1V39A

Dc26 mutant of vaccinia virus protein vp39 in complex with s-adenosylhomocysteine and m7g(5')pppg
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
297
structure length
291
Chain Sequence
b'MDVVSLDKPFMYFEEIDNELDYEPESANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP39
publication title Specific protein recognition of an mRNA cap through its alkylated base.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Methyltransferase
total genus 103
structure length 291
sequence length 297
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 1996-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1v39A00
3HEMA 2XYRA 1SVUA 5FWAA 3UA4A 1MJFA 2OPBA 3EVGA 4DF3A 1H1DA 2HWKA 3AXTA 1KIAA 4V0RA 5C1IA 4ISCA 1AV6A 5K05A 2VS1A 2VP3A 5E2AA 2UYHA 3PVCA 1EJ0A 2V7EA 3HTXA 5EMMA 2C7RA 3DXZA 1NBHA 4HRAA 3LBYA 2JHCA 4IWNA 4BLVA 4YMGA 2BM8A 2G72A 2YX1A 3KQYA 4XUEA 5M5BA 3TM5A 3NWEA 1NW6A 1KHHA 1TW3A 4GUAA 4GOND 3KQOA 2B9EA 3GWZA 5K0JA 1R74A 2OO3A 5KYGA 3HNRA 4RTRA 1BHJA 2AR0A 4AZSA 5CIYA 2GLUA 4GEKA 3T0IA 4A6EA 3KPJA 5B1SA 5K0FA 4X63A 2ZBPA 1HNNA 4GBED 4C05A 1AQIA 3AXSA 4K6MA 3LDFA 1EQAA 2AN4A 2XYQA 1R00A 2QYOA 1ORIA 3JWHA 4LWPA 4YMHA 3IEIA 4PYQA 4C06A 4PONA 4HC4A 3LBFA 5GOZA 2UYQA 3I53A 2PVCA 3TM4A 2OB2A 1HMYA 1D2HA 5DLYA 1FP1D 4OBXA 5E2BA 2NNWB 5HIJA 4FP9A 2BR3A 4PNEA 3C6MA 1VIDA 1VLMA 4R05A 3HVKA 1RI1A 2FK7A 5HIKA 3NTVA 3PX2A 5EMKA 5FTWA 4KVZA 4YUXA 3FPHA 3UJ8A 5DSXA 3NW9A 3ERCA 1NKVA 2C7PA 5HEKA 3G89A 1NW5A 5DTRA 5K0NA 2N47A 2YXLA 4O29A 3DMFA 4FZVA 3DUWA 5E9JA 4DA4A 3BXOA 1KYZA 1DCTA 3NMUF 2ZIFA 1L3IA 1ORHA 2B78A 3HCEA 5DXJA 5K8VA 3OZRA 4E70A 4OX9Y 5DTMA 1FJXA 1Z3CA 2P35A 2ZBQA 5FA8A 5GP1A 1R8XA 5D1NA 3TKYA 1VL5A 5ICEA 1RI3A 4DKJA 3ME5A 3UJBA 2ONZA 4BP3A 1BC5A 3LCUA 5IH3A 4ER3A 8MHTA 3ANXA 4P58A 5JUWA 5CD1A 2P40A 1YZ3A 4RVFA 4WXHA 2EFJA 3RW9A 1WXWA 5ERGB 3BWCA 5E1MA 3V97A 3LCCA 2GA9A 3KHKA 2HTEA 4FSXA 5DM0A 1YZHA 4BP1A 4U7PB 3LX6A 4FT2A 2YUIA 3BWBA 3MTIA 3JWJA 4KW7A 3ID6C 4UOEA 4H0NA 3B89A 3A26A 4ER7A 1QAMA 2PT6A 1NW3A 4U7TB 2H1RA 2IDKA 3QOWA 4EK9A 1VE3A 3NWBA 3CJRA 5C9ZA 3JWIA 3M4XA 2PJDA 4E33A 3FUTA 2R3SA 5GINE 5EZSA 2GPYA 4GOMD 2KW5A 4C08A 3M6UA 1F3LA 3THRA 5K0GA 3EVFA 1UFKA 5HILA 3C0KA 2C7OA 4R6WA 1WG8A 3HA7A 4GC5A 2ZZKA 4G56A 4KIGA 5E1OA 4CTKA 4RTMA 3ER9A 3ELUA 3HCAA 3SSNA 3EVEA 4AUKA 3DMGA 3OE5A 2GB4A 5LQKA 4R6XA 7MHTA 3HCBA 5BP7A 4POOA 1N2XA 1XDUA 2B25A 2PWPA 1U2ZA 2ZFUA 2VZ9A 4A6DA 2F8LA 4C03A 4DMGA 1XJ5A 5CCXA 2NP7A 3TRKA 1BKYA 4HGYA 3DH0A 4AX8A 2G71A 3BGVA 4MHTA 3HVIA 5GM1A 2YXEA 2LD4A 2ADMA 3P71T 3DP7A 1QANA 1VP9A 3A7EA 3MCTA 3UJ9A 5ICCA 3VSEA 1XTPA 1ZHFA 3C6KA 3KR2A 2A14A 4KWCA 3EMBA 2WA1A 2Y1XA 2ZIGA 4PIMA 2G8NA 3FPFA 3VC1A 5EMJA 4C04A 2Y1WA 5LQRA 1WXXA 1XCJA 3BKXA 3ELDA 1X1AA 3TLJA 1RJDA 2I7CA 2QRVB 1RI2A 4RTLA 1SG9A 4B17A 5FQNA 1YUBA 1G55A 1QYRA 2H00A 4X1OA 4R8RA 3BZBA 4PYMA 3L8DA 3B3FA 2EX4A 3E23A 1B42A 3O4FA 1JG1A 2NXEA 3OFKA 4QDKA 5EZQA 1L3BA 4DCGA 3A25A 5DRYA 10MHA 5HZMA 2UYOA 2WA2A 5D1HA 3KQQA 2B3TA 3M6WA 3UA3A 3GCZA 3CVOA 1L1EA 3PT9A 4MWZA 2OBFA 5DWQA 1KXZA 3SXJA 3M33A 5CVEA 4E32A 3EGEA 3KQMA 3DLIA 3GRUA 4YUWA 2O57A 1L9KA 4PYJA 3BGIA 1FBNA 4BY9E 1VQ1A 1G38A 2UYCA 3MQ2A 2H11A 2O06A 2B2CA 3BGDA 1T43A 3UJ7A 4ER5A 3EVAA 3RIEA 5HOQA 2PGXA 2IH4A 3ER8A 1P39A 2I62A 5DXAA 4CKBA 4EVIA 2Z6UA 4GC9A 2PT9A 5EEGA 2PBFA 2P41A 3P2KA 3P97A 3OFJA 5KQSA 4ER0A 3EPPA 3U81A 1FPQA 2PV0A 5ICGA 1OR8A 3SMQA 4RTJA 4YV0A 4LWOA 2AOTA 4M38A 3BUSA 3CKKA 3TFWA 2AOUA 3FPEA 5CVVA 3EGIA 5IKMA 4E2ZA 3KPYA 5EEHA 3LGAA 4JXJA 4OBWA 3GRVA 5JR3A 3MB5A 4MQ4A 2HNKA 5FA5A 1P1BA 1RJGA 2P3OA 2P3LA 1L3CA 4FGZA 4PYKA 2XVMA 3SX0A 3FUVA 2BR4A 5G02A 3AWIA 2C7QA 1EAMA 3FPGA 3KQPA 3NJRA 3GIWA 3HCFA 3BKWA 4NECA 2JG3A 2Z6QA 5C0OE 3G2QA 2O05A 3GRYA 3MERA 3CC8A 5EVJA 1ZGJA 2FHPA 2K4MA 3HCDA 3P9CA 4FSDA 4QVGA 3V8VA 4DQ0A 5LQAA 3LDGA 3CJQA 1AQJA 3PLAE 3G88A 2IP2A 2BH2A 4PYNA 4BLUA 1QZZA 3UBTA 1UWVA 2PXCA 3FTFA 1KP9A 3OCJA 3P9NA 2AVNA 1QAOA 5ICFA 3R6TA 4GF5A 4IV8A 1XVAA 1EG2A 3VYWA 2G1PA 5K09A 2I6GA 2GH1A 4DCMA 1VP3A 3G2MA 3R0QA 1YFJA 1KR5A 4OQDA 4F84A 3SM3A 3R3HA 1JQDA 1XDSA 3S68A 5EKXA 1M6YA 5BW5A 2CMGA 3HP7A 4DZRA 3I9FA 3KQWA 1N7JA 2CKDA 2PKWA 3CCFA 3DTNA 2AN3A 4AZVA 4MIKA 3GGDA 3MTEA 5GWXA 3UZUA 4PYLA 3T7TA 3A7DA 1IM8A 2ZIEA 3PFHA 2UZ4A 1EIZA 2NYUA 1P91A 4CKCA 4RTOA 2FCAA 3EMDA 1Y8CA 5K0BA 3C3PA 5EHGA 1FP2A 1JQEA 4QVKA 4RYLA 1ZKDA 4GOLD 3TR6A 2FPOA 3E8SA 4QQNA 2BM9A 3B7PA 5FUBA 5BXYA 3TMAA 2XBMA 3DULA 5U4XA 5E9QA 4YV2A 3F4KA 3G5TA 3KU1A 4RVDA 1D2CA 1G60A 1G6Q1 1XDZA 2HMYB 2FRXA 3DXXA 3EVBA 3C3YA 2PX2A 5DX8A 4KDRA 2IIPA 4HTFB 5DM4A 5H02A 3H2BA 3LDUA 4AZWA 4YUYA 3D2LA 3G8AA 1ZQ9A 1UIRA 2VDWA 3KPVA 3RODA 5GIPE 2ERCA 3HA5A 4PINA 1JG2A 2P7IA 3Q7EA 4ER6A 2QE6A 1XCLA 2PY6A 1YFLA 2GS9A 3ELWA 4QTTB 3FTDA 2IPXA 3LCVB 3R24A 3OPNA 4L7VA 2VDVE 2HV9A 2YVLA 2YXDA 3KR1A 5CVUA 2QM3A 2FK8A 4FS8A 5F2NA 4X60A 3UJDA 2ZCJA 3LL7A 3FTCA 5FQOA 1AF7A 2PX8A 1SKMA 1M6EX 2Q41A 3CGGA 3DLCA 1IXKA 4AZTA 2PLWA 5E1BA 2AZTA 3BWYA 3LSTA 4E31A 3JWGA 1G8SA 1JG3A 1SUSA 2OY0A 2PX4A 1N7IA 1KPHA 3DMHA 5P8WA 3EVDA 3I58A 