1V39A

Dc26 mutant of vaccinia virus protein vp39 in complex with s-adenosylhomocysteine and m7g(5')pppg
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
297
structure length
291
Chain Sequence
MDVVSLDKPFMYFEEIDNELDYEPESANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP39
publication title Specific protein recognition of an mRNA cap through its alkylated base.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Methyltransferase
total genus 103
structure length 291
sequence length 297
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 1996-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1v39A00
3P2KA 5FWDA 3B7PA 1BOOA 3HCCA 2HV9A 3SX0A 5EOVA 2PXXA 3OU2A 1X1AA 2DPMA 4KRGA 3REOA 4F85A 2AVNA 1SG9A 2PKWA 3LDGA 5K0EA 1JG2A 4PYOA 5ERGB 3FUVA 3O31A 4GOLD 4CKBA 3FYCA 3HA5A 3KQYA 2HTEA 1VQ1A 1KIAA 3EGVA 4BY9E 5CVEA 2IIPA 3P9CA 3CJTA 5E1OA 4YV2A 5LQAA 4IWNA 2PX4A 4PONA 4Z2YA 5BXYA 4M38A 5K0FA 4GBED 5FADA 1XDUA 1XJ5A 2P7IA 3LECA 2E5WA 3PX3A 1UWVA 2EG5A 3Q7EA 3TPZA 1YFLA 4C06A 3FPJA 5F2OA 2YXEA 2P8JA 3GO4A 1I1NA 5HIJA 1P91A 4RTKA 1R8XA 4KDCA 1FP1D 2OKCA 3BGIA 3Q87B 3UJ8A 3THRA 1L9KA 3LSTA 3HM2A 3V97A 3G2QA 4C03A 4EKGA 1DL5A 4CKEA 4OA5A 3BUSA 3B89A 2H11A 2G72A 4P7KA 3SR4A 3TM5A 2FPOA 5C9ZA 2CMGA 2AOTB 3G2MA 1P1CA 2ONYA 3A7DA 3UZUA 1O54A 3H2BA 3FPHA 3A25A 1SUIA 4DZRA 4QTTB 5CVVA 2K4MA 3X0DA 3DXYA 1EIZA 3I9FA 3KHKA 2JHAA 3KR0A 3E7PA 4RWZA 2UYCA 2NP7A 4LWOA 3MTEA 3P2EA 4IV0A 5K0LA 4PNEA 1N2XA 1JSXA 2BZGA 2VDWA 5EZSA 4YMGA 3JWGA 3PFGA 1ZHFA 3EVFA 5FHQA 2IBTA 1I9GA 2ZLBA 3KQMA 3LBYA 2HNKA 4FT4A 4WVLA 3DLCA 5E9JA 4E2YA 1MHTA 3R0QA 3A26A 4QVKA 4O29A 5K0CA 2OXTA 3P97A 4GQBA 5G02A 1T43A 4CTKA 3FUXA 1R00A 2A14A 5K03A 3HA3A 1IXKA 1NE2A 1NW3A 2BR3A 2JHCA 3PT9A 2PGXA 3M4XA 4DCGA 3T0IA 1MJFA 4X63A 4ER6A 5MHTA 4QDJA 2ZWVA 4ER0A 2G1PA 3U81A 2IH4A 2B9EA 5U4XA 3MQ2A 5IH3A 3SMQA 3KPYA 2PX5A 5FULA 5HIMA 3UA3A 3R9XB 4DA4A 2HWKA 3KR1A 4C05A 3IEIA 1QYRA 5BP7A 4R05A 3OFJA 2PWYA 4R8RA 5EKXA 3L8DA 1VE3A 1ZKDA 4BLUA 4C04A 4RTQA 3ERCA 2N47A 2OY0A 3AY0A 3DLIA 4F86A 3G5LA 4POOA 1PRYA 4RSRA 3BKWA 1R6AA 1BC5A 3UJ6A 2EJUA 3ELUA 4QPNA 5DM4A 2OYRA 1RJDA 3KPJA 3TMAA 4FR0A 2IDKA 2P3LA 1RI2A 4HGZA 5KQSA 3P71T 4PCLA 2ZVJA 1X1DA 3LDUA 1L1EA 1NV8A 3G8AA 1O9HA 3NWEA 4MWZA 4OA8A 5D1NA 2ZCJA 5EZQA 2BM9A 2NNWB 1RJGA 4U7TB 1Q0TA 3EEYA 3TRKA 4K6MA 3SSMA 1KPIA 4DF3A 4M36A 3BT7A 3EVCA 4AUKA 3JWHA 4RYLA 2JHPA 5HFJA 4RTSA 5CVJA 4RTPA 4CTJA 4MHTA 2KW5A 4DCMA 4MIKA 4E32A 1SUSA 3LKDA 5DSXA 1ZGAA 2WA2A 3IYLW 5FA5A 3BKXA 3O7WA 3I64A 5HEKA 2AOUB 2JH9A 4E70A 3GIWA 4GUAA 4XCXA 1VPTA 3FUTA 2PT6A 5HZMA 2NXNA 1WZNA 4V0QA 1YZ3A 2HMYB 3EVZA 3NVMB 5EEGA 4BP3A 4QDKA 2OZVA 3A7EA 3C6MA 2Q41A 5EEHA 3UWPA 4CXMA 4B17A 1FBNA 3FUUA 5K09A 1WY7A 5DRTA 2ESRA 5M5BA 4QTUB 2I6GA 2YVLA 4QPPA 5BW5A 1YF3A 1YZHA 2Z6QA 4V0RA 3KPWA 5EMMA 2ZIEA 4E31A 5HIKA 1EQAA 4OX9Y 1V39A 2CKDA 4LG1A 1B42A 3THSA 3PB3A 2PT9A 4PCAA 3UBTA 3ER8A 1G38A 1XVAA 3KPVA 2GPYA 1XCLA 2IPXA 3HNRA 1X1BA 3LCCA 3M6WA 1N7IA 5LQCA 2ZZMA 2ZZKA 4Y2HA 5ICGA 3EVDA 4FP9A 2AOXA 4OBXA 4EQZA 2ZBRA 4XUDA 3CGGA 3UJ7A 2C7RA 3B3FA 3LGAA 5E1BA 2JH8A 1ORIA 2H00A 5P8WA 3KQOA 1AF7A 1NBHA 3OU7A 1OR8A 1Y8CA 1RJFA 3HCBA 1ORHA 4C4AA 1QAQA 3D2LA 1X1CA 3SXJA 2Y1XA 4KIFA 2IBSA 2B3TA 4BLVA 5E9QA 4F84A 1JG4A 1VL5A 3QV2A 3HTXA 3MCTA 4ER7A 3EVAA 3MERA 5E1DA 5FA8A 1WXXA 1BKYA 1TPYA 3NWBA 4A6EA 1G6Q1 4E2WA 4LECA 1AQIA 3PVCA 3EVGA 5LQNA 3KQPA 2NXCA 3TFWA 3TM4A 1D2GA 3HCEA 1L3CA 3UJCA 4A6DA 2IH2A 1BHJA 1YFJA 3CJQA 1TW2A 2YXLA 2WA1A 1IY9A 3DR5A 2BM8A 3OZSA 4OQEA 2PWPA 4RVHA 3TR6A 2ZZNA 5CIYA 4HGYA 1EG2A 4GEKA 1PJZA 3EVBA 5DTMA 2NYUA 4PYJA 4X60A 3M33A 5LQRA 3UJDA 4G56A 2AR0A 2GH1A 2UYQA 3SSNA 3EPPA 1FPQA 3G2PA 3WSTA 1EJ0A 3ER9A 3GRZA 4OQDA 2AN4A 3HCFA 1JTFA 3HVKA 1JQ3A 4L7VA 5E8RA 3C0KA 3I5UA 2VDUE 3KU1A 5EMLA 4GOMD 1NT2A 1XDSA 4YUWA 4RTRA 3ID6C 4AZSA 2ZBPA 5F2KA 4EK9A 3T7SA 1D2CA 1R8YA 2AOVA 3NW9A 4RVDA 5EVJA 2FCAA 3JWIA 2B25A 3OE4A 3RIEA 4RTOA 4FGZA 5CUQA 5K05A 3EGEA 1M6EX 2UYOA 3KQQA 3TOSA 4EVIA 3JWJA 3DP7A 5DX1A 4AZWA 1F38A 1L3BA 5DSTA 4EKIA 3FPGA 5E9WA 4E30A 4RTLA 3BWMA 2BR4A 3I53A 1SKMA 3LDFA 2GS9A 2QE6A 5K0JA 3MHTA 1JG1A 3B3GA 4H0NA 4PYLA 4DQ0A 1G55A 2P1DA 5K01A 1DCTA 3K6RA 3ANXA 1P39A 5EC8A 1VLMA 1VP3A 2JJQA 3F4KA 4OBWA 2Z6AA 2O0LA 4HRAA 2G70A 2DULA 3P9NA 5D1HA 5DWQA 3FUWA 1F3LA 3DXZA 2ZFUA 3LHDA 3GNLA 3ELYA 3NJRA 5GINE 3ME5A 1UFKA 1XDZA 10MHA 3SVZA 1JG3A 1XXLA 2AN3A 3HVHA 4X61A 2FK8A 5FCDA 2NXJA 5CM2Z 4YV0A 3FPEA 2EFJA 5IKMA 2FK7A 1VIDA 3MGGA 3KR9A 4RVFA 5FWAA 5ICEA 4IKPA 1XCJA 2XYQA 1KP9A 2F8LA 9MHTA 3C6KA 3FPFA 2NP6A 3PFHA 3BWBA 1JSZA 4HTFA 1HMYA 4YV1A 3BWCA 1NV9A 4QQNA 4C07A 5HIIA 3GU3A 5FHRA 2PVCA 3G7UA 4KW7A 4HTFB 5DXJA 3NDIA 4R6XA 2PJDA 5E2BA 2FHPA 3GJYA 4P7GA 3BGVA 3S68A 3MTIA 2PSSA 1JQDA 2O57A 1IM8A 4QQKA 3DMHA 5BW4A 5T6BA 2PY6A 2ZBQA 4YMHA 1SQFA 2R6ZA 1VP9A 3DXXA 3OE5A 4FZVA 4PINA 4ZTBA 5FQNA 2CL5A 2NXEA 2VP3A 2OB2A 3EMDA 1XTPA 2O05A 5K0NA 2JG3A 4C08A 2P41A 3R3HA 2IGTA 3M6VA 3AJDA 4P58A 5DTQA 5EKUA 4FT2A 2ZIGA 1G8SA 2FYTA 3GWZA 2YTZA 4JXJA 1SVUA 4DM3A 3HCAA 3IV6A 