 4CKEB 1DPGA 1GV0A 4S12A 2WU1A 1PFVA 2CGEA 2DOKA 2EF0A 3NIBA 4IDBA 1ETUA 2I3ZA 5B1SA 4DV1B 3NHMA 4EEZA 2KW5A 2X76A 5A3SA 3H5NA 3ZJ4A 5KVSA 1FMJA 5EJEA 1R00A 4HEHA 3D3NA 3CUTA 1X6VA 3VV2A 2IYQA 4NDAA 3QM1A 1K6JA 3GRKA 1ZH6A 9ATCA 5JVDF 1EHYA 2P6PA 4G67A 3ACBA 3AUTA 2JGMA 4N7RA 4ARAA 4RTQA 2WAAA 2NYVA 1ZL0A 1PWXA 1R88A 1UCFA 1Y1TA 2XNKA 3FDFA 4XJXA 5DTIA 3DXZA 1RW4A 1N0HA 1UEXC 2JFUA 2VJOA 2ZU6A 3IQDB 3AT1A 3KK0A 3PE6A 4ZAXA 1YS9A 3HADA 3KB1A 3JD0A 1BH6A 1SUWA 3AF2A 3CW8X 2PCJA 5BQFA 1FSGA 5GM1A 3V7NA 1RQLA 1OAAA 3DEJA 2OFFA 1JPJA 4LYFA 1P7WA 1TO1E 4I9UA 2X1MA 2BFCB 3IVRA 4RUKA 2FPUA 4V24A 2ZQZA 1XA0A 3QPWA 4XUEA 1J7KA 3A26A 4KO8A 3MMNA 3AXSA 5K0JA 2H06A 3U6KA 1AD2A 2JKYA 2IXGA 4KUEA 3T99A 3ZHSA 5KTKA 3C4JA 4ZAVA 3F8TA 4DA8A 5JDCA 3QU9A 3IXQA 5IJ0B 3A27A 3TSYA 1KZGB 2NUBA 4XSGA 2QLTA 1GO2A 1OH6A 2FP3A 4XX1A 5J58A 1W4CA 4ZCLA 4JC5A 2QBYB 3ZDQA 2XMCA 4FB4A 1Y5NA 3ASZA 3QKWA 4RVOA 4X5OA 1KNQA 5BRNA 3ROGA 3WGKA 2IE0A 4ZEOA 2HHAA 1YTLA 1FYWA 3BF8A 1U0OC 4EZBA 4DV0B 1KI2A 1RI2A 2B20A 1K66A 3QBJA 4RGBA 2XA2A 2GRUA 2XVAA 1YVEI 3B85A 3MMPA 4LIPD 2VRCD 4Q9AA 4S35A 2NPFA 1XTTA 5LYJB 4HH1A 2VL7A 3ENVA 4HNTA 1LX6A 2VHQA 4HYQA 2Q29A 4A36A 4KO3S 1Q1EA 3U4GA 4IVRA 2JANA 1M9NA 4OBEA 3QYFA 4E1BA 5F7JA 3S4YA 1EINA 1I6MA 2EZ8A 3D4PA 1L7EA 1EVYA 2P5UA 2Q2VA 3MMZA 4HOYA 3E1KA 3EMKA 2D1FA 1D7OA 2ZYRA 3AK4A 4W7HA 1JFLA 4H15A 2JVIA 5IBQA 2IWHA 5E0KB 3VH4A 1Y5MA 2YIMA 1YJAA 5F98A 3WS7A 3ICWA 3A04A 1D2RA 4ZEXA 1B8PA 1OB2A 4YMVA 2ZWAA 5LZ4A 4BO3A 1P9OA 3H5IA 2VK4A 1U9IC 5FXMA 4P9NA 3W5BA 1U3CA 1YVRA 4JWKA 4OBWA 2PVSA 1Y4SA 3HVJA 3QLVC 4XYGA 5B1YA 2AFHB 5HZKA 1XJ0A 5I7WA 4CGZA 4E4TA 1X1AA 3B1JA 1CPYA 3EC7A 5JE8A 3RVLA 2G28A 4D0LB 2NT4A 1I01A 3COPA 2QQ5A 