1V39A

Dc26 mutant of vaccinia virus protein vp39 in complex with s-adenosylhomocysteine and m7g(5')pppg
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
297
structure length
291
Chain Sequence
MDVVSLDKPFMYFEEIDNELDYEPESANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specific protein recognition of an mRNA cap through its alkylated base.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Methyltransferase
molecule keywords VP39
total genus 103
structure length 291
sequence length 297
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 1996-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1v39A00
3C3PA 3FZGA 3KQPA 1UIRA 3R0QA 2GPYA 4X63A 4R8SA 3ANXA 1O54A 3T7RA 2IFTA 4DF3A 1JSXA 3LSTA 2PBFA 4O29A 5HIIA 2FK7A 3ME5A 2O05A 2H1RA 4HGYA 5JR3A 4ISCA 1TPYA 2BM9A 3G8AA 5E2BA 4QDKA 5EKXA 5CD1A 4RVDA 5KQRA 3S68A 4V0RA 2JHPA 4QVKA 5EOVA 1MJFA 4PYIA 1L9KA 3OCJA 1KR5A 5EZQA 1QANA 3EMBA 5DLYA 4DA4A 3SGLA 1IY9A 4GOMD 1RI4A 1WXWA 2PWYA 5FHRA 4RWZA 2K4MA 5LQRA 1F38A 1JR4A 3OU6A 4E2ZA 5E9QA 2ZCJA 1Q0SA 2BR5A 5GM1A 5GP1A 4KIGA 5EVJA 4E31A 4PYJA 2C7PA 3R24A 4ER0A 4YUWA 4IWNA 1VP3A 3I64A 5LQAA 3GWZA 2FHPA 1N7IA 4PYLA 2ZULA 3EGVA 3KPVA 2NXJA 2YXLA 4GEKA 3WSTA 1X1AA 3A26A 3SX0A 4YUZA 3FTCA 2ONYA 5ICCA 1D2GA 5GIOE 3O7WA 3FPFA 3M6WA 3MCZA 5GWXA 1NKVA 5K8VA 3EGIA 3G2OA 2H00A 3UFBA 3PX3A 1P1BA 2AOUB 3M4XA 1XJ5A 4BP1A 1EJ6A 3GRVA 2PLWA 3PFGA 2HNKA 4R05A 3FUXA 4HH4A 5DRYA 1L1EA 5K0EA 1DUSA 4E70A 4E2XA 4FSXA 1INLA 4EMSA 4R6XA 3Q87B 5CVDA 7MHTA 4KDCA 1RJEA 2AVDA 2CWWA 4PYKA 3I53A 3MQ2A 2VDVE 5E1DA 1RI5A 3CVOA 3GNLA 3O4FA 5DX0A 3TQSA 1R74A 1Z3CA 4PGGA 1P39A 3HM2A 2PXCA 5HZMA 2R6ZA 2PGXA 3VYWA 4E33A 5IH3A 4MWZA 3R3HA 3OZRA 1H1DA 5K01A 3HCDA 3H2BA 1I4WA 1XDZA 5ERGB 3A7DA 3P9KA 5EMLA 5HOQA 3BT7A 3G5LA 2AOWA 3P8ZA 2ZWVA 4CKCA 3O31A 4DM3A 2XYVA 3TPZA 3AWIA 5C1IA 1RJGA 2B3TA 4Y30A 5EG5A 5DM0A 2ZIEA 5DSTA 5ICGA 2IH2A 2AR0A 4DQ0A 1I1NA 3GDHA 4EKGA 1NV8A 1EIZA 2P3QA 4YV2A 2BR3A 3EVGA 3EVFA 5GOZA 5E8RA 1ZQ9A 1ZHFA 3HVKA 5K0GA 1NW8A 3MCTA 5KS2A 2OYRA 4RTKA 5LQUA 3OFJA 3SMQA 3IEIA 4AX8A 2NNWB 3RODA 2P40A 2GB4A 2ZBQA 4RVFA 4RTSA 5KVAA 3K6RA 2PXXA 2GA9A 3TKYA 4OX9Y 2AOTB 3MGGA 1NW7A 2VDWA 5EC8A 1KPGA 5K0NA 5C0OE 4GBED 3NWBA 4C07A 5HIMA 2UYHA 3DMFA 4IKPA 2O57A 2EJTA 1R6AA 3EVCA 3BKWA 3UJ8A 4RTOA 2AOXA 3A25A 2B2CA 2JH8A 1BC5A 1JQ3A 5DXAA 5EIWA 4BLUA 5LQJA 4B17A 3P2KA 2IBTA 4OQEA 3JWGA 4PWYA 3GO4A 3IV6A 4PYQA 4UOEA 3LCUA 4ZTBA 3BGDA 4EQZA 2BZGA 3HCEA 1SQGA 3PLAE 2ERCA 5D1HA 3EVAA 3ID6C 1VE3A 3DTNA 3KQTA 3LDFA 2WK1A 3PVCA 4RVHA 3NTVA 4X60A 3E23A 4CTJA 1SVUA 2G70A 4POOA 1P1CA 4U7PB 2ZSUA 3AJDA 3MTIA 4LECA 4DZRA 2HWKA 3OE5A 3C6KA 4FZVA 2WA1A 3SR4A 3A4TA 1R18A 3LDGA 1PRYA 2YTZA 4X41A 5DX1A 3LKDA 4E32A 2IH5A 1YB2A 4HSGA 2YXDA 2QY6A 5CUQA 4YMGA 5FWAA 3FPEA 3FTEA 1HNNA 1I9GA 2UYOA 3FPGA 3FUTA 3EVEA 2QE6A 3C6MA 3ELYA 2OXTA 1YFJA 4FSDA 1XTPA 3KHKA 1NV9A 2P7IA 3HCCA 2NP7A 1JTFA 3MAGA 3FUUA 3CJTA 1NT2A 3HNRA 4HTFB 5K0LA 5ICEA 4KVZA 1EQAA 2Q41A 3LHDA 4XUCA 5FQOA 1XCLA 5HEKA 5CCBA 5GM2A 1NE2A 1SUSA 2BM8A 5HIKA 2YVLA 2I6GA 2YXEA 3P9NA 2AN3A 4GF5A 3TKAA 4ER6A 1ZKDA 3UJCA 1FP2A 5CCXA 1KYZA 1QAQA 4KDRA 5ICFA 2ZW9A 2PX2A 3R9XB 2IBSA 2EFJA 4KWCA 3KR2A 4RTJA 3NVKI 1WXXA 3QOXA 3GU3A 4GQBA 5DT2A 4FP9A 3UBTA 1F3LA 2OY0A 3KKZA 4K6MA 2P3LA 3P9CA 5K0BA 3HP7A 2QRVB 2JHAA 2AVNA 4U7TB 3LKZA 3UZUA 3UA3A 3BZBA 5EGSA 1M0EA 4MHTA 3P2EA 2GH1A 2XYRA 2UYCA 3TOSA 4E30A 3DXXA 2EJUA 5E1BA 3LPMA 2I7CA 3G8BA 3I58A 1JG1A 2BR4A 3OE4A 1ORHA 3KR0A 4YMHA 2C7QA 5EQJB 3DOUA 2ZTHA 1O9GA 3I5UA 4WVLA 3KPUA 9MHTA 4KIFA 2F8LA 3RW9A 1EJ0A 3EPPA 2P35A 4FT2A 3E8SA 5DTRA 3E05A 2FCAA 5KYGA 4G56A 4E2WA 2WA2A 4QTTB 2GAFA 1XCJA 1QZZA 3AXTA 3JWHA 4DCGA 3OZTA 4V0QA 4BLWA 2JH9A 4FS8A 4M36A 1KPIA 3SSMA 3KPYA 3MB5A 5CVEA 2IDKA 2PT6A 2PSSA 2GS9A 3FUVA 5DTMA 5DSXA 2Y1WA 5LQNA 3BUSA 3UA4A 3TRKA 3THSA 3DUWA 3PFHA 1SQFA 5H02A 4LWOA 2Z6AA 1N2XA 5G02A 8MHTA 2N47A 3FRHA 1ZGAA 3B3GA 5DM2A 3T7TA 1AQJA 3UJ7A 3G2PA 4P7FA 3MTEA 4E2YA 4PYOA 5FTWA 3V8VA 3BXOA 4OBWA 5FUBA 4BP3A 3GJYA 3EVZA 5DWQA 3RIEA 4M37A 3OU2A 2KW5A 1UWVA 5EMMA 3HA7A 4RTLA 3BWMA 1YUBA 3LGAA 4C4AA 2QM3A 2FYTA 2Y1XA 4RTNA 1T43A 2VDUE 4XUEA 4QDJA 4A6EA 2AS0A 5P8WA 3B89A 1O9HA 1SG9A 3UWPA 1EAMA 5GIPE 4RVGA 2LD4A 4RTQA 2NXEA 3FYCA 2R3SA 4NECA 3DLCA 4OA8A 1JG3A 1VBFA 1NW3A 3BWCA 3KQMA 5E9WA 4C06A 3ER9A 1MHTA 3PS9A 5EZSA 3LCVB 4C08A 5CVVA 2OO3A 3UJDA 4OBXA 3EEOA 3TM5A 3IHTA 4BY9E 1Q0TA 2V7EA 3IYLW 4PONA 3TLJA 3MHTA 5CVUA 4KW7A 5LQCA 3ERCA 4RTMA 5FADA 1IXKA 1VP9A 1R8YA 4L7VA 2G72A 3A27A 3KQSA 3ER8A 2O07A 3BKXA 4HTFA 3U81A 2P7HA 4PYMA 3GIWA 3B7PA 5LQKA 1TW3A 1ZG3A 2FRXA 2IPXA 3C0KA 3LECA 2XYQA 3GCZA 4ER5A 2DULA 3QOWA 4R8RA 3HCFA 2I62A 3FYDA 1M6EX 4QQKA 5E1OA 2O0LA 3CGGA 2NXNA 3KQWA 3KU1A 4RX1A 5DM1A 3FUWA 3BWBA 1YZ3A 5DPMA 4MQ4A 5CM2Z 5EEGA 4F84A 3R6TA 3PX2A 3FTFA 2AZTA 4BLVA 2ZFUA 4QPNA 4PYNA 5EKUA 1DCTA 1N7JA 3ELUA 3P9IA 3KPJA 5EHIA 3HTXA 5JUWA 4LG1A 2OZVA 1XVAA 2P3OA 4KRGA 2IGTA 4AZTA 3PTAA 1NW6A 1KP9A 5T64A 1RJDA 1Y8CA 5EHGA 4CTKA 1RI3A 4MIKA 1B42A 4IV8A 2VZ9A 5GINE 1P91A 4RTPA 1JQEA 