1V3FA

Solution structure of the dep domain of mouse pleckstrin2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
120
structure length
120
Chain Sequence
GSSGSSGLHRIVDKMHDTSTGIRPSPNMEQGSTYKKTFLGSSLVDWLISSNFAASRLEAVTLASMLMEENFLRPVGVRSMGAIRSGDLAEQFLDDSTALYTFAESYKKKVSSKESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the DEP domain of mouse pleckstrin2
rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Pleckstrin 2
total genus 18
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2003-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00610 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1v3fA00
2M1BA 2PBIA 3W6JB 4CO8A 5FLXZ 5L3EA 2FOKA 2VODA 3V8JA 4U88A 4ESBA 2EWNA 3KP6A 1ZGJA 1Z7UA 1BM9A 1QGPA 3I53A 1KQ9A 4HW0A 3TOAA 2GA1A 2DTRA 3B73A 5BOXA 3WTWC 1TTYA 4NB5A 3GZ6A 1QZZA 3HRTA 4HLXA 1QO0D 1OYWA 1G3WA 2ZNYA 5LEKA 4YFNF 4H0EA 4EJOA 1XDUA 3L09A 2Q8KA 3MFKA 1B1BA 1U6GA 4B8XA 3J80K 1UHMA 1WWXA 4S04A 3HTSB 2F5DA 3IWFA 4G9YA 5EEGA 2XRNA 2M8EA 1MD0A 3ZN1A 2VOOA 2KJCA 4GXOA 3KZYA 4HF0A 3CUQA 1MJAA 4G8XA 2DBBA 1J5YA 2PEXA 1DUXC 1PP8F 4EJUA 1YW8A 3JAMZ 5CVVA 1J75A 5E17F 1R22A 3LA3A 1S29A 2MLGA 4RAZA 1F1ZA 2R3SA 1SFUA 3LAJA 1WSUA 2YSRA 5L3CA 4NHJA 1HBXG 5D5UB 1ON2A 4A6EA 2V1DA 4KIBA 1IN7A 2HEOA 1QPMA 1W5TA 3LFKA 1ZARA 4HAMA 2VXZA 3ML6A 1C0WA 2MD5A 1O3SA 1MGTA 4A2UA 3LA7A 2EV6A 3EUHA 3F6OA 4BHBA 1RIOH 3TKYA 3J7AO 3FMSA 5LLQA 4BH9A 3MAJA 1SD4A 1X3UA 1K79A 4L9TA 1FYKA 5FFXA 3ZP5A 1GXQA 2EFWA 1ZG1A 1YTYA 4YFXF 2PFBA 1W7PB 1I27A 5TRDA 2J5OA 4WXCA 5D4SA 3MEXA 4UUVA 3TGNA 1F9NA 2OAZA 3O6BB 3C7JA 4A0YA 3QP5A 4O6JA 1XN7A 2W25A 2L4AA 4ESFA 1SMYF 2ZMEB 5DCMB 4RS8A 2M45A 3RYPA 3F6VA 3LSTA 3GUDA 1V4RA 1VTNC 4MNUA 3SXYA 1TW2A 4D0PA 1KQ8A 4EM1A 3QU3A 3RKWA 1RUOA 1PP7U 1G6NA 1EH8A 4HV5A 3P9IA 4LK0F 5A2QK 1QBJA 2EFPA 4Q4ZF 3E3VA 2D1VA 4HX8A 5CLSA 2BEOA 3R0AA 1J7KA 1IN4A 4BHPA 4HDVA 2DAOA 3IRQA 2AXLA 2DFIA 3E6CC 4CDGA 