1EAMA 5ICFA 5EHIA 5C0OE 2V74B 4ER5A 3CJRA 3O4FA 1YB2A 1WXWA 2ZTHA 2EX4A 3SM3A 4E2ZA 2GAFA 3HVIA 4PWYA 4YUZA 1AQJA 2QM3A 3E23A 2GA9A 3B5IA 2P3QA 1VBFA 2AVDA 1FJXA 1H1DA 5KYGA 3BZBA 1WS6A 1Z3CA 2XVAA 4LWPA 5GWXA 3MAGA 1INLA 3LPMA 5LSAA 4FSXA 2B78A 2P35A 5DXAA 3M6UA 1RI4A 2PXAA 3EMBA 2P3OA 4X41A 5EMJA 2FRXA 5FUBA 3DMGA 5GM2A 2YUIA 5FQOA 5DM0A 4PGHA 3SGLA 8MHTA 3AWIA 3BXOA 2EJTA 2BR5A 3OPNA 4HG2A 4ATNA 1JTEA 3R24A 1N7JA 4AZVA 3NDJA 2PLWA 4CKCA 2VS1A 1G8AA 4PYMA 3PLAE 3MB5A 2QYOA 3NVKI 1Q0SA 3P9KA 3GGDA 3NTVA 1G60A 3OZRA 4PYKA 1QANA 3GRVA 2QRVA 2O06A 1NW6A 1KPGA 5E1MA 1KR5A 1U2ZA 2ZIFA 4MQ4A 5T67A 4GOOD 1WG8A 2QRVB 3GRRA 4YUVA 3DOUA 3RODA 2IFTA 1NBIA 2ZWAA 4WXHA 3CBGA 4E2XA 4YUYA 5F2NA 3E05A 2AOWA 2YR0A 4DKJA 5K0BA 3OU6A 2I62A 3OFKA 3FTCA 1NKVA 5GM1A 3TQSA 3FRHA 3G89A 5DX0A 1R74A 4EMSA 3KR2A 4KDRA 3PS9A 5DRYA 2VDVE 2IDJA 4HSGA 3KKZA 3UJ9A 3UJAA 2UYHA 5DX8A 4GOND 3P8ZA 4XUEA 3KQSA 3OCJA 3G88A 5K8VA 2HR1A 4M7RA 3VC2A 4DMGA 2AOTA 4HH4A 3GRYA 2ERCA 2XYVA 3EGIA 3OZTA 3PX2A 2IP2A 3CKKA 4FSDA 4U7PB 5T64A 3C3YA 2ONZA 1TW3A 4X1OA 3ELDA 5B1SA 3E8SA 5KVAA 2OPBA 3LL7A 3KPUA 1HNNA 1RJEA 3KQTA 4PYNA 3QOWA 3V8VA 2I7CA 5JR3A 4NECA 5LQKA 3GDHA 1KYWA 2ADMA 2OO3A 1JQEA 4YUXA 4BP1A 3BGDA 3HP7A 5EHGA 3G2OA 4RV9A 2XBMA 4ER3A 3GXOA 5CVDA 3UA4A 3FTEA 2O07A 4PYIA 3LCUA 1SQGA 3HCDA 2ZW9A 3QOXA 5EIWA 1KXZA 1R18A 3DMFA 3DULA 2UZ4A 3LBFA 2YQZA 4PIPA 4R6WA 3TLJA 4KWCA 2I9KA 2B2CA 5H02A 5CVUA 2CMHA 5LR6A 3BWYA 1YUBA 5DM1A 3M6XA 3GCZA 4RTJA 2PBFA 2BH2A 3FTDA 1RI3A 5EQJB 2P7HA 2GB4A 2ORED 1JR4A 5EIFA 3PTAA 2PV0A 4XUCA 4R8SA 2GLUA 3MCZA 3GRUA 5GIPE 2XYRA 2LD4A 5GIOE 3EEOA 3UFBA 1QZZA 3KQWA 2Z6UA 2YX1A 3SSOA 5EGSA 4CWAA 3FRIA 3AXSA 5EG5A 1I4WA 2PXCA 3A27A 3T7RA 4RTMA 3VSEA 4RTNA 2ZULA 3DUWA 5CCBA 5K0GA 1ZGJA 3HVJA 3EVEA 4PYQA 2V7EA 5DM2A 4M37A 2R3SA 1KYZA 1O9GA 1KPHA 3DTNA 5CD1A 3TKAA 1D2HA 7MHTA 3FYDA 4UOEA 1QAMA 3C3PA 3A4TA 3HEMA 2IH5A 3G8BA 1ZQ9A 3P9IA 5DTRA 4AZTA 3NMUF 3CVOA 4RVGA 3LKZA 3R6TA 2PX2A 1DUSA 1RI1A 5CCXA 1UIRA 2OB1A 5DPMA 2VZ9A 4QVGA 2G71A 5HOQA 1M6YA 2AZTA 2WK1A 4PGGA 2H1RA 1X19A 3HA7A 4Y30A 5JUWA 1KHHA 2AN5A 3T7TA 2C7QA 4BLWA 1NW8A 1AV6A 5LQJA 3B3JA 3K0BA 5ICCA 5C1IA 2Y1WA 3LCVB 3KQVA 5KQRA 4P7FA 3VYWA 3TKYA 4MTLA 3VC1A 4KIGA 3AXTA 3RW9A 2C7OA 2AOUA 5GP1A 3M70A 5DT2A 5HILA 1QAOA 5EMKA 4AX8A 3IHTA 4P7JA 2XVMA 2P40A 1EJ6A 1ZG3A 2CWWA 2YXDA 4RX1A 2AS0A 5DLYA 5FTWA 4E33A 3I58A 5KS2A 2ZSUA 3DH0A 2OBFA 3ORHA 3P2IA 1FP2A 1RI5A 4PIMA 1NW7A 1NW5A 2QY6A 5E2AA 2C7PA 4FS8A 3ELWA 5GOZA 5LQUA 4GF5A 3CC8A 2PX8A 3UJBA 1M0EA 4HC4A 5E8JA 3LX6A 4GC5A 4GC9A 4KVZA 5EPEA 3FZGA 3FTFA 4ISCA 1P1BA 2G8NA 1L3IA 3CCFA 4IV8A 3G5TA
chains in the Genus database with same CATH superfamily
2W6CX 3WMEA 4W5TA 1ZGBA 2PXXA 4I1OA 5FL7D 5BN5A 1UJCA 2WWFA 2BGJA 2VK2A 3BMOB 1ABFA 4L0QA 3E9MA 2AVNA 2BGGA 1TTQB 3EXAA 3LDGA 1JG2A 4ES6A 5LCXA 1J0BA 5HFAA 3KQYA 3VHLB 4D25A 4LIPD 5J43A 5JALA 3Q4GA 1E6LA 1JKJA 2BGKA 4YV2A 1PLLA 4CDRA 3E5HA 1N2ZA 5BXYA 1MZVA 3ISTA 4HWKA 4CNBA 4EYOA 4CLXA 1KI6A 3PQDA 3UHJA 1EVJA 3JATB 2PKYX 2W6ID 1F2UA 2EP7A 4MXDA 4NENB 1R0KA 1SIUA 3S44A 5CLFA 5HIJA 2H5LA 2Y27A 1EK6A 5I5GA 1T0BA 2ZYDA 3HPQA 4KDCA 2R6DA 1KQNA 2OKCA 3WK7A 4F7DA 2ZJBA 5LWHA 4X92A 1G19A 3FUCA 2Q1SA 4HDNA 1XKTA 4MI9A 5CBKA 3HJGA 2FSSA 4PG6A 2QGZA 1S6YA 4YALA 1T36A 5F7OA 1L6RA 3WL4A 5JT1A 1XV5A 3FDFA 5JEEA 3O9MA 2GZSA 4JJKA 2WKQA 4MV4A 4R0NA 1CUDA 5D7BA 4ZYYA 1L5KA 1T5LA 2K4MA 3D3JA 2WEKA 3BWEA 5JASA 1ZR2A 3CZ4A 1GQ2A 4EUEA 2W4QA 1N0HA 3I9V6 3QNMA 1Y3AA 3P5BA 3JYQA 3B6IA 1BHQ1 1OU4A 1ZH6A 3GJTA 5BRNA 4BX3A 5LL6P 3K0EA 3W6NA 4JC8A 3GGSA 4P4SA 4I1PA 3KQMA 1RABA 1XL1A 2PKXA 1FYEA 2DWOA 4MR8B 3OSUA 5CX1A 5IT0A 1I7PA 4ZYVA 2YY7A 3ZHRA 1NRXA 3R0QA 4Z4GA 2IK8A 1ESCA 3JD2A 3QMPA 4MMZB 3FDJA 5G02A 1YL7A 4LY3A 1PJBA 2O3TA 2XB2A 3ZZ1A 4KXVA 1UMDA 4JVSB 2W22A 3IUNA 4DNQA 3LWBA 1YAJA 3C1TA 3PT5A 1KMIY 2IZ6A 4IIYA 4MS3B 4X63A 1Y6JA 3UUGA 4ER0A 3T95A 3PHJA 4M1SA 3M2PA 5J47A 3OVMA 4MRNA 5AXBA 3WB0A 3ZE8A 3JVVA 2R60A 1P31A 1Z06A 3HDYA 4I4TB 2WWYA 2LUOA 2B6HA 2O7RA 4DTIA 2Q1YA 1R9NA 1SCBA 3L1JA 3R76A 2LRHA 1TU4A 4LXUA 3GR6A 4XVHA 4YRPA 4BMOB 1PRYA 3WDSA 3IUSA 2AF4C 4HAUA 4L27A 4RNCA 4KQMA 1I4EB 1IEWA 4QO8A 5DM4A 3KPJA 5AJUA 1M2WA 1Q7RA 121PA 3PC4A 3IC5A 3H04A 2FEWB 4ZT4A 3ZJ4A 2N75A 3ZV7A 1I7NA 3FIJA 4MOWA 2WY2D 1U0FA 3DLAA 1ISGA 2PQ6A 4E7OA 1F0NA 1JZTA 4A23A 5LA6F 4ZIRA 1AUPA 5HXAA 4I50A 3SSMA 2BCGY 3U09A 3OFND 1E1CB 1UC9A 3KHTA 5AKLA 2OCYC 2UXDB 1A9RA 2C2KA 3UPDA 2XODA 3BT7A 4L50A 1CUJA 4RA6A 1I3OA 3TZEA 2WQ6A 3QW4B 3KQNA 2NXWA 2OCBA 5AW5A 2IKQA 2IPNA 2XXAA 2SKEA 3IXQA 3T7IA 3ZHUA 3QUBA 1WKCA 1DWQA 4FNAA 2UXBB 2G80A 2F1OA 2QSYA 4F4DA 4JZKA 9ABPA 3RS8A 3I64A 3DHEA 5HEKA 1GGNA 5AM2A 1YB4A 1LRLA 1VPTA 1Y1KE 1ZD1A 1RJ9B 2BF4A 2QR5A 3FUTA 3VV2A 4GG1A 1EGHA 4FGKA 1PNTA 2D8AA 2QF7A 2X76A 4HAIA 4YI5A 2LPMA 5L45A 3FLEA 4V0LA 1OYWA 4RF3A 5HTKA 1Z8HA 1UFRA 4C6TB 4Q3KA 2FJ0A 3ZPXA 2AFRA 2XCUA 1NQOA 1TAGA 3ITDA 1PZFA 2JGNA 3S2EA 3OY7A 4A0FA 2P4HX 2Z6QA 1I0IA 4FOPA 4HUQB 2JJ1A 1W0KA 4N1AA 4B3MB 2WIJA 4IDQA 1KFEB 1Y1RA 4WK4B 5EZYB 3RARA 5EE3A 