5IKMA 1D2CA 3ELWA 3GRYA 2IIPA 4R6WA 3TFWA 2ZIFA 4DMGA 2A14A 3UJAA 3DXZA 2IP2A 2AOTA 3HCBA 2AN4A 3K0BA 1G8SA 4RV9A 5E9JA 4OQDA 5E2AA 2PKWA 2ZWAA 3BGIA 5EMJA 1KYWA 2ESRA 4M38A 5F2NA 1X1CA 2OPBA 2YX1A 4Y2HA 5C9ZA 2ZZNA 4RSRA 3GXOA 3G2QA 4CWAA 3T0IA 5K0JA 1XDUA 3VC2A 1ORIA 2P1DA 3P2IA 3EVBA 3HA3A 3NDIA 5FCDA 3UJBA 2OB1A 2AN5A 1FPQA 2AOUA 3CBGA 3GRUA 3HEMA 4FT4A 2ZZMA 4QQNA 3FTDA 1QAMA 3B3FA 2ZBPA 3OFKA 3SM3A 4F85A 3NJRA 1WG8A 3OZSA 3DH0A 4IV0A 5LR6A 3JWJA 1X1DA 3DXYA 2VP3A 3L8DA 5FQNA 5FWDA 4EK9A 4HG2A 2ZLBA 3DULA 4DKJA 1DL5A 3M6UA 5E8JA 4GC5A 1KXZA 3KQOA 1VPTA 5FHQA 2GLUA 5M5BA 5B1SA 2C7RA 4AZSA 4YV1A 5F2KA 1WZNA 4C05A 4YUVA 4CXMA 4DCMA 3C3YA 2OKCA 4PCLA 3OPNA 5LSAA 3KR1A 4PIMA 2PXAA 3SSNA 1G8AA 4QPPA 2ORED 4P7GA 5BP7A 5DXJA 4XCXA 2NXCA 4PGHA 4ER7A 2UYQA 4GUAA 3B3JA 3GGDA 2G71A 5K0FA 1NBIA 4FR0A 3HVHA 4PNEA 2IH4A 4HRAA 3TMAA 3LBYA 3PB3A 2Z6UA 4CKEA 5MHTA 3DR5A 2HMYB 1RI1A 5EPEA 1KHHA 2E5WA 2JJQA 3D2LA 3MERA 3THRA 1X19A 1YZHA 3AXSA 1IM8A 3GRRA 3OU7A 1AF7A 1HMYA 2ONZA 5CVJA 2OBFA 1UFKA 3G89A 3CJRA 4RTRA 2G1PA 1VIDA 3NWEA 2YQZA 5HILA 2HR1A 2ZZKA 1RI2A 1VQ1A 3LX6A 1JG2A 2ZBRA 1XDSA 2PV0A 4GOOD 5FULA 1QYRA 5EMKA 3KQVA 1FJXA 4EVIA 1JG4A 2B78A 3EMDA 1FBNA 1X1BA 2FPOA 4HGZA 4QTUB 5T67A 2PT9A 1NW5A 5DX8A 3FRIA 1BHJA 3V97A 4YUYA 1R8XA 1U2ZA 5KQSA 2AOVA 1R00A 2DPMA 3G2MA 3P71T 5FA8A 2ZIGA 1QAOA 4GOND 2Z6QA 1EG2A 3T7SA 4A6DA 2I9KA 4MTLA 1G38A 3DMGA 2FK8A 3Q7EA 5EEHA 4AUKA 1YF3A 3M70A 3ORHA 2PWPA 1FP1D 2UZ4A 2CKDA 2XVMA 2B9EA 5FA5A 3TR6A 1PJZA 5BW4A 1SKMA 1G55A 1WY7A 4X1OA 5T6BA 3VC1A 2PX8A 5K05A 3DMHA 1L3CA 3EGEA 3SVZA 1AQIA 4JXJA 4GC9A 5HFJA 4OA5A 3EVDA 4C03A 5EIFA 1YFLA 2G8NA 2QRVA 5U4XA 3FPJA 3BWYA 2YR0A 3NDJA 3PT9A 2CMGA 4AZWA 3SSOA 4QVGA 3JWIA 2XBMA 1V39A 4FGZA 3NMUF 1G6Q1 3M6XA 3SXJA 3HVJA 1M6YA 2PY6A 1BOOA 2ZVJA 4ATNA 5BW5A 4EKIA 5K03A 4X61A 3KR9A 3G7UA 3M6VA 4WXHA 1KPHA 1OR8A 3I9FA 1JSZA 3CJQA 2B25A 2H11A 2EG5A 1ZGJA 2PX4A 3HVIA 5DM4A 2O06A 2P8JA 4PINA 3P97A 4Z2YA 3KQQA 3X0DA 3CCFA 3GRZA 5K0CA 1XXLA 3UJ6A 3CC8A 4CKBA 2XVAA 3NW9A 1JQDA 4PIPA 2IDJA 3AY0A 4AZVA 2NYUA 2JG3A 3DLIA 3KPWA 3LL7A 4PCAA 1D2HA 1RJFA 1AV6A 4P7JA 1NBHA 4LWPA 2ADMA 2OB2A 4RYLA 3LBFA 3F4KA 5D1NA 3TM4A 3B5IA 3BGVA 2JHCA 2QYOA 1L3BA 3EEYA 3ELDA 3UJ9A 2V74B 2PX5A 4ER3A 4YV0A 3LDUA 10MHA 4P58A 3QV2A 3E7PA 2EX4A 1BKYA 1JTEA 2PVCA 5DRTA 3REOA 5E1MA 4M7RA 2C7OA 1WS6A 1SUIA 3NVMB 5K09A 1L3IA 2YUIA 4GOLD 3CKKA 2CMHA 3DP7A 5DTQA 5CIYA 5HIJA 3G88A 1G60A 1TW2A 3HCAA 4XUDA 2HV9A 4H0NA 3A7EA 2VS1A 4P7KA 2NP6A 4C04A 3VSEA 4HC4A 3G5TA 5F2OA 2PJDA 2P41A 5BXYA 3HA5A 1KIAA 4YUXA 2CL5A 3LCCA 1VLMA 2HTEA 3FPHA 3KQYA 4F86A 1VL5A 2BH2A 3M33A
chains in the Genus database with same CATH superfamily
2WU0A 1FLAA 1XD9A 4HX2A 2RHHA 1Z8NA 2J6IA 1V95A 3S27A 4ROSA 3GZNA 4FPXA 5IMBA 3Q1KA 4Q7JB 3GT3A 3KKPA 4LMPA 4CV0A 4NNJA 5BSRA 4W82A 4H1TA 1ZISA 5JR3A 3L7AA 1NAIA 3FKJA 3PEYA 1E5QA 2PH1A 2O3SA 3CZMA 1YE3A 1LRLA 5COQA 3TRHA 1KYYA 4L57A 1AQ6A 1O6ZA 3ANNA 3S1AB 3L0CA 1M2HA 1MAHA 1WHTB 4EEXA 1FSSA 4D41A 5DLYA 5KVQA 2CV1A 3T52A 1QV6A 4EARA 5KSWB 2WFMA 5ADHA 3VC7A 4HNAB 1T5HX 3VU8A 6REQA 3CURA 1HBJA 3CTPA 4RK4A 4TXNA 3K15A 3LLMA 4K6GA 5ALIA 4X62B 1C7QA 1FOEB 4RPLA 2VTVA 4U39A 2PRYA 3PUVA 4GG1A 2H0QA 4KBFA 2E7ZA 4E03A 2YJ5A 1ZNXA 3C8UA 5JO0A 3CVXA 3HABA 3N75A 5CG1A 1C7EA 1GG8A 1XZQA 3AV3A 2DSTA 3CO5A 5GVRA 4GMGA 3MLAA 3WLHA 2B34A 2HDWA 4PSAA 3AZQA 4M21A 1UBSB 3GL9A 3H1PA 2WT8A 2O2HA 1VYHA 3B1YA 3M6WA 2MOKA 2PO5A 1BCRA 1CEQA 4ZT5A 4DEXA 2Z04A 2VPXA 3DE6X 4PVDA 4CUZA 2R8EA 4FTWA 3WB1A 5ICSA 5TXGA 4LIPD 2GTPA 3K1YA 1A8UA 4WXPA 5JNWA 3MOIA 3TSOA 4WJKB 3QIVA 1JQ5A 2J48A 1XTSA 1T9KA 4UEJA 1T26A 3DBHB 5FI0B 2CWWA 3U60B 4DR7B 1FUUA 3KV3O 1DEKA 4BNTA 1T0BA 4LXUA 1KI1A 2B7BA 1J5XA 1IONA 2G09A 2CLCX 3TQSA 3GAMA 4EO4A 2PXCA 4H35A 4P3PA 4KGXA 1KZYC 2FSPA 5A7GA 5FTLA 3MUNA 4BMDA 1GUAA 2VKTA 5UKDA 3FB4A 3ORSA 4GMDA 4BE4A 4JLVA 5CFPA 3JYLA 2Z9CA 2QY9A 3TLBA 1MHPA 1LC3A 4GSLA 4RHXA 1KO4A 1NU8A 4DCNA 3LRTA 4Z53A 1ZI9A 4R2XA 3N2LA 3C1TA 3QHPA 1XQYA 3TEJA 3ZYZA 3RBZA 3LK6A 4R1OA 1J22A 3IHLA 3O31A 1RC0A 2KS6A 1SKQA 3BIXA 4YAEA 3HSSA 1PV1A 2MINB 1EZZA 1VCIA 1IEQA 1HUQA 1PNVA 2FPUA 3HJAA 3DAGA 1H3FA 3EH1A 4PY2A 4FQ7A 4N3CA 5CYPA 1QLJA 4CCYB 3RIYA 2UZIR 2WD8A 1B16A 2PQ6A 1PN3A 2AK3A 1N6KA 1C3OA 1XKTA 2GA9A 4HAYA 4CF3A 3P2OA 2RJNA 4BL5A 5C8DA 3VOSA 4WLNA 4IHKA 5D7NA 1IJFA 3SMVA 1NC1A 1IOZA 4FI3C 2PYZA 4TQAA 5LP1A 2BLLA 5IYZF 2P6MA 4P54A 3DAHA 1LY1A 1ZWLA 2EEZA 3BAZA 2X86A 4MVCA 1JG6A 3DV0B 4X1YA 3TCXB 3WMEA 1E2UA 1DKNA 1TGVA 3CF0A 2VHUA 4K8OA 4XPIA 3W5DA 4ZT2A 4YCLA 1R4NA 3URMA 1T2CA 1JGTA 4XRRA 3W04A 4BMYA 5BURA 1TTTA 4LOLA 3W4JA 1C81A 2DWUA 3ZVNA 3F9CA 4EP1A 1Y3DE 4MV4A 4L8VA 4Q9JA 1G0NA 1WEHA 4GECA 4HEA1 2F2TA 5CDFE 2I7VA 2DPXA 1L5LA 4TWAA 1U3GA 3WIDA 4H1UA 4X60A 2WUFA 1CJVC 4PNEA 1HURA 5L4LA 1KETA 1UBJS 1ECLA 1VKZA 2YY7A 4XQ9A 2E4WA 3K32A 4OB6A 1WKCA 4HDRB 5DX1A 3CLUC 1G8JA 1DEHA 1EJBA 2G83A 3PJFA 3WRYA 4ZVLA 3MRTA 1YB2A 2WF5A 2GYUA 4QXOA 3HJTA 4NABA 3L9WA 3DOEA 3AC0A 1VJTA 1YRLA 2L69A 2QROA 2VSFA 2ZI4A 1I7NA 1MVLA 3ELYA 2OXTA 1GNSA 