5T6BA 1NV9A 4C07A 3QOXA 1R18A 3FZGA 1KPIA 1NBIA 1ZG3A 1RJFA 3EVCA 3B5IA 2NXCA 2CL5A 3DOUA 4QPPA 5HFJA 1D2GA 1PJZA 3KKZA 1R6AA 4C4AA 5FWDA 4OA8A 4RX1A 4CTJA 3KQVA 2EG5A 5CM2Z 2IH5A 3NDIA 1IY9A 3G7UA 5DM2A 3AY0A 5DT2A 3TPZA 2AVDA 2NXNA 4EMSA 3I5UA 5K01A 5GM2A 5HIMA 2BZGA 2P7HA 5EIWA 3R9XB 4QPNA 1YB2A 2YQZA 1VPTA 3KQTA 4M37A 3G2PA 1X19A 1O9HA 5FCDA 4BLWA 3FTEA 3EEOA 2O0LA 1DL5A 5LSAA 3G8BA 2AOXA 4RSRA 4X61A 5DTQA 2ESRA 2IFTA 3QV2A 4YV1A 1TW2A 3EGVA 2QRVA 2E5WA 2PWYA 2ZULA 3HA3A 3OU6A 1P1CA 4Y30A 3FRIA 5EC8A 5EGSA 5F2OA 1R8YA 2CMHA 2ORED 3B3JA 3DXYA 4HGZA 2OYRA 3UJAA 1X1CA 2NP6A 5CVJA 5DRTA 2OKCA 4PCAA 2BR5A 1JQ3A 2DPMA 3EEYA 3GJYA 3M6XA 4F86A 1JTEA 2AOTB 5EOVA 5FADA 2AOUB 1SUIA 1M0EA 2JHPA 3UJ6A 1WS6A 3FPJA 4ZTBA 5LQCA 4ATNA 2GAFA 2ZVJA 5EG5A 5CCBA 5DM1A 3P9IA 3OE4A 4KIFA 3NVKI 2P1DA 1SQFA 1I1NA 4FR0A 3T7RA 3KQSA 4E2XA 5BW4A 4P7GA 5EMLA 2EJUA 2ZWVA 5K0EA 5EHIA 4CWAA 1MHTA 3EVZA 3FUUA 1V39A 4F85A 1X1DA 3GXOA 5T67A 4E2WA 4QDJA 4RTKA 3GNLA 1DUSA 3KR9A 4RTPA 1Q0TA 1NE2A 1WY7A 3M70A 3E7PA 3GRZA 5LR6A 1XXLA 4P7JA 3M6VA 3G5LA 3TOSA 1BOOA 4PCLA 3WSTA 3OZSA 4PGGA 5K03A 3HVJA 1G8AA 3NDJA 3LKDA 3FRHA 4V0QA 4PIPA 3GO4A 4Y2HA 3THSA 3BWMA 3P8ZA 2VDUE 2P8JA 4OA5A 4IV0A 3KR0A 3ORHA 3OU2A 5FHRA 1I4WA 3B3GA 4LG1A 1Q0SA 5LQNA 1NW7A 2IBSA 1JSZA 3O7WA 5E9WA 4WVLA 4YUVA 1QAQA 3I64A 3X0DA 4X41A 1EJ6A 3MAGA 2AS0A 2QY6A 3NVMB 3BT7A 4KDCA 4KRGA 1JR4A 3LKZA 4XCXA 3PX3A 4RWZA 5EIFA 3TKAA 4EKGA 5KVAA 3MHTA 2ZZMA 1RJEA 5CUQA 5K0CA 1I9GA 4PYOA 1YF3A 5K0LA 2V74B 5KS2A 2JH9A 3IHTA 4CKEA 4RV9A 5FULA 5KQRA 3P2EA 3P2IA 4P7FA 4PGHA 3Q87B 3LECA 4PYIA 2ZBRA 4OQEA 5HIIA 1JG4A 3SGLA 5E8JA 3G2OA 2XYVA 4E30A 1INLA 3DR5A 3VC2A 3HCCA 2IBTA 3LHDA 4M36A 5DX0A 2PXAA 3UFBA 2P3QA 4RTNA 2DULA 2ZW9A 3IV6A 1F38A 1SQGA 1KPGA 2PSSA 4QQKA 3KPUA 5MHTA 1O54A 1X1BA 1NV8A 3AJDA 4Z2YA 3CBGA 2JJQA 5E8RA 4GOOD 1VBFA 4FT4A 4GQBA 2AOWA 3MGGA 2AOVA 9MHTA 1WZNA 5FHQA 2NXJA 2ZZNA 3PS9A 4XUDA 2OZVA 4R8SA 3IYLW 1JTFA 4PWYA 3ELYA 4EQZA 2G70A 5E1DA 2YTZA 2XVAA 3GU3A 4RVHA 5DX1A 2PX5A 3HM2A 1TPYA 3FUXA 3FYDA 4HH4A 3REOA 4E2YA 4HSGA 2EJTA 2WK1A 4M7RA 4QTUB 3K6RA 3GDHA 2O07A 3O31A 5GIOE 2ZWAA 2CWWA 4P7KA 2PXXA 1NT2A 3MCZA 3HVHA 2IH2A 4YUZA 4RVGA 3UJCA 4IKPA 2HR1A 4RTQA 3TQSA 4HTFA 1O9GA 3CJTA 3OZTA 1KYWA 1PRYA 1ZGAA 3SSOA 2I9KA 1JSXA 2IGTA 3KPWA 2Z6AA 3GRRA 2ZTHA 3K0BA 1RI5A 4RTSA 3OU7A 3P9KA 5LQJA 2ZLBA 4LECA 3PFGA 5F2KA 5DPMA 3SR4A 3UWPA 3PB3A 5DSTA 3SSMA 2JH8A 2ZSUA 3E05A 5EQJB 3T7SA 4EKIA 3A4TA 5CVDA 2AN5A 4HG2A 5EKUA 4MTLA 5LQUA 2OXTA 4DM3A 1NW8A 2OB1A 3PTAA 2ONYA 3FUWA 2IDJA 3FYCA 2R6ZA 5T64A 2FYTA 4XUCA 3SVZA 2YR0A 3A27A 3LPMA 1RI4A 2JHAA 5EPEA 4CXMA
chains in the Genus database with same CATH superfamily
1LNZA 1OV6A 1PVVA 3U49A 1DKLA 4IIYA 5EY5B 2ON6A 2QZ4A 4MB2A 2ZI6A 2KLBA 2A1UA 3AR2A 4OMUA 2O8DB 1MJHA 3B13B 1PL0A 3LYUA 1RZUA 1POXA 4B85A 5GJCA 2ASEA 5FO1A 4CVNA 3U37A 3R23A 1BYUA 3E9NA 3PC6A 4S0ZA 2UYYA 4U5XA 4WXEA 4QNRA 1YBMA 4NZMA 4BLVA 1TQ4A 1DO8A 1V4BA 4HAOA 4ML3A 2HRBA 5I7HA 4KU4A 2P6MA 4DIBA 5L4NA 3X3HA 4K6HA 1H9AA 1Z18A 4RZHA 1BDJA 1D09A 5H9VA 3C3BA 4IMIB 4EJ0A 1BFKA 1TW3A 1XV5A 3HPRA 4BXOB 2DTEA 1XZKA 4IDBA 4J94A 2WU3A 2XWJI 3LVRE 2BI7A 1YDMA 4BX9A 3DE2X 1DBWA 2PG3A 1Y4AE 2QLJA 2AJTA 2RAUA 4OL0A 4AZSA 4CEJA 1NSTA 2JAOA 3LW7A 4Y2PA 3FSEA 2YNMD 2ZIVB 1S3IA 3ZV7A 2IPNA 4RADA 3V8NA 3CX6A 2ZTUA 4N0EA 2JBAB 3P2JA 1QDEA 3TQFA 3QFTA 2QUIA 3O1JC 3FOEC 4JP3A 2PA3A 2G9NA 1ECCA 1S0UA 3G2HA 3O8RA 1NYLA 1ECJA 3DDOA 4MPTA 1GYPA 4S35A 5BURA 1NLZA 2HQSA 3PGXA 4EUFA 4PZ0A 2GWHA 4AECA 3QI7A 1O0CA 1Q1BA 1JU3A 2NQ2C 3U4DA 2A9QA 2BR3A 1ZC3A 1SPBS 1HDGO 5AOCA 3B1KA 1K89A 3WLNA 2YWFA 1U7TA 2GYUA 2W0SA 5BSKA 1B3BA 1E9FA 4YWJA 2JFYA 4UDYX 4E5DA 1LH0A 2WUEA 5F98A 1AUVA 1YL7A 4U9UA 3LFTA 4PU0A 5DGIA 4HEA6 4EP1A 5C37A 1OH6A 1NMQA 4H7EA 2BONA 4LWZA 1KHTA 4MWGA 3RK1A 5DI9A 3ZU5A 4E70A 3ECSA 4Q21A 3ZDYB 1Z3CA 2QWXA 1TQHA 1B73A 5D1NA 1VHDA 4K46A 2DPLA 3RV4A 3WLHA 1FDIA 1R9JA 1YRYE 4TL6A 4AN4A 1RAEA 5I5EA 3O75A 3Q0IA 2C54A 2WWGA 2X0IA 2F4NA 2JFBA 4JLVA 3L4KA 2IIBA 1NX6A 1W85B 4I4CA 2P2CA 3RLIA 3WMGA 2YOFA 3UGQA 5BWCA 3HI6A 4WNAA 3TRJA 1BDBA 4RQAA 5AKGA 2PL1A 2IYNA 3RW9A 1DX6A 3OEED 1WXWA 3TTSA 4YCLA 4Z99A 5EUQB 3JU3A 3RC3A 4UE6A 2PV7A 5ELMA 3DJFA 2GA9A 1YDEA 3OQJA 4NMHA 5FUXA 3A3OA 4QGAA 2ZT8A 2V6GA 4EL0A 5JZVA 1RKXA 1PGQA 2ZUVA 2RHHA 4KUEA 2PD4A 4EA7A 2WT9A 3HL4A 3ILHA 3KM0A 4FYYA 1UM8A 2Z9BA 3A26A 3PEUA 4HAVA 2ZYAA 4QAJA 3T7EA 3LCJA 1T5OA 1XDWA 2YZ7A 3A2NA 4NL4H 3B1JA 4WNIA 1KMNA 2EYQA 5JXJA 1TAHA 4YAJA 2YWXA 2WZBA 3DVAA 4WDQA 2UU9B 2N9UA 1TU0A 4AG3A 5HF5A 3TN7A 4XQ0A 3EVFA 4BMNA 1E94E 1TZ2A 1U80A 2IHKA 5HILA 5AK5A 3IMFA 1PI3A 1OE0A 4QGFA 3ZU6A 1MAVA 5DBHX 3DR3A 3O38A 3R5SA 3TBFA 5IDXA 2P77A 3W5AA 3DE0X 5JH7B 1PFWA 5JJKA 1HTBA 4UE2A 4EG7A 2VBFA 3EH2A 3EDCA 3INYA 4BKUA 2XCRB 1GPAA 1NUHA 4DY4A 3DE5X 5AJTA 4DMGA 5H5JA 1N78A 3HABA 2UUCB 5CCXA 2IEIA 5AXCA 2YV3A 4PPQA 4C0KA 1FDUA 4JP1A 1NQOA 5TV2A 3LLSA 4NNOA 2G82A 2QTVB 3MCTA 1PJ3A 3C6KA 2V7UA 3FPAA 3LI2A 2IVZA 1EWVA 3PPVA 2EW2A 2VUTA 2ZIGA 1PL6A 4MVYA 5J5AA 2ZRGA 5JAMA 3Q7TA 2VJDA 