2FRHA 1BI3A 3H92A 1ZRDA 1XSXA 1O3RA 4EJTA 1P2FA 3GWZA 1Q1HA 3VOEA 2H94A 5H6RA 1L0OC 3BPXA 3BP8A 4CZZA 1H0MA 5LBQA 4P9UA 2KIMA 1XCBA 1O7FA 2HS5A 2MBFA 2G7HA 1FBQA 6PAXA 4B09A 2W57A 5D5WB 5D8LB 1P92A 1UFMA 1R1UA 3S2WA 2HYFA 1XGSA 3BZ6A 4Y17A 2IRFG 2DK8A 1STZA 3WU0A 3WTTC 4Y13A 3OV8A 5D5VB 4ZH4F 1U2WA 2VBYA 2G7UA 4I0BA 1IF1A 1HKQA 2DK5A 2K4BA 2KJBA 4HQMA 3F8MA 3KFWX 1FLIA 2GQQA 1HKSA 3IKTA 2NNYA 4EGZA 5IT9Z 4EQQA 2Y48A 2IW5A 4WXHA 4ETSA 2DPUA 3NQOA 4L9JA 3E5UA 1IW7F 3GX4X 1PUEE 2EFOA 5E1WA 3F8BA 2JT1A 2F2EA 5IT3A 1OYIA 4WXDA 5L3BA 3H3UA 1ZG5A 3GVAA 3GFLA 3IKVA 3HTUA 2FF4A 1KU2A 5EEHA 2J5PA 5L3FA 1FSHA 3IRRA 1QNTA 3BWGA 5DD8A 2PMHA 3GFIA 4KMUX 1ZYRF 3FM5A 1B9NA 2JSCA 5JI6A 5JFRA 1IN5A 1LVAA 2OU2A 4GO1A 2VONA 5CVUA 3N97A 1CF7B 3R61A 1FBSA 1YS7A 5E1XA 3RKXA 5AIPA 2FBKA 3B02A 4GGGA 4A0XA 2K27A 2ISZA 4KYWA 4HYEA 1MDMA 3ABTA 2PG4A 4GYIA 2V9VA 3MZYA 1XDSA 2VBXA 4R1HA 4ASNA 3COAC 2IJLA 1FOKA 1RI7A 2CW0F 3KE2A 4YIIA 1IUYA 5BPDA 1P4AA 1EH6A 2QQ9A 4EGYA 1W5SA 1IRGA 1DPUA 3QPHA 1XB4A 4XLNF 4G7HF 2L01A 3K9TA 5HVQC 4WF2A 3K1NA 4HA8A 3FX3A 2LKPA 3P9KA 1G3TA 2ETHA 1T6SA 2X4HA 2EFQA 2QQBA 1E17A 1FPQA 3CUQC 3NEUA 3TOBA 4QWQA 1D5VA 1FP1D 1LB2A 4I02A 4GYGA 4HOBA 5CVJA 4MHGA 1H9TA 1LDJA 1R58A 1JHFA 4LK1F 3ZMUA 1R00A 1KYWA 2KRFA 2O8XA 3WTUC 4FHTA 2P4WA 3L2CA 4ENNA 1FYMA 2VT3A 3IL2A 5LGTA 3KEOA 2DW4A 5JR3A 4OIQF 2KIUA 1YIOA 1BIBA 2W24A 2XGXA 1REPC 3HIFA 3KCCA 2O6GE 4BAYA 3WTZA 4ZZLA 2YPRA 4HX4A 1XCVA 4L5JA 1HKTA 3J80Z 5KK1A 3V7SA 1YG2A 4JBAA 4LFUA 4CICA 4KICA 2ZKZA 4A5MA 5HOOA 1J2XA 3O3KA 1T2KA 1WQ2A 2IVMA 4OINF 4O5VA 5FFZA 4ZYGA 4HF2A 4MQVA 4IXAA 4F7ZA 2YX7A 4JQFA 2IT0A 1I1GA 4ZYHA 4S05A 1J9IA 2VC1A 1S6LA 1TQPA 2CO5A 4EJWA 3ZMSA 1V3FA 1CGPA 2DO7A 2ESHA 3FMRA 2CG4A 1BI2A 5LEJA 3GFMA 1IN6A 2FXAA 2IA0A 4UVBA 3DPTA 2P7CB 5DUKA 2FU4A 1ZGAA 3F21A 2ZNZA 1JHHA 2VE9A 4IVNA 3KEQA 3U2RA 4XBFA 4Y15A 2XHKA 2QUFA 5CYVA 4PGHA 1ZLKA 2DQLA 2EJRA 5F6FA 