4I4CA 2GYWA 2FE1A 1VG8A 3KHKA 2Y1KA 2GF2A 4JKOA 4EA8A 1PK9A 5D3QA 3F6PA 1RWKA 3OQMA 2RC6A 3SR0A 4L0CA 4FSHA 4MQBA 1IBSA 4QICA 2ZJZA 2B0CA 4QU0A 3IUBA 3LHIA 2O9JA 5IBQA 3FNRA 4YT5A 4Y9TA 4J9UE 2N1MA 4ZKDA 5CA1A 2IS6A 4M1ZA 1PZEA 4JT9A 4OKSA 3FWHA 1UZLA 1ZM7A 1QFXA 2AN3A 2RGXA 5CXQA 5LWQA 4N7JA 3U3XA 1Y8QB 3KBOA 1RHKA 1SVOA 4K0RA 4Y1FA 5IAJA 3WLTA 621PA 2OK8A 1KWKA 5HZGA 1RQRA 2ATXA 1ABEA 2ZWPA 3A1CA 1V5IA 2KPOA 4PQFA 2IW1A 4CIAA 3VI4B 3REQA 4H0FA 1YB1A 2FW9A 3OSUA 1UJ2A 1GZ3A 2Q50A 3WAKA 5B12A 1D5CA 2UYCA 2GEBA 4PNPA 4E30A 3G85A 5E1BA 4AX4A 4BE9A 1IBMB 2ZTUA 1WPXA 2A78A 4KJZA 4DEYA 3VR5D 2ZI6A 3FZYA 4RMGA 4B75A 5HW0A 1M67A 2HQBA 4AKHA 1V7QA 3P9QA 2WU8A 2GDJA 2W4QA 2ZTHA 1VHLA 3DMYA 5AJWA 4H18A 3UQYS 3CF4A 1TD9A 4MUXA 3LPLA 4JBWA 721PA 3Q3VA 4I19A 1M83A 1ZS9A 2RHTA 2X8JB 2GZ1A 4MWBA 3SJ7A 3WRXA 3ZCSA 2XCRB 2W6QA 4UPVA 1XCJA 1QZZA 2B8JA 2R8RA 3IIIA 4FLFA 4Z9FA 3OIYA 2PXHA 5I9IA 1QFZA 3V4VB 2ZJ7A 1VECA 2JAOA 3A04A 1Q1NA 3C14C 2IDMA 2C5GA 2Y6VA 4B46A 1Z4NA 5P21A 4B7ZA 4LN1A 3WNCA 2IU0A 1OLSB 1A1SA 4NATA 4DZZA 4G0UA 4FKZA 4TX1A 5K3FA 1KU0A 1SD1A 2GBPA 5KTSA 1TEZA 4IHJB 1UR5A 3FRHA 5DW3A 4GBMA 1NX6A 3ZR4B 4FMDB 2CF5A 2G4LA 4NYIQ 1TA4A 1YQXA 2ACVA 1LEHA 4IH9A 1WVIA 3W8RA 3ZHOA 2IE8A 1TKAA 5FUBA 2JAWA 4WBNA 5EJ7A 2XX3A 3T7KA 3SIXA 1UWVA 5EMMA 1GUBA 2FRDA 5KJEA 2PT7A 1UOEA 3BMCB 4RM3A 1EHIA 3BF8A 3EGXA 1MC8A 1Z4KA 3HDTA 3BN3A 3NAZA 3K6SA 1ORDA 5JC1A 1FS4A 1R16A 3BMXA 4JJ4A 4HQLA 2VNJA 1AHPA 3CRRA 4DSTA 3T3OA 1UMCA 2G9ZA 1NONA 1D0VA 3QP9A 5CVVA 1E5TA 3V9PA 3IRUA 1O8CA 2UVQA 3RIGA 3GQVA 4AJOA 4DMFA 2HMAA 3Q0EA 4O4HF 2J46A 3TLJA 1TFRA 4Q00A 2EP7A 2I6SA 4DHWA 3PRHA 1YJAA 3AFNA 1XZNA 2DF8A 2WTNA 1HYHA 1KZ7B 5DASA 3V80A 4B6QA 3A1NA 2VJPA 2VQ3A 1GOTA 4D8UA 1KAMA 3VYVA 3SBOA 5LMZA 3BKXA 1UIMA 2JL1A 1N2JA 2P7HA 1K7FB 1TW3A 5B4VA 5KB3A 1O6GA 2IPXA 3DHVA 4Y2VA 4REQA 4E4RA 4DRZA 1WWKA 3UMVA 2Y0DA 4UOZA 4QBTA 5LFAA 3DLHA 2CB9A 2COEA 1T4CA 3BHJA 3B1VA 4CKWA 4LE2A 3KP1A 2NZJA 1DDGA 1JN0A 1FVXA 1V0JA 1XLTC 2QTGA 2BKVA 2QTBA 3AERA 4EELA 3QHQA 1JHUA 1FEZA 1GV0A 1GUZA 5BWNA 3V4FA 1LBSA 2ZFUA 1U9CA 4V38A 3UGQA 3ULKA 4BUCA 3GJ6A 3P9IA 3QWAA 2BEWA 2ZG6A 2ZSFA 3VH3A 2R5NA 2PSEA 3JS5A 1RKBA 3L6RA 3W2EA 4QG3A 3KYCB 1NW6A 4RZIA 2P30A 1RJDA 4DY6A 1XPUA 1FZTA 1K9SA 2PCLA 3FYHA 1G59A 4ALIA 2Y76A 1D2CA 2IC5A 3NX4A 5B2FA 2NVOA 2ZS7A 2GK6A 2IP2A 1E7SA 2J8ZA 2WJPA 1GKIA 3U17A 5HUJA 3V1UA 3NHMA 3E0QA 4D02A 4XJXA 2CT8A 3MM4A 3FHJA 1GITA 3I9V6 3M6IA 4DJAA 2FI1A 1QHNA 1E2IA 3ZQUA 2YN2A 2B8EA 3I73A 4JMLA 1DX4A 4Z5XA 4FQ5A 2GAJA 9LDTA 1T36B 1PNTA 2GN0A 1YQQA 1E3IA 4QU5A 4E1VA 2NAPA 1Z3IX 1B8PA 1LPNA 2C5EA 3BXHA 3QF4B 1YO6A 3ORFA 3KXLA 4OUDA 3AX6A 3CBGA 3LA6A 1BMFA 1M66A 3BTSA 2H2DA 4V0KA 1TYEB 4QQNA 3E48A 1QO9A 2PLNA 3DFZA 1GPH1 5BVHB 3D3NA 2O3TA 3HY4A 3IOCA 3OZSA 1KVQA 1U4SA 2AJ8A 1GN9A 4HXFB 4RJJA 3W3AH 4BB9A 1X1DA 3E2PA 5B36A 4ZYYA 4GKJB 2JAXA 2ZLBA 3JQBC 4D9BA 3OM0A 1W8IA 4LV5B 3KVRA 4EYGA 5JDIC 1JE1A 3B6KA 2HYIC 1KOJA 4P33A 4HLNA 1XZLA 4DSUA 1R9MA 3KUDA 4BFSA 1ICIA 2HRZA 3KZCA 5AHRA 4X7PA 1MVNA 3L06A 4NWIA 4KBGA 3WK6A 4UVEA 3EZ7A 4IS3A 5CIQA 1U2RA 1SBNE 3TCKA 4UUMA 3LPNA 5KAMA 3WNVA 1Y89A 4CL0A 3FVQA 1WQ1R 2I3ZA 1TRKA 2G71A 1IB0A 3U7HB 3CMCO 4BO6A 4M0DA 4HRAA 1NN0A 4HO1X 1YI8A 1GRVA 3QKIA 1TIKA 4N6OA 3J7AC 2IOYA 4XGNA 5AJHA 4QHYA 5JFOA 2D5CA 3JD4A 3PDJA 1H0RA 2ERXA 3EG5A 4FHDA 3TVDA 5C1BA 3O74A 4BLPA 2XE8A 4YAFA 3J81k 1P1KA 5LU8A 5FA6A 4DM4A 2UU9B 1CY0A 4FHCA 4LWQA 4TVSA 2JFFA 5J3JA 1U6JA 4RK1A 2OE2A 5COAA 4DA8A 3KB2A 1QHFA 1A96A 2TS1A 2I1LA 2ZBRA 4K0KB 1BW9B 1QYRA 4PW0A 4G0PA 3KQVA 3RTGA 4LOAA 3H9QA 1JJBA 4BEBA 4TUYB 4WDQA 2AUNA 1N2CE 1SGWA 1P0QA 2HWWA 1E3TA 1ML4A 2QORA 1NW5A 4LISA 5B3JC 4JFAA 1SWWA 5KQSA 1XEXB 5HUQA 1J8QA 1R00A 2FPPB 3NFYA 3WGYA 3OQOA 3LU1A 3GGJA 5JWHA 1S2LA 4FDLA 4HQFA 4ZYZA 2WOJA 1YDMA 3NTOA 2CCKA 1DKOA 4N7MA 3WIOA 1EDZA 4YLEA 2BMJA 2FOLA 1JI3A 1UQTA 5EJ5A 1W34A 4ZDWA 1B6RA 1KBOA 4O8ZA 3CKMA 1WY7A 4HY3A 3X1JA 4A2QA 3OH8A 2HSGA 1I94B 4XIGS 4CIBA 1AHHA 3IALA 1XV5A 4M8KA 3TRJA 2X7HA 3U3ZA 3F3YA 1H1LB 1TJYA 1V1RB 2HLPA 4BS9A 4HDAA 3JRNA 1Z6ZA 2HC9A 3MJCA 1ECPA 2D1YA 3KKNA 1L7RA 1EH5A 2FGKA 3EG9B 4W5WA 4I2VA 1LLQA 1UJ5A 1Y8QA 2RSLA 3SJAA 3WBKA 3UPDA 1XFAA 1O96B 5IZCA 5T8KC 3KR9A 3PHBE 4G6ZA 3TIXB 5CDSA 3GCWA 5AW9A 4TS4A 4K9RA 2XCOA 5HIAA 2A0FA 3A3YA 4Z4HA 4JL5A 2ID4A 3UJ6A 3QEAZ 5DHPA 1DMSA 3A70A 4ZPXA 1EK1A 1CZRA 4PNHA 1E5DA 1S4MA 1Y80A 2XRFA 3AUTA 3HUFA 4QGAA 4CGYA 4DV6B 1UPFA 3TM4A 2X6QA 1H69A 2XWQA 3W0LB 1VE7A 4I36A 3TZCA 3BGVA 1H5UA 2C78A 2RAFA 1Z0DA 1K5GA 4QGGA 3WDSA 2RH5A 3K5PA 2ZB2A 1T8TA 1LWNA 4L76A 4V0MA 5CAEA 1NJ8A 1U2GC 4E22A 3ZY6A 4B45A 4M8LA 2PH7A 3BORA 5JAQA 2P2SA 3VH2A 2W8BA 4EG1A 4JV5B 1SU4A 5HIJA 5G0TA 5BN4A 8ATCA 5D86A 4G26A 3M5WA 1GTJ1 4GGOA 1FNDA 2PMBA 3HZOA 2OFXA 1NURA 1VA4A 4FU0A 1MRNA 1PG0A 3EXG2 1CX9B 1KDPA 4Z9YA 1SD2A 3FOBA 4R2KA 5FTNA 4B3IA 4BJ5A 2BH2A 4FFNA 4RAQA 1FA9A 4ES6A 2H4HA 4QJ4A 2EQAA 3EIWA 5D84A 4U5XA 1QYDA 3T7RA 3PFIA 1GZ6A 4ARZB 1ML3A 1SQ6A 3RAJA 4MITA 2PSFA 1J8YF 3WRYC 1USKA 4UCXA 1TJ3A 3ME5A 1RMQA 4D4JA 4DV4B 2IIQA 5FR2A 3K09C 