2JHGA 3IE2A 4C7MA 1ZJYA 2PQ0A 4FUTA 2FMTA 3KPVA 1CEQA 3ROQA 3V4VB 2GPYA 4A8PA 4QPCA 4KC0A 4ZU1X 1FP6A 3IT1A 2DLDA 3K8QA 1L4KA 2ZYVX 3SU8A 1B74A 1XZMA 4OBXA 2YJZA 5K6TA 1P74A 4Q9AA 3EDQA 5E1BA 4Z0NA 4ARVA 3V3KA 5P8WA 4ZDWA 1NJ2A 4ZZ2A 4AYWA 4G5GA 3PCXA 5KREA 3PR3A 4QX6A 5HKLA 1VYVA 3MEQA 3OE7A 2OWEA 4RL4A 3TTUA 4KIFA 1KO7A 4D3XA 4YYZA 1I0LA 4ME6A 2GD2A 1FFXA 3RHFA 4JUAA 4BMPB 1EFDN 1NF3A 4IGKA 1M1YE 1ADYA 4REQA 3VZDA 4A6EA 5JFTA 1TPYA 3FNGA 5LZ5A 5JZVA 2JKVA 1L5MA 1TJ3A 4OYLA 1OKKD 4M2LA 3FVRA 4C7BA 2WD9A 1IY8A 3CO0S 3OQIA 2GWHA 4II3A 5CLQA 5D00A 5DHAA 4AUNA 3IPXA 5FBRB 3SYNA 4B82A 2NADA 5KYWA 1JEJA 1EG7A 3IXMA 4LYYA 1E1QD 4A36A 3GGCA 1NG9A 2QYTA 3B85A 4LJ8A 3E22B 5CIYA 2HPAA 1ZD5A 3SPXA 2QD3A 1H0RA 3EK2A 3HFSA 1I6WA 5JPCA 2AFIA 4TT8A 4D7AA 2QAGA 1K6MA 2IU4A 3F6EX 4QBFA 1F48A 2QNRA 4N54A 1SCNE 4N82A 5F4BA 3S99A 3UAWA 3PTZA 2OZPA 1E2KA 3HCFA 3VH4A 3M1YA 1GN9A 4NFYA 3WI7A 2HMWA 3JTEA 3EXIA 1EINA 3FHCB 3A31A 4U1RA 2WUWE 2A30A 2GVZC 4LDRA 4R1MA 4XDZA 1LV7A 5F2KA 3JVUA 1K4KA 2AC4A 2QTAA 2WTAA 1LDBA 3WRWA 4C0QC 3OUTA 1TZ2A 1E99A 5KQPA 3PEWA 4RAQA 2C96A 2RGDA 3PA6A 3R0IA 5E6UA 3KOZA 5AHKA 4G4SP 2W2NA 1K6EA 4B4OA 5C1PA 3Q8MA 2Z2YA 1LW7A 3QFTA 2O1WA 3JS5A 3QOFA 3EAGA 4E30A 1BX0A 1S7GA 2E37A 4EKYA 3FTPA 4UTOA 4E5UA 1GVNB 1X7ZB 1G55A 2AMJA 1Z5NA 1K7FB 3AP3A 2QT1A 1K5DA 4BGDA 1HO3A 3F4KA 2MYPA 3OTIA 4WZAE 1VRCA 4DMMA 1BVUA 1LZLA 3OZCA 4I1VA 1IXZA 3SF0A 3VYRB 2RH9B 4V2UA 4QGAA 1UZLA 2P67A 5HVNA 4KDFA 3A1NA 1ILEA 3L5OA 2G1AA 1IY1A 3AFMA 4YY3B 2WJVA 5KTYA 1GTRA 1TI7A 4K6OA 4Q3AA 3ZNNA 2PMKA 3QYJA 1T1SA 1TTHA 4IJVA 3ZXXA 1HDCA 4IVPA 1Q0PA 2EFJA 1ZNQO 3SBOA 1OE0A 3IAFA 4YAEA 1XZFA 3WV4A 1G63A 2P5TB 2XYQA 1BMTA 1EJ2A 2H52A 2IKSA 4K87A 5DN9A 2IU0A 3U4AA 3W5BA 2PJRA 2REBA 4EF5A 1Q11A 4HTFA 2C4TA 3BWCA 4QDOA 3VBEA 4E12A 2AK3A 1DAOA 4URYR 1JFTA 1N6LA 1SBIA 1XNQB 3KNZA 2Y67A 5EJ5A 5HRAA 5MN5A 4ZHQF 5MFPA 1E9BA 1RWNA 5HQ3B 1R6VA 1FYWA 2O57A 1WSBA 1NT4A 4KQ2A 2Z1MA 5JDCA 4EUKA 5I4CA 2NSYA 4OHOA 5ED0A 4FB4A 4AYTA 1WLYA 3SN6A 2MYNA 3I1FA 3LC7O 5EJ8A 4LQCA 2A9VA 2G07A 4BE4A 1MC4A 1WVGA 2B5VA 3CB4A 4X54A 4CM4A 4QYIA 1XHLA 2P11A 4B79A 2D3TA 3D0KA 1D7OA 4IIDA 3HV0A 1Q3HA 2EBFX 2XMQA 4YN3A 3RSLA 2BKVA 2P4QA 4RZIA 2J6CA 2OMEA 1WVIA 1JPVA 2C5BA 2DERA 1N92A 3GWZA 4KXUA 4NOKA 4DM3A 1WP9A 4ZYZA 1NU6A 2QTNA 2A9QA 3WK8A 1CY0A 4AK9A 2FOXA 3GT4A 5FRDA 1E7YA 3QITA 1CQJB 4BJ6A 1EFUA 2QRQA 1Y7TA 4N49A 1PQ4A 4LJLA 3T0GA 1MJNA 5KWJA 3H83A 1AHPA 1BEUB 1DKRA 1NJ6A 5GWXA 3VQTA 4CL8A 1INLA 1FL9A 1C7RA 1KH2A 4G1BA 2FH5B 1ZM9A 3ZHXA 1R5JA 3CNNA 2R8OA 1YZYA 3M6UA 1YBAA 4D9EA 2C3UA 2GFHA 2XUJA 3EOBI 5CH5A 2ZRFA 5DVZA 3VUFA 4MR9A 2GD6A 4LXYA 3STVA 4B3JA 1NSFA 4JS0A 1GZUA 3IP9A 5TNXA 3FVTA 4K8RB 1CU1A 2R7NA 4INPA 3KX2A 4OQ4A 2CVZA 5ALRA 2AFHA 4TXMA 3OLVA 5JVDB 2AWNA 3OURA 1TEXA 2CY0A 4N03A 5C1OA 5HZKA 1L9XA 1QHEA 5U9CA 1XNGA 4AKSA 4R3WA 1AQNA 2P8SA 2Q0QA 2ZIUB 3WWDA 4WX2B 3TTYA 2HK9A 1WXQA 1Q6YA 1GKUB 2C5LA 1M2VB 3RC9A 4Q4AA 3UPUA 4GI1A 2AX4A 3I2HA 4M3NA 1Y81A 3NBZC 4KK4A 5FWXB 1NJSA 1CT9A 4PPNA 2X19A 3C14C 3MCUA 4KKXB 2JAQA 4HWSA 1BHSA 2UZ1A 5GM1A 1AKVA 1PVVA 2HT1A 4W8OA 2OV8A 4HV4A 1U7DA 4WBNA 3RYFA 1XB2A 4RFLA 3U7FB 4I08A 4UEWA 4EHAA 4J3NA 1O4VA 1H4TA 1PLKA 1ZU5A 1SURA 1GNLA 3LY5A 4CG2A 5CB4B 1U9JA 1PUJA 3JZIA 4UUNA 5CITA 2HR1A 2AQIA 1HYBA 5FTLA 2YJGA 2XYVA 4PLWA 1ZIOA 2B7CA 5LOVB 1G5IA 1W4BA 5AK0A 2F17A 1U28C 2YFQA 1GL6A 3FMPB 4JR0A 1MH9A 3RT7A 1NIPA 4HOYA 1UH5A 3NV7A 5HA5A 3UFXB 1KZ7B 3WWPA 4NECA 4G84A 3WK4A 4EPTA 5IANA 1KYWA 3IJPA 2VT6A 1XEXB 3FA2A 5E6SA 4QZVA 3BRWD 4MJ3A 1JHQA 1B6SA 1OJLA 1QCDA 3TMYA 4KR6A 5CVDA 1ZH8A 2TS1A 2PS9A 3CRZA 2GBIA 4WESB 2RHCA 2ZSFA 3FYUB 4LV5B 4Q93A 3V34A 4WBSA 1MEOA 2G09A 3UXEA 4FYYA 1YWGO 2I9KA 2E3JA 2ZRQA 4PSCA 2B82A 3E18A 1QIIA 4EF6A 1EP1B 1ZUWA 3RFXA 3F6CA 4IHJA 4Z51A 3H1TA 2XGJA 1BSVA 1N7GA 3BFKA 1X42A 3PXEA 1G17A 3TUZC 4G01B 4RLQA 4OGWA 4XUGB 4WDQA 4HFRA 1CUUA 1HQCA 1P0PA 1X9HA 2ZSJA 1BO6A 5H68A 4MKZA 2ZUBA 5AHXA 1A97A 1W5AA 4M76B 2JJ8A 2MMCA 3C8ZA 1AUOA 3TB4A 2J6HA 2G77B 2W9XA 1ORWA 3FWKA 3MWJA 4IOKA 3LK6A 5EGNA 2DFVA 1U2GA 1DAKA 1ZIYA 2G5PA 2J8ZA 5EG5A 2IODA 1QV9A 2JFHA 4CMGA 1KC1A 2O7SA 4YAKA 2BI7A 1FU7A 3GJ3A 3WIUA 3QMVA 4ONEA 1ZGJA 4ZPXA 1B43A 2B2NA 3L01A 4AN0A 4BRWA 3GD5A 2QQEA 3H9GA 2FLVA 4OEHA 1LLCA 1H22A 1XVTA 1B8UA 4FHEA 4KQHA 3TQFA 4UHKA 3HEMA 2CYCA 4F6RA 4ND1A 4BKOA 1IE3A 5MF6A 3E9YA 5CX4A 3NMUF 2A1IA 2VSOA 3C7CB 3VR4D 3L05A 1XMIA 1MFZA 2C2WA 2L17A 4MS1A 4DLBA 1ZD3A 3QI2A 1X7HA 1M6YA 3B7WA 2J3LA 2I3AA 3KWMA 3BJZA 1I4LD 3L43A 1T0UA 4YP6A 5JBIA 1RC0A 3GGOA 3FOZA 1XELA 2GKGA 4F2DA 4EI7A 1JKIA 3P0RA 1YQDA 3IEUA 3ESAA 2E4XA 3JASA 3KQVA 3AHCA 2JD0A 2P9CA 4EY4A 4K6GA 1NXSA 2QKYA 4RXMA 4DQUA 3BSSA 4JDUA 3MRTA 1ZN2A 1ZY2A 3AFIA 1GRRA 4PTYA 2WTEA 4TYPA 4FYMA 4B3GA 2I67A 1M6VB 2QBYB 5A2GA 1EFVB 4U9HS 1DIGA 1JG6A 1SC3A 2O7NA 3BQ9A 2QLMA 4HN4B 3DKPA 1PWXA 1U3TA 1OTXA 1JP7A 2WJ3A 2ZSUA 3JVIA 3QEKA 2I03A 4GBMA 4IIVA 4R9VA 5FBQB 2Z2ZA 3N2IA 4NQRA 4TWAA 2QY6A 5E3IA 5IG2A 4S1OA 3BC1A 4K9OA 1NVFA 4UNNA 1ZIXA 4LX8A 2GESA 1TKBA 1GEGA 3H1FA 3CC8A 4OD0A 1CLUA 3T4EA 