4BVGA 2QPOA 3TNYA 1WZEA 1NF2A 3HSKA 4CT4B 2F7SA 5EZ5A 2IXFA 1L5YA 4N76A 3WGTA 1HQYE 4WK0B 3OCXA 4R8RA 1G20A 2EJCA 5IJ9A 3WWEA 5KBYA 4DGSA 1A9PA 1V5WA 1W2HA 1LCIA 2OFFA 3QSYA 4IPTA 4AJNA 2RH8A 5BR8B 1F0YA 1IJBA 5G0VA 4TV9B 1YD7A 2FV8A 4ZOBA 4C6RA 4BNIA 4W1RA 3QBVA 5CB8A 4EJ2A 2HSGA 4URHA 1MC5A 1ORWA 4RFSA 3R9XA 1C2YA 3STWA 1AT1A 3LX5A 4RESA 1LSSA 1NLYA 5AXAA 4BB0A 3W06A 5DHQA 1T6ZA 1XZDA 2R8BA 5F1OA 1WOMA 4NU6A 5B7NA 4M1OA 2DYKA 2VA8A 3ADCA 2HLPA 4Y6RA 1JEAA 2HBRA 1F2UB 3ONVA 3UW1A 2ZJ2A 4B3IA 1RLMA 4MZDA 4R7ZA 1SHUX 2P75A 3ZHTA 4RVOA 2HU7A 1OVMA 3KOWA 3FTNA 1VLLA 3BA1A 1HFKA 5KQSA 4M0DA 1TFRA 2FW7A 4WECA 1ETUA 3CX7A 5A5EA 2C5BA 8GPBA 5J1TB 5C8YB 4KXMA 3QU7A 4TMWA 5CR9A 2W48A 4JYZA 4WCDA 1YWGO 4R2XA 3JQBA 5KYXA 2VI5A 2HMSA 3JQCA 1K7SN 1XWFA 1ZRMA 4C78A 4PAOA 4LYDA 4N5MA 5CJPA 3AR7A 4CQJA 1N2ZA 3DD1A 1J9ZA 1ORDA 4MYSA 3KRTA 1PL7A 1G3UA 2AKAB 3S81A 5C4IA 4L9WA 1G98A 4GHWA 3Q11A 4B2YA 2AKYA 4PLVA 1LNSA 1Q1QA 1T2VA 2YRXA 1MO4A 4DNFA 4GKKB 3G2QA 3WTCA 4J0KA 2RHOA 1SUDA 1XHEA 1JWLA 4NQZA 1PNRA 1U1CA 1FFDA 1UPUA 4JI5B 3UMRA 1J4AA 4UD6A 1EK2A 3ODGA 2VJMB 1P1FA 5I5GA 1QK5A 3LXUX 4XTCS 5FBWB 5KYNA 3RYIA 1NN1A 3JQDA 3GJ0A 1RTKA 1CRQA 4GF5A 1T9BA 4RMNA 4KE6A 4YLEA 2OL4A 4DUYB 3CGWA 1YRQA 3N0TA 4JGIA 3UXHA 2G80A 4BVFA 1KEZA 4EITA 1SRRA 3ZK8A 4MGEA 4ZQHA 3K9FC 1F20A 1ZM2A 4TV8B 2XT9A 1UDWA 2ZT7A 3IPRA 3KE9A 5C7IO 5ELXA 3LBIA 3B1YA 2A5LA 3WJ7A 2A0YA 1EUZA 2CNWA 1KRWA 1II8A 1QTRA 3OA2A 4NBSA 4MIKA 4WA7A 2I8CA 5HDQA 1OFHA 4QKQA 4B71A 4MWOA 2IYXA 4GYJA 3DT9A 4JB0A 4LZZA 3EXHA 4MV9A 1ZVKA 2FR8A 2LDBA 4O2BF 3ZK9A 5HKKA 4RTOA 1E1LA 3QF4A 3V3TA 4OGWA 4S1VA 5CNIA 1NMSA 3ICOA 3AG6A 4RYLA 1A4RA 4MI3A 1LDNA 4EG4A 1GAWA 4X5OA 4UU0A 2EBHX 3QVTA 2OCDA 5DN6D 1T2NA 2E82A 1XEWX 3GUVA 3PJDA 1JAYA 1JI3A 3SCZA 5DHUA 4RVDA 1D2CA 3GQBA 2ZYWX 4JK3A 3GJQA 4DPLA 2RGRA 2A88A 3JQFA 2HK9A 4ZI3A 1L8QA 3DTVA 5ULLA 1YU9A 4JJKA 5I51A 4C0AC 1M72A 3H18A 2IP1A 3AC0A 4UUMA 4Q9HA 5I01A 4RIIA 4FLFA 5I3ZA 4H7FA 3FOAA 5LMNB 5BYKA 4UMDA 3FTDA 4RORA 5A6SB 2G07A 4YRMA 1K3FA 1BXGB 3H2ZA 1Q3KA 1ZD8A 1I1QB 3HN7A 3VX3A 5JYEA 4X60A 1OB5A 2Y66A 1G21B 1AF7A 2VXOA 2ZTLA 1OCEA 3DLCA 1CJTC 3N8NA 4WE3A 5LIPA 1OBOA 3R7SA 5AW7A 3QFHA 1FA9A 1CB0A 1WEKA 1GDDA 2O23A 2XKBA 3D4BA 3MM4A 1G7SA 1CRWG 3OJOA 1EZZA 3ECAA 3ZY4A 3N6RA 1SUSA 3P19A 3KS9A 3OCWA 3K32A 4GI7A 1VA5A 1EFRA 1VLVA 1SBYA 3DMHA 4KR0A 4LVOA 3V80A 1NP6A 3W7AA 1WDWB 4KQXA 4YR7A 1Z2OX 3C7AA 4WTOA 3DZGA 3F3MA 4GVXA 3G68A 2FWBA 3FKSA 4BRZA 3QA9A 5IAOA 4YAOA 3T4PA 4ZHQA 4LXHA 2EP8A 4GI5A 4RXUA 4XD2A 4ZJZA 3KD2A 4HNRA 5JCJD 2XXAA 4WLEA 1G18A 4JR0A 1TAGA 1U9IC 1YGPA 4QBTA 3RS7A 4S05A 1YZUA 5CLFA 2A9JA 2O8NA 1KK2A 3VHXA 4DLBA 2AVDA 4DARA 2JLAA 3V2IA 2Z0MA 3TI7A 2D54A 1NFFA 1TO6A 2WZDA 3OP1A 1YQGA 4WXYB 2ODNA 1XZJA 5IHPA 2B2XA 4QBKA 2AEJA 3OE1A 4FYHA 1X19A 2ZWMA 4ND8B 1B0AA 2RC5A 5EP4A 4BNDA 4YRSA 3WSWA 3WIDA 2VHQA 2CL6X 3C8DA 1M74A 2R85A 2WU4A 3QNUA 4W9RA 3UXMA 1RLOA 4W5WA 1SZDA 3FWNA 4HQFA 3U4AA 3PRHA 5L3VA 1P1CA 4NZNA 4CUZA 4K88A 3CLSC 4IJUA 3UJAA 3S8YA 4XX0B 2AG6A 2NP6A 1XRRA 3CEHA 2J7PA 4Q0MA 4HNSA 2OKCA 1QUEA 3SQMA 1ZZEA 3ZZMA 3C3AA 4F4IA 3OQIA 1OLOA 4HH1A 1SD2A 5EA2A 1X7YA 2VJQA 1GCIA 2EZTA 2JHPA 3PWKA 5AI5A 3N2KB 1EM8B 2F62A 2BKXA 5L7YA 5B6JA 1QF6A 2OCIA 4EHBA 1Z26A 4UBMA 2XDQB 1T1IA 2R4UA 1FVFA 1A98A 2OC4A 1RPNA 3HB0A 1K2VN 2ZWVA 5FL7A 5EHIA 4XWGA 2BDTA 4R98A 3O83A 3GT7A 2OXRA 1EBBA 2P78A 4E2WA 1JXQA 4EWLA 1CV2A 1HRDA 4FKMA 5TC4A 4D4MA 5FWYA 4X6XA 5K0TA 4B3HA 4RTPA 4JXXA 4OLHA 1M8PA 4Q1EA 1YIDA 4H3VA 4HB3A 1UOEA 2QL6A 3CZAA 3EAGA 3TJRA 3UMSA 2FF5A 4KDEA 3UHFA 5K03A 3JRXA 1ZI8A 5BMVA 3K71B 3LKDA 4B9EA 5A5DA 4L76A 3GX1A 4BQQA 4NP6A 4IV0A 2W8BB 1HSOA 1GUFA 3C5HA 3VYSB 3G2LA 1PDWA 5CA1B 1R4MB 5I4CA 2FXIA 5GJBA 4TUYA 4LZAA 2QGZA 3DE1X 1JFSA 1XQ9A 4EGSA 1YB6A 4QOSA 1TM4E 3X2EA 2I66A 6PFKA 5KOHB 3M9LA 3F73A 1NN3A 5A04A 2FSFA 4CEIB 1QC5B 4HDCA 4P8RA 3IC5A 4P4TA 5J43A 3KWJA 2X7XA 3E9CA 1P9WA 3KP1A 2JLWA 3NP9A 3ZD8A 3DB2A 1D2NA 3I1JA 3VC2A 3W6PA 2I6FA 3WDMA 3N86A 1M34B 3PUIA 2Q6LA 1YQEA 1AKQA 3H11B 3TVYA 3CLTC 1ZBDA 1B8UA 3MBOA 3IV6A 5THXA 1SQGA 1SZPA 3ASZA 4RJIA 2O0JA 3BZWA 4MR9B 4YJFB 2IYTA 1T8SA 4MCIA 2ZR8A 3UHJA 2JJQA 3W3AA 1PFGA 4LHYA 1J9EA 4OKIA 4Y18A 2BE9A 1DCFA 1GSOA 5EUCA 4CLXA 3HKDA 4OUKX 3AM3A 4GAEA 2FUEA 3KYIB 4PNPA 2FWPA 4LOKA 3VBCA 1GKLA 4JFRA 5CTJA 1O6BA 4R8SA 2GJSA 2JPDA 3ZXUB 5JH7F 3RH0A 4EQZA 5J4HA 5EE3A 4IJMA 4CDNA 2FY8A 2ODAA 3FYDA 1MAWA 4RY8A 3REOA 4BKMA 2Z4RA 1C2TA 2CLSA 3O2SB 4JJFA 2D5LA 4P34A 1PR9A 2OCGA 2WIGA 2ZWAA 3DPIA 4OY3A 4P7KA 3CNBA 5AM2A 3CEPB 1AMOA 1GT91 3WHKA 3RROA 3L84A 2VK1A 4FEEA 3EGXA 1HXHA 2WFLB 4B3CA 1JMYA 4L8VA 1EX1A 1TECE 2P30A 4RWEA 3RS8A 4LC1A 3NAMA 5I9TA 3LLVA 1G5HA 2FTKE 3AUUA 2RHJA 4KAAA 5B1EA 1YK1A 1IBKB 2J3IA 4D4IA 1LGYA 4GKAA 3TXYA 5CXQA 2BFMA 4RD4A 3N2ZB 3WC4A 2QENA 2WLSA 3IBFA 4AJPA 2QTBA 2IYOA 3G17A 2HK6A 5B6PA 4KRFA 4WKPA 1MT0A 3LUFA 4Y9UA 4YRNA 1U31A 2HV8A 3A4TA 2O7RA 3NHAA 4HMQA 4RY9A 3GLFB 4DM3A 5AIAA 3VTZA 4ESOA 4DEVA 3CW2A 5TVGA 3ML1A 1Z74A 3JPYA 1R64A 1G2QA 2XEXA 3DTYA 5KC8A 1XG5A 5ALDA 3JRNA 1XU4A 4MKHA 