5AW3A 5J1TB 4C21A 2O6HA 2O4CA 4H3VA 4EMUA 5JCPA 5K4HA 2H63A 1W36C 1JEYA 4DNOA 1DIAA 1IK6A 2GHIA 2Z8ZA 2NG1A 4PYIA 3EVTA 3N7UA 2H0RA 1JIVA 2DT5A 1GG9A 1EX7A 1M2FA 2RG1A 3SYKA 2PGOA 5AI4A 3ESBA 5KKAA 1WXWA 1CUJA 5DW0A 4Q3AA 4F91B 1NRWA 3CO0S 1KDTA 1JBQA 1XZFA 4ZVNA 2Q7DA 3D2BA 3PKZA 5F1KA 4CFYA 4XYEA 3T9FA 4DA6A 4F2WA 4ER0A 3EEQA 1O2DA 5DWVA 1A2QA 2MSWA 1KK0A 5EJ2A 5KOHB 5L3SA 1C30A 1NY6A 4K9MA 3C41J 1F7UA 1U3TA 2DQ4A 2GARA 3D5TA 5CB6A 3RS9A 1Q5PA 2FPWA 2OXFA 3WNQA 1RLUA 1TQDA 3LLCA 3LQFA 1J06A 4YRFA 3RC1A 2V7PA 3AUYA 5ICCA 3KU4A 3FPFA 1I2MA 2ZI9A 5C51B 4GUDA 4IRUB 3EXHA 4MUIA 3I04M 4UEKA 2BFFA 4GVXA 4ENRA 1PJRA 2QTHA 2RHOA 2AOUB 2YRXA 4R1QA 1G8KA 4I55B 3H0KA 5H81A 3OX1A 5KX5B 1UOQA 3PFGA 5B3JA 4U2FA 3HXMA 3QPVA 4JEHA 3SOZA 3FXAA 1AF4A 1YOVA 2PEYA 3KXKA 4IIDA 3BREA 4M4SA 3HRKA 2QUIA 5CVDA 3FOCA 3R5XA 1RJEA 4CR8A 1H94A 2YYAA 1ZN9A 2X2PA 1U0OC 3D1JA 2JIZA 3OEHD 3SP1A 1RI5A 1SIOA 5DX0A 3UMSA 4IYJA 1USGA 3EZFA 1UC5B 3SM9A 1ACMA 2ZYHA 4BVKA 4WLOA 3TLKA 3JQAB 5C3UA 3HWWA 4NV1A 4KHZA 1V1MA 3OZRA 4OQFA 3H1AA 3D4PA 4GM0A 4NEHB 5DN9A 5A9SA 2P5SA 1SHTX 1I4WA 4LSWA 4LPSA 1OFVA 2J3MA 4N0QA 3HU2A 1Z63A 1X9GA 1YU6A 1EGAA 3I2GA 3ZV4A 3T0FA 1S5PA 5LZ2A 5KSOA 3UJNA 1EVLA 2F7SA 2FR8A 4Y30A 4RDHA 5DSTA 2V58A 4DQ0A 1F0KA 2CW5A 2HXYA 2VJOA 3GCDA 1LD3A 3O8NA 4TYPA 2P3QA 2QZ4A 4OL9A 4UVHA 5K8JB 4MVJF 3HVKA 3UW1A 3NUZA 4MVXA 6Q21A 3FOWA 5ENVA 4D8TA 3CISA 3ZD7A 3T54A 3E9NA 3CNNA 3H11B 3OZFA 3BD8A 4CIDA 3K6RA 3RF7A 1TCCA 2NZUG 3MGAA 4W63A 1ZR2A 1HLPA 1Y3AA 2ZSBA 3K1AA 2AOTB 3W3ZB 4FN5A 1XAHA 1Z7GA 1Q57A 3FW1A 2AXPA 3LFTA 4OCZA 3JRWA 1E2KA 5BSHA 3GLHA 4URFA 1U7UA 4GBED 4XIFA 2C82A 3HBFA 4UBMA 2UYHA 2PUWA 2UZ1B 3HJUA 3HLKA 2RC5A 2GJKA 4G1EB 3W5JA 1QHHA 3JZDA 4LOIA 4FVTA 1GGEA 3V33A 1U7HA 3HG7A 1PTJC 1YRYE 4WGFA 1JFFA 1WW8A 1ABBA 1NWHA 2G9NA 5AFSA 5AVQA 1YTLA 1U3CA 3EJWA 4TSRA 1PNOA 4JGBA 4OQQA 4UEQA 2OAEA 3CWZA 2Q2QA 1ZUD1 3HB4X 4RK6A 1IQUA 3WLSA 3OPQA 2IEYA 2ZP1A 4AKEA 4PO1A 2O7NA 3HCEA 4FYMA 1BGVA 1Q2XA 1R6VA 3SZLA 3FWYA 1KBZA 3QXSA 1ZGGA 3R75A 2DAPA 3WIUA 1UJNA 2NU6B 1YI1A 2R8YA 5ANRB 5F78A 3TI9A 2PZLA 3WWZA 1CJMA 2EW8A 2SHKA 3ENQA 5B6JA 2ZT7A 3CBQA 4URWR 2R1TB 3GT0A 1ECJA 2OQIA 3D3KA 4JOSA 3CZAA 5AOBA 1FX0A 2OGZA 5DBOA 2WDZA 3IP8A 3RRYA 3K9GA 5DHSA 4X92A 4NENA 2AQHA 1DRJA 1ARZA 1YB4A 3A6FA 4ZI2A 4LJ8A 4EA9A 4TV9F 3DV2A 1MX5A 2UYOA 4ETIA 4CF4A 2HFKA 2X0IA 2QE6A 2Z2ZA 3FI0A 2XBUA 3H86A 4FSDA 1Q83A 4R41A 4TT3D 1XTPA 3IKVA 5GJCA 1NV9A 5GQSA 2Z98A 3WP0A 1JTFA 1Y4AE 4MS4B 2HXSA 3D54D 3DE7X 4YRQA 3UK1A 5H80A 2HJWA 2QP4A 1KIMA 3CRW1 3OJEA 1BE1A 5FOUA 1PL8A 2ARKA 4JQSA 3KFXA 1PLLA 1VIVA 3A9CA 3BE6A 5TVGA 5IN4A 3K2QA 2PA0A 2PS1A 3WYNA 2REQA 1F6DA 1B8NA 2XB6A 5AVWA 2MTBA 4KDRA 3AFIA 1FXSA 4ZEOA 3ZIAD 4TTQA 4O6VA 2FJ0A 4HDNB 3RSZA 2OV8A 5DLPA 2P9GA 1K4YA 5JZOA 1ID8A 2HQOA 3LXUX 1T9HA 1E2GA 2DBZA 2P3SA 1UFOA 4WEQA 3ONNA 3QI2A 5TQVA 5K0BA 1N33B 4X6YA 5AJYA 2QZZA 1ZMBA 1XTUA 1IZ8A 2IPNA 3HN6A 1K6MA 1CIJA 2IZ0A 2QV7A 4TKUB 2YIMA 4Y6LA 1VKHA 2ID9A 1WABA 3ZNOA 4LMBA 1AUVA 1MV5A 1N2CA 2GH1A 4O1IA 2L0XA 3FCOA 1JZQA 2QTNA 4LAFA 3RYHA 1XD8A 5K51A 2I7CA 3WYBA 4UCWA 1MV8A 3MWDB 4P2BA 4Q34A 3GQBA 2ZDHA 2V9CA 3AUAA 3KR0A 4D3XA 1V2HE 5FORA 1VIAA 2IEGA 3I6MA 3PP8A 3L92A 1I36A 1AE1A 1ISRA 2HUNA 5ALYA 5JCJA 1EM8A 2F3PA 4FT2A 2P35A 4GX5A 3STVA 1ZCAA 1SY7A 1VMIA 3G0CA 3LYAA 4I55F 4WCFB 3TQFA 2PUFA 1Z0AA 2C2GA 1GGFA 3D8HA 2C4HA 4X94A 2ZRAA 5ALSA 3IOMA 4P0TA 4NXMB 3CT6A 4GICA 4KFSA 2GMWA 1G1MA 3MJHA 3KE8A 1U02A 2AZMA 4NQZA 2OUKA 5J40A 2WU4A 1ZESA 2XT0A 3HC7A 3BUSA 1MIOB 5DSXA 4Q18A 3T5TA 4E6PA 1MT0A 2PO7A 2YCBA 2DHCA 2ZROA 1VKJA 1RBQA 3DB1A 1G6OA 3GN1A 2P6NA 1N2XA 3PFHA 4AT1A 1OH6A 4Q1EA 1NBWB 3GMSA 2VDKB 3G5AA 1CP3A 3TLEA 3ZE1B 4ALMA 4DLVA 1LJ8A 1UADA 3UUWA 4HNTA 4WRRA 1OYWA 1BDHA 3O9VA 4UMEA 3AESB 2HF8A 1QX3A 4ZVTA 3RVRA 2ZXEA 2IYLD 1M54A 1RWNA 4OAQA 5F1OA 5A0FA 2VFAA 2OBNA 2GZRA 2WTAA 2JLZA 4EY7A 3R0VA 4WECA 5HUHA 2WNSA 2X41A 2VHCA 4M37A 4RC9A 4QQ8A 5T6MA 1I4EB 3NPMA 4D9EA 1QHXA 3ROMA 3DTVB 3P32A 3CLUD 2YC2C 4RU1A 2Y1XA 3PGLA 3OOYA 2F1HA 4PCUA 4JQCA 3S29A 1QCZA 3KDPA 3LQ2A 4LJ9A 3W4IA 2EFDB 1A9SA 3LT4A 2NU7A 4RGYA 1OXMA 1R6UA 3IIKA 4WUVA 4RTQA 3B9BA 5EJ9A 9ATCA 3HBJA 1KO5A 4M83A 2X14A 1DTSA 1YNSA 5K8LA 4QYXA 4O4JB 1RXVA 1DDIA 4KAJA 2F3TA 3RUCA 4MWSA 1L4HA 3PS9A 3WGNA 3ZDFA 2EFHB 2YZNA 3UJDA 5L7TA 4BIIA 1CUHA 1ZUWA 2AXQA 5AK4A 5CNMA 1GTSA 2UZAA 3HDJA 3RASA 5IJWA 2R5WA 3ERCA 3TIIA 1CQXA 1X1SA 2OBYA 2NZYA 5ER9A 1MEOA 5E7JA 2ZRQA 3FNQA 4J3FA 2Q1SA 4V1CB 3LCRA 3ZZNA 2O52A 5K8UA 2FRXA 3GUUA 3K20A 2JGAA 3ZS9A 1Z2CA 3TIGA 1NASA 1XN1A 2Q4DA 3DEKA 3FYDA 3HCFA 1COWD 6NULA 4TZ0A 1CIPA 1P7YA 2R8XA 1TECE 2PZAA 1VLLA 2GPSA 2TRSB 4YGXB 3O0TA 1SXGA 1BS9A 2JVIA 2NMVA 1XA4A 1RZRD 4H7PA 1R9NA 1X80A 2REOA 4RJLA 1SXQA 4LJ4A 1XZIA 1TD1A 2V7VA 1NOKA 4L51A 4O0LA 3N8KA 1XRRA 2BY4A 4WKOA 4ASUD 4NF2A 5JUWA 4LG1A 3ZTYA 1A1VA 4Z99A 3HWSA 2V7XA 2YN0A 3VNBA 4TZTA 4Z9BA 1NP6A 2CEKA 5EHGA 4L1KA 4D8YA 1AKUA 4BKRA 5MGNA 4OHRA 1GDTA 1UBGA 2WMNB 4DQKA 3DSRA 2R2GA 4LNHA 3CKLA 3QYFA 4EYQA 5JEEA 1G8SA 1OILA 1XTVA 2OG2A 3E35A 2KWIA 5HM6A 