3HVKA 3KPWA 5HSGA 1CDZA 1PDOA 4JXKA 4RGQA 5AHKA 1NZFA 1TZ2A 2WM9B 5IAGA 1EBUA 3PUVA 4GGMX 1L8XA 4F4JA 4HUTA 4MO2A 3AYXB 5FLYA 3J7AC 4RLQA 2HU8A 1UBTS 3IJPA 4IXWA 5E1OA 3SIRA 1WU7A 4OQEA 1QIHA 2X58A 4AM8A 4REOA 5AVYA 3N0TA 1V5IA 4R2HA 1W85B 3A4LA 3Q7QA 2F8MA 4LOAA 5DU2A 3IP3A 3RGGA 1V47A 1PFKA 1FFXA 1SQ5A 3LHIA 3SSMA 1X7ZB 3BWYA 1V3UA 4WUVA 2CL6X 1C1XA 1CQJA 1PKEA 4HNHA 4MWOA 4ZDWA 2BN4A 4AZ3B 1HYGA 4D8UA 4F45A 2DAPA 1SXJB 4FFVA 3HJBA 4FOLA 4DILA 4PW0A 4YCDA 1IJEA 5HEKA 4BMPB 2DKNA 1T4GA 6REQA 2QROA 3TMKA 3SF0A 2FOIA 3JYLA 3AKYA 3G7SA 4MQEA 1O08A 1E1DA 2H7CA 2A5LA 5BW5A 3VH3A 4KODA 3WI7A 5BY2A 2QT9A 4Y2GA 1QKIA 2V6BA 3D3WB 3HZRA 4GPTA 3WGLA 1QK4A 1OGYA 2OUIA 4Q7EA 3OZUA 4KQGA 2M6KA 4BKUA 1A5ZA 3EEBA 5GVSA 5E3IA 5BVGA 3A8TA 3D8BA 4KEAA 4YT4A 1VECA 2ES4A 3A2NA 3NDPA 1KKUA 1QRDA 3KR9A 1UBEA 1E3TA 1LUAA 2V1XA 4KQJA 3WSTA 1Z0UA 1H4VB 5C31A 4JOBA 5BSUA 3VOSA 4PICA 1ZGGA 5EWLB 2Y1OA 3TR6A 2WF6A 3LLMA 3OQJA 1JHQA 4EB8A 4WXRA 2X2PA 5C8YF 5JMOA 3C2QA 3EF0A 3ZTWA 1LS1A 1R4MA 3FUVA 1MH1A 2HA5A 3OLVA 5FH9A 2POQX 3D4LA 3L0PA 4OATA 1P75A 4QBIA 4DOMA 2Q5OA 4UTVA 4G4SO 5FEUA 2GHQA 4JV5B 4W63A 1A7AA 1LNZA 2OCPA 3D7SA 1FX0B 2DTXA 4TOIA 3HB5X 4ZXPA 4MGYR 4WOCA 2O2XA 4BDTA 3KL4A 1ZSYA 1ISSA 4I55B 3QXSA 5FTWA 4JFRA 3DBRA 5EMLA 3A3KA 1XTVA 3OU7A 1Q14A 4Q3AA 4WDQA 4P5PA 1VIVA 3OJFA 4JVMA 4L08A 5AP9A 3UAOA 1URPA 3ZGLA 3PNMA 4R8VA 2G07A 4AB1A 1O2DA 1GN8A 1NVTA 2HQBA 2OT3B 2YXNA 2I8LA 2ZK7A 2ZJ0A 3B78A 4HXFB 4KGVA 1ZAKA 4OHPA 1XDGA 4X44A 4ARUA 1WDKA 3SQWA 2GO1A 2ORYA 1FTYA 2W0MA 4L9AA 2EWWA 4R2XA 1A2BA 3WAGA 1OWPA 1AV6A 5C8YA 3H5VA 2WNIA 3SIPA 5IDXA 2I3BA 3ZQ4A 1V5EA 2WIJA 2LNDA 1SOMA 3UPTA 2CUNA 3BK1A 5FAKA 1HK7A 3ESAA 3WKDA 5ALFA 4G09A 4RETA 3OT5A 2ZIXA 