2IWHA 4FXPA 1TJ5A 4EPTA 2R4QA 3MT0A 2BFPA 4O2RA 4YRFA 3WMRA 1RE1A 4GR9A 4IDHA 2FEMA 2NWQA 1QM5A 3UOGA 2WVJA 3K92A 1KZGB 4U0JA 2FHSA 2QU7A 1XZLA 3E5MA 3R5XA 4MVXA 3L4JA 2C7RA 2JHCA 2JKZA 2MT9A 2WF8A 4GP7A 2IUFA 4B8ZA 4INOA 1JSRA 2OXFA 1HRKA 2XCIA 3G2NA 3SF8B 1NONA 2W2QA 1RQ2A 3N0WA 4WXRA 1RP1A 2B30A 5C8YF 3AWDA 1W0KD 3IPYA 3LBHA 2Q0QA 5K3SA 1ISGA 2OGUA 5JAOA 3E22A 4KN9S 3DJYA 2VHZA 3DMNA 3DMYA 4KQGA 1AUQA 4S0XA 3OQNA 1NYQA 4GICA 4MGYR 4X3PA 2XT0A 4KRYA 4ZAZA 4L4SA 4YP9A 3OOWA 4DG9A 1NUAA 1C9NA 4CU5A 2PRYA 3HRKA 4IIGA 4ZN6A 5JVDB 3CNNA 1LDYA 2FZEA 3DZBA 2BFEA 4QOFA 4B3FX 2OCAA 3L7AA 5E2IA 1R0WA 4NI5A 4D9KA 1QZXA 4M98A 4YRAA 2OBYA 4G6ZA 4N40A 2EIXA 2CV0A 5F76A 1JIVA 2CB0A 5A05A 3HDYA 3EB9A 4MA5A 2OCYC 1DTWA 2C99A 4BFCA 1JQ5A 4NJEB 3ZS8A 4HGRA 1Z5PA 3HJRA 4H7PA 2L69A 3HKBA 4FP9A 1RHJA 1NI4B 3W2EA 3ZHUA 4H7KA 2WWRA 4GKJB 5T4BA 1XKXA 2WLTA 3IPXA 4EZEA 4YMTA 1QP0A 3E70C 1QFYA 2XUZA 1IL0A 3EXEA 4N39A 4YCDA 4ZQCB 4K26A 4TV8F 4UHKA 3IS3A 3GGGA 4OF4A 1KYQA 4K81B 3ZHOA 2Q1YA 3CRZA 2ZBGA 3FNEA 3BULA 3HR7A 4COKA 4BNNA 5B3LA 3G49A 3WO0A 2I71A 1LZLA 5JQGA 1BSVA 4DV3B 4DQLA 5F5XA 3QUSA 2D74A 4R9UC 4ZKEA 2XUPA 3OX1A 3ZHZA 1EG7A 1L7OA 4LI3X 5TEWA 2EEPA 3SLKA 4YGYA 4DLNA 2FMHA 3A6FA 3PHGA 4RK4A 2B21A 1WXGA 2ONZA 3PT5A 1CFJA 3E9ZA 3AVPA 3DDNA 4NOLA 5IH3A 4QDOA 1QGED 3E35A 1TYAE 4ER3A 3ANXA 1GPYA 2E5LB 2DFPA 5K3AA 4BO5A 4NFYA 5EINA 2XWBF 4OOEA 1XZAA 1OYWA 1YZ3A 2B35A 4OI1A 4RJKA 1ONBA 3B8HA 2QZSA 3ZGZA 1CF4A 1RHQA 5ERGB 3H9GA 3OOEA 5FAXA 1YMQA 5KTTA 1Y6RA 3ZV5A 1P8JA 1R5OA 1UP4A 2R00C 5GZ6A 3LX6A 5LJLA 3TXXA 1TT7A 4BCCA 3OFSA 3S1AB 2HF2A 1H05A 4JVNA 4WCVA 3L5OA 4M0PA 4LSGA 3ZHBA 1J22A 4LW8A 2GCPA 1EK6A 2ZI7A 1IZZA 2JVKA 3CJRA 3QVGA 1UDXA 3CPJB 4KVGA 1L1FA 3FVQA 2VQEB 4KFUA 4KR9A 1PZEA 1K08A 1XJQA 3TGLA 5K0GA 1O5OA 4V1CB 2P68A 3UK6A 4DNXA 5KNBA 2VHTA 1I6MA 2DH5A 3F74A 1GAJA 4HXGA 5EIEA 2ZIUB 4K87A 2M9MA 3HCAA 3D6MA 3IHWA 4FYPA 2NO6A 1HT3A 1Q1ZA 3MJDA 2P6RA 1ZD9A 5F12A 2CXUA 4JJGA 4XKJA 2HRZA 4R1PA 1L5FA 2NSJA 4ACAA 5IF9A 2GEVA 2X3UA 3KJNA 1GOTA 3GYGA 3CF0A 4B7AA 4TKVA 3DF7A 4CE6A 2HHJA 2SKCA 3Q15C 3HJAA 4WADA 2BBTA 5GM1A 1LX7A 5DLQC 4HYEA 1VP9A 2VSQA 3A7EA 1CEQA 4X84A 1ZHFA 3RFVA 4TVSA 5EGNA 2W71A 1A50B 3C1AA 1F7VA 1ULZA 1FQKA 3M3PA 5B37A 5JC8A 5HA5A 3J81k 3MVEA 4AMUA 2NVUB 3E1KA 4FYKA 4DCNA 3TLJA 2R7MA 2LVBA 1DKUA 3DLAA 3IAS1 4MVJH 5L95A 1I5RA 1UKCA 1YUBA 4ND3A 1QYRA 4RMIA 5DV9A 2JB9A 1FTYA 4LA4A 5EYPA 2WB4A 4ISBA 2NUAB 3ZR4B 3DNMA 3DT6A 1G16A 1KEVA 3WK9A 2MSKA 2O52A 2QVLA 1FDSA 2ZUBA 1MW9X 1O4VA 3DWFA 2RIPA 3O4FA 4DC0A 3V6LA 3MG9A 4EUEA 1OT3A 2Y0CA 2ZS9A 2X4DA 3VPSA 2YN4A 1TYDE 4A7PA 4BMOB 2FUG6 2X15A 1TM1E 2B7BA 4FSHA 2V0GA 3IEVA 1P81A 3H2SA 3OEHD 3H5AA 4I1YA 2DRIA 3IP3A 1GV0A 4ZAFA 5J4VA 2IX3A 3A4IA 3AY3A 5CA0B 3M33A 2ZXUA 3PQDA 4E32A 1SKYE 1XJ0A 2EZ8A 2QTLA 2QXUA 2CYBA 2R5WA 5GOTA 2CVQA 1E1RD 3FYSA 5GV8A 2D00A 1QHHA 3JASA 4XSHA 2PGDA 4UTXA 2LGJA 3HKEA 4V39A 1YCFA 4ER5A 1M2FA 1Q22A 1UT6A 3DFZA 4HGPA 1LK7A 1Y48E 1W5TA 5EHNA 5JDIC 1GZ4A 1N6KA 3UT5B 1MP0A 4UVIA 4Y9RA 1HT1E 2A9PA 1VCMA 2GCEA 4PC2A 1A9YA 1KL7A 3ESZA 3WL5A 4LXUA 1M66A 3CH6A 5ICGA 4W7HA 5AVWA 1DWQA 1FF9A 2UVPB 2AOTA 3AGQA 4HN9A 2RDMA 2CVFA 1PJ8A 2GJ9A 1C3OB 2IHUA 2FZWA 1NXSA 4DB2A 3IQXA 1J8FA 1WB9A 3L41A 4RGYA 3UBMA 2HK7A 2HEGA 2X0EA 2QYTA 4UUOA 5CA1F 4KZKA 4YX9A 1C14A 4FLMA 3FSRA 4PQGA 4F8EA 4FJ2A 3WLMA 3LDHA 4ND2A 2O05A 3L4BA 5EVJA 3OPYB 4DRXA 1FBTA 2X9NA 4TS4A 4YMUA 1P2VA 1UAGA 3T9EA 5CIWA 5B7PA 2RI1A 1E5QA 2EQBA 2XMSA 4ZCPA 4ESVA 2W6CX 2X40A 3ST7A 3D6AA 3OHMA 5C0OE 5DNYB 1QAOA 5ICFA 4OATA 2XDYA 4P31A 3TSYA 4JUAA 4R1LA 1EG2A 5FYQA 5DHTA 2C98A 1E7SA 1T5SA 4KE8A 3R0QA 2HAEA 1YVEI 1W5EA 2YYAA 2PTHA 1OTXA 4OYYA 1KE1A 1UKEA 3HP7A 1GNRA 1U0OC 2CEKA 1CQPA 2AC4A 2GZ2A 3DTNA 2P9FA 3KELA 4N49A 2OQVA 4AZVA 3UWKA 2EF1A 3FDJA 2ZIEA 2UZ4A 5KDDA 2JFGA 1FX0A 1IBMB 2AFIE 4BO7A 3USZA 2OFPA 4R9VA 5EHGA 3PNYA 4L74A 5LZ7A 3KKNA 1DKMA 5CBKA 4OI0A 2VJPA 4BUCA 3NG1A 2F1IA 1W2WB 3BMNB 2DUNA 1O94D 2I1VB 5EIAA 3DULA 3WICA 4MV7A 2XBMA 3F4KA 2J3LA 2CBGA 5K3BA 3TJMA 1E2PA 1G60A 2JJ1D 4O4JB 2ZSFA 3DEIA 3A8TA 4N7RA 4V0SA 2OILA 3UO8B 3WMEA 2C3MA 5BSTA 1G7CA 1Y7LA 4Z9AA 8ADHA 2ZM5A 3QYJA 1B6GA 2D5IA 2QU8A 2HWWA 1VL0A 4RK1A 4NG4A 1LQTA 2B2NA 3CHYA 4U7HA 5JFGA 4RGQA 2ZUCA 5GIPE 1E9CA 2C7BA 2FW9A 3A2KA 3JQ6A 4DWJA 1RPJA 5JS7A 2BGRA 1OZAA 3DMTA 2PY6A 3VR5A 3ELWA 4DY6A 2BAGA 4Q02A 4NBNA 4XM1A 1AHPA 1NMZA 3N7AA 4XVRA 4ZI7F 4K7JA 3LL7A 4L27A 1LU9A 1PSDA 1QB7A 1GSIA 4ASUD 1CG6A 1AKUA 3QGMA 3O84A 4E31A 2A59A 5K20A 1YZFA 4IVNA 5T6BA 3H2IA 2WABA 4Q3AA 5DNVA 3AFHA 3M5WA 5M2QA 4C07A 2AQIA 5TRTA 4E5SA 2LPMA 1V71A 2ZJ3A 4R16A 1DWPA 4ND1A 2GJKA 4DEXA 1ZOLA 3CKLA 1KQFA 2CL5A 2DHRA 3AM4A 3SZRA 3T95A 1NR7A 2BELA 3ILSA 2XB4A 3LUDA 4OA8A 4UNRA 4I4IA 3WIUA 4ETWA 2WNHA 5FOVA 3BF7A 2GO7A 3VH1A 1CP2A 2ERYA 4MUAA 3A9CA 2ZXEA 3WX0A 1VTKA 3V2GA 1H94A 3HWWA 1T2CA 4N47A 2YDYA 1NY6A 2DCUA 2DFNA 4WCFA 2C4WA 2C42A 4LQLA 4EW3A 4IIUA 4RV4A 5BV8A 3C4VA 4QECA 2D1FA 1CY8A 4NV3A 5FCDA 1FXWA 1OASA 2CHUA 3FTEA 2IV7A 4E21A 5LSAA 3LP8A 3VPXA 2VKQA 1KJIA 1Q83A 4LZOA 