4IMRA 1NXQA 4D6PA 5IXYA 5KSWB 1VECA 4P9NA 3NEPX 3TEMA 4JY7A 4DC9A 4OJTA 3M1LA 1Z6XA 4ISCA 3UMRA 3MYYA 4Y1RA 4IQ4A 3CCFA 2WC1A 1XG5A 2YWCA 5EP4A 3P2KA 3WVNA 3I0ZA 1DCFA 3B1JA 4MIYA 4AS3A 3ED5A 5JJKA 1Y4ZA 3K9FC 2Q2OA 2WSBA 3L6RA 2YHIA 4EI9A 4CI9A 1SG9A 5IM4A 1HNWB 1COWD 1UK9A 1M2GA 1USUA 2JVJA 2VL7A 4NMMA 4QEZA 4B2IA 2OFOA 1VG9B 1BD3A 1MVOA 1GKKA 2I54A 4MJ7A 4ZA2A 4I2NA 2FE1A 2NUTB 3RVPA 3H2IA 3KE8A 2WTBA 5JW6A 1LEHA 4JYCA 4AMYA 1DQZA 4KE9A 5K0FA 4RACA 1QFMA 1ID8A 3LECA 4EH1A 1JDUA 2VXBA 4LZLA 1T4BA 2JGJA 4JBIA 4Y2GA 3NHMA 4QBHA 4X7BA 1PFVA 4I4TF 3UW3A 3JD1A 1C1XB 2ZSBA 3EF0A 1R8XA 2WHPA 2P6OA 3EZ6A 3QYFA 3NT2A 1GZHB 4CW7A 3GUVA 5DF1A 4BMCA 5L40A 1M3SA 1TD9A 1A72A 5AKZA 3U49A 1DOZA 2EZ8A 3EXG1 4QYWA 3BUSA 4M0EA 2IYRA 1QGZA 1XMSA 3BYZA 4P7KA 1C9JA 1GIAA 2WVJA 3SR4A 3KU4A 4HDQB 4OI4A 2AOTB 2X6TA 3DD1A 3G2MA 4Q0MA 3A28A 4QA9A 3Q1KA 4UMEA 1K7CA 1SWWA 5ALWA 1SEVA 2J7PD 4FIZA 5ECYA 4C0AC 5HJ5A 2Y4NA 3ICOA 1SUIA 2HU5A 3GEBA 4KEAA 3VR6A 3WGUA 4GKAA 4YR9A 4KDEA 2OHHA 2CLIB 3L6UA 1PT7A 1V5WA 1NR7A 3I9MA 2NZWA 3L7JA 3QNWA 4OYHA 5JS8A 2SHKA 1Z56C 2UV8A 1HZZC 3K0KA 3SC3A 5AOAA 2EWWA 1UBMS 4Y2UA 1ZHOA 721PA 1JFRA 2ZLBA 1K2VN 3HEBA 3QPDA 4RD1A 1QRUA 2X9GA 3L04A 3P19A 4B34A 3UMJA 4XQ9A 3HG7A 4GGMX 3WLOA 2CNNA 5HJ2A 4CQLB 1ISJA 2GEKA 3MWLA 4NMLA 2AWOA 5LJIA 1DTWB 1XRQA 2Q6VA 2FMKA 3BZUA 3PD7A 4O2AB 3A9SA 5HF9A 1GPBA 3K09A 3L7MA 2X0IA 2P6UA 5D3QA 3ZE0B 4YJGB 3FNHA 3OOWA 3GUUA 1YXMA 2HK6A 3U0BA 1G3MA 2JBAA 1KL7A 2G1PA 1L2TA 3G5MA 2YCBA 4F4UA 3ETGA 4XPIA 5CEJA 1M33A 2GPBA 2AQKA 3GCDA 4PLFA 2YJTD 3COZA 3UHAA 3R4VA 4W8HA 1RM5A 4D9CA 5LZ4A 4HRXA 4R8RA 4TMTA 4FILA 4C04A 3AR2A 3FFBA 2N47A 3G5LA 2CD7A 3MW8A 4ZOLA 2VZ0A 3KZCA 3WLLA 1RD4A 3GJXC 3UJ6A 2EJUA 3TMAA 5FWYA 5D84A 5FO1A 4FR0A 4X20B 1VMAA 3KKOA 2FWJA 2Z08A 3CX6A 1WW3A 2VJLA 4X71A 1TGVA 1KR2A 3MK31 1Q3KA 1CJBA 2C99A 1VYHA 2ZAGA 4LC0A 5C3MA 1BGWA 2QN8A 1NXOA 4HYEA 4QQ8A 4IDOA 4JI5B 4U7TB 2IYUA 2WTMA 1TF5A 2BL4A 3PHLA 4OJNA 2IHTA 3GBPA 5D3MA 3D3KA 3TLXA 2ZPAA 1O95C 3H5LA 3E2PA 2IPAB 4AUKA 2AZXA 1JVBA 4HBZA 4RK1A 5TJHA 1O97D 4B3SB 3L7DA 2X0JA 1MORA 1PR4A 2H63A 1E5XA 4JQOA 4WWHA 1TKRA 2M6KA 3NP9A 4X1YA 3K8OE 3SQMA 3AF1A 4Z49A 1B0ZA 1DBVO 1LVHA 1POWA 1VLHA 2HIGA 2VPXA 4WVFA 5DBIA 1WZIA 2HMTA 3M1IA 3SZUA 2FWBA 4DWOA 1YONA 1BS9A 4RENA 1CZNA 1JI0A 5HDQA 3ZH9B 4BP3A 1YZ3A 5I8PA 5IHXA 3UTDA 3H1PA 2A84A 4MUXA 1EK5A 2QQ0A 4UULA 4CG3A 3GJZA 2WM3A 2PMEA 3VR3D 1G3UA 5AQEA 3NRBA 1PFQA 1GJRA 2XD4A 2YHAA 4KBYA 2G3YA 2R1UA 2VXOA 3H2SA 1Y3FE 5EJMA 4Y9RA 4ETWA 4WPGA 1Z83A 3BBPA 4PANA 4WERA 4DLAA 3G0HA 2JFFA 2PRSA 3PD1A 1E18A 1HY3A 4MV8A 3Q15C 2QX6A 1FTNA 1JYFA 4NONA 2ECPA 3DFMA 4G5RA 1AXEA 1XR3A 2E82A 3MHPA 2WLTA 2QL5A 3N0VA 4BX2A 4F97A 3SMVA 5BWLA 3EA4A 2PO7A 4Y2HA 5JY1A 4Z4FA 3CGWA 3Q9LA 1KYIA 2Z8XA 2HXSA 2X3UA 2EJCA 2HSEA 3GLRA 3AZQA 3CGGA 1WP4A 3ZJVA 2H7XA 4EW1A 4G23A 5EINA 3KQOA 4TLCA 4KMSA 4CEIB 2GBFA 2V7UA 2AEMA 3OEED 4ZRNA 1N75A 4MEAA 2OESA 4PCUA 2OP0A 3ZV3A 2VHJA 1E32A 3G8DA 3OUUA 1GU0A 1FMCA 2XGMA 3RVLA 5GONA 1ZR4A 4WOCA 2SKDA 4HAOA 3WHPA 1KU0A 1WB6A 3GXBA 5U1PA 5AW1A 4M98A 1XZJA 5LD2C 4JWKA 2OECA 1T1RA 3NM5A 1LRKA 1Z0SA 3SIWA 4PN3A 4KQGA 3EVGA 3TIGA 4YPOA 5HPYB 3A9CA 3EBLA 4PX2A 3HU3A 3BD6A 3HXOA 2ROQA 1KIMA 3CEAA 3QVVA 5C8ZA 2WFLB 3JQBC 4D4KA 1Z5ZA 2OMKA 5K6AA 4MRVA 2ZI3A 2DHQA 1PNQA 2E9SA 3NNDA 2PWPA 3DE3X 1TEVA 4MP8A 5KTOA 3RIGA 2P9GA 1EGMB 1EG2A 4FXPA 1FRZA 2JRCA 3DO6A 1U5AA 4G9GA 1ORVA 4IS3A 1KJWA 2DR0A 1H3FA 1KI3A 2GF9A 2IYFA 1GSHA 2GH1A 2RH8A 2UYQA 3BA6A 4KZPA 5CHYA 3S3TA 2GAIA 3ZK7A 5GVSA 3LCMA 2YFKA 3TQQA 4BQQA 2GNAA 2VRBA 1P3Y1 1VL6A 1K75A 2EHDA 3DHVA 4M49A 5DNDA 3NKFA 2VDUE 3GYBA 6REQB 3H9BA 1PSWA 3AV0B 4U2CA 2AG0A 2WYWA 2AN1A 3ID6C 5BRAA 5EKSA 4EYKA 2W2OA 1AS0A 2TYSB 1L5FA 5K0ZA 1QP0A 1C9DB 2FPMA 1S02A 1SPXA 3JWIA 5EXEA 3TIIA 1D5CA 1K92A 3QOYA 2CXHA 4MKRA 2E6UX 3ESYA 3B1ZA 3BD7A 4J29A 4QU5A 3UG6A 5EE5B 1CUXA 3EFHA 3IAS1 2QG9A 3I53A 3R5SA 4CQNA 5C3UA 3OF3A 4X62B 1TK9A 1RBMA 1T8UA 1UZAA 2JFOA 4JJIA 4NG5A 5H83A 5B1IA 3DTVD 2E2WA 3ANXA 3MC1A 1SXJC 4KXMA 3G2NA 3PXXA 4LZJA 4P5PA 3TD9A 4UVGA 3UV6A 3ZZNA 5ALOA 4W63A 2O0LA 4Y6GB 3SZGA 3L4KA 2PUBA 1Q1ZA 3DW3X 2QE7A 4PLGA 5CT9A 3UPTA 2ZXUA 1WKBA 3GAZA 3H9JA 5MGBA 3KZOA 4RD4A 2BFNA 3BJEA 3R6GA 4Y9DA 4QJ5A 4HGPA 2Q46A 1U1CA 3ZOZA 4CUJA 4IILA 5AVTA 1E7MA 3SFVA 4BAZA 3IVMA 4I5DA 4RV4A 5IKMA 5KVVA 3DE5X 1TUIA 2QP4A 3AESA 3EIOA 4O0MA 4GHWA 1RPAA 1GUZA 7ADHA 5AOVA 1U1IA 4YRFA 2GXAA 2C42A 2F8LA 4EB3A 5BV0A 1TMOA 2AGVA 2CBZA 4PG5A 1G8FA 3JZMA 3OLXA 5HMLA 4EHKA 4CRWB 1X7YA 4DYDA 3MJEA 5K3AA 1JN0A 1TK2A 1D0VA 4YMWA 2FQ1A 1CEXA 1IB6A 3AFOA 3KTDA 1NLZA 3W90A 4BNGA 4QQKA 1XTBA 3E9DA 2JCXA 4XX1A 5TQ2A 4DREA 1XI2A 3IH5A 3DT9A 3UKDA 4FPXA 5FF9A 3EC1A 3DBRB 1JH8A 1K98A 1V71A 3IBCA 5HJ7A 2A1UB 2QRPA 3ZGYA 1V37A 3L07A 4HKTA 4B45A 4UUBA 2DRIA 3R3JA 4GR9A 4Q9KA 1L7PA 4GM0A 1FYXA 1NVMB 2AYXA 2NU9B 1LK7A 3HUTA 3IDQA 2XCSB 1YTUA 1C1DA 1T4GA 1Q74A 2A5GA 3C43A 4YP1A 3V6LA 4OUKX 3LUAA 4ZTZB 2ZIGA 2RGUA 2DR3A 3I62A 4N0QA 3CSDA 4N5DA 1NNI1 3I2YX 4AU1A 3ZKWB 2PGAA 3GLTA 5JFGA 4HNQA 5ALIA 1Y4SA 