3ZN2A 4MEJA 1WIWA 2BFBA 5FEMA 4C3VA 3P52A 2M1XA 4FFMA 5EUQB 4D9MA 1M1UA 5C9ZA 4YCSA 1Y98A 1B23P 3T0IA 4IXMA 2QL5A 5K0JA 4OEHA 1X15A 3ZHZA 1BQEA 5KOIA 1QZ3A 2KI5A 2WJZB 3QEMB 3UWPA 2W2KB 4C5AA 2QVCA 3D02A 2JA2A 4PZYA 3QEJA 1Y3HA 4DR3B 3CUUA 3AHFA 4TV8B 2ZUTA 5IJXA 2P8SA 4B32A 3OQIB 1NDHA 4KRXA 5EP2A 5AVZA 1THTA 2HCFA 1X3SA 8GPBA 2XNDD 4P9NA 2X8JA 1CZKA 3ZIUA 2RONA 2WJAA 3I61A 1Y6QA 2PD3A 2ZRFA 3QFHA 5B1SA 3TEMA 5AHKA 3VBEA 1C4WA 2GAIA 1JEJA 1P45A 2C3UA 1H5NA 1WZNA 4RMHA 3RF6A 1B8UA 3ADPA 1PJSA 4BUZA 3IR7A 2PCJA 4MQFA 4MYRA 3DWGA 1A2OA 1M5UA 3ZXXA 3FDIA 4W7IA 1D4OA 4JP8A 3VNQA 2Q07A 4PBTA 4EECA 4XD7A 4GUAA 3WKBA 4A16A 3TOXA 4EX7A 3R6DA 4HFJA 4QSMA 5SY6A 2GRUA 2HIAA 3AR4A 4YDRA 4OJMX 3SIPA 2Q21A 4DWVA 4K87A 1NQAO 3FLEA 4RH0A 3ZHRA 1NMZA 2G08A 1UBRS 2QI9F 1N3LA 4QLAA 5GGYA 4WSOA 4UTNA 1X19A 2FMKA 2JCSA 2R86A 1AF7A 2IF0A 2PTGA 3G89A 2O7SA 1YZUA 1AQLA 3MJEA 4RTRA 1F8YA 4CCSA 3T5CA 1EP9A 4DMMA 3LQYA 5BV0A 3K5WA 1R8JA 1VQ1A 4IIVA 3KJNA 4M99A 1Z5NA 5KNDD 4BXOA 3W90A 1J2UA 3CB2A 1Z07A 4MIOA 3WLIA 4U1RA 5CT6A 2DKOA 2QNIA 4QDZA 3WNZA 2J45A 2X4LA 5BYAA 3VUEA 4QTUB 4L28A 3FGOA 3PR1A 4RHEA 5DWDA 3BB4A 3ACBA 4QULA 3VVLA 3G0BA 4CQMA 3Q7EA 1EBBA 2LZ0A 2WT9A 3D7KA 3M70A 3AJEA 1RAEA 4X44A 3WKCA 3DWFA 4RELA 3OBBA 1SBHA 4G4SP 4JQZA 2A35A 2QHXA 3QFRA 1SKYB 3ZWNA 2VK1A 4X1OA 1KS2A 1V1JA 3HNOA 5EESA 3WS7A 1A95A 4QPDA 4YAUA 1NPTO 4LBWA 3NAQA 2BELA 4GPD1 4AMBA 3EUWA 3LNTA 4F2HA 1COZA 3DVAA 2G8NA 3U44A 1DAKA 2F43B 4NEGA 2WMYA 3AEUB 2QUJA 2CMGA 3CX6A 1RRKA 3GLIB 3L7OA 1BWQA 4ND8A 4KYTA 2XBMA 3NMUF 5AKJA 1GCGA 2GHQA 4A4DA 1M6YA 5BSFA 1TQ2A 1ZK2A 4EA7A 5BNZA 1HM5A 2GCGA 4FWTA 3QVWA 1I0ZA 4OFXA 2QLLA 4PM4A 3FHTA 2OFFA 2XI4A 3AETA 3K53A 4PPGA 2UXCB 1U0HC 3E9CA 1HDXA 1Z0UA 3JQCA 2QR5A 4ZT7A 3OE7D 1KZ1A 1PLKA 3I9OA 4RGQA 4TLCA 5J5CA 1P1IA 4I4NA 3WMWA 1GPKA 1Z7WA 4ZJUA 4EG3A 3FSGA 1C1XB 2G8LA 1J7JA 4D4HA 3DLBA 2O8BA 1XA3A 4JIMA 5LJIA 1N6RA 1X7HA 1VDMA 3EOZA 2I8LA 4GXRA 4DQVA 4TSFA 1G21E 5JQGA 2HJRA 5BN5A 2VR1A 3PC6A 1U2DA 2AG5A 1PO7A 4P58A 5DP1A 1QONA 2PVSA 4G37A 1CJTC 1ONSA 4HQKA 4EZEA 4ZN6A 1N8TA 3I05A 5CVCA 1Z6PA 2RAUA 2XMBA 2O0JA 3FDJA 1PVVA 2ATVA 1DC8A 3NVMB 3GLTA 2Z0MA 1Z17A 2BJVA 1PKEA 2HF7A 3AOEC 1OXUA 1GAWA 1S3IA 4YGYA 1EUDA 4A8TA 4FEYA 5IJ9B 2P41A 5I7VA 3LOPA 4LZLA 1QQ5A 3MCAA 4RM2A 1U2SA 5CNJA 3PQ3A 2R6CA 5FBLB 3AINA 3U4AA 3M33A 4FYKA 2FZWA 3ZD6A 1HDCA 3Q3IA 2X9NA 1IEXA 2CUKA 2O23A 3QOYA 5FNVB 5FUQA 4P81A 4R0VA 1H8ED 3H2SA 1O54A 1C0IA 2BMWA 1LI7A 2IFTA 3LSTA 3IUJA 2VC2B 2SECE 3CCCA 3NC1C 2ZRIA 2PQ2A 2PRSA 4BU0A 3FH0A 4WH0A 1LXCA 1L5HB 4QDKA 5CD1A 1Z56C 3AP1A 1Z73A 3DZHA 1MJFA 1Y9EA 1RACA 3M6LA 3NC4A 2JCXA 4XA8A 1OAAA 5K3OA 3S3TA 1KR5A 1QANA 2BZ0A 4Y1EA 5FBWB 1V4BA 4BZQA 4EM6A 3GPLA 1XRQA 2IIBA 3N3BC 4QGSA 5KYXA 1Z5VA 1WVGA 2GF9A 1XL0A 5FUYA 3FZQA 1ZXBA 2Q3FA 1U9YA 4N5MA 5D3MB 3CZRA 5GP1A 2VQSA 3BK1A 2ONJA 2FSUA 4W1PA 1PWZA 1U3VA 3I64A 4LXQA 1UDCA 3OCVA 1JJFA 3I2YX 2I2AA 4ZU1X 4AM8A 1WTCA 4BTVA 3NWPA 1CUDA 4B48A 1QKJA 2FUG6 3NQ41 4AUNA 3AEYA 1FXWA 1KORA 3JQ7B 1XC7A 3NU1A 3VR6A 2O2DA 4B3SB 3IAAA 1NR5A 4KQXA 4UDOA 2IBMA 2ONYA 1D2GA 4Q1AA 1CIVA 3B3AA 4AWBA 2BJHA 1DELA 4FZ5A 1GKUB 5CM8B 4NI5A 1BE8A 2PZMA 4K28A 1JR3A 3MIIA 2MT9A 2B69A 5T7BA 2A9PA 1ST3A 2R7AA 3BIWA 2ACKA 1K7SN 3ESQA 4PRYA 3SS9X 3GRVA 3VXKA 1DAPA 2J3IA 2PLWA 3C8HA 4G89A 4US0R 3BGOS 1UDXA 5DRYA 4HL6A 1Q1EA 1BNCA 4S2EA 3CVWA 3AF1A 4YJ2B 2PL5A 4IZIA 4HF7A 1SRQA 2WABA 2L42A 5CA0F 4W9RA 5CXSA 2VPPA 4M7PA 4NBLA 3OX4A 3M4JA 3W2IA 1NVXQ 4P83A 1WJGA 5HZMA 3OHMA 3SG0A 2H4WA 1CS0B 1PBTA 4F1WA 4DJTA 1Y9JA 3LOQA 1FSFA 5IBRA 4KR3A 2OZLB 2WDPA 3MZ0A 1W5AA 1AZSC 3MINA 4HUQB 4LGMA 4G85A 3DHYA 1YVEI 1R12A 1X0VA 2XQVA 4F6RB 4MMYB 3FHCB 3SF8A 2VOEA 3L3BA 2HMTA 3N87A 4C7XA 2Q6OA 2QN6A 5J4LA 3UXYA 5DV9A 1XL1A 2JANA 4OXNA 1J7KA 1ZJYA 2FEOA 2E5FA 3AZPA 5EG5A 1KC1A 2D2XA 1SAYA 1OT3A 3E5NA 4TN5A 4LJ5A 5GONB 5BR4A 2IH2A 4ALNA 1G5FA 2C3MA 4G81A 4YTEA 3K6SB 1DQSA 4PC1A 1GAEO 2DQSA 4ZT4A 4RMJA 1F4LA 1RYMA 2RI0A 3RDPA 1DGQA 1WZCA 3CXRA 2QG9A 3JVVA 4L74A 4YAOA 3VR2A 4CGZA 1DOAA 3R7SA 4FOOA 4ZT6A 3C16C 3ZBTA 1MABA 4QOEA 1JJVA 5K3FB 1UOPA 3SIWA 1WV0A 3THOA 4C9BA 1RM5A 3R3XA 3R8CA 3ACDA 2CSXA 2PZEA 5CHYA 4W5RA 2P0EA 1NW4A 3N70A 4MB0A 2XCIA 3RYIB 5FLXA 1F2VA 1JQ3A 3UB2A 4ZV4A 1ADFA 2GBIA 1PR5A 3BL5A 4AYXA 4DNXA 5EHZA 1HYQA 5FPKA 1MKYA 4MI1A 5EP1A 3OCCA 3PICA 2AK2A 3KTOA 1RSZA 5KCMA 3SXPA 4B40A 1A04A 2VXYA 4Q9IA 4LW8A 3UCEA 4TQGA 4MS3A 4P0PB 4KN6A 3E5RA 2ENUA 3OMXA 1G21A 1GL3A 2Y77A 3ID6C 4KVGA 1D2AA 3LPDA 4GAEA 5D1HA 3JW8A 3NTVA 5LDGA 3WJ1A 3O9ZA 3FMOB 2BBTA 1FQOA 3KJGA 3K4QA 4U7PB 5DMXA 2X9GA 2FG7C 3RVMA 3MJSA 4BNHA 2G5GX 1J8VA 1QBGA 1Z0JA 2D2VA 1T8YA 2IYNA 3NRJA 2VDWB 1PS0A 1NBME 2D8AA 2QTMA 3BC1A 2YV2A 1CG6A 2GD2A 3NR2A 4RJTA 3EH2A 13PKA 1SHKA 2PQ0A 4W1SA 1SU7A 4EGSA 2OO7A 5JH7F 3ICCA 3K7EA 4G1MB 3VV2A 4FW9A 2A7QA 3KAQA 1O0SA 1CZHA 2CJWB 4XARA 4DMRA 3GT7A 1TMOA 4IDGA 4MCAA 1RYZA 3PPWA 4WT7A 2Q62A 1EQAA 3VA7A 4GKVA 5FQOA 1WOYA 2PT5A 3GLGA 1JLLB 1T2UA 2PKQO 2AG8A 5EZYB 2XITA 5AW5A 4DQLA 3UFXB 2V03A 1RWVA 2BM8A 3H04A 2YVLA 4NJMB 5BQOA 4RF4A 