3M4XA 1PGNA 1A9PA 5BSMA 4G1VA 1GJRA 3FF1A 2IU4A 1SIWA 3BXEA 2P9QA 1MW9X 3B5JA 4KXNA 4CMJA 4X7MA 3A6JA 1Y6QA 4MVJI 4EG7A 1N92A 4P93A 2P4QA 5AHRA 1TFUA 3VAYA 2H54A 1R5OA 1DO2A 2Q5CA 1A9SA 3I4LA 5C35A 1UFQA 1ADYA 5CVDA 5IS2A 2I54A 1DV1A 1S1CA 3UHAA 2IQ5A 2J41A 3EZYA 3GBPA 4OP2A 1T0PA 4R7GA 3HN7A 4PG6A 3O0TA 4FMCF 2A9RA 4EGJA 4QBKA 4AXBA 1KMHA 1KY3A 2ZWMA 4TM8A 1O94A 4EQZA 2O8EA 4TVKA 3ADOA 3SPXA 1PL7A 5FBWB 3SYTA 4HZUA 1RRGA 3AR4A 4KQKA 3N28A 2PGIA 1LXCA 2PH7A 1T3HA 2PZKA 2ZAOA 2PSEA 1ACMA 3X1XA 3EXHB 5KKAA 3A6DA 4MQMA 3FNIA 2BE9A 1ZCFA 1QYVA 3PFBA 3VR2D 3AVTA 1O0CA 2PT7A 5D2CA 3I9JA 5JY1A 2G77B 1QVRA 4RLHA 1K0UA 1BWRA 1XWWA 2GBCA 2Y6UA 3DZBA 4ZC1A 1Z0FA 1KEPA 3IT0A 4A6DA 3MJFA 4O3MA 2IEIA 4HH0A 2B4QA 5CU7A 4IHJB 4RA9A 4DVJA 1JDBC 1KSJA 1WQ1R 4FGUA 1PWHA 4H7IA 3O95A 3C3WA 3NHSA 4Q34A 3VR5A 3LOQA 1CR4A 1AMNA 4KO1S 3NCHA 1VE3A 1MAUA 2CLFB 4PNHA 3HZZA 5K3FA 4KIGA 2JIOA 1JPVA 1SIUA 2HDHA 3H7AA 3JQEA 1EFVB 3LHKA 4FMCB 4F8YA 2Z1DA 1PZMA 1D2CA 1UJMA 1QHNA 2ERCA 3G89A 3GIDA 3LZ6A 3ZXYA 4X66B 5IZCA 4G9EA 3NZEA 4B3GA 2XYPA 5TC4A 4EA8A 3L8HA 5EQJB 5TR9A 4ZVTA 4C1BA 1EFAA 3F5SA 3BJRA 1SBZA 1CCWA 3K8ZA 4AJOA 3PLRA 1NVVQ 1Q20A 2FEWB 4CIAA 1UK8A 5JNRA 4UDXX 1E7QA 1RWWA 4WKBA 3UK2A 5C5CA 3AGPA 4P35A 4TKMA 4DUGA 5FL7D 2PLWA 3HVHA 5FTMA 2JIBA 2WVHA 3GLHE 1JT2A 4W8HA 3EF3A 3DE5X 4B85A 5K3EA 2DUWA 1ULSA 4E4RA 2AZXA 1C1XB 1AZWA 1FP2A 3N6XA 4PCAA 1T8RA 2BFDA 2GJKA 3LT1A 4HRXA 4RFSB 2NW6A 3EVFA 2HIGA 3AHEA 3NW9A 3SLKA 1C0LA 1GNQA 3EDOA 2QSYA 1Q0SA 3L5KA 4RGVA 3WLHA 2Q1XA 3OQ6A 3QVKA 2F1KA 3RTGA 5A03A 3LQQA 1Y8RB 1O0SA 1ML3A 4JLUA 4R84A 1I6KA 1NUPA 1IN5A 4INZA 2GZRA 2ZEJA 1FYFA 1VL2A 1EFPA 1G2OA 3E0XA 3L07A 5DTMA 4BE7B 3EVNA 1WRBA 3PC8C 4G4IA 1CDOA 1KC1A 