2AD5A 3NHRA 3PUIA 4MYRA 3E3OA 4WOBA 4AS2A 1WXWA 5H0IA 3EDRA 1Z75A 1ODFA 2RB4A 4M55A 4Q9JA 2IV2X 3RB8A 5CB4F 2QM3A 3KQKA 1XBTA 2YBEA 2Y05A 1SC9A 1VBFA 3AEQB 3MFYA 1JKFA 2BZSA 2FEAA 5AI4A 1EFKA 1IDOA 3AERB 4ND2A 4WXRA 2GM4A 1M76A 5DOZA 4TRMA 4DEXA 1AKUA 4E6EA 5KNBD 4HAXA 5LOVF 5F35A 4L4RA 2G5GX 3ABIA 2PRKA 2D5LA 3KJHA 3PWKA 3UUFA 2P3OA 3ER6A 4LDPA 2XE4A 2QQFA 2VH1A 3SGLA 2EGUA 4JJ8A 4MVYA 3GVPA 1UZMA 5AO9A 3ZZ0A 1EDEA 1T9DA 3A32A 3WYFA 5KB3A 5G4LA 3E81A 3RUPA 1P1FA 2E21A 2HGZA 2Q7OE 2M32A 1ACMA 3LQRA 1GYRA 4AZVA 4F9GA 1OLUB 3VYVA 1C9KA 3WGTA 3TECE 2C9MA 3QE9Y 1Q16A 3CG0A 4LHEA 5F5NA 3EPHA 4OBEA 2P9FA 3BX1A 3R0XA 5EIHA 4D9NA 5L3RA 5BVHA 4N7JA 2YWGA 1KNXA 1LLUA 1VJGA 3CT6A 3KXDA 4MQ4A 1PTJA 1EVKA 2O19A 4KLCA 1G5HA 1QO7A 1CK4A 4BNWA 1RCUA 4UCFA 1JJ7A 2C4UA 4D9BA 4Q3DA 1BTOA 1R37A 1FP4B 2XADA 1I01A 2B7LA 1ZK4A 3KSMA 2Y92A 5B2FA 3ESCA 3JX9A 1XTSA 3D8BA 3GYGA 2FP4B 4UAVA 2AZDA 1RRVA 4GDFA 4EMSA 1X87A 3BG5A 3H6KA 3LC1O 4CLEA 4B9EA 5AHRA 2V0CA 4N5LA 4XQCA 1QGUB 1DIAA 3EZGA 3M83A 4HSGA 2NV6A 4LZPA 5JHGB 4D8TA 1JF8A 4HPXB 2JFZA 4Y7DA 3UJ9A 4YP7A 4N6NA 3V55A 1IULA 1MRNA 4MWDA 3DD5A 4N0MA 3MSCA 3PUZA 4YRTA 4QEKA 3U7QA 1XD8A 4I5FA 3VC2A 4ZCTA 3G9ZA 3KBOA 3V4ZA 1G2PA 3FLMA 2GHQA 4TVSA 3STWA 3MT9A 4ZANA 2ZUDA 2F1JA 3HY4A 4NBVA 4U00A 5TRTA 1LLDA 3VU8A 1TJ4A 4RVNA 4UM5A 1AC5A 2W2PA 5FUWA 3DQZA 1KOLA 3VHXB 5JHHB 1Z0FA 3SCZA 2I7CA 2ILTA 4H27A 5A9SA 5ALNA 4JP1A 5E7QA 2O8DB 2PUDA 3KL4A 1GGEA 1AQUA 4TXJA 1KDVA 4ALLA 5EIOA 4BB6A 3NUGA 1UUFA 1XTIA 3UC5A 3GPLA 1W2WB 3OCYA 2AG6A 2PGDA 3OUZA 2FZVA 3MIZA 3SDZA 1KBOA 1PX2A 1VIMA 3O8QA 4N8DA 4O0LA 4CF6A 2IXTA 5JD5A 3PF9A 1AA9A 3IQXA 4GP7A 3HKEB 3R3XA 4HH3C 1N6OA 5DGIA 4DL9A 4MULA 3RKRA 5KYVA 2EDAA 2EZ9A 1X7DA 3IX7A 4NENA 4ZQBA 3LTNC 3GC6A 1KO5A 4B7ZA 4C3VA 5IRCD 4EAAA 3GLGA 5G40A 3A9RA 1PNRA 2PT7A 4JEUA 3PRJA 1G1MA 1QYVA 4F8JA 3P1JA 3WRXA 4D3FA 1GOTA 1DC7A 1UOPA 2PKCA 2HUNA 3EQ9A 4UE3S 3ZLJA 3LLVA 2JF0A 3DB1A 3M6IA 4GMKA 4HTAA 1N5MA 1E2HA 1VKJA 3ZDAA 4NCNA 4RZXA 2I1VB 3HR7A 5BQPA 4OFZA 4CCYA 3UUWA 1FLDA 2JAOA 1L8QA 3DONA 3HGMA 1FFAA 4ERXA 3X1KA 3UMCA 1MVNA 1PJ4A 3EHDA 3IQWA 3LLCA 1HORA 1Y42X 3GRAA 1QYXA 4M37A 1Q7CA 2CLEB 3CS3A 3KJFA 4B3RB 5AI9A 3PQ3A 1VJ5A 2AUMA 5GONF 1RE1A 1TE2A 1AZLA 3V9AA 3LAWA 4EY6A 1YZNA 2EU8A 4LJSA 5F64A 3ZR4B 3FHTA 1OXMA 1DBQA 1JHOA 1K7XB 4DMUB 4RVGA 1NNUA 1SBHA 1KORA 2FZEA 1LX7A 2WJGA 3LKZA 4B3FX 5IBRA 3IOMA 3MT0A 4B87A 3CZCA 5HOQA 1XZBA 2QU7A 2FOIA 3NCTA 2O7VA 1UBTS 1XKQA 3FAZA 2I2WA 3CNQS 3FM9A 2BHTA 4LXQA 1W94A 3OCVA 1Y9AA 1SVMA 3SSAA 3TI9A 2XB6A 1V8OA 2BRUA 1JDBB 1SBCA 2MU1A 3LCVB 4XIIA 1CZLA 1TB4A 4L9WA 4KIGA 2C7OA 1BVYF 4JOBA 2BSAA 4PAQA 3L6OO 1IQ0A 5EKDA 1MKYA 1YK0A 1HOTA 3AIIA 4XIGS 2VJNA 1YS6A 2VHYA 2C7PA 2Q8NA 1ZJ6A 4AMVA 4RU1A 1E0SA 2O3SA 1KJJA 2GHIA 5LDHA 2NO0A 5LQUA 5C5CA 4OXYA 1B3BA 2ZAOA 2PRJA 3PL1A 4MV1A 2BONA 4XYEA 4BJHB 1R5NA 4NEQA 2XUAA 1H6CA 3UVEA 2COUA 4I4CA 1ZVMA 4MCHA 1E2DA 1CTQA 2HJ9A 4V1CA 3MGBA 3D6AA 1FVFA 4YXWA 1PV2A 3WYBA 4NESA 4PAWA 5BSEA 3R7WB 5GZ6A 1VI2A 1QE5A 1C4WA 1YB7A 1VKNA 2VAVA 1Y63A 4AMGA 1RXEA 1ENPA 3D8SA 4DNXA 2ZAYA 4R41A 3L6DA 5I6DA 1JDPA 4JITA 2V9ZA 5EY5B 2YJ4A 5I7HA 3SEQA 1JHMA 1XC7A 2C20A 4H18A 1XDDA 1CDDA 1U1DA 1CJTC 3HYNA 3MXTA 2QPOA 4IBOA 1TVMA 1JIXA 3TTVA 4DIOA 1UPXA 2XSZA 3EFBA 4INJA 4DDHA 2ZM5A 3OPXA 4GBED 5DCWA 1C7JA 2GYUA 3P7MA 1VPLA 2E5WA 3RVJA 2ZJ6A 3Q7EA 4LF5B 2H1CA 4AG5A 1JU4A 5F21A 3C8DA 3CIOA 5F4ZA 5ICSA 4FBMA 2GCOA 3FZEA 5B3KA 1CV2A 5BRJA 2XY4A 1GAQA 2PPVA 3NAQA 1CUVA 4AP6A 1OX4B 2IUTA 2PCJA 5J4LA 1P1CA 3A7DA 4I5GA 4TM7A 1R3DA 1THZA 1QZUA 1K66A 2F3QA 2BKXA 2IY9A 3MLBA 4LJ6A 3ZWDA 3STHA 5AW3A 5EUBA 4RCZA 1N9GB 1KEZA 3OX4A 2C0CA 3C85A 1V47A 3G2KA 4FB5A 4ZICA 1GD1O 5TB5A 1U80A 3AIKA 3BORA 1K8XB 5A04A 3AH8A 3KUKA 1V8PA 1XAIA 4F72A 4EPVA 2VDWA 2GEUA 3QE4A 2CMKA 3MILA 5CFLA 4UATA 2LZ0A 3M6LA 4US2R 1GNVA 1WZEA 3DOEA 4AZ0A 4KPUA 1I0ZA 1QIDA 2HNKA 3BXXA 1UP6A 4ALIA 3PJDA 1F0YA 2EF1A 5EFZA 1U7XA 1M6NA 1QHSA 3JW8A 2QL7A 4FEEA 1QX4A 1LQUA 1HURA 1F20A 1FNBA 2BMJA 2VHCA 3NO4A 3SDBA 4MJXA 2YNMD 1ULSA 3B2NA 3VGPA 4TKLA 1Q0QA 2VBIA 1UMBB 2D59A 1V2HE 3Q2KA 3WYAA 2JLAA 5KSOA 2MINA 3JQ9A 1L7EA 4RK6A 1W0JA 1YDGA 2XV1A 2IYWA 3P9XA 3IKLA 1QYRA 5BP7A 2Z6AA 4RTQA 1S89A 4XVRA 1FIUA 3DPIA 3E0QA 2OY0A 1SUEA 4HFJA 3NP7A 4EHFA 1CDEA 1SU7A 3QWIA 4FMCB 4LRUA 4F0JA 4X7MA 5H8WA 5AJWA 4COKA 2EFCB 1A4RA 1AKYA 1A9OA 1U1EA 1R7RA 3IAHA 1GGJA 4TS9A 1W47A 1XCGB 3II6X 4LOLA 3LDUA 5IVKA 5TMBA 4IDAA 4A4DA 1CNEA 2ZEJA 3E5RA 1ZRHA 4HQKA 1JAHA 4YH1A 3S2SA 4FFSA 1QQTA 2ODWA 3TQRA 3SAJA 3KVRA 5E4FA 2IYYA 2Q6KA 4DCUA 5JSZA 3QXCA 4F4HA 1BJKA 1NVDA 1PR1A 2P68A 5G1PA 4BVLA 3LDAA 3CRQA 1QH8B 1KWGA 3D3EA 4MV3A 1E7QA 4GI7A 1IN7A 1YZQA 2WM2A 3CR7A 3QVGA 1TT7A 2OD7A 3C3BA 3QWBA 4FFLA 4MCJA 4RIIA 5C4GB 4PAMA 2WA2A 4U2GA 4D6XA 2VQ6A 4J7AA 2AXPA 5CMLA 3U9LA 3N2GA 5CBPA 4G0XA 4O4IB 4EZIA 2CV2A 2ZRPA 3ZG6A 2X8LA 1M7BA 1S8FA 2H1HA 4Y9SA 5CA0B 2GZMA 4OJQA 3A7EA 3IAXA 3C6MA 5A7HA 8LDHA 1K3FA 1I2CA 3J80A 1J20A 3U4GA 3VPXA 4P08A 4LPSA 4D82A 5JXWA 4EGAA 3QXGA 1JDTA 1W30A 2A94A 1YDWA 4JT2A 3P4XA 1EWQA 5BMVB 