1BH6A 1WHTB 4LZJA 3DEFA 3UFXA 4GT1A 2VHUA 4B4VA 4CTOA 1H0RA 1XNHA 2F55A 2XZLA 5KYGA 3BFPA 3THOA 3V1YA 3V8RA 1UAAA 3B3JA 3UWDA 2WJ3A 3PD1A 5EZYA 2J1LA 4NONA 2C00A 2WOOA 1BRMA 1FRZA 1VXRA 5JVDF 1JQ3A 2W2LA 2YJNA 4MR8B 3CA8A 3D6HA 2BSAA 5FJJA 2CDBA 2J67A 3ORQA 1U5BB 1OXSC 4KN6A 5JSFA 2DLNA 5LD2B 2BYTA 3AIIA 3ONWA 1KBQA 5EG5A 1F14A 4X94A 3BMOB 3JD4A 3I3OA 2XKKA 1OB2A 2ZJOA 3VR6A 3CZ4A 1EKXA 3HBFA 1QNLA 1C9DB 1JBKA 2LUOA 4KMMA 4E2XA 4LHVA 1KK3A 1I51A 3IMGA 4ZTUB 1C1YA 1SUFA 2G77B 3EVZA 1GNTA 8OHMA 1BE0A 2PUVA 1KJNA 2OCPA 4W8GA 3W4KA 1KAMA 4CMEC 1MPXA 1T34A 1XTKA 3I72A 4QSMA 4X95A 4YDHB 1O96A 1JWBB 3EIEA 4RHFA 4YRBA 5TARA 5LR6A 1TX4B 2VSOA 3TH5A 4EJSB 1YQ9A 5DHAA 3OZSA 3S1SA 3VV3A 4AZ0B 4XJXA 2EV9A 1IN6A 2QLNA 3F9IA 4OMDA 1TB4A 4R2IA 1T36A 3AEUB 3CZPA 3KXPA 4X1KA 4TWBA 4DUGD 5BNTA 2WUVA 5KAMA 1XQ6A 4YMWA 4ARIA 1ESCA 1ZMBA 3BTOA 2IW1A 1E1KA 3OU2A 1CS4C 3ZHSA 2FFRA 1H5NA 1Q0SA 2CFSA 2GD2A 2SECE 3R7FA 4AWBA 5BUQA 2OCXA 1P6QA 2RGGA 1VB5A 4O8CA 4TTPA 5I7UA 1XR3A 3BXHA 1RSZA 3QPDA 5C2JB 2HJSA 1NJ8A 1XT6A 1KFKB 1WULS 3V9AA 1QH1B 1AK2A 4MINA 5ER6A 3TKAA 4EKGA 1ZR2A 3PQFA 4KMOA 4PYOA 4G5GA 4J0GA 4B1FA 4RV9A 1M2OA 4REQB 2D4AA 2IYVA 1H93A 1R4NB 2VUIB 4F1WA 1S96A 2OPHA 2GTHA 2OAEA 2TSYB 3F8SA 5CIQA 5HIIA 3WO1A 3ZBUA 2PUFA 1SXJD 2RIRA 4TVBA 2ALJA 4YJGA 1JBQA 3CN7A 1W5AA 4I1VA 1Q2XA 2IHZA 5J58A 1G8KA 3EAQA 1R8SA 1XZMA 1KPGA 1PFYA 2GM3A 2XADA 4PLZA 5JLJA 5KU7A 3FVWA 2A1TS 1J0AA 1X1BA 4FCWA 2ZITA 3ZDAA 2IYRA 5BNWA 5I48A 1PDVA 2Y76A 2Z8ZA 5BVGA 2NPIA 1YCGA 1DI0A 1XF9A 1U4NA 1XMSA 4LDQA 5IXYA 3QY9A 2VLBA 5AVKA 4GRAA 1ZK3A 5BRNA 3RC1A 4NZ9A 4D02A 5BPHA 2CLEB 2VT6A 4LQDA 2F8SA 3G0GA 5JJLA 3FKJA 1OLUB 4OXIA 2VJKA 3L0ZA 4UNIA 1Y9AA 2VNHA 4QU8A 2R8OA 1X6VA 1FUUA 2QN8A 3JZFA 2ZVPX 1LFDB 5ARCA 2H4ZA 5L3SA 3PC2A 4KBFA 4PZDA 3SBOA 1WKCA 3KNZA 4A3SA 1P1JA 3WK5A 1JAIA 3W7BA 3OQPA 1MUUA 2H85A 3AJ9A 2DUWA 3IJPA 3JQ8A 2IH2A 3UGJA 2JGIA 1ZVVA 4E5KA 4IKPA 4TYYA 2EFGA 2HXSA 1TYZA 3RUDA 2GD1O 3PUXA 4JROA 1NUTA 2C92A 2UZAA 3E3OA 2OAQ1 1T8RA 3K4QA 3KSDO 2ZS7A 1E1NA 4DZZA 1RBYA 3FR7A 3TNDA 3GRRA 1XTBA 2ZTHA 5BSGA 1S4QA 4UFOA 4E4YA 1ZIOA 5EWLB 4D8VA 2ZCUA 1YR8A 4PC1A 1UOOA 4Q4DA 4A16A 3WLRA 1ML3A 1HSZA 3WAKA 5H82A 1HEYA 3T7SA 1MH9A 1YZVA 2VT3A 1D07A 1XPRA 3BD8A 3G85A 2OXTA 1CIPA 4K9DA 3Q72A 4JC4A 4GI2A 2FOIA 4UHHA 4XX1A 4YROA 3TL6A 2B3DA 4ZMBA 4L07A 4UEJA 1YL6A 3BH7A 1OH5A 3LC2O 5DH9A 1YJQA 2MR5A 2QUAA 4D57A 3PEYA 4L15A 5CA0F 4KC0A 1XAIA 1L5HA 1L4GA 3K8ZA 4ZZ0A 2FN4A 1ZO8A 1P2TA 3AP3A 4C0LA 2XTMA 2HWKA 2FDRA 1JEJA 4RS4A 1F0KA 1W0JD 2FSIA 3VH2A 3KYJB 5E2AA 1SA0A 1SQ0A 2DUMA 1P0CA 4Q01A 2HFKA 4II2A 4WZBE 4D9MA 5JAQA 4IEEA 4AJKA 2X2EA 3C85A 1EWRA 4J90A 3MWDA 4XDZA 4C0JA 4LYHA 1YXMA 4MPDA 4ZO8A 1ZK1A 3FBGA 3SFVA 1E3WA 3ZWCA 4C2BA 4IYRA 2NU8B 2V96A 3ZH9B 1YA6A 3Q2IA 3JD1A 2JFOA 2ZROA 4QA9A 1QS0A 2FZKA 2CHGA 3TFQA 1ESZA 2GVDC 4D44A 1JFLA 2R7NA 4DM4A 1FDTA 3T1YB 2I78A 1JNXX 1FFWA 3BRWD 3D7MA 3QTLA 4PIVA 4F96A 2R8YA 2X77A 4UTNA 1KXJA 4FMCB 5B1SA 5DN9A 4C4ZA 4IJ5A 4EJMA 1VE7A 1T6NA 2C95A 4G3XA 4E14A 3I09A 1DOZA 1AGXA 1RDFA 3PD7A 4H7HA 4DR7B 3OIVA 1BDMA 5HBRA 2BSQA 4NPCA 2P62A 3COWA 3I1IA 1CRZA 3D0KA 5E0OA 1SGWA 5IJAA 2UUAB 1JDZA 1R6BX 2GHTA 2G6TA 2CF5A 1SUWA 5AW4A 1U94A 4BVEA 5KJ6A 2PVPA 3O8CA 1FP1D 3BHNA 3H2YA 1TZCA 3GJ7A 1C0LA 4O08A 2MMGA 4LJ9A 1U7HA 2R6AA 2WF5A 1KZ4A 4Y0AA 2N1MA 2X8JB 2FJUA 4ZT7A 5JFOA 1QKJA 4V2IA 2Q5JA 1JYSA 3R3VA 1NAIA 2OXCA 2C9DA 3SR0A 1JV2B 2C7PA 1NW5A 2EJBA 1C1HA 2YFKA 4R8LA 3D4LA 4WH0A 1A2KC 4D0RA 2O0HA 2C3PA 3HDGA 3IP5A 2JIDA 1G291 1SIWA 4PAQA 1JHZA 1WUKS 1TVEA 1O95C 2JHGA 3HCEA 4L0MA 5DXJA 4ESHA 3A06A 3I5XA 4FDMA 4MS4A 5H3LA 5LDGA 3BCRA 3UXYA 5JBQA 2IPOA 4KPUB 2IUUA 4OLJA 1I4LD 3UC5A 1BWSA 3UB4A 1U5AA 4BJ3A 2EFHB 4EATA 3IUPA 1YB5A 1S2LA 2EHJA 3MRXA 3UG7A 5K0SA 1DSSG 5KJFA 1OFTA 3PG5A 4K2AA 2YWRA 5EJ9A 3STYA 4F6CA 3MLBA 3I3SR 4XM2A 5EXSA 1CZHA 1LLFA 4IICA 1L7PA 4O4JF 2ONJA 3R3XA 1F8FA 5DB4A 4F6RA 2Q2OA 3H8VA 2VWQA 3NHMA 3MEQA 3PJGA 3HS3A 1KP3A 4R8MA 3LXRA 3B5JA 3B9PA 4YJ3A 2GRAA 3HQ4O 4KJXA 1GKUB 1IJFA 2YKGA 3BMQB 2BHTA 3AIKA 3DDCA 5TF4A 2XB2A 4F56A 2VJCA 5AMXA 5A9SB 3AUXA 3GLSA 2I22A 4CQMD 3F6CA 3EPKA 2DSTA 3L7LA 2FWNA 4EKEA 2RH9B 3JWIA 1M2GA 1NRIA 2Q5HA 3LPCA 4FPXA 1FTWA 5EZSA 2AI2A 2KW5A 2V7VA 4R2HA 4FW9A 4N5DA 3EGDA 4WMLA 4D1YA 1V6CA 1Z6AA 4YRCA 5I4IA 3HN6A 1R6XA 4D0SA 5DNDA 3EQ2A 5IXJA 2AG8A 2AE2A 4OSEA 4PAGA 4BB6A 5AVJA 3EWNA 1VLJA 3KDPA 2H0AA 3O8QB 4IYJA 5FPSA 3I05A 1NVVR 2BUBA 1X7ZB 1RTTA 5A3VA 3VZQA 4AUKA 1V9CA 5AKEA 3T34A 2AFIA 4WGFA 3VR2D 2P6PA 3BK7A 3AVVA 4RDXA 4RK7A 4KTTE 2I6QA 3KUUA 2QAJA 2QUZA 1X15A 3MIIA 4Q82A 2CZGA 2QM7A 2Z2XA 4LBWA 2E37A 1I3NA 1RAFA 2FEWB 1LPNA 1RM3A 2OLJA 1TQ2A 2EGUA 4KYIB 1BKYA 4U2FA 1YS1X 3IGFA 2TMYA 3BGVA 3PC4A 5LUBA 3BXFA 1J8MF 1TTTA 2PD3A 3P71T 4TL8A 4HWGA 3VTFA 3KOYA 1T8YA 5CLHA 4GQAA 1I10A 3EMBA 2PHZA 2H7VA 4MAMA 1NN5A 4IHQA 2X5NA 2XXBA 4RH0A 3VNUA 1W36D 3W3ZB 2W6JA 4NESA 1D7AA 1O5TA 1HE1C 1X1AA 1GDTA 1VPEA 3HR4A 5AKYA 3TAHA 4D3XA 5C1DA 1G55A 4DC1A 4XB2A 1A72A 1ZUHA 3H05A 1V25A 3BMXA 3LWBA 5KX5B 4AJ4A 3A1FA 1ISPA 4F8JA 2FQWA 