3D6FA 2CJPA 2JIZA 5CG2A 1EUDA 5JNVA 4M46A 3QVWA 2FPPA 4MMYB 1QH1B 2Q5QA 4C43A 3IEXA 4PGMA 1VLQA 3DKKA 2GVNA 2CHVA 2QRQA 3LKZA 3OOJA 3GH1A 2OEPA 1PV2A 4UU0A 4RIFA 1V1JA 5FA6A 5IASA 4J1QA 4JI8B 2C61A 4MLDA 2A59A 2WT8A 1UM8A 1V0JA 2BCJQ 4A2CA 4CLHA 1ORTA 1VL5A 2VK2A 3JALB 3VKVA 4D41A 5C80A 2Q6KA 4PIVA 3VPFA 4BLRA 3RUDA 5LKAA 4MVWA 3VVMA 1AZLA 2A9VA 3JYNA 4O2BA 4X94A 4Z4HA 2IPNA 4URXR 1XCMA 4KN5A 1TF5A 3JASB 2FOLA 4QVGA 3T5AA 1FSFA 1U9IA 5CH5A 3W3AD 4RMJA 5SYMA 2VPIA 4DR6B 4EUNA 3A6KA 4JR2A 1O6ZA 1Z4JA 3VHXB 1JG3A 5U4QA 1KYVA 3IVMA 3EXIA 4K2AA 4ZOAA 1QJ4A 4RGYA 4OHCA 3M3DA 3HWWA 4OHXA 2JLXA 5A3QA 1GZDA 9LDTA 3WICA 2Q27A 4RESA 4OQPA 1J8DA 2OO5A 1IVSA 1C14A 4FYJA 4L73A 4LZJA 3VR5D 1JQBA 1TKRA 1GNVA 3EASA 3P9QA 2XAUA 4JC4A 4MKZA 1L1FA 1JJFA 3WMGA 5E7IA 3NM4A 4ZCPA 2HMSA 3I6YA 3BH7A 5DSTA 2EKZA 4BQPA 3G2JA 5DO9A 4C89A 2GMWA 4ZOQI 1FZQA 3VSEA 1LDNA 1FLVA 3JR3A 3L4SO 3ANYB 5M29A 1AIPA 3A6ZA 4CKZA 4ZICA 4IWXA 4GRAA 1TO2E 1F0KA 4NF2A 2TMYA 1SU4A 4WQMA 2XHZA 4ZWNA 2OD7A 3W4JA 4P8RA 3ZE1B 5A7GA 4WRRA 4ML3A 2PGDA 1E18A 3JQBA 1L4YA 4X7RA 4LCJA 4OQDA 2IUEA 1EAYA 5F2KA 4D92A 4LZWA 3D2AA 3QX3A 2PSDA 4WD3A 1BKDR 5ERXA 1S0UA 3P2KA 4C9BA 2C4MA 3G85A 1QDLB 3FJYA 3TIGA 4L8YA 4E08A 4Q47A 1JHYA 5JHHB 2OK7A 3T54A 4KR0A 4K6MA 2B4YA 1VMEA 3I2HA 4KN8A 2FZVA 3F49S 5KCMA 1ZVMA 2ZT6A 4BQNA 1P0CA 2CK3D 2J9GA 3FFXA 4I50B 1CUSA 4INPA 1U0FA 2GM5A 3EQ6A 3ZI0A 1Q0TA 5A3JA 1OTXA 1UEJA 5LP6C 1N8NA 1KOFA 1XN4A 3UYKA 3O2NA 4B6SA 3T3NA 4Z2AA 2QY9A 4TM7A 3SXJA 4KHPB 3OESA 2GNAA 3WWEA 1AN0A 4WESB 2E82A 4I5IA 3H1GA 2XRMA 4MPPA 3BFKA 3C3MA 4Y1RB 1AHPA 1VLVA 3DULA 5K6TA 4X60A 1TO6A 2O5CA 3BREA 2YR0A 3HCDA 1Z39A 4CLDA 1SUCA 2NTVA 3GLQA 3IH5A 3R8CA 4BX8A 2W2PA 4FYMA 2GZ3A 