5CDUA 2HF9A 2YIMA 3L1KA 1Z5VA 4KXNA 1CG6A 5E6RB 1I2BA 2QN9A 5HMMA 4C4SA 4HLDA 1Z82A 3TLMA 1Q91A 5MDHA 2EV9A 1SKYB 4DRYA 1SH7A 1QUFA 2OM2A 1WBDA 1EE1A 4RHYA 3SC2A 4MKHA 5JQWA 3QVSA 1U81A 5JDCC 1OU0A 2AOXA 4M0LA 4FW8A 3LUDA 4UBMA 1EWTA 4JJ6A 2H00A 2CLHB 3OLCX 3ZYZA 2ZTMA 5KVCA 3GLIB 3C6XA 1C80A 3LUHA 2GPJA 3TEFA 2P9QA 5DKFA 2EKPA 4AJ9A 4H3VA 4HX9A 3AM3A 5IN5A 3S4YA 3WKCA 4CMEC 4F84A 3V4SA 4RQTA 5IDQA 3BN3A 1WB4A 2VYVD 3AOEA 2UYGA 4MGEA 1AQIA 4FYKA 5J2TF 4IDFA 1N32B 4K6HA 4D9HA 1EX6A 3KQPA 3TM4A 1V3TA 1HG0A 4BUCA 2IH2A 2EVWX 3L1IA 1KO1A 3P52A 2BAGA 4D8VA 1QIEA 3MS7A 1TAQA 2J33A 1MEJA 4I4IA 3D5QA 1C3JA 5DI3A 4F5EA 1ADFA 3WL7A 5F1OA 5LLDA 3BJIC 4X60A 2FN7A 3FGPA 1C0IA 4G56A 1LPAB 3WLAA 1EVYA 3IR7A 3PVZA 4LA4A 2RKBA 3KXPA 4KVFA 3SKYA 4B35A 4OQDA 1T0HB 1XRMA 3UO8B 3IL2A 2YMMA 3BMQA 3D6HA 1II8B 3OM0A 4J0IA 4CMJA 1C1HA 1WXFA 1CHNA 3I5UA 3OKCA 4KFRA 4CLOB 3W34A 1FDRA 5BNFA 1SA0B 3F5QA 5I3CA 1X14A 4QAQA 1T0PA 1M2NA 4RVDA 2HPVA 2ISCA 3WG9A 3NHUA 3K1YA 1NBEA 2V1XA 2W48A 2OVFA 4NS1A 5KAPA 4EKDA 1OSNA 2QYSA 4HDKA 4UZSA 2H4WA 2OUIA 4BKUA 1N8TA 2PPLA 1IHOA 5GJWC 3W2FA 2O2XA 4HJXA 3LDFA 4E5KA 4NTZA 3PCRB 2VDQB 1T6ZA 2CVPA 3G02A 3GJ6A 5LXTB 3ZCSA 3DVRX 2Q5FA 5EC8A 5B3AA 3GJRA 4ZOBA 3OOJA 4YP5A 3RFFA 3LO5A 2VPYA 1YRWA 1ZM4A 4AM8A 1H9BA 4LVOA 1OXUA 1F3LA 3P9ZA 4R71A 4QTZA 1AZTA 1FFWA 2PU7A 5GINE 1KJNA 3AY3A 3W78A 2CHQA 3WAKA 2W0MA 5TEVA 3I30X 3RK4A 3SG0A 4PC6A 3HDVA 5D3KA 3CUKA 2PJZA 2JZNA 2A1TS 3T7CA 2G7MC 4DA7A 1V41E 3T5AA 2UAGA 3FPEA 5G0SA 3PGMA 1VIDA 3T1OA 3B70A 4XSVA 3K70C 2UVPA 3FZNA 4HB4A 5J58A 4DKXA 2PMFA 2C2BA 3UK2A 3TX2A 1P5RA 3FPFA 5EIBC 1Z4NA 5KHLB 2VDKB 2ZRDA 3SJUA 2M98A 5HIIA 4GI3A 3P94A 1U6JA 4UM9D 5DLEA 3AX6A 4OX9B 3SVLA 4JNKA 1T15A 1W4LA 1JHAA 2I3BA 4P7GA 1HDRA 1EHYA 1GPLA 4LRTB 2Q62A 5KTKA 1I10A 3K4PA 4RQUA 5BW4A 3DCJA 2GWRA 2I3GA 1E4EA 2PY6A 1Y8QB 1YS9A 2ZAMA 4G07A 5BN3A 1VSBA 2ZB2A 1FDIA 2R6ZA 3D5TA 4IW3B 3OE5A 1EZZA 3EXEA 4HDMA 2VNHA 1PJAA 3AR8A 3GNTA 4A0QA 5KJ6A 2VP3A 1AURA 4J4HA 3D7LA 2W2LD 1NYTA 1U3GA 3EC2A 4PQGA 3VH2A 4YJ3B 3X1WA 3JAMA 1NDHA 2HF7A 5A2QA 3DUFB 3BHJA 3JXEA 1Z0UA 4X6LA 5F9HA 2NTEA 4AN4A 4ZARA 4MWGA 1R6TA 1H2ZA 3GPIA 1KY3A 3ROXA 5L6LB 1XDWA 3I01M 3OJEA 1YK1A 3ZIAD 4ZCPA 3O83A 1U2GC 1P19A 5DHRA 3U80A 4YUZA 1LXCA 4H16A 3B5IA 1Q83A 2NO9A 1OZFA 4H7KA 2PZ8A 3F7TA 1NSYA 1UQUA 3I05A 3PDJA 4ARZB 4YRAA 3N8IA 1E79A 1TT5A 2RH4A 3H5TA 4HB3A 5F1YA 1ZH4A 4EGJA 1XJ0A 1L7MA 4CMKA 5AM4A 3JYNA 1HFKA 2P62A 4UBOA 3CE6A 4F8YA 5F1KA 3JQFA 5BQFA 1R4AA 4Q6WA 5I47A 3U4HA 4XQ0A 1SR8A 5KOJB 4BLTA 5A3RA 5EKTA 3VR2D 4ATNA 5BVGB 2Z57A 3BHMA 2BMFA 4GRIA 1II9A 1JEQB 1SXHA 1YQUA 3MWEB 3VC7A 1D6SA 4BKQA 2HA5A 2XT6A 1R2QA 2P6MA 2C00A 3L92A 1KMQA 2PA0A 1KS2A 4XX0B 2ZE5A 3VPBA 1A5ZA 2BYTA 4L4ZA 1YT5A 2PUJA 3OZGA 1M1UA 2ZKLA 4YT8A 5HUQA 4EG7A 1IZ7A 2H9IA 4KV9A 5FI0B 2BKUA 4PIVA 2QYHA 4ZU3A 5EXXA 1UXGA 1Z12A 1YS1X 4QHTA 1XA3A 2Z5LA 4J16A 3QBDA 3GQBB 5F78A 4LBZA 3V48A 1GAJA 4LJAA 4QRDA 1LJLA 2H31A 4XB6B 1UF9A 2R84A 4H7JA 1IOVA 4XVCA 3K4QA 3MUFA 3FRHA 4U3JB 1GXSB 2RAFA 5DX0A 3M6FA 1V11B 2B69A 3ETLA 1U8TA 3NBUA 3PS9A 4PZLA 3PENA 5EZ6B 4KRFA 3ZY6A 2WU4A 4KQCA 1JS1X 3VH3A 1GPJA 4D9KA 3LUPA 3PKZA 4C2TA 3HZRA 1PR0A 3TZBA 3AB3A 4NLLA 1U0TA 5HGJA 1JT9A 5JZOA 2UYYA 3SE0A 5HQTA 4NDNE 3ABOB 2D0OB 1B4DA 1T25A 4IJKA 3C3YA 5KVAA 1W52X 1QG4A 5T7BA 4BQPA 1WKVA 1TM1E 3TLEA 1CIJA 4MW2A 1ENZA 1AY0A 3NHWA 3VZSA 1WRBA 4IVRA 4YB8A 1TUEA 5BV2P 3SOZA 1XRNA 3ZV6A 3U9TA 4ZT2A 3GLHA 1Z6YA 4TVKA 4UAUA 1TEHA 1PN3A 2CF6A 4PVDA 5T8KA 4KR2A 2RAUA 2C95A 2BFWA 3N6XA 2XIJA 4HZUB 1DSSG 2AJDA 3F3YA 3RVOA 3ADBA 1FLAA 5EJIA 2RC6A 4CVNA 2C58A 1KRWA 4DA6A 1J5EB 2FMXA 1OWLA 3UQZA 3U5TA 4OIMA 5HBGA 4XGIA 3EJ6A 5AUQA 1XVUA 1PQPA 2DHRA 2R8YA 4UZFA 1JU3A 1KDZA 3WO0A 3UGTA 3ZCVA 3NGMA 4BJ1A 2G28A 4TMKA 3WLMA 4F5WA 1FVHA 1DBWA 1DS6A 4OATA 3ZWXA 2DFTA 4EBBA 5BUZA 4WN9A 3DDUA 4O4HA 1JZQA 1IJKA 1ZNXA 2G82A 3TSYA 5BSFA 3DDNA 3WRVA 3TZHA 2ATCA 1J49A 1Z8NA 3VI3B 5ALZA 3LF1A 1XAJA 4YDQA 3AXSA 1XZKA 1ZOPA 4ITRC 1FX0A 3BIOA 1IAVA 1NUQA 1XOIA 3DT8A 4YT5A 3I1IA 1L1FA 3LRXA 5L3SA 1N2GA 2Q2WA 3ZGZA 4U5QA 5ENZA 5BYKA 1EVIA 2OFPA 2B8TA 2UVDA 4R7GA 1HKUA 3QXJA 2ZBVA 1KYZA 4HQ6A 3FJ1A 1V95A 2CLCX 2AMYA 2EJWA 5J59A 3S5JA 3TH5A 3BIFA 3HL4A 3JQ8B 3RS3A 7REQB 5IAOA 2AFIE 2OV2A 3C8HA 1ZGZA 5CG1A 2H59A 4O02B 3TCKA 3KSUA 4WOPA 5CIQA 4HH0A 2NUAB 2NPFA 3U48A 5K3BA 3CVUA 2OA0A 1DEXA 3DBVO 1BA2A 4CM3A 1JYEA 1P80A 1PGPA 5G1OA 2ZQYA 1H0SA 1XZNA 4KMOA 3PRKE 5ARBA 4N5IX 2GN2A 2B2XA 4FU0A 1AJEA 5K45A 4P7FA 3VC1A 2J4DA 1QH0A 1W85B 3GT7A 4O4LA 4MV5A 2H9AA 1C30B 5EJ4A 2ZUUA 1OBFO 3AY7A 4OL9A 2WAYA 1AXGA 2A33A 4AKGA 2PL3A 2JPDA 5KWIA 1WF6A 4JQCA 2PEYA 3G7NA 2AJ8A 1NZJA 2VA8A 5BSTA 4R40A 1FP2A 2ERYA 4PIMA 3ZU3A 1DCTA 2CLFB 3RRJA 5CDSA 1I3LA 1YCHA 1L4UA 3UAZA 3PEYA 2CKMA 4LHYA 1EFTA 1FTQA 4B4WA 1CY4A 3V7NA 1CR1A 3I5MA 2MMGA 5EPEA 1JHYA 4JIGA 4C01A 5FUYA 1Y8RB 2RBKA 5J23A 4MRMB 2O5CA 3KJGA 1MJGM 1U9YA 2C07A 3H9UA 2JCVA 1Q1QA 4H1UA 4IV8A 2J7KA 4ZAFA 2QTVB 3C7DB 3C7TA 4BO4A 2FAXA 4MVJD 5UKDA 3INGA 4RGVA 1NG1A 1VGRA 3ADOA 3OU2A 4H60A 1JBQA 1X1AA 3FVQA 