5K2OA 2I91A 1KO7A 2E6KA 2MJLA 3D7LA 2ZJOA 1KFCB 2BHLA 3AR7A 2AH5A 3L6CA 1CUGA 4DVGA 3V8MA 1NF3A 2YHBA 1N3IA 1W5FA 2ZBUA 4TM8A 2QE7D 4ZYUA 4I9FA 4HEA6 4ZARA 3ELBA 4N82A 4BX3A 1YR1A 4DMUB 1ENOA 3ER6A 4DV3B 4WAUA 1XNJA 1JVSA 2QVGA 1QHGA 3RREA 3UPTA 2F17A 3ADDA 5FBVB 3E2IA 3PG5A 4HDQB 5IF9A 3AR2A 5KQPA 1AJEA 3LKZA 1AKWA 3M34A 1D2MA 3EWIA 2AMFA 4OKIA 5EGSA 1W1IA 3V1YA 3CNOA 4AJ9A 4ECEA 4G5GA 5LJLA 5AKZA 1F51E 3HB1A 4GQAA 5DTEA 2Q9AA 4PHFA 3WZLA 3F5DA 4BBJA 3LPMA 3AIKA 5BSGA 1T5LA 1ZD3A 3I58A 1LSJA 4QLOA 4CLRA 3C1UA 3S28A 1IN7A 1X39A 5EQJB 1H9CA 2J9XB 3M81A 4G65A 3HKCA 2IYEA 4G1BA 1QHYA 1V2GA 1V6SA 1EJ0A 1X14A 1EGVB 2AFIA 2WIAA 4FKBA 4YNBA 3GUVA 1DOHA 1DX9A 4ZAYA 5JAMA 4W5TA 3DEZA 3DD5A 2WA2A 4Z7JA 4B2IA 2W37A 4Q9DA 5L51A 4C7KA 3AL3A 4CV2A 4DWOA 3WIVA 1A4UA 3JASB 4B3XA 3NI2A 4BX9A 4DIBA 1JFRA 3FB1A 1N2HA 2IQ5A 1G41A 2V6JA 4BJ6A 2IYVA 4A0QA 2DQKA 2R84A 1L5OA 2OQ2A 1L2TA 1WKBA 2N75A 2XJ9A 1XVVA 4ZQHA 4DLRA 4J7AA 2CLSA 2BRUC 3QM1A 3S1AA 4BGEA 2NT3A 4D9CA 2GERA 4FGLA 3KWLA 1Y8AA 5DCUA 3TSAA 4HI0E 3SZUA 4PLPA 1I7PA 3E1KA 4OJQA 5CGZA 1SN7A 4UKDA 3EVZA 3SICE 2PIDA 5TS2A 3CN7A 4K46A 3NUGA 1F0PA 4X20B 1CS4C 1E6WA 1ZPDA 5AW2A 4Y6QA 2Y0PA 5J1SB 1AS0A 4Z4IA 4FX2A 4EB6B 2Y93A 3LX5A 3UAYA 2QTTA 5GJVC 2H1CA 1E5XA 2PL9A 5AHOA 3SIRA 3W78A 3CPJB 1J9GA 1NNLA 5ALRA 1GFZA 2BAGA 4OHZA 4RMIA 2JBAA 4EPWA 4DTIA 2C31A 1JFFB 1HG0A 4L07A 4L27A 3FI9A 2ZIWB 4I50A 1H6CA 2BC9A 4Q9LA 4QOIA 5B37A 1SEVA 2AUMA 2G9QA 3AOGA 4Z0PA 5BW6B 1VJ0A 5BR1A 3OC0A 4KI7A 3ZDAA 4MUYA 3LYLA 3WGTA 1EZ4A 4R98A 4CZ2A 1FSZA 4MA0A 4B4KA 1QVWA 1TVEA 1RAHA 3TLGA 4ZO7A 1VP9A 3AIIA 2BGWA 3MUEA 3EG9A 3VNVA 3P0FA 3R23A 1DBRA 4UM5A 1P73A 4HTFA 3L05A 1EXVA 1E0JA 2J0UB 4HOYA 2CEAA 4W9NA 4Z49A 3GAFA 3QVKA 3IR5A 5EE0A 5GJWC 4NENB 3ROFA 4CN9A 1NMEA 2P75A 1E66A 2ZIXB 4QQKA 2FPPA 5E4FA 2VYFA 1C2YA 2CNNA 3D81A 2JCYA 3LCJA 1LPAB 3H84A 4I4TA 2WD7B 1PL0A 4KLAA 5DM1A 2B99A 2RHCA 1M5TA 1X42A 2C7VA 2JFVA 4C7MA 3WADA 4F84A 1GXSB 2LIVA 3CNLA 3JQ7A 3FTFA 3EXAA 3K72B 1G17A 3DZJA 3T4UA 3T4EA 4JWTA 5EKUA 3TZEA 1SZPA 5A4FS 4RIHA 5KNCA 3PNYA 1HL7A 3OJ0A 4IDFA 2V98A 2Q6LA 2X4DA 4JLSA 4C0KA 1DIOB 4Q4AB 4WUTA 1TYDE 3HDYA 3SQNA 4CTKA 2QWXA 2R4UA 4YMLA 1O5OA 1QRAA 2G80A 2VJAA 1PAUA 3DQPA 4FFOA 4F60A 3O1HB 2GEJA 3FKQA 2L18A 4A2PA 1C3OB 1CJSA 5B2EA 1FE8A 4DIKA 3NHYA 1PEYA 5HK8A 5JYEA 3T1YB 1IMOA 1ONOA 2OHJA 1MF7A 1LK0A 1IOWA 1UXIA 2X2FA 2Y0CA 2H0AA 4IJMA 5JWRA 4TWRA 5F2NA 2A0UA 3LUDA 1H3NA 4Y2TA 1VHWA 2QA5A 3HSYA 4RSRA 4IX1A 2WY2D 4MCHA 3DMRA 1N2CB 3X1XA 4P4LA 1W29A 2XCUA 3RHZA 1KY4A 2ZBEA 4HEQA 1TLFA 1E7YA 4IG4A 1CUIA 3OT5A 5TF0A 4IDDA 2I1QA 3ZV5A 2BIFA 2ZYSA 4ZYXA 1W85B 1R9JA 2JEYA 5BVGB 3PCRB 2A92A 5AO9A 1WG8A 4H7FA 2YXNA 1Z33A 3D6MA 2WF6A 4DY4A 3GI1A 3S6JA 1E9VA 1N1GA 4S1WA 1RZRA 2Y1FA 5NLLA 3A4LA 1KFJB 2VT7A 4RF2A 4GC5A 3KQOA 1LUAA 2Z1MA 1XZHA 3U19A 1FFYA 3OY2A 1LVGA 3UT6A 1XRJA 5TB5A 4J0EA 1RRCA 3W7VA 4B09A 3VU1A 4KRYA 4C01A 4V0SA 3ZE7A 4PZUA 3ZDZB 1SELA 2QIPA 2VTKA 2CKMA 4QPPA 1JAXA 1NRXA 1MW9X 3H9CA 4ZK6A 4DR2B 3I2JA 3PFFA 1XWWA 4GXQA 2G5TA 4NYMR 3OOEA 1VSUA 1G4AE 5K0FA 3BCSA 4QEDA 1KMHA 3A4MA 2QI9C 4HNSA 2QTLA 1OC2A 3NIWA 3SKVA 2RHWA 1J42A 3IB3A 2AE1A 1IC6A 3GVPA 3K4HA 4MUNA 3S0JA 1EWYA 2VDRB 1PF7E 3KSUA 2JDID 4HAWA 3DC7A 2H06A 3IBTA 3LBIA 3K0AA 1L4KA 4Z0TA 2YY5A 1ITZA 5K3EA 1BOFA 1A8HA 2JI9A 2MWMA 1LQUA 1OA1A 1RQ7A 1VL1A 2YZ2A 1RI2A 2YWHA 2ZZKA 3B6MA 2A33A 3LPCA 4IJWA 3K70D 5K8TA 3BXPA 3FFTA 3G9QA 3GLRA 1WZEA 4M1SA 5BN3B 3OUUA 4EF4A 4EHFA 1PTJA 3AEQA 3D6FA 3ZHCA 4PRZA 1U9ZA 3G9UA 3OLZA 3UMBA 4D42A 2G7ZA 5DEIA 4Z4EA 3PGMA 1R10A 5HKKD 4TL9A 5F4BA 4C4TA 5JADA 3SC2B 2BFPA 3QVOA 4YWJA 3NBYC 4FFWA 1ZZEA 5HWSA 1DT5A 2J67A 3DEYX 4P3OA 2PRJA 5AI5A 4E6EA 3PENA 3GJ7A 3WQBA 4AUKA 2ZWMA 5H1YA 1W7AA 3ORHA 1HXHA 4MGYR 2UZ4A 1XZMA 1CUSA 4AMVA 4U7DA 3HKBB 1HKHA 3GRPA 2H9IA 5PGMA 4EF5A 5A5EA 2EVWX 3ZDBA 4ESOA 2Q6IA 1G55A 1P44A 2HDHA 1I3CA 2E4YA 4JJFA 4PHHA 1A82A 3JALB 3G7SA 3T3EA 5EIFA 1H4QA 4ZO8A 4EHLA 2QPOA 1T0IA 1PSWA 4GRDA 5IXJA 1JALA 2X8AA 3ZCRA 4KE6A 1WXHA 4LF4B 1EK6A 4IFBA 4TWIA 4ATNA 3L07A 2PUDA 1I51A 1OAOA 1DE0A 4GYKA 4HMQA 4YFYA 1GV1A 3TX6A 1E3WA 3CNEA 3DE2X 3QIAA 2WJVA 3TQCA 1BS1A 1E7RA 2B25A 1EYZA 2FQYA 2H11A 3KYBA 4LYHA 5J59A 3VM6A 1R4AA 4BQRA 1F0NA 3CM0A 1UINA 4EUHA 1R0YA 3IPAA 1PR4A 1VMEA 3RJTA 2B8TA 3CY6A 3CRMA 3K3PA 2CHFA 3GX1A 4PCAA 3C3KA 1FYFA 4L3VA 1E1CA 4TTPA 1PR6A 1SUPA 1NBHA 3RTAA 2ADMA 2QT1A 3ICQB 2PRZA 1BXKA 3AGPA 2HF9A 3GCXA 3P96A 2WSMA 1YVUA 3ZUPA 1Y8ZA 1ZU5A 2NSDA 5BT9A 1A7JA 3WK9A 2PZKA 3P9YA 1KI6A 2FMIA 3GLFA 3WSVA 2FW7A 2EX4A 1BG6A 5EMHA 4BB6A 1ODTC 3ROQA 4BTEA 3ANYB 1ZSYA 1Q1ZA 1WS6A 2RGBA 5K09A 2ZSDA 3CKKA 4FUQA 5DTQA 1IBLB 3R9WA 3HCAA 3EZXA 2JH3A 1DQRA 1FFBA 1Y6JA 1G8MA 3SE7A 2ISCA 1DV2A 4PPNA 2BM0A 1NKTA 5F2OA 1D7OA 4NE2A 3RTDA 5BXYA 4ADSG 2DFNA 1C9EA 1DAIA 2A5GA 3DM5A 4LZNA 1P80A 3N0WA 3NRBA 2C9ZA 4F86A 3I32A 2H3HA 4JVSB 3FZGA 5GV7A 3KZMA 3KQPA 5G40A 4V02A 2F6RA 4LYEA 3WL8A 1N1MA 1SRRA 4IILA 4MJLA 5KNDH 2PBZA 3KVOA 3IULA 4AO8A 4O29A 1Y3CE 2R8PA 4ALJA 3THYA 2MYTA 2GEKA 1G9TA 1T9CA 2N3ZA 2CWDA 3JAWA 3OA0A 