5F2EA 4K7JA 1FCJA 2FEAA 2BFEB 3RS5A 3RYCB 4NK5A 4TXLA 5K4AA 2HJRA 2I62A 2IX3A 2Y9MB 4H9GA 3R6WA 1IM5A 2RC6A 1H3EA 1KVQA 2BWJA 2Q7OE 3DM5A 4DM4A 1PV4A 2WVAA 4G65A 4F04A 4XGKA 4JP5A 3EVGA 4E15A 1T3LA 1D2NA 4DQXA 3I04A 1ZG3A 2VBFA 5E95A 5SY4A 5JY6A 3E9DA 3A14A 1WVMA 4FFLA 2WM8A 1DPFA 4MEAA 5LMZA 1XNGA 2QRVA 1NBIA 1OD6A 4IIDA 3U4CA 4B47A 5BSFA 5C0OE 5AUPB 1L7BA 4I5FA 4Q18A 5FBZA 5I3ZA 5ALQA 4FQ5A 3SR0A 3SC3A 2VTBB 2PRZA 4I7EA 5LQRA 2YWRA 5FBHA 1MUUA 1P4AA 1P19A 1UP7A 4LDNA 5LDHA 3QUSA 3E3LA 5B64A 2DPMA 3CO0S 3KFLA 1EX1A 1PS0A 1X7XA 3AFHA 1ULBA 1VRCA 2DH6A 1TUIA 3WBFA 3F7TA 1YONA 1DLIA 2XBUA 3I04M 3MD9A 3WK9A 3HUEA 4HV4A 2UYQA 3DXYA 4GQBA 5E6UA 4L4SA 5ALKA 3TUIC 5MHTA 2ZB7A 3N2YA 1ISRA 3Q1KA 1DQSA 4H4EA 4XLZA 4EG0A 1E0DA 4EHKA 4DCSA 1P4SA 5GIPE 1XL0A 3PYLA 3ZLBA 2Q21A 3T52A 2CJWB 2AYZA 2EEZA 1KEVA 2EP7A 1DHRA 2OO7A 3CIOA 1JX6A 3KEFA 1FRQA 3R3HA 4IDCA 1CWUA 2QM8A 2BBOA 2VP9A 3C15C 3EEFA 5IN4A 5CA1B 4DA9A 3D7MA 1YJBA 5IYZF 2DTEA 2I65A 3AUSA 3CRZA 1S6YA 1KHHA 1E4EB 4FGZA 2K4MA 3F6SA 2CFIA 2FWBA 2RKWA 3CPHA 3QLUC 3BGOS 3NGXA 4BX9A 1O5TA 3FDXA 4BYGA 3O4GA 3OOYA 2VUHB 5DXAA 4ANFA 4BN4A 4EELA 4XQ0A 1ZIPA 1KQ3A 3EBPA 3K4HA 4EMSA 4ZO4A 1QHEA 2XA9A 2DU8A 3F3SA 3N0WA 1XZGA 4TYPA 5AKXA 5FI1B 3ZLTA 4C0XA 2WJVA 2W8ZA 3ONEA 4Z0PA 4M9RA 3ZY3A 3JV7A 1FY2A 2OGWA 5IMBA 1FPMA 2HJGA 2X9NA 3P45A 2JJ8A 1X1CA 4B84A 1QZZA 2HGSA 4DSNA 1K8ZB 4BJ3A 1MF7A 2PKEA 2JFZA 3GPBA 3ZDYB 4BVAA 4CM8B 1CSEE 2D2VA 2HZ7A 2ATVA 2GCNA 4KP7A 4I0WB 2G76A 3K09A 2V7QD 4H16A 4EBFA 1N5JA 1Z4KA 4I5GA 3TUJC 4BQRA 3KALA 4CHGA 4XOIA 2ZYTX 3SKXA 4RHXA 1MOZA 1GZSA 1ZOSA 2M6RA 4PYKA 3ZYZA 4MRMB 1O95D 3D6MA 1D5WA 4MI9A 3L8ZA 1NVWQ 1OV6A 4YMGA 1HKUA 4PO9A 3OF5A 1DMRA 2ID8A 4QYIB 1JG1A 1ISFA