3N2ZB 5EYPA 3REOA 2WUVA 2G67A 4FFVA 1QE0A 2VEDA 4G65A 1E3DA 4IEEA 1KZHA 4U2DA 2IOFA 3DO8A 4HEA1 3FYCA 3QTLA 3RH0A 5CA1A 1V4VA 2GGSA 5CCDA 1YA4A 4EPXA 4Y67A 2C88A 3CJTA 5CW1A 1FUEA 2NU6B 1GA6A 3BIJA 1QZTA 1WO8A 2Q7DA 3OZWA 1D6MA 5FADA 4Q3NA 3FGNA 2P7IA 5DU2A 4K9LA 4TMYA 2IX3A 5BOVA 2DX7A 3FKJA 3AFHA 3PX3A 1HE4A 2M6LA 4AKTA 4Z86A 1AMOA 1V16A 2QUKA 2B4TO 2R86A 3KSZO 4II2A 3QIVA 1LPNA 1MR3F 3LYUA 3ETHA 2AG1A 3LRPA 2AB0A 1LUAA 1PZGA 4EB6B 1G6HA 1A1VA 2FMFA 5H7XA 5IKXA 1PS9A 1E6CA 3AW9A 4MRSA 2O6HA 4XB2A 1XLWA 4DAEA 2Y1LA 1GQSA 2B20A 3M4NA 2CHFA 3BD8A 4PBRA 2OV3A 1GGHA 4ZD6A 2NIPA 3ZW7A 4FXOA 2QMZA 5LYYA 4DZRA 1A5TA 2P0YA 3A1VA 3RDPA 4RWZA 4TMFA 2O2ZA 3P2EA 4J4TA 4LVUA 2FPWA 5LWQA 3K6SB 1OZAA 3KSAC 3UWDA 4DSAA 1H4QA 1LTKA 1Z7EA 5AYVA 3QSGA 1G64A 3MMXA 1SUPA 5CFMA 5FHQA 4UOZA 4I4LA 4KSYA 3LBYA 3RC3A 2C2OA 1FS4A 2JZCA 4JI6B 3CPHA 3RRBA 4TQUS 5B7NA 1NBMD 4YMTA 5EVCA 3A6PC 1RZRD 3FKSD 3JAWA 3W6UA 4O29A 1PX0A 2OXTA 3VTKA 1RYNA 3VJKA 3ZD7A 1R4MA 1XUOA 3E1GA 3EZYA 4CTKA 1XZQA 5LYJB 1I5EA 4QFCA 4M0UA 4G09A 4IG4A 1B8VA 2ECQA 3NONA 4NC9A 5JWHA 5BWMA 5K6AC 4JV5B 1BYUA 3MG9A 4AIRA 2WR8A 3M4XA 2ZPTX 3T0IA 3LLUA 5JXJA 1P1RA 4NMXB 1CY6A 5JTTA 1BVHA 5L53A 1F8FA 1XRLA 5TMEA 3B2QA 3SQLA 5DHQA 4DJEC 2AFHE 3LNTA 2HW8A 5GJBA 1QPZA 3KUXA 4MQEB 5SZHB 3WY9A 2CZGA 2M6RA 2NGRA 1U3DA 1A9TA 3TD6A 1XXHB 2ZIXB 3IEIA 4WLVA 1YUNA 2BFPA 2QQGA 4IGIA 4LWQA 3PDUA 4UUMA 4F6LA 3AY0A 1XWIA 2XIQA 2I4TA 1RQLA 2V7BA 1M8FA 3E70C 3QBEA 3FF1A 1PT8A 4I1YA 4NBNA 4QUHA 4X1IB 4BVKA 5C8VA 2D7DA 3PTLA 1T2UA 1UT8A 1Z4MA 2EYUA 3AJRA 2FOLA 2AW3A 1VSTA 4RIHA 4QOEA 1CE8B 2BFDB 1G0NA 1GKIA 1VE1A 1USGA 1Z0DA 1Z22A 1Y5LA 3FVWA 3H75A 3NWEA 2J3IA 5D1NA 3RIXA 4YASA 4AAYA 1F7UA 3GT3A 3AM4A 3MJCA 1XA4A 3QELB 3GMSA 3NHJA 5FR2A 4AZ3B 4RMHA 3EGXA 4M36A 4L5BA 4BNKA 4JI7B 4BL5A 3QJGA 2P6RA 3RBZA 1KJQA 1BEEA 3F97A 5LUBA 3VV3A 4YPVA 2O8BB 2FPGA 5FAKA 2JHPA 3LBAA 4LQ4A 4RTPA 1NW9B 4A2WA 1DTSA 3KLPX 4GMXA 3NM4A 4CMHA 2N1BA 2ZJ0A 4Q9NA 3H0EA 2P30A 5DSXA 2CLOB 2DB3A 2NZVG 1RJ9A 1RWPA 1CULC 4CTNA 1RXUA 4PZEA 4DJ5X 5CB0A 1TQ8A 3GIWA 3PIRA 4UNQA 1XFAA 5AT1A 2P77A 3K1ZA 2BISA 1NL3A 3UOAB 4QC2A 2WYHA 2PBZA 4ND7A 1PYDA 2WWGA 3LM8A 4DJTA 4D6YA 2WVGA 2ZS8A 2RK3A 2QIPA 2X86A 4HPJB 3UG7A 2XCOA 2FKAA 4LHXA 1GSIA 4HUQA 4MUGA 4FR2A 3VR1A 3ZQKA 5EZYA 1E3TA 1N3LA 1PV1A 1YS4A 5FBWB 3VBCA 4N3AA 1PQYA 1QHFA 1QM5A 5BW5A 4C2UA 3QYAA 3KPWA 1IN6A 2K6GA 2PNJA 3PXBA 2II6A 1NQVA 4LG1A 1AS2A 2QRKA 2CSUA 1X7WA 3SHVA 3TGLA 4DCVA 3PXGA 3VX4A 1D1TA 4PRYA 4TVBA 1OWPA 4Y2VA 3V9PA 1YZVA 4OHYA 2I2DA 2RHOA 4UARA 1SOVA 2Z2KA 2ZYTX 1T4CB 5J2UB 5JCJA 5DNEA 4BTLA 4CR7A 1D1QA 5DHSA 1FRNA 4FNOA 2ZKIA 3HDJA 3OU7A 5COQA 5KU1A 2YZKA 2R6JA 4PFKA 3ORQA 4KIJA 4ZVSA 4E5PA 1YE3A 3BDVA 4O25A 1N6KA 3D8RA 1ORTA 2QTGA 2YBDA 3VRHA 4M0KA 4HMOA 1XMJA 3KE9A 5DNCA 1Q1EA 4O4HF 2X8AA 3FHJA 3Q3JB 4FCCA 3EF3A 3FH0A 1NRWA 5BN4A 3UGKA 1ZMBA 5C4IA 2WE8A 4DM7A 2C5SA 5KVSA 3OQPA 3LYAA 4YPFA 4C20A 3F5FA 3WV5A 1BHJA 4X9XA 2PUEA 4HS4A 4DUGD 3JQGA 3KJQA 2AR9A 3GZJA 3GFGA 2BM8A 3O84A 3OTWA 2V9CA 3EIXA 1DT3A 4RVHA 4FEYA 1X8LA 2JH3A 1E9VA 4BVEA 2J9XB 3LBIA 4IAOA 4RPLA 3RKUA 4CDMA 2IEBA 2AR0A 1IZ8A 1CFZA 4E7PA 3OZEA 1WPXA 1M2FA 3I3OA 3IPCA 4S1TA 1CUFA 1HX7A 1P0CA 9ATCA 1WSDA 4UC0A 3Q0IA 5DBEX 1ECLA 4UDOA 4YYEA 4ZDIA 5JS7A 1KSFX 1ZVJA 3QBTA 3BSWA 3L1UA 1REQB 4Y2JA 2PGLA 4BO8A 5I7WA 2HY7A 4J0KA 4OQNA 3OAAD 1Q0ZA 1ZJZA 5IC5A 3N3AC 4DS3A 4XLLA 3TQTA 4C4OA 4FQ8A 2EKQA 1DIOB 1XCPA 4QUJA 3LKVA 2O3RA 2GBLA 4E03A 2Z6VA 2WTUA 3BWMA 2BR4A 2CFSA 1T3ZA 4WCDA 4KAFA 1E1KA 2FPSA 4LW8A 2QM7A 1Z18A 5IDXA 2GN4A 3HUEA 2XPCA 2Z5FA 3OPVA 1W8DA 2F90A 2PR7A 5JV5A 4NHOA 2F1RA 5FTJA 4YP9A 2UXCB 4FFOA 3IKJA 4LOKA 4EWLA 4M53A 3SE7A 3H97A 3ZDRA 3NJRA 4B6FA 5BN1A 2XAAA 3H7IA 4HVCA 2IIVA 3CCBA 1BD4A 3K9QO 5JYEA 1NQUA 2VSXA 4X61A 2KLHA 1GA4A 3EQ7A 4NMHA 3HXTA 4OHZA 4NJEB 3RU2A 1OTHA 2CVOA 2XEXA 4E15A 1ISPA 3G2IA 3QX8A 3KR9A 3OZXA 4M46A 3B12A 1PBTA 2B7BA 2D06A 2IUYA 3EW9A 4H4DA 4CIYA 2ACVA 4YLGA 1AIPA 1RYEA 2P2GA 3LW7A 2WUEA 1E5LA 5ALPA 5CA1F 3C3DA 5THKA 3RS5A 4KW7A 2NQTA 2VHVA 5DXJA 3JALB 3AGQA 4IZIA 1SFRA 1YU6A 3BGVA 3F96A 3DDOA 1RRGA 2PSSA 1IM8A 4JEHA 4CCWA 1BFDA 4Y6OA 4UTVA 4LMBA 4BNDB 1N2CA 5G1NA 3VISA 4R16A 2HU2A 4Q1VA 4W4TA 5CCEA 1OH7A 2NVWA 4K9RA 4ROSA 2BLNA 3ZHCA 3DHWC 1M1XB 4Y9UA 1I30A 1N9KA 4BMXA 1QP4A 1R0LA 1SNYA 2W6OA 4JP8A 4WV3A 2P41A 3Q12A 3SZMA 4GIBA 2VUUA 1GPWB 1RE0A 4TLDA 1CVIA 1SBZA 4K7JA 4HYTA 5DTQA 1NUTA 1FFHA 2Q99A 3USES 1YQGA 1PJSA 2J3HA 3WJ1A 3WRXC 1Q7BA 4J94A 1L5NA 4L2IA 3O93A 2G9NA 8ABPA 1WETA 1CQJA 3WYEA 4J9UE 1D04A 3ABSB 1P18A 2NSDA 2A4KA 2GAFA 1Z0ZA 4L72A 1IM5A 4YAJA 3VPAA 1W59A 4QWMA 4J03A 2PH3A 1WS6A 4PO8A 1P4JA 4LWPA 4IQGA 1BKSB 2DJIA 4OGGA 3FZQA 2QTRA 3TK1A 4EENA 2QT9A 1BJTA 1GPKA 1KOFA 2MJLA 4KTTE 1XRRA 2YZNA 6NULA 4J3FA 3VSDA 5IAAA 3DMGA 5JMOA 2YOHA 3O8BA 3T9EA 4JL6A 1EXNA 2LV8A 3TCNA 2EJTA 3EFOB 4I55B 2PFGA 5JS1A 2J48A 5K0NA 5CDFA 4A0HA 2Y1CA 3W77A 3RHSA 3DXFA 5ALMA 1FA9A 2LDBA 2XMRA 3KTFA 4E5SA 2BRUC 2B5OA 4BQFA 5KNDH 2WE7A 4I5EA 4BASA 4DADA 3DLTA 3SQOA 1OHHA 1Z33A 3A2MA 3UV3A 1WMEA 