5HDGA 4M6YA 1IAWA 1H9GA 5KVRA 3GXOA 2ZFWA 1BN5A 1AWCA 2WTEA 2FBIA 2HQRA 4IHSA 1B9MA 1BI0A 1BBYA 4AD9A 4RGXA 3T8TA 3I5UA 3JSPA 1TBXA 3BJ6A 1TLHB 3P7NA 3I59B 1OPCA 1XGNA 5LRSA 3WE2A 1WI9A 2ISYA 2MH2A 3L7WA 1F4KA 2QBYB 5LHHA 3DF8A 5CJ9A 2XUBA 2FNPA 1K78A 4M6XA 1ONVA 2YX4A 2PLYA 4EMSA 3V4GA 3HUGA 1FBUA 2QLZA 2JRTA 3MQ0A 4HLYA 4KMFA 3V7CA 5JHUA 1B6AA 2A6HF 4QLCU 5E18F 5D4RA 4U0VA 3ZPLA 2DQRA 1ULYA 4I0AA 3FM3A 4PCQA 1KQ0A 2RVCA 1P4WA 3ZQ7A 2HWVA 1LJ9A 3F22A 3Q5FA 2CFXA 1T98A 3M1EA 3D5LA 3IC7A 3DV8A 1LDKB 2EK5A 1OYYA 2BE5F 3DKWA 3V7RA 1YFHA 1BC7C 3M8EA 4RB0A 2BBYA 3BJOA 3ZN0A 1YO5C 2OBPA 1FY7A 2XAHA 1EV7A 5LGUA 1E2XA 4LB6B 2MA3A 3BJAA 4M73A 5ICEA 2MH9A 4A5NA 4LLGF 2P5VA 4RGSA 1T38A 4IPAA 4MTEA 1KU7A 2CQKA 2Z99A 3DQVC 3ROUA 3RI4A 5DV5A 1IZ1A 1KA8A 2A68F 2JZYA 2K7LA 3DXJF 4OMZA 4LLNA 1MZBA 1WKMA 4MGRA 3WGGA 1FC3A 2A5YB 2LNBA 2K02A 1JGSA 3SFZA 3WTVC 3BPVA 3G73A 2HYGD 1O7LA 2Z33A 3M8FA 2F5EA 2A07F 1FWZA 4LGWA 2ZXJA 1USSA 2L54A 4KFCA 4M74A 3WE3A 3HHHA 4YFKF 4HV6A 1MKMA 3TO7A 2DPDA 4BHCA 3F3XA 2ELHA 1DP7P 2R7DA 4ON0A 2RN7A 5F64A 3TDUC 4A6DA 3ZMZA 3BDDA 2IA1A 1I1SA 1ZN2A 3QAHA 3I0TA 2XAFA 2PMUA 4BXUA 1R5HA 3REOA 3PFIA 4IJAA 1SAXA 4CHUA 4FX0A 4RB3C 3MZHA 3JAMK 5D6FA 5A2QZ 4G6QA 3M9AA 2RDPA 3KETA 1MDMB 2H09A 3F8CA 5L3DA 4BYYA 2FE3A 1TW3A 1HW1A 1IXRC 3U9GA 1YYVA 1XMAA 5FD6A 1RNLA 4ENMA 1KU9A 1FSEA 2FA5A 2EV5A 2L4MA 1ZHFA 1XSVA 5ED4A 1EH7A 2VN2A 4Q48A 2VT2A 2JPCA 1Z91A 4IRIA 3LQRA 4RGUA 3Q9SA 3HHGA 1BOAA 4MEXF 4FX4A 4M71A 5DCFA 4IRHA 3CO6C 4HF1A 2OQGA 2ZBKA 3WG9A 3VB2A 3C18A 2FQ3A 5L3GA 3E6MA 2GA2A 4ENKA 3CUOA 3TO6A 1BIAA 2HGCA 2A6EF 1Z9CA 2XAJA 2M30A 3HSRA 4BQAA 2HOEA 3I71A 5FGMA 2GWRA 3RDIA 1FT9A 3QRFF 2QWWA 3T8RA 3LAPA 3D0SA 2HTJA 3L00A 1NHAA 2AS5F 2H6BA 3PQJA 2HTSA 3AAFA 1LEBA 3BOQA 3TO9A 5BQTA 3E5XA 2KKOA 2H27A 3F8NA 5BS6A 4MEYF 3WU1B 3F72A 3CTAA 4UVAA 2K4JA 5K5QA 1JXSA 3W6KB 2CWEA 3HOSA 2JTVA 4OIOF 2W84A 3EQLF 5F1RA 