1YZTA 2JI8A 3AV3A 3L6CA 4WGGA 3PNKA 2LZ0A 3ZDCA 5DJ5A 5TQ2A 1M7HA 2PBZA 1CF9A 3DKRA 1Z62A 2VPQA 4FCCA 2IS1A 1P5FA 5D1HA 5LOVB 2XQJA 4BQSA 4DG8A 4DYHA 4WY2A 3K8QA 5FNVB 4BN5A 4PEVA 1SB8A 1JEDA 5HKOA 4XWAA 3W8NA 1KXZA 3A2MA 4HZGA 1UBLS 5TPWB 1Y1TA 2EKBA 3VHLB 4EFDA 3TK1A 1XZBA 1Q15A 1GWNA 3EGEA 2WNSA 4RK6A 4O33A 5C31A 3RJ9A 1MX3A 1NM5A 3FFBA 3F5MA 2X7JA 1XLTC 3BGIA 2HSDA 4RA9B 1P45A 5BWLA 1IDN1 4QRIA 2O06A 4CR8A 2B1GA 1GRCA 1U2GC 2AFHE 2H5IA 5E6RA 3SE7A 3URKA 4UPVA 4IDFA 1GKYA 1X7XA 2AWNA 5AI0A 3VU9A 1ZCJA 4IZOA 5HZHA 3PXXA 1AKWA 2BGNA 3ZGLA 4Z4EA 3C5CA 1P62B 2VPIA 4A1OA 3COSA 4WLNA 4DEYA 2H2GA 3SBDA 5K45A 2AOUA 4V3BA 5CVVA 3ZWMA 5K4HA 4HPXB 1VJGA 3T9BA 3UWMA 4BAGA 1YA8A 1Z0DA 4H59A 4BMPB 4OH1A 5FOUA 3RFCA 1WF6A 3SG0A 2HNKA 4G5OA 2GAIA 4OGKA 3DWIA 3KQLA 1MW8X 3WIOA 2W2NA 3ZI4A 5EMHA 2E0IA 2ZUEA 3BK2A 1V8OA 1XEFA 3PE3A 3HCFA 4EG1A 4MGZR 4TTAA 3R3SA 4QO8A 4ZREA 4LJKA 5T8KC 1WWKA 4FW8A 3M4YA 5HNKA 3COJA 1AKYA 2Z6QA 2HRRA 4D7AA 3WAJA 1LVGA 3V8VA 2ZJ5A 2YHAA 4F1JA 2HHAA 4QXRA 1U8FO 4CF6A 5HHTA 3HMQA 3RVNA 1RJ9B 2IEBA 1K7CA 1W19A 4J0IA 4HI0E 3LYHA 2ARKA 2H54A 2XYHA 4OG2A 3GA0A 5KKCA 1BYIA 2HB6A 3IAM6 3LZDA 5D2CA 4CTMA 4CLOB 4Z53A 1F51E 3OBBA 3V00A 2OZPA 3G2KA 2V1UA 1ZD3A 3ZJVA 4G5HA 2FFJA 2NYAA 5A4DA 4GNKA 2EHDA 2ZSBA 3G2MA 3K0SA 3ECCA 4E5MA 1YGYA 3K16A 4E22A 2HA2A 1A9RA 2JLVA 4I4NA 1MEEA 4E11A 5JSQA 1SIOA 5IWCA 1E8MA 3KQWA 3NIDB 5CW1A 4ALIA 4DLLA 1KVSA 1S1MA 3KJQA 2R1VA 2UKDA 1MXHA 3MTEA 4KYTA 3IX7A 1KRXA 4MITA 4LI0A 2X9QA 4CM4A 5ABPA 4WKGA 5LVAA 5HF9A 2FPPA 2PX0A 4OHMA 5EPOA 1ZKDA 1YL5A 1PUIA 2I8AA 4TXJA 4ES6A 4L95C 3QKRA 2FWMX 1QKIA 1RWPA 2HOQA 2J59A 5H70A 1Z5VA 4TTIA 1FFXB 5DWDA 5BQXA 1YVPA 2RBKA 1FFAA 4YMVA 4QUBA 3HA2A 2BKVA 3G0OA 1RW4A 4AZ3A 2ZQZA 2C2XA 2GF9A 2POCA 3DAOA 1JPJA 4OHVA 3BN3A 4DLXA 3M1AA 3AVUA 2YJ3A 1RRVA 1N6HA 2JAQA 5B4VA 5JNVA 3AJ8A 4BFZA 2B4RO 1SVSA 5JCOC 1VDZA 2KBFA 1MAUA 1C81A 2LBPA 4UUPA 4WFQA 1YS4A 4YEDA 5F7JA 4QE3A 3QEJA 4AROA 2LP4Y 1I3OA 5DGXA 3CXRA 4DV6B 1ZQ1A 5EESA 4CM1A 4KRXA 1O87A 1N6RA 2UUOA 2X1LA 3BEDA 3LCVB 4Q39A 4L7VA 1U63A 2GGSA 2G5PA 1I30A 2OFXA 2OZEA 1ZRHA 2AQKA 2V97A 3DKKA 2C9OA 1T5TA 4LJ8A 4P1ZA 4P98A 1FDVA 4RELA 5TE9A 1IM2A 1T6BY 4O4HB 2CNKA 4RVCA 3B1ZA 3QU4A 4A0QA 2XX3A 3DVLA 2Q0SA 1E3JA 1GQQA 1MNAA 2ZKLA 4MYTA 4HX9A 1JG3A 4L7QA 4E08A 5JTUA 2RGBA 2X2PA 4KX3A 1B76A 1U9ZA 1LDEA 1WSDA 2BFNA 1IB6A 2MJLA 4JS0A 4YAFA 2RAFA 2H3EA 4CF4A 1E79A 1Y8AA 1H6BA 1R7RA 1E96A 1MVOA 2ZQ5A 1LY1A 3O3OB 4LPSA 2YFQA 1V5FA 3I6QA 3BFVA 3LGXA 1TAUA 1VG8A 3K1AB 5BQ3A 1GLNA 3EEFA 1L5SA 1A96A 3OTQA 1T13A 1HZJA 3IUSA 5DW3A 3RC9A 3PDUA 3WLEA 4M8IA 2PVSA 1Z2PX 3RJ5A 2BZGA 5EJ8A 3OQVA 5JNUA 4EENA 1NG9A 3FTQA 4PXAA 2QI9C 3TLEA 2Y1GA 1EDZA 1NFQA 3UV7A 4CCYA 3F3YA 3K4HA 4A6XA 4EUKA 3N7TA 2CYCA 4XVQA 4D8YA 4W8OA 1YHNA 4ER6A 1W25A 1P5JA 4CMCA 4Q5IA 3DGEC 2E5WA 4LYGA 5JAIA 2LRHA 3E2MA 2R2GA 3OIYA 4BNUA 3R5HA 3VSCA 4FMCF 1JB9A 4D4KA 1ZVQA 3CH7A 3W2GA 2R8ZA 3SKVA 5LQDA 2DH6A 2ZSHA 2I4LA 1NUQA 2VDKB 3BL5A 4UTZA 1QIIA 4PWZA 1S02A 2GAFA 2VYCA 4LHWA 2WDPA 2VJAA 1KY2A 2BE7A 2BTOA 2VK8A 1NVWQ 2C94A 3CONA 3ABRB 4K1XA 4DXAA 5B58C 1DELA 4DM7A 3VTKA 3NVKI 3OKFA 1B00A 2O3JA 4FR0A 3K09A 4CM8A 4Y2VA 3A1NA 1S7CA 3FLBA 3I8OA 1T2EA 1V39A 3A4LA 4NZZA 5BSVA 4ZODA 4QDJA 4Y1RB 1SURA 2WKQA 1M2KA 3PPXA 4WZBA 3MGKA 3LQ4A 4GPTA 5B64A 3FJYA 3M70A 1A8QA 3E7PA 3S44A 1ZW6A 2VL7A 2PQMA 4X8HA 3SQNA 1SEVA 2Q8QA 2JFVA 1IBLB 1UBFA 1MNQA 3R7DA 1B2RA 2V9PA 3GT3A 3HJUA 1SVIA 1EJBA 3VR1A 4YAKA 4MPRA 4PIPA 4MI1A 4XYEA 2LCQA 1AKMA 3RAFC 2JVJA 1IBSA 3V7YA 2EP5A 4IFTA 3IO5A 1X8XA 1S9HA 1SBQA 2FLKA 3VR3A 2NO4A 3K35A 1YJCA 3O7WA 1PLJA 4JV5B 3AVTA 4PSKA 3N2LA 1P60A 3AL3A 3R0ZA 3VZSA 1KSJA 3EIXA 3HADA 2PKXA 1KVUA 4KKXB 1I2CA 4L5BA 3WMFA 4YT2A 1P2SA 2NO7A 1FVOA 4ZXPA 3UAXA 4H0FA 1AIPA 1TO1E 2VG8A 4H35A 2O3QA 2QVZX 4QREA 5EIFA 3B5EA 1I9GA 1VHQA 1IUKA 4DCPA 3IHTA 2OEPA 2SCUA 5H68A 1LPOA 1WW8A 3JYLA 1MX9A 3RVJA 1DHRA 4M1MA 4TTQA 4TMVA 3IXQA 5CDFE 2Y4OA 3W4JA 5DX0A 4QYIA 2PXAA 4G01B 4PPGA 3T61A 2YV4A 4OFWA 1EEXB 3EXFA 3PQ2A 3KTOA 3W4IA 2B4AA 5HFNA 3LVBA 2A9FA 1G5PA 2PGOA 3PXGA 4IS2A 1JHXA 5GONB 1IIRA 4CGZA 2E4WA 4GOOD 5E7JA 2IXEA 3KL2A 3QVVA 4XYGA 2I91A 1JBEA 3AL0C 1RWKA 1PZNA 5D3MB 1R0SA 4MV8A 2EWWA 1PGOA 1T4BA 2FI1A 1EP3B 2EX0A 3MTJA 3SAJA 3LO5A 1ECFA 5FUQA 3LOUA 5HM8A 1E2DA 4GR5A 5JIBA 3E53A 1J56A 2QQEA 2PX5A 2V1XA 5BMOA 3F5SA 3MCVA 3QKSA 1U0GA 4PPFA 2C96A 2WZCA 5WRFA 5CCEA 2CE2X 4EQ6A 2Q5FA 2R11A 1OFUA 4NV0A 2LIPA 4WEOA 3WB9A 1D1PA 4UMEA 5GIOE 3UTCA 1YOVA 4A2PA 2R25B 2XQGA 2Q9UA 5EE9A 3U60B 4K9KA 3GN2A 5AR1A 3KUXA 4FEAA 2BFBA 3OQ1A 1CWUA 4PR3A 3FPSA 3I04A 1O9GA 4LYFA 1MOQA 2AW3A 1DARA 1PRYA 1XF1A 1ZGAA 4TWZA 2GUWA 3D59A 1XYYA 5F9HA 3HM9A 1S3FA 3KPWA 3NNSA 5H3HA 3BQNB 4LSWA 2CK3D 3MWYW 3Q3EA 4Q47A 2WMDA 2XDWA 5CB4B 2PZMA 4GXRA 5KX5F 3A1WA 5A02A 4BKPA 4CQNA 1ZJZA 1CKEA 4ALLA 3PX7A 3QU5A 2X9LA 3Q3CA 3K6KA 2QRHA 3FWYA 1PTKA 3QVOA 3C41J 3BORA 2BI4A 4JT9A 4AG5A 3KXKA 1R0XA 5IM4F 3DUFA 1T35A 3Q8WA 4XD7A 2V8BA 2JGFA 5ADUS 221PA 5LOVF 4NCAA 3ZE9A 3MYYA 4K3VA 1QX3A 5FNVF 2EZ9A 3DHWC 3P96A 3Q0TA 2QL9A 