1KAQA 3EEQA 4ITVA 4LNUB 5F3WB 5FWXA 2O8EB 3B6EA 3ZBTA 3IIJA 4DLYA 3GQVA 4RLSA 4UUQA 1RZVA 1SMKA 5BSUA 1H2YA 4F45A 4JDPA 1ZMOA 4GBGA 4QHSA 4URXR 1UWKA 4R2IA 2CSXA 1AGPA 1ZUD1 1FNSA 2I62A 3P32A 4EDHA 3DNPA 2JIBA 4PO1A 3EZLA 3TN7A 3WMRA 3AP1A 4GBJA 1BMFD 1R3UA 4MW7A 3RU3A 4EITA 2JI4A 3VNSA 3BICA 2ILVA 2GZ2A 1J25A 1KAMA 3TSZA 1GGKA 1H93A 1L4GA 1Q0LA 1PI3A 2QZZA 2JGEA 2R5NA 3UJ3X 5C34B 2P9YA 1SHUX 2HDWA 3VO2A 2RJOA 2JLWA 4HH4A 4R1UA 2FE4A 4KYUA 1YJ5A 2PLAA 2RBGA 3OQHA 1UFVA 1EX9A 2PWBA 1T6YA 2PANA 5KX5A 1BX1A 4CGYA 3SWWA 3CB2A 3UFXA 2OPBA 1O94A 1AN9A 2XWJI 1HNNA 3L77A 4ZGGA 4WGFA 1P1KA 3PUHA 4BWVA 1IUPA 4L8LA 3A1SA 1Z2EA 4OKNA 3CY6A 3GDHA 4PS1A 4BV2A 5ESWA 2BFFB 3KLMX 4PR0A 3ONDA 1DG9A 3TNFA 1GCAA 1SULA 1U0GA 2QRNA 4TKZA 3SD7A 3UT5A 3F6RA 2X42A 4F04A 5HK8A 3CN7A 4G4SO 4PYIA 1JECA 1FFCA 3JZFA 3URKA 3WDMA 2B0CA 2ZRHA 4DMKA 4K9MA 3OLZA 3DMFA 2VAXA 1W19A 3D1VA 5L3QB 1JFFA 4G1FA 2B2CA 4EW3A 4ARIA 4L6CA 3TB6A 4TLBA 3F3SA 4MWSA 1PEYA 5T3YA 4KO4S 2JIZD 2PBFA 3ZW8A 2VHEA 3O2JA 3Q8XB 2W6JA 1GGMA 2GEBA 4B76A 4S2UA 5AKJA 4AMBA 1LNSA 2Z8ZA 4K81B 5CLLA 3ZD8A 4DB2A 3GRUA 2CXTA 1LPMA 4ID3A 5KCMA 1THMA 4R98A 3WLIA 1PK8A 3VNUA 4EA6A 4IH4A 3PRYA 5B30A 3RS2A 3FNQA 3KLNA 4G4IA 4YRCA 1ZL2A 4NCKA 4BO6A 2A5FA 4UU7A 4YRRA 1ZEMA 2QSJA 3LUKA 4R83A 3T7RA 3N87A 4ASUD 1FW6A 1QTRA 2CNDA 4MQ5A 2CB9A 2Q3BA 3MPOA 4W6QA 3LXMA 3VPFA 3HKBB 5AIBA 2P6PA 4I4NA 4HVAA 3IE0A 2RJNA 4LE0A 3R74A 3UB3A 4BQOA 2VTBB 1DT5A 3AF2A 3J7AC 3P20A 3STTA 2PX2A 3GEMA 4IDEA 1K86A 3K92A 1UIRA 1EDBA 3RF6A 5JQGB 3SK0A 1DARA 2AZTA 2WICA 5EP3A 3RTDA 1I2ZA 2YUTA 4XB1A 5IUNC 4GR5A 5TPZD 4BJ5A 1IZ0A 5LQDA 1WJGA 3N9IA 2IXGA 4PAGA 1JE1A 3MQFA 1YHYA 2REXB 1LDGA 4Q05A 1T2DA 5IUJC 3V8EA 3HXKA 1QC5A 1Z88A 2ZJZA 5TQVA 5I7EA 2AOUA 4BB5A 3G5AA 1U2RA 5HILA 3TW4A 4EVQA 6CHYA 4Z4IA 1YL6A 3OTHA 3I2GA 1ZD9A 4URZR 2B1JA 4B85A 1PJ2A 3HSSA 2P40A 1EJ6A 1G4HA 4FDMA 5AW8A 3T1VA 3EGOA 2FRDA 2IZOA 3BWXA 1O5IA 1CEEA 3I04M 4V3CA 1OB2A 2WM8A 3VZRA 3LTEA 4WJLA 5B1DA 3C6BA 5I8ZA 2IYLD 5CP8A 4NZYA 1C8BA 2DUJA 4XVUA 1V9SA 4TROA 3ELWA 3UH0A 1AE1A 1IFXA 4PCVA 5E7MA 3OZ7A 1U90A 4AKHA 4UHHA 4NATA 1M0EA 1XVLA 3IODA 4DNPA 2QX7A 2BMVA 1GARA 2YV1A 3HDGA 3I1YA 2HDOA 3QLJA 3U44A 1NXVA 2CMFA 3PC3A 3TZKA 1GILA 5A5VA 4CEHB 4JEIA 4Y6RA 5GTDA 1AKMA 3WHIA 4EOGA 3ROKA 4OKIA 3JY6A 4A6XA 2RIPA 2HBQA 4KRGA 4F38A 1FDWA 2OBNA 3VKHA 2PKWA 3QFSA 2Q5HA 4EJSC 4L5AA 5JXGA 2F4VB 4BN5A 1PK9A 4LMAA 4TTJA 4TT3D 2ZM6B 5KNLA 1OLOA 3IMGA 3RRNA 1L7QA 4R0MA 3R3WA 1AKNA 4HMQA 3SR0A 5E1OA 3ROGA 5KTSA 2YFHA 4TN1A 1S2IA 4YWJA 4J2OA 4WH0A 1WW2A 2RBEA 4JL8A 4EJ6A 3I9KA 1I3CA 1MV5A 3QEMA 2X1LA 1E3EA 4WD3A 5I8WA 2XKJE 1D8TA 1XLUA 1MT3A 2O48X 5DLPA 1O6BA 2ZVPX 3ZHYA 4A9AA 2JVKA 1T5BA 3ENQA 3LP6A 3MLAA 1MABB 1NI4B 4H2DA 2JFVA 1Q15A 3GVIA 1AHHA 3PCTA 4DHWA 1L7DA 2VJKA 4TYYA 2CNLA 1M1ZA 2JRLA 1UM9A 4UM9B 2VH2A 3D6VA 5D87A 2FPLA 1GGVA 4BLSA 5GV8A 1BE0A 2VVTA 3H18A 1VSQA 2BT4A 4FBLA 4RSMA 4YLEA 1FFSA 3RHZA 7ABPA 4X8HA 3NX4A 5JO0A 1L4YA 2VJDA 2ZQZA 4CQMA 1PDVA 3U6BA 2ZQ5A 5CXSA 1U02A 4IEIA 1A50B 4CIWA 5IC4A 4CKWB 5K3FB 5SZIA 4BVJA 3RG2A 2JHAA 4PBTA 4BE7B 1KK3A 2GCNA 5FV4A 1EM8A 4AIIA 4AJ4A 1UC8A 3IQZA 4FVTA 1XPRA 3HO6A 3DFUA 4MQ6A 5GGXA 5A62A 4I8XA 3LPCA 4FONA 4KHZA 1CRLA 1TD1A 5GOTA 2ZYRA 5GY7A 4CQLA 4O4JB 1ZXLA 2A5LA 4O2AA 3AOEC 5ALYA 5GPBA 4YJGA 3ECAA 1VBMA 5E7IA 2A14A 1Z37A 4JVOA 4MLCA 1OD6A 3Q85A 5IF3A 1YA6A 2ZROA 1MA0A 4KJZA 2DGDA 3WSVA 3D4IA 4B8WA 3AVYA 4BCDA 5LBIA 4ZOEA 4ZO6A 1NMYA 1T6NA 3PEVA 4PZZA 3LI2A 2ZIZA 3GNSA 3U81A 1RHKA 4S0XA 7MDHA 5DZSA 4YI3A 3E5MA 3GZ4A 4OLBA 3KR1A 5AM3A 1FTGA 1M34B 2BUBA 4RKQA 4BVGA 1ZKDA 2X58A 4G8JA 1MF7A 3V4FA 3B1XA 3CIFA 3ERCA 1D7AA 5ELMA 1HUQA 2OYRA 2M1XA 2XUHA 3BB4A 3F7MA 1VLVA 3HGTA 3MIIA 4DCTA 2OGUA 4OHKA 2ZVJA 1SC1A 2HT6A 2BM1A 2ZI6A 3MA0A 4N3NA 1A2BA 2PUWA 3PWTA 2Q3LA 1M1YB 4RK5A 4TWRA 2WYUA 5CDYA 2ZCJA 1DKLA 1E0DA 1OV4A 2BM9A 2CUZA 3BS4A 3CA8A 2BKLA 1WPRA 3VKWA 4AJKA 1LDMA 5AW4A 4D02A 3E9RA 4BVFA 4DJAA 3B13B 4C4XA 2ZTUA 4BC1A 2EP8A 4UKDA 1ADCA 5I9LA 1GFZA 1SCUA 4WXPA 4Y6PA 1KK0A 5D85A 2FQWA 1QRAA 1PR6A 4EMBA 1T9AA 4P3OA 3LCJA 4D4IA 5DBHX 1UMCB 2CYBA 2JCSA 3OQOA 4MGYR 3V2GA 2WLSA 3GN1A 4MIKA 2O8FA 1HFJA 2ZJ3A 3V1LA 4C4RA 4CG0A 4KHPB 2OCGA 2Z9BA 3R0JA 2IHYA 3V00A 1U3FA 2WVAA 4HMPA 1I7QB 2A0WA 5AKEA 3CZ9A 4P93A 5JTUA 3C2QA 1P0MA 1JL3A 4CL3A 4ZVQA 2CJPA 3NM6B 3T6KA 1O95D 4BKRA 1PUIA 4G97A 2D5BA 2RHRA 4NCIA 4FEGA 4DIBA 3SQDA 3E9ZA 4C6HA 4EFNA 1NW4A 5KX5F 2PYDA 4RHXA 2JANA 4O8ZA 1TYEB 3LHFA 2H7VA 4QPPA 1XJWA 1MDBA 4X6XA 2ZJ8A 2LR0A 4MK4A 3W3AD 3CVXA 1US8A 2XD9A 1L6IA 2VJAA 5AFSA 4DMCA 1V39A 2BGIA 1PYOA 2PGIA 3OJLA 4G9BA 2YYYA 3IS3A 4LY0A 3MMNA 1IJBA 3MBKA 4Y2QA 1ISRA 5LUAA 4X93A 3FB4A 4ARCA 2I91A 1LFAA 3A6FA 1OI7A 2A2ZA 4X8LA 4ILKA 2ZE7A 4JU8A 2GAJA 4F2PA 4AS1A 1JWBB 2DLNA 4HYQA 4KRXA 3JR7A 3QHAA 4YCCA 2XMSA 1Y9DA 1LPBB 2I5PO 1J0DA 4ROTA 2GCPA 3CNBA 3K0FA 3KZKA 4MV7A 4R5MA 1SG6A 3DR3A 5DE3A 4ZVVA 5T6MA 1ZJJA 2F1IA 4L22A 1N25A 4TXNA 4J1NA 1R88A 2AC2A 2FDXA 2NYVA 2PKEA 3A4YA 2FG5A 2C8KA 1S2GA 1X70A 5C4MA 1EA5A 4YACA 3W4IA 3D2LA 3THWB 2I4MA 2VLBA 2JGAA