2DI3A 1U5TC 1XD7A 2GXBA 5FLXK 4K2EA 1BC8C 1OMIA 1R36A 3IWZA 2B0LA 4G6DA 2ZJ2A 2XKOA 4XLPF 1RZ4A 3GEZA 1W4MA 2L02A 3GYHX 4DQ2A 4EVIA 2E1CA 4L18B 1O57A 4RGRA 1IRFA 4WWCA 2DLLA 5DUIA 3HRMA 1ZRFA 4LLLA 5HS9A 4HX7A 2NRAC 4XRFA 2D1HA 1OKRA 1GVJA 4G94A 1HXDA 1OR7A 1SMTA 2Q2EA 1UHWA 5HLIA 5ILVA 4KT5C 2H6CA 2GXGA 1HQCA 3WTSC 2K86A 3E97A 2P7VB 4L5IA 1SD5A 5DD4A 4Q5SF 2CSOA 3WGIA 3P9CA 2ADUA 3K2ZA 3KP5A 3WGHA 2PJPA 3F8FA 5LHIA 2P8TA 3VFZA 1RUNA 2EA2A 4IHTA 2OZUA 1K7AA 4XSZF 3ELKA 2VBZA 2IP2A 1A04A 1S3JA 3QPTA 1R1TA 3CUQB 1P4XA 5CVRA 4ZYDA 3VEPA 5HS7A 2PI0A 4HZFA 4I7HA 1SFXA 2HZTA 2XKPA 3HSFA 3RTRA 2QM3A 5HS8A 1J59A 3ZMVA 4AIHA 5FO5A 2P6TA 3KLOA 4Z2YA 1XGMA 2UZKA 4CGZA 1HSTA 4I09A 3V8LA 1IXCA 1D3YA 3JTGA 5HLGA 3RKYA 3E5QA 4ZZDA 2ACJA 2KIFA 2STTA 2QYOA 3CO7C 3R60A 3I4PA 3TDZC 1W7PD 1ZG3A 2QENA 2RC4A 2V1UA 2EFNA 5ILSA 2M87A 2E1NA 2MLKA 4AVPA 3KP7A 2Z5UA 1XSDA 2D2WA 2CGPA 3FMQA 3GLXA 2O0YA 2ZCWA 1BJAA 3SZTA 5K5RA 3O2PE 4OMYA 1J0RA 3EDPA 1T0FA 2XV4S 2O3FA 3SHFA 4UV9A 2XAGA 2R7FA 2QQAA 1HW2A 2PN6A 1I5ZA 2EB7A 3J81K 3KP2A 4WCGA 3RPQA 4EV0A 1GXPA 1YS6A 3KP3A 3K0LA 3HYIA 3WODF 4FT8A 2UWMA 3I64A 4UHTA 3EYYA 3TQNA 2RNJA 2HDCA 2C6YA 1KU3A 1XMKA 4KIFA 2A69F 2E7WA 3FXRA 3OOPA 1TQMA 1LDDA 5D6EA 5TJJA 2O61A 1IXSB 4M9XA 4P55A 1Z6RA 1MJ9A 1FNNA 1TQIA 1FZPB 2QVOA 2P6SA 3DP7A 3QU6A 1QQIA 3GZ5A 3G3ZA 2ZMEA 4CYDA 2FEZA 3GW2A 3MWMA 3I54A 5FD5A 2RKHA 5ICCA 1U3EM 3BY6A 3SZPA 5JVTA 5E1ZB 2NAZA 3RJPA 4EJVA 1R7JA 3KZZA 4RAYA 5E20A 3BROA 1B4AA 4ESJA 3CJNA 4U7BA 4MTDA 1T39A 3KLNA 1Y0UA 2HFHA 3E6DA 5AONA 4LJZF 5DDGA 1U5TA 4KIGA 4L9NA 2RQPA 2XVCA 3VODA 4WK8F 4I98B 2EA4A 4O3MA 2EV0A 2HR3A 4RB1A 3NRVA 2ZO4A 1W7PA 1P6RA 2BGCA 2MC3A 4XSXF 1QZYA 4Q47A 5IT9K 4KN7X 2IA2A 1Z05A 3L9FA 2P5KA 2V1XA 3M7GA 5LHGA 1G3YA 1SD7A 3V8KA 2V6CA 1YLFA 3R0JA 3ZMDA 5K1YA 4P9FA 4N9IA 5ICGA 4OIRF 1L3LA 1ODDA 4OU0A 3LWFA 3SQNA 1DDNA 2VC0A 2FBHA 2OZ6A 3HSEA 2FMYA 2PQ8A 1G4DA 4P96A 