3LT0A 3CRW1 4LRTB 4H77A 4Q93A 5ERXA 4QG3A 2W11A 3Q6NA 2FEKA 1Z28A 3N2IA 3SEAA 4PO1A 4FYXA 2ZRLA 1EESA 1BX3A 4C4OA 4FNOA 4Q4AA 2WTEA 3TTTA 3TQTA 3UC9A 2BUAA 4DRYA 4OI4A 1GUZA 2VP6A 4ZQIA 3WK6A 2ZPAA 5MN5A 3QXCA 4JJAA 3MBKA 2RHTA 2JEYA 5COBA 1YNSA 3UCEA 3PYLA 4IWNA 1CY4A 3ZDQA 4JBWA 2PJUA 3BSYA 3UPTA 2P9GA 2ZT5A 3Q7RA 2IHTA 1W87A 5EIBD 4ZEOA 4DG5A 2V7QD 2OGWA 2V7BA 1EP1B 1XU7A 3FIJA 3PPIA 4GX1A 4TMTA 5FOWA 1CQZA 1GTZA 3HV2A 5GGXA 5JCJA 3WFIA 1K6IA 1QFSA 4IDQA 2WUWE 4N6NA 4IR7A 1LV8A 1UWLA 3VVCA 4B7CA 3ZE0B 4NOMA 3OPVA 4LOHA 3KXDA 4Q6WA 3ZOZA 3RIMA 1NG1A 1R9MA 1FUIA 1MH1A 1YI1A 2I7XA 4GSYA 3VHRA 1Q6ZA 1SBHA 2PYIA 2OO5C 3QMVA 5TT1A 1A4XA 3C8UA 1HA3A 2OFOA 1R00A 4MQUA 1RACA 3PTZA 1NWCA 2IL1A 2ZRNA 3PNSA 3VPCA 1ORVA 5CB6A 2EIHA 8ABPA 3AR6A 3KZOA 4PONA 5FWXB 3OG9A 4RPCA 4YT4A 2HWXA 2OMKA 3ESCA 3AW8A 1I7LA 2ZE6A 4NMXB 4QQRA 5HIJA 2MTBA 2OAGA 1NF9A 3C6MA 4YH1A 3F8WA 3GDFA 2AFHA 4JODA 1L5LA 1WY5A 4MUEA 3I9V1 1PJRA 4AY3A 1F1JA 1EFAA 3ZWYA 4M1QA 3OD1A 3DLBA 1UH5A 2JJMA 4CKXA 3UJ8A 3KFXA 4NAHA 4DSNA 1VKHA 5HEKA 2BKLA 2QTAA 3PICA 4UMVA 3GFOA 4CDRA 2ORVA 4J0EA 1PR0A 4OXYA 2ZPUA 2X4GA 1KOJA 2Z5GA 5HR5A 1VOTA 4EB8A 5E9AA 2Z6VA 1FLAA 3OZRA 5KNDH 3JQBC 4EHNA 1N25A 1OX4B 1PYGA 2O59A 1VL5A 4TN5A 1QQ6A 3JPWA 4XW2A 3UJBA 5BQFA 5C81A 2WJPA 1N9GB 3RS3A 2EQAA 1GEGA 2ZRMA 1RJWA 2G9RA 3OE7D 3UMFA 1UEXC 2XMZA 5AI8A 4BIMA 4I6EA 4JB3A 4P58A 5HM6A 1UM9A 3QEMA 1TZJA 2O2ZA 4JBHA 2QRZA 2EZ4A 1BRTA 1Z25A 2QTTA 4LZNA 1TA4A 4NE2A 3RFFA 4DR1B 1RFLA 2BVNA 2IITA 3TS1A 3LCCA 1K3TA 3B9QA 4GKBA 3MYRA 1VPLA 2AF3C 4A26A 1HE2A 4OJYA 2H2FA 2J6HA 3WA6A 1JPUA 4S2UA 2JGMA 2EERA 4FT2A 4Y2XA 1W7AA 1R0KA 3E8XA 5FKJA 3GDGA 3T5GA 1PV2A 5IU6A 1KDYA 4I08A 1UC9A 4MVJP 3T0FA 2HA0A 5BN1A 2W90A 7YASA 1NI5A 1NW3A 2XRZA 1P7CA 2H1RA 2IDKA 4H1HA 4JL6A 1VE3A 2IEGA 3T7IA 5KTNA 1SC9A 1S2DA 4MGKR 2R3SA 2VOJA 4O0MA 4V0LA 4CM3A 5IASA 3IAAA 1IQPA 2AFVA 3AEQA 3M6LA 1UBMS 4O4HF 4DCUA 3DYVA 4Y9SA 1FTQA 1X80B 2QTZA 3QOYA 3NXKA 1Y5LA 2WD7A 3GJXC 4O3FA 5EJ7A 3SWWA 3B12A 4GC5A 5JAUA 3IAXA 2NUPA 3S27A 1R37A 3DHEA 3FGNA 4IDGA 3ZU3A 3EXHC 3QPUA 4XDHA 2FR8C 1HL7A 4YV7A 3VU0A 3IDZA 4DMCA 1VYVA 3ZE2B 4BB9A 2RGDA 2BEWA 4BVHA 4DJ5X 5C5IA 5BP7A 1CJSA 5KOIA 2B25A 2CY0A 1VG0B 4C03A 1ZCAA 4WFIA 3LMKA 3PA8A 4IDDA 1UBKS 4DREA 1G8YA 1X2EA 4UJ3A 2G71A 4FC7A 1JW9B 2VCHA 2YC2C 5IBQA 2LD4A 1VMIA 3G0IA 4ZU1X 2C9CA 3DE4X 4W6QA 1ODLA 2JIZD 4L9AA 3C3WA 4BFSA 3FBTA 1QGYA 2WMNB 4B4UA 4DANA 3CLKA 3AJRA 3QJ5A 4HWOA 2KBEA 4KOEC 2GHRA 4FXOA 4LYYA 2Y1WA 1ZIDA 3ESRA 2EJVA 1WXXA 3ZDEA 1X74A 4GIBA 3S7ZA 3DDSA 3HCOA 4N0QA 4AWAA 4HVLA 3PKJA 3U7GA 4B17A 1PD0A 2WIJA 2MSDB 5ANRB 3RASA 1G0OA 4ZVQA 3FFAA 1S89A 3T5PA 5HRUA 2HC9A 3HSYA 2YXNA 5FEMA 2FGJA 4A9AA 1JJBA 1KO8A 1BGWA 3U4CA 1ZC4A 2GN1A 2AMJA 2NXEA 1X7YB 2BTQA 4X85A 3WQSB 4BWYA 4K9SA 5HZMA 1ZHHA 4PQEA 1WSAA 3CUWA 2PH1A 3AO0B 1RKUA 4FFSA 3IQIX 4XR9A 2Y27A 3PT9A 3I0MA 1ENYA 4FGKA 4G0MA 4HDRB 3VO1A 1ESNA 1ECGA 1RRPA 4LVCA 3TL2A 3GVXA 5KQGA 3DLIA 3TLCA 1N5JA 2LW7A 1CR0A 3S7TA 4KACA 4KXFB 1M2NA 5BN4B 1H8HD 2OK8A 5H4GA 1FBNA 1FEZA 1RYDA 4UVDA 5FWYB 1APBA 3C5VA 3QWFA 2XUKA 3MQ2A 3NTRA 3R7LA 3MWEB 1W73A 3AY6A 3L7NA 4CKBA 1Z6PA 1V35A 2Z30A 3ROTA 1AF4A 4MGIR 4FWBA 3MWLA 1TGVA 5CLQA 3ZV6A 4R71A 3IVMA 5C3UA 3ANLA 3DT8A 3ASVA 4M55A 1KS9A 4YV0A 5KOJA 4WLVA 2ZM6B 2GM4A 3PVSA 1MB0A 4F5YA 3F1KA 1NA5A 4RF4A 3LGAA 1K86A 2VHCA 3C7CB 4J1TA 4TUYB 5FFMA 1OWOA 3GRVA 4HLCA 3QHAA 2WU1A 3EIUA 2JI7A 1P1BA 3OPXA 4DCVA 1GPH1 3QLJA 4RQBA 4IXDA 4W63A 3WLTA 4P0TA 4GLLA 1LW7A 1EAMA 1YJAA 5TJ9A 3BJZA 3BREA 3UMVA 3W7VA 3F5DA 3U3OA 3JALB 1IH8A 1Y1KE 2FPGB 1S1CA 2HJVA 5ALWA 1Y3FE 1EH5A 4DL9A 1EK0A 3D3WB 1XVIA 1D1TA 1M6NA 3N2GA 3NBAA 1BKSB 3G6WA 4WRRA 4DQ0A 2ZB8A 3OCZA 1AQJA 3W77A 4DLPA 3PLAE 4MZXA 4MYDA 3SVTA 2OZLA 3GFVA 3UUWA 1Q74A 3V48A 3TJZA 1K5PA 5CT5A 3LNTA 3TMKA 4D96A 4OHYA 1O03A 1HDCA 2KJQA 3F71A 3R4VA 4Y6LA 1U0TA 2YS6A 4R1MA 5IVKA 2ISSD 5A4KA 3B70A 5CH5A 4DIKA 3DCJA 4TZKA 1ZNZA 4IDCA 5BW5A 2KQUA 1JALA 3HKDB 4GYKA 5TQ0B 1SU8A 2X2FA 5GONF 4LFCB 3X2FA 3K5PA 2BY4A 3O94A 1QO0A 4JUFA 4ZI5A 1WCWA 1JB1A 3S2UA 1Z37A 4E13A 3C3DA 4BFLA 1QHGA 5A71A 5EHXA 1FJ2A 3QENA 2HMUA 2HQBA 4BX3A 5U9CA 4HX5A 1CD5A 3WGKA 4M86A 3ZDBA 1XZFA 2HJHA 4TXNA 2R48A 5H80A 1QB8A 3AHCA 3PXAA 3K73O 3WLLA 4I4LA 1XLUA 3JYOA 1Q0PA 1EUCB 4FK8A 1CY6A 4MVJD 1ZJYA 2Z57A 1PP4A 4KAFA 4HVAA 3BIOA 4CW7A 2ZSEA 5H02A 3DHYA 5EXPA 4FUTA 3DLPX 4QM6A 1WCIA 2FP4A 4OGGA 1EFUA 2P7IA 1VSVA 3B53X 4Q9IA 1OWLA 2CFTA 2GZAA 4XFJA 3W2IA 5CDFA 2PO7A 1D0IA 1TGYA 1UJNA 2HV9A 2EARA 3KR1A 4GU5A 2XNCA 5HMMA 4BNLA 2FK8A 5BN5A 5CB4F 1ZUNA 4N82A 1F6WA 3OZDA 4Y2YA 1E4OA 4BRSA 3FF4A 2OOKA 5GMOA 1CK4A 1IXKA 1CTQA 5E1BA 2JD2A 4GPEA 1T5DX 3WWCA 1TCAA 5DTIA 3TD2A 3QVJA 1TCVA 5EP2A 3RV3A 1F7UA 3TE7A 3N53A 5J5CA 1IOWA 1E1QA 2RJOA 3C8HA 1RLUA 1V6AA 3RSQA 3FZEA 5H7XA 1R18A 3FHLA 1P9RA 1EGHA 1AO0A 4U7JA 1UC5B 1JR2A 5MN4A 1RAHA 1M10A 1Q92A 1T0HB 4FOPA 4PNHA 4QPPA 3COVA 4Z8YA 5HFJA 2O9JA 3X1JA 2G8LA 2IPLA 3VYUB 4NS4A 5CM2Z 2J3DA 4WFKA 2G63A 4B0OA 5E3HA 4YVFA 2X0DA 1GR0A 2NXNA 6ADHA 4OQLA 2P7HA 3DSRA 1AMNA 3WQQA 