1JDPA 4NAUA 4A0GA 1E2DA 3AILA 3IP1A 4AP9A 2C42A 1IWOA 4KV7A 4RVDA 5KQRA 4U7GA 3TFOA 1UWKA 4BN5A 4QVKA 3RAFC 1FC0A 1SXHA 2BBSA 3EUFA 4M88A 4B6RA 1A3CA 1G4HA 4E5PA 1GTRA 4NARA 3RBAA 3VDNB 2V1UA 3X1KA 3EPHA 2QUBA 2NUPA 1CR6A 2K4MA 2V8OA 3HSKA 4AKGA 3GVCA 3LP8A 4A15A 2ZK7A 2VHVA 1QKKA 1Q3KA 4UHHA 1C3EA 1ADJA 1Q0SA 2HIHA 4KIGA 4YJFA 1QHIA 3M9WA 2UZ3A 1DADA 2W2VA 3M6MD 4HDKA 4QYIA 5BO5A 3RNOA 4JB3A 2BH9A 1PR2A 1WDWB 3COVA 3INNA 5FV7A 2ZQZA 4IR7A 3CUVA 4EYKA 5M34A 2W42A 5B1EA 3B36A 4FZ3A 2VK8A 2G7MC 1KK2A 2ZYUX 4BNXA 3PHIA 2XA1A 3P45A 4EYOA 2QAGB 4BMXA 3CEPB 3LVQE 4IIGA 3NBUA 1N57A 1L5FA 3QELA 1OU0A 1MO5A 1NKVA 4UTPA 1DKPA 2WZCA 5JW6A 3A3PA 1Q15A 1CHDA 1UXKA 2XTJA 3II6X 2IT1A 5K0EA 3MS4A 4X7MA 5JAHA 4NVRA 1KJ8A 5KYWB 1F20A 2CC2A 2IUYA 4FSXA 4UFPA 1S7CA 3ICEA 2X8LA 3M5DA 2ZS8A 4Q1FA 3SQOA 5AVYA 5KVCA 1JU3A 1E9CA 3TZHA 1KK3A 3EIFA 1EVEA 3V7UA 4XRGA 1JHOA 3M1AA 3HM2A 1I01A 4U4AA 4RESA 4BFTA 4EMTA 2EFCB 4LXHA 3KQNA 4R1LA 2PMKA 3RT7A 3I45A 3MWEA 2V9ZA 4QX6A 4MKXA 3ZD8A 4FW8A 4MPTA 1IH8A 2PZ8A 1PGOA 3RSQA 4GOKA 1LNZA 2ZUCA 5EMLA 2B4RO 1XHLA 3D0RA 3EY4A 3IVMA 1OV6A 3P8ZA 3FCEA 4FJ2A 4ZVVA 4D3SA 4AS1A 2OGWA 1QIHA 2QU8A 1AUPA 3ENVA 5IWAB 3T7CA 1JQJC 1R0SA 3OZ7A 1T36A 3PU6A 2XNKA 4PYRA 4YASA 4M9SA 1PHPA 4CKXA 5KNDA 1N5KA 2ZB7A 3NEAA 1NVFA 3BBLA 4JUAA 5AOCA 2HEGA 2RHBA 5K0GA 5TEVA 1N5RA 4KK4A 2DPGA 4LDRA 2A1TS 2YVAA 3D3WA 3PK0A 4R68A 1A9QA 2C4KA 3QV1A 1RJ9B 3KLOA 3TQQA 2WYIA 3SF0A 2GYYA 4DLYA 3TKYA 4ESHA 4FXPA 1FRNA 1AO3A 1Z16A 4NCAA 1E2NA 1EXDA 1TKRA 1HYEA 1RYYA 1LLUA 4UCQA 3FG9A 3LDAA 3MFYA 4QGFA 4UU0A 3QWHA 1JB9A 2XQGA 2JLRA 1GILA 4IM7A 4Q3CA 2GCOB 4UHEA 4CG2A 5JDCA 3G5MA 4R1MA 3HV0A 1YRHA 2GNPA 4CDRA 1VJ1A 4PFSA 4LUCA 1BC5A 2R7NA 3FLMA 3A1TA 2AEEA 4UU8A 3V2IA 1K5HA 5DJ5A 5KYTA 2FPIA 3IV6A 3BMQA 4PYQA 2A58A 1O0CA 5JZMA 3LX4A 4ZTBA 1P1RA 2O2YA 3A1WA 3RRMA 3TX2A 1GCIA 3MJVA 3QKSB 1AM4D 2WUDA 2BUAA 3OCWA 4BMCA 1KYTA 3PUJA 1BD3A 3I2FA 3EVAA 4U7WA 4PC6A 1R0ZA 1DO2A 3LDFA 4M1KA 5TRTA 4E5SA 3B82A 3E23A 4RE6A 1PK8A 4WOCA 4QNNA 1P6QA 4E5NA 4L5IA 3KLPX 5CTAA 3WFIA 2W2OA 4RXUA 3C24A 2GJ9A 1VSQA 3FF4A 4NOJA 5EYPB 5GMOA 4IDCA 5FWAA 2O7RA 2R79A 4JJGA 4OKNA 2Z08A 3FPGA 2BUCA 2X5XA 1A2KC 2JB9A 4S1NA 5G53C 4N3NA 1V9CA 3Q3GE 2CFOA 1F2DA 3RUDA 2Q1WA 2ROQA 4K1LA 2RGEA 3CJTA 4RK5A 4GL2A 1P7PA 1EHCA 1Q3TA 1J00A 2Q41A 4NYJQ 4FN4A 4I8IA 2XV1A 4XUCA 3REFA 4OMFG 6AT1A 2Y1LA 1JKFA 2YQ5A 4GW3A 4R8VA 4MUFA 2WUVA 5KTNA 4PWZA 3RT1A 5KSZA 2ICAA 2FHSA 3I12A 4AWAA 2E89A 4BGIA 4D74A 1KSJA 3OD1A 4HK4A 4C3ZA 4EITA 4ZMSA 1RPJA 5IVKA 3OMWA 3QOXA 3TW8A 3WQQA 1W4LA 3C5WP 4B3DA 4XB2A 3BH0A 5I3ZA 3UBTA 3F9RA 1Z18A 1TQ4A 4IDBA 3U6KA 4CE6A 2P9FA 3PGXA 2AMJA 3IMFA 4WI1A 3T1NA 3HCRA 4DB4A 3LF2A 1GCAA 2VJNA 2QSYA 5CYFA 2QVYX 5E4TA 1ORTA 1WV1A 4PRKA 3L1KA 2BFCB 1CZLA 4IJQA 4MJ3A 1PDWA 2O1XA 3T4PA 2Y3IA 1EIWA 3C48A 1XQWA 1YIAA 2DM6A 3MMXA 3GCGA 1XHFA 3VR6H 1KMCA 3KLMX 2ATEA 1OHHD 2RGGA 2VSQA 4G0NA 1RU3A 4OI2A 4TKUA 4Y2UA 3MTJA 1QGYA 5IS2A 4RCVA 2VT6A 4G56A 5DN6A 1QTQA 2JS7A 4C76A 3TZBA 1HYGA 4PG6A 2OD7A 2XW6A 3PWKA 5LNK1 1Z13A 3QJGA 4O2LA 1RZUA 4H77A 3EPLA 4TZ6A 3WLMA 3LD9A 2C4TA 1M7GA 2GM9A 4C7OA 3AJAA 4FS8A 3IH5A 3FZEA 4CW7A 2FMTA 5AM4A 5CVEA 1CD5A 3HK2A 1J0XO 5EHQA 1KF0A 4J0CA 1EEXB 2R11A 3S44A 5LQNA 5TT1A 1LH0A 1P2GA 3A6EA 3TRKA 2BGMA 2J3QA 2UKDA 3Q98A 3U7FB 2GBLA 1NHGA 3BVPA 3GEMA 3H3JA 1UKVY 3THSA 3ZZ1A 1W47A 1CQIB 2E1PA 4TMFA 2GSDA 3FFXA 4QUIA 4YJDA 1HSZA 4C78A 5BN4B 3NB0A 3TWOA 1LTHR 1Q74A 1KI6B 1SIBE 4MP3A 5C53B 2OV1A 3E8MA 3MTEA 3ZU4A 3CX8A 1RVDA 3EZ9A 2NSJA 2X4GA 5JI3E 3U26A 4A0FA 2WIKA 5AYVA 3WO1A 4EI7A 1Z2NX 2VYCA 4TT3A 1C1DB 1II8B 3T9EA 4R2MA 4EAQA 4OY3A 2FEMA 1YKFA 2QLJA 2XB8A 2AS0A 3COWA 3Q72A 5A05A 5JJBA 3H87A 2OCYC 5JBIA 1YFZA 4MW7A 3UIEA 1Y34E 3DW3X 1UEJA 5G4LA 4WVFA 2QB5A 2GN1A 3RUEA 2CXQA 4EGFA 2G63A 1BGWA 4MQUA 3OOWA 4XIJA 3QPAA 1IU9A 2YRWA 3GLFE 5EZSA 1G7SA 3NOOA 2VRCD 1O6CA 2PIAA 2DCMA 4OBXA 1HT0A 3UXHA 2TMKA 1WHSB 1Q7RA 4RLFA 1WB6A 1FXWF 3FVWA 4M1OA 4NFLA 3SDBA 4C4PA 3TNDA 1WMFA 2GUGA 4Z51A 4XX0A 2W6MA 1IXKA 2JNWA 2PKEA 3DE5X 3W8DA 1HRKA 4YQYA 4BVAA 4IJ5A 3BXXA 4M86A 2VRWA 3H5NA 2V7BA 4IF6A 4UE3S 3P27A 3P2MA 4GLBA 1JAHA 3F8WA 3FPLA 4PYMA 5FWXA 2EYQA 1VLJA 1Z5PA 1VI5A 2HJSA 3M82A 4XFDA 2FZKA 3KB8A 2YJ3A 1B1CA 4KIJA 1P1JA 1YT5A 3AF5A 1OB5A 1EK0A 4KFUA 3QXJA 5DOZA 4ZMBA 5E95A 4BX8A 1JAIA 2WIFA 3K2BA 3ZV3A 5F9HA 3QVVA 1B4DA 1YZ3A 4QREA 5DPMA 3KYIB 4TTTS 4MW9A 4RETA 4W7HA 4UAUA 2ADFA 4DAOA 3WR5A 4FFSA 4KQJA 4PQRA 3A28A 4RKEA 1C9KA 1FMFA 4QTZA 5I48A 3HR7A 3DHEA 5IK2D 1NI5A 4AKSA 4AJKA 1HX7A 3V6LA 2P0YA 1SMKA 1T15A 2RCYA 3E3NA 1T2DA 2GEDA 1RI3A 3JSAA 2ZBGA 3ZXUB 1JIXA 1P33A 1SXJA 3NHLA 2OESA 4TLEA 3P0EA 1I1OA 2BL4A 5DI3A 1GZDA 4DT1A 5IKMA 1OROA 5HG0A 3CYFA 1TQHA 2IIPA 1HPLA 5AM0A 5I7OA 2V6BA 3FCUB 1ZHHA 3GDWA 3RGWS 3DAYA 5LZ8A 1U81A 2AOTA 1HQDA 2O8FA 1E94E 1OXBB 2PDAA 4D5GA 2NTJA 2A5JA 3T3NA 2OLEA 3GGOA 2C1XA 3RVDA 3MGCA 4B2LA 3WV5A 3RUFA 4CMAA 3B6ZA 1UKEA 3ESXA 4F5DA 2D1TA 1EE9A 2QM7A 3VR5A 1B6SA 1Z22A 1MTOA 2NYRA 1GKLA 4XOUA 2F4NA 5JPCA 1YDFA 3NDIA 4FT4A 3EIOA 3UXMA 1M74A 4DXDA 3EC2A 2AT1A 2JFUA 2MSNA 3VJMA 1QIIA 1DCKA 3H9BA 1Q0QA 4TTAA 4YRPA 5DGTA 1PR3A 1KI3A 4J43A 5IM4A 2C2KA 1VRCA 2G0NA 1XXHA 3RAGA 5KHLB 5EMNA 3TBHA 2VKQA 1C41A 5JXIA 4ZTZB 1KXZA 1Z7YA 1IY0A 1IHPA 1OVGA 1UMCB 1E7MA 1Z7BA 3G1UA 4ZTUB 2C7RA 1XB2A 1JR3E 1NUPA 3CXUA 1C9YA 4YO8A 3TTUA 3ETHA 1OZAA 1W2GA 1K3FA 3A06A 3I30X 2AL7A 4N1AA 4LNAA 3SR3A 5B58T 1UXGA 3SSNA 3TNLA 4C3OB 3ECSA 4BYMA 1U7TA 1KHTA 4JB2A 4Q03A 1NXSA 2E6UX 2O0MA 2R1VB 4X8LA 4YRCA 2PPVA 4DN6A 4BKUA 4CMIB 4EG8A 5EL0A 3MHPA 2O8CA 1ISGA 1C4KA 4BQEA 4ZEVA 2B8NA 3U9SA 1RP7A 4JH0A 4CKEA 2CMFA 5EPEA 3UOGA 4AIRA 4MYDA 2QRMA 1Y5LA 1GR1A 3IUYA 3AXSA 3B1FA 2X22A 1HOXA 4WA8A 5D8DA 4CLXA 4BFWA 6CHYA 4RZXA 2C07A 4UULA 5AIBA 1GNPA 3LY9A 4KUEA 4PC3A 1GM5A 5C37A 1ND5A 1ZRNA 3IIJA 3JYNA 2EZTA 2WJ4A 4FE7A 2QJWA 3QU5A 4I4IA 3W3AD 5K20A 4MR7B 1GARA 1G3MA 3DBRA 1QE0A 4LXGA 1MB2A 4D6YA 5FUMA 4LZOA 4FYPA 4JLWA 3VJKA 2AYYA 5K0TA 2B21A 2B94A 1ATIA 1XP5A 3QWIA 3KHUA 1M2EA 1ZFNA 2QU7A 4OFZA 3N0XA 3N2NA 4KO1S 5EZYF 1ZJWA 1LJLA 1YC2A 3G8CA 5F23A 3DONA 2FB9A 2FUKA 2X7JA 4IDOA 1N92A 3D7NA 4A0HA 4EBFA 3PLNA 4AJEA 4C0WA 1EG2A 3EXHC 1GA4A 5B7QA 1V8OA 5U9CA 1BXGA 1JVNA 1TCUA 1FP1D 1NVWQ 4RANA 1R4ZA 3QMPA 1EBFA 2F4VB 1YJCA 1AGPA 3BULA 3IAS6 3RK4A 3WGOA 3ZHTA 4CKYA 4TOIA 1OH5A 1NATA 4DUZB 3T7DA 2Y8EA 4L9AA 3TQIA 1LDEA 4DQUA 1QU2A 4MCIA 4A8PA 4B83A 4JXJA 4B6OA 1VPDA 2TMDA 3MCVA 1IZ9A 3NOVA 4Y9UA 3WB0A 4CR7A 1HDRA 1MLDA 2QLFA 2ZM5A 3PNVA 1L8QA 3RHFA 1ANKA 3ENZA 1MBZA 1W75A 4M49A 2OZKA 2HGZA 3E7WA 5DTJA 3JQAD 4F0JA 4XPZA 1FMLA 2P4UA 2PY6A 3BK2A 3AG5A 5BW5A 4G0QA 4NE7A 1K75A 2O1EA 3G7UA 4FBLA 2X0JA 1GKKA 1ZIOA 4K6OA 1Y7LA 4K9DA 4K86A 3Q4GA 2VHJA 3ZGVA 3BT7A 4N8DA 3NBXX 4PN7A 5ERYA 3GP3A 3CCFA 3NM6B 5K0CA 3SVTA 1AUXA 1M1NA 2NX2A 1BWRA 2QP3A 2OHFA 3LHSA 4LYDA 2NYUA 4L22A 4PIPA 4YAJA 4J6EA 5J5AA 1IOLA 1L7OA 1Q1QA 3GEBA 4DMHA 3IJEB 3M89A 3LBFA 5LD2C 1FP4A 3HEBA 2DB3A 3A9SA 3PGVA 1AS3A 1MW8X 2M6SA 2B5OA 3MSXA 1VPLA 3ANSA 3WYFA 2VNKA 2I2CA 2Q46A 4BWVA 1EUYA 4BNMA 4Z0HO 1H2RS 2QD1A 1X1TA 3R0XA 3MEQA 2OT3B 2OVFA 2WYWA 5KREA 3Q8MA 4MVYA 4WK2B 3HLTA 4I99A 4OXIA 4NICA 3PHGA 2UV8A 1CYDA 4S04A 2J0QA 2C59A 3VSEA 1L4MA 2WIDA 1U7ZA 4DW8A 2FSGA 1MGOA 3QWBA 5EJ8A 5CDYA 4R0NA 3DL7A 1XTTA 3RYCA 4LOKA 3INRA 2D2IA 1UBKS 4ND4A 4DUPA 2H7VA 4GT1A 4D1YA 2G1KA 4ZV7A 1BZYA 2IOFA 3OZAA 3CF4G 3W5HA 4P7BA 1WXDA 4URXR 1JSXA 1MNAA 4KO8A 2J41A 4O8CA 5FL3A 4MARA 3DKKA 1J2TA 4ISCA 2BM9A 6GPBA 2FUG1 5EKXA 2DEUA 1RKXA 3ZHVA 2FXIA 4RFSB 1SZDA 3O9MA 3GFOA 1SK8A 2AG1A 2E37A 1R0WA 4WXYB 3RRZA 4BECA 3DO5A 3CR8A 2AR7A 2BBWA 3HVUA 2BGUA 4R2LA 5BMVF 4DA4A 4M9RA 4YJ2F 3QXXA 1IY9A 3PSAA 3PC2A 3T7JA 4X24A 3ZU5A 1CR0A 2REXB 3FHLA 2A57A 2VT3A 4QFDA 4W4TA 2ZI5A 2CDRA 4X93A 1Y42X 1YNOA 1OPRA 3CW8X 2XB4A 1BKSB 3NP9A 4KAFA 4KH1A 1P4GA 2HIGA 2IU6A 2L17A 3FROA 3K6KA 4X7RA 3RR2A 3WX0A 2HZBA 1SVNA 2G77B 4WY8A 1TZJA 3ROZA 1U98A 1H65A 3GWZA 1XBTA 4O2AA 3I0MA 3EUAA 1MRSA 3TDMA 1SVSA 4L3WA 2VHQA 3QLTA 3WSTA 2DUNA 2JFPA 4OI1A 3CZQA 3VR6D 1KH3A 1TC2A 3GJ3A 1ZSNA 4ME6A 4AY5A 4M55A 2YNMC 1GPMA 4GX1A 4AY6A 2HEIA 4P4GA 1JPVA 2XEDA 4P5EA 2HWXA 4YT4A 2FPMA 3UFBA 2J9RA 2CLKB 2RDMA 3M1YA 4PLCA 3NJ8A 2QM0A 1O95C 1C29B 2PLFA 4BP9A 3ON5A 4ZVKA 5K6AA 2IXGA 3ABOB 4Y2PA 5CEEA 4V03A 1J49A 5ADWA 3KUUA 4CYMA 3PXXA 3CLTC 4KXLA 3HS3A 2NO0A 4J0GA 2BV3A 3C3EA 5JO9A 4I5IA 1FDOA 5THKA 3PUXA 5AJZA 1E9RA 4N41A 1YQUA 5I5GA 4D2IA 4ENSA 3HADA 3I2HA 3O4FA 1E59A 4NCHA 3C15C 4X9XA 3WE7A 2Q45A 3OZUA 2W4MA 1NVGA 3VSCA 3PDUA 1G9XA 2VYVD 3UXEA 1XTIA 4GE0A 2AJDA 1JJAA 3E3AA 3I1IA 3FTNA 3NTUA 4KQMA 5SZKB 1RFLA 1S89A 2X1VA 3IQDB 3MGBA 4IKEA 5K01A 3F67A 5FNVF 2D06A 4XDGA 1Z8HA 1B8VA 1SXJB 1HK7A 2H2IA 4EUKA 3WAGA 1OKKD 2APJA 1FDUA 2D1RA 1I4LD 2EKDA 3LT5A 4L2IB 2B3TA 4DM3A 2GKGA 3KSRA 2BPOA 1KI7A 2AR0A 2WYVA 3OIUA 1E4EB 2JRLA 3ESCA 5LC1A 1E2BA 4GYYA 5JLJA 2Z9DA 3K4PA 2W0MA 5EE5B 1KYXA 4FDTA 4MUBA 5KPJA 1SBQA 3OFJA 4GBJA 3RODA 1TF2A 1GUYA 4Z1MD 5KVAA 2IPLA 3EIUA 4NH4A 4R01A 5E38A 3SYTA 1S4QA 3VISA 5E6SA 1Z36A 3ITEA 5ELXA 5L3QA 1FVOA 1MR3F 4DCUA 1E99A 3FBTA 4BNDB 1XAIA 2CBZA 3E81A 4Y7CA 5F3DA 5I7EA 2FR8C 2J5RA 1KS9A 5KMGA 1NG9A 1E6MA 5AM3A 4HTAA 1HE3A 3HZHA 4P08A 1NJGA 1SC4A 1UM8A 3HR4A 2HTFA 1EK2A 1SOVA 3IUNA 3K9NA 2Y0EA 4BX2A 5JT1A 2C04A 1S0UA 3R09A 1VGVA 1VJGA 5HJ2A 2I8AA 3OSZA 4RHUA 2W48A 2V7QA 1JKIA 3T15A 4N8SA 3HNPA 1VSVA 4R2HA 3R9XA 1ZNZA 3D64A 2CD9A 1WDKA 2BZGA 2HNBA 4TM7A 1NIJA 4D9KA 1M6WA 1TE2A 5FBHA 5FOXA 5K3DA 5SY9A 2ZIXA 2WHYA 4A8JB 5F98A 3KQTA 3U6BA 4TMYA 1XCPA 3VZPA 1EU1A 1YCGA 1NF2A 1P4SA 2BHNA 4GZLA 2C2WA 4Q6BA 1PX2A 3TXAA 4BQOA 5A4MS 1U8ZA 3O8OB 4OHPA 4R1TA 4EHHA 3LDGA 3M9XA 3WWOA 5ADVA 3FSJX 1U28C 1XDWA 2AYXA 1D1QA 1ONBA 4YROA 1YOVB 5LWHA 16PKA 1ORRA 1I9GA 3C5EA 2PU7A 4J16A 4PGMA 1N2BA 4NG4A 3IE2A 5AKHA 5ALKA 2PBRA 1PLJA 4D25A 3RT9A 1UKAA 4F9TA 1YIOA 4QYTA 4HJXA 2ZB8A 4BN0A 5ICEA 2GN6A 2PSHA 4KXFB 4NJEA 5IJ0A 3UHPA 4EVRA 4QC2A 5GM2A 1C3JA 1NYTA 2RBEA 2ZAMA 4U3JA 3N8IA 4YI5A 3UAWA 3VPFA 821PA 4CEHA 4NMHA 4I4TF 4YMUA 2WJ3A 2NV6A 1KYZA 5DIZA 3VNUA 3IB6A 4B3FX 1QAQA 1KEKA 4F96A 2H3EA 3FFBA 5IAGA 5ICFA 1VL2A 4C43A 2JLCA 3UVEA