1A95A 3KCNA 4UUAA 5B2FA 1P0FA 5CT8A 4HP8A 2GCOB 3WIVA 4I66A 4O4LA 3LW8A 3OFNA 1SG0A 5AHXA 3PQ5A 3WL8A 2XRMA 2C20A 1T6YA 4NULA 5D5PA 5K4GA 1S3GA 2ZDQA 4QHYA 3ZU2A 5C1PA 4PQFA 2FPIA 4JJEA 2QRVA 3L2OB 4H3SA 4F7DA 1E9VA 1XHLA 1QIMA 1KSFX 4PYRA 1LUAA 2CXOA 4I2NA 2Y1FA 3OCVA 1OIVA 1Q1GA 2BFAA 4EY4A 4Q7EA 1EK5A 1YQQA 2B1RA 3F96A 3H2GA 3WJAA 2B92A 1AGYA 4CHTA 2H2AA 1DTWB 3NTUA 4RENA 3KLPX 1DDIA 1NU8A 4PHCA 4DLVA 2JKYA 1WMSA 2C9MA 2JGDA 3FJOA 4I4TB 2Q3JA 1GU0A 1ORTA 3H2KA 1T4CA 2H8KA 3NYIA 5EMLA 4F38A 4ZGBA 5HKBA 3GRCA 1EUQA 1TVKA 2QN6A 1NZJA 3I61A 5L3RA 2WJZB 5C52B 2B4YA 1ZU5A 4W1PA 1EXVA 3GUYA 4JLAA 1ONPA 4RD2A 2FPUA 5EP3A 1RAAA 2O54A 1LTHR 1PR2A 3JQAD 1DQZA 3QP9A 4YT8A 4KNYA 1CUXA 4Q6BA 3M1IA 4NE9A 3MN1A 1HE4A 3O3CA 4EKYA 4LTDA 1EA7A 2EBUA 4CIWA 4LDJA 2VDRB 2D0PB 4I5DA 2Q29A 1EQUA 2BV3A 1OBVA 4FOLA 4E51A 5M29A 4A8JB 2ZTMA 2H1HA 2P9CA 2X6QA 3ROEA 2VDUE 1PT6A 4J6EA 2CSXA 1E32A 3KR0A 3KTDA 4TWIA 3SPXA 2QG4A 1FPMA 1E60A 3WGLA 1G2OA 2R62A 2ZJAA 2B6NA 3AONB 1QAQA 1W0CA 2Y0DA 2O2XA 4Q48A 3W04A 2JA1A 2XW6A 3RBXA 3EXIB 1JSLA 4DA7A 1SB9A 2NG1A 4J0CA 5ALOA 4QU9A 1JKMA 4RWZA 4BNGA 1QHIA 2Q6KA 3MHTA 3DOFA 2PSEA 1DBSA 3EDYA 5EJ6A 1FYVA 4R9SA 3N28A 1RBMA 4OHRA 4R3WA 3TIIA 5KS2A 2GQ0A 2REQA 4J0QA 3U3ZA 3P2EA 5K3EA 1YCHA 3Q87B 3GB9A 3GGJA 3F1LA 3LECA 4JX9A 2ZP1A 2P79A 2QNRA 1INLA 3QVGB 3ZCTA 4N0MA 4FGJA 4BLPA 1PF7E 1Y4UA 4M36A 1F2DA 2XGJA 2P3QA 3Q8XB 2CXHA 1IEVA 5ITZA 1MOPA 4N0PA 5BQOA 4GPBA 1O54A 1B8OA 3MJFA 3KOMA 3V55A 3AJDA 3HCPA 2OTCA 3ENZA 4TTVA 4D56A 2DETA 3BGOS 1KQPA 3NTLA 1YULA 3ZIDA 1VBFA 2QTWB 4L6AA 1X0VA 3B60A 4BVBA 4JCCA 4KIUA 4F3RA 3HNPA 5K8IA 3R44A 1JYFA 1XQYA 3GMDA 4FONA 3MWGA 4U8HA 4I1RA 3CVYA 1XYVA 4ZHQF 5T3UA 1EDBA 2RGCA 3MT9A 3H17A 1Q95A 1N8TA 3VHQA 2FUG1 3PIRA 4CMKA 1ZONA 3KXIA 1GQRA 1V3QE 4KCGA 5TY0A 3VXKA 4EI7A 5LKRA 2C8VA 4M7RA 1Z6XA 2PRZA 3EE6A 1GNSA 2GEFA 1NATA 1F4VA 3PF9A 3Q10A 4EQ6B 4QLBA 2K7ZA 3K9WA 5GADl 1UOQA 3B1WA 2WJIA 4QUDA 2PZKA 2IEDA 3R0IA 4TMKA 1U65A 4TXLA 3DBOB 3HVHA 3PZRA 4GRIA 4R5MA 1O0SA 4RVGA 1ODFA 4MUHA 3RGGA 4DYVA 3FHTA 3LBNA 1OBHA 4LZLA 1XTSA 4HTFA 5AHOA 4BRUA 1E3IA 3G1UA 2H4JA 1WA5A 2D3TA 3TZEA 5EYPB 1W6UA 4DMRA 1Z2CA 1FU4A 3ND5A 3QVKA 1GILA 2J4CA 1LD3A 4JIGA 4ODIA 2GASA 3DPSA 5NLLA 1PHPA 3CLUD 1MOSA 4DBZA 1TIBA 2Q27A 1A9XA 5DK4A 1EWYA 3LD9A 1ND5A 3CU5A 3LL4A 1L5MA 2ZYHA 2VN8A 4DLKA 1DXYA 1PK8A 3E3NA 1PJLA 3V1NA 4R68A 4R01A 4CIAA 4PGAA 1ZGGA 5BQPA 3B78A 2BHNA 3IEKA 1GGHA 1YVRA 1W76A 2FYTA 2Q3DA 5BSHA 4AMGA 1ETHA 4NZOA 3OTWA 3EFOA 1RI4A 5KWVA 5LLSA 1KYYA 1B23P 5JISA 1SFRA 4ZU6X 1Z7GA 5LZ5A 3WFJA 1RM4A 3WK8A 4HRYA 5JBNA 5KCZA 1MJFA 2OPBA 3ZBPA 1N5MA 2FMFA 3D7RA 3ZY3A 1H1DA 2I7DA 3T1HB 3R7WA 5C1IA 4YP6A 1VJTA 4MYHA 4MQEA 2VS1A 3IT1A 4M7OA 3T9FA 4PO8A 3TOVA 2UYHA 3RFTA 2CJXA 3KT8A 1X87A 4KQJA 4UUQA 3IQEA 2NQ8A 1MQAA 5GV7A 3GYBA 2FFAA 4JJIA 1XRNA 1Y0BA 3TLGA 1IYZA 2WJYA 1ICEA 4OFZA 4GM4A 3NS7A 3SP1A 2GPTA 4EF4A 3PLNA 2B9EA 3QPVA 3C6QA 3QBJA 4IG4A 3C5EA 3SMVA 2H65A 3JYPA 4LTNA 4E1AA 4RTRA 4TUYF 2AHRA 3S4YA 2DC1A 3SKXA 4OH7A 2Y71A 5KYWB 4KMSA 4TS3A 4NBWA 1XCGB 3LUBA 4JQYA 3TGPA 1RQLA 3PJFA 5K0FA 1UCFA 3ZD6A 4ZCMA 2WHPA 3VPAA 3OAAD 1ZGZA 2L82A 5E4FA 1C0EA 2GILA 1DEAA 1H3NA 1QHFA 1E1CA 2VH5R 3NHFA 5JALA 1EXNA 1HGXA 1M6VA 1Z8HA 3NANA 4IFEA 2C5EA 4GPD1 2J0QA 4M1KA 3LT5A 4YMHA 1X3LA 3EXG2 3IEIA 4RZ2A 5DBOA 5GOZA 3DM5A 3ULKA 3TE6A 4D9NA 4CKZA 1U04A 1SK8A 1HMYA 1I4TD 3ZZNA 5FBLB 4QFDA 4CFSA 2NTNA 1QRUA 2XKJE 3DNPA 1J5EB 1VIDA 3PUJA 1AQ6A 4EPYA 1KZ6A 4PQYA 4QUKA 2FK7A 3M2PA 1L4BA 3OEWA 3FSGD 3NHBA 4KVZA 3SKYA 1GKIA 3EZ2A 4XWTA 3NW9A 2Z2IA 4JXKA 4UPDA 3QVXA 4JLOA 3RS5A 3RVBA 3FAZA 3TBHA 3R9XB 2HF8A 3O92A 2YXLA 4OSPA 4A8TA 1XO1A 1KNXA 3P9QA 1UADA 5F52A 3PYXA 5KYWA 2F3TA 4P38A 5K2MA 1KERA 4C4PA 4MROA 5FDFA 5KMGA 2WIAA 4K40A 3OEYA 1RI3A 2C59A 3H0KA 2RHLA 4RKRA 4UTPA 2HXYA 1L0BA 3V8MA 1C29B 2GXQA 2RKOA 3JAWA 4O59O 3SHOA 1WE2A 4WN3A 3FGPA 4IF4A 1TUGA 3HXKA 5EE0A 1EGQA 1OQAA 2E6KA 4Q4JA 5G1NA 2OWDA 4GZ3A 4M0UA 1KS2A 5FI3A 5FRDA 4LIPD 2I3GA 1PJ4A 5E4JA 1EWQA 3PGA1 4IIEA 4C21A 3M49A 1YZHA 4QDTA 2ZB4A 3EPLA 1NUSA 3KOZA 4OB8A 3BWBA 1G3RA 1U7ZA 3JCZA 3LE8A 3ZLBA 4JYAB 2Z9DA 3TX2A 2K87A 1YZNA 1AA6A 2CMKA 3AF3A 4L0QA 3FNIA 1CEEA 2R86A 1BGVA 1ZSVA 3P9PA 5FLEX 2AI1A 4AMVA 2CVZA 2HHCA 1SXJB 2ZAIA 1E5DA 4C08A 4DA9A 1PR4A 2QD5A 2UVDA 4B45A 1YR7A 4U8GA 2YIDA 3GEEA 4RZSA 3WHLA 4JOQA 2I1QA 2Q3MA 1KU0A 3B36A 4J7UA 3O03A 4CIXA 1WG8A 2O4UX 2GEBA 2VNJA 2Y1KA 2ZAGA 3ANTA 1YIAA 3GP8A 2QM0A 3BWEA 2QD4A 5C4MA 3EVEA 1NVVQ 3GN1A 3ILYA 4QASA 1KEWA 2QL5A 2XCQA 4C6TA 4H3KB 4KPGA 3WLAA 3H5VA 1L4MA 4Z7NB 4ZD6A 2VZ9A 3TAXA 2ZFUA 2BLNA 4R8VA 4JLPA 4K0KB 5EQFA 2C4KA 4ND6A 4LNAA 1XQVA 1CDOA 4EY7A 4X20A 1IPEA 2IEYA 1TVCA 1P4RA 2DUJA 4QOGA 3A1DA 4WCFB 3KSBC 3JX9A 4NEHB 3KR2A 4LRXA 1Y4DE 4LV5B 1DUVG 1CQXA 5JSHA 5I7OA 3A0UA 4DLTA 1NPYA 2BHRA 4RQUA 4ZGGA 1N77A 3CVWA 3GDOA 1CE8A 1GIAA 2YQ5A 2DU8A 3HZRA 3L79A 3QW2A 4HD8A 4PICA 5KVSA 1PN3A 5JSYA 3UFXB 4BJ1A 2VPPA 2ODQA 1UBHS 2GPWA 2I7CA 3JD3A 3G3EA 4MAAA 2NN3C 4LGYA 3VV2A 5HJEA 4KR3A 3UAWA 1N34B 1JHMA 1G9SA 2EYUA 3L8DA 1ZAKA 1AUPA