2STWA 4YIFA 2FMLA 5ICFA 3HRUA 2XIGA 5HDNA 1GHCA 3JSOA 1S7OA 4UVCA 2XROA 3ULQB 2IPQX 4ENJA 2YR2A 4KUMA 1YW9A 4E70A 4P5OA 5J6XA 2V79A 4AIKA 3LA2A 5H20A 2BV6A 5H6QA 1SD6A 4U0WA 3F23A 1ZRCA 1S7AA 3H3ZA 1ZREA 3J81Z 3T1BA 3ZMTA 1FYLA 5FB2A 1O3QA 2L3DA 2RV8A 3FHZA 5DCMA 1Z6TA 1K6OA 3MCZA 4UNOA 4CXFA 3IHUA 3K1PA 2NS0A 3T0YA 5BPIA 1D8KA 4NQWA 1TNTA 2NNNA 4A0ZA 1PDNC 1ZH5A 4KDPA 3JW4A 4EM2A 4PZJA 1LEAA 5D8KB 1LNWA 3ABUA 4G7OF 1WRJA 3DPLC 2JPBA 3FZVA 3RPUA 2HQNA 2VE8A 2HKOA 1I6XA 2Z3YA 4I01A 4M9ZA 2BYVE 2VOPA 2Q0OA 2OD5A 1HSJA 2W85A 1Z1DA 2XAQA 1UCRA 3T5XA 1CF7A 3R6SA 4UXNA 1R1VA 2LF8A 4OOIA 2GAUA 4EM0B 2D45A 1JE8A 3FXUA 1B59A 5J8CA 2DT5A 5HDKA 5DEQA 3QOPA 2UXNA 1FP2A 3CDHA 3KP4A 4LG0B 2G9WA 3R4KA 4M72A 3Q9VA 5J8FA 3K1MA 3HRSA 1KYZA 2XASA 3FWEA 3EETA 5DYMA 5D5XB 2QBYA 5AIQA 4N0BA 4HBLA 5LRRA 5BMZA 5CVIA 1O3TA 2A3SA 2F5CA 4MQ9F 4LMYA 3EYIA 2P5LC 2F5FA 3PQKA 3RYRA 5ILUA 1TNSA 1ZLJA 4L9VA 1XGOA 4PDKA 1USTA 2LDUA 4M9SA 4IF4A 4U7DA 4ZYEA 2Y75A 2VBWA 1IN8A 2OQRA 4R8HA 2NYXA 1R23A 4KNYA 1YQAA 1G3SA 1YW7A 5LGNA 3CLOA 2QZ8A 2HKXA 1FX7A 3I59A 1ON1A 1U78A 3HOTA 4JK1X 4IRGA 4YG2F 4I2OA 3DFGA 3N4MA 2O03A 2RGVA 4LD5A 2GIVA 5HLHA 1K78B 4LB5A 3GFJA 3K69A 4PGGA 4DNCA 1BI1A 4UV8A 3C3WA 4N9HA 3U1DA 3WTYC 1SFEA 4GCVA 2E7XA 3FXQA 1U8RA 2TDXA 1ZAOA 2COMA 4TV7A 4R79A 2DU9A 3ECOA 2Y0MA 2YU3A 4LG0A 3ERED 3E6BA 2LF7A 5K5OA 3I58A 3JTHA 1F5TA 4AWXB 4RB2C 5E8GA 2GZWA 4HDUA 2OA4A 4KA4A 4AIJA 4L0YB 3GO5A 2WC2A 1S8NA 2M5WA 2WV0A 4HQEA 4BNCA 5ERIA 1AOYA 2FNAA 5E8IA 4KN4X 3C1DA 2CYYA 1D8JA 2X0LA 3FF5A 2WWYA 3LQQA 3QP6A 4L0ZB 2FSWA 4A12A 3ECHA 4G7ZF 1HW5A 2Z9OA 1R5GA 4OIPF 4WX9A 3RIRA 2UXXA 1UB9A 2A61A 1DPRA 4U0YA 3ISPA 2ESNA 1KGSA 1MJBA 1LQ1A 3GF2A 1U5TB 2LSOA 3WTXC 3DEUA
chains in the Genus database with same CATH superfamily
3CCLI 2M1BA 2PBIA 2NXNB 3W6JB 4CO8A 5FLXZ 3HGGA 5L3EA 2FOKA 1W0UA 2VODA 2E2HJ 1IJWC 5HODA 4BGDA 1BR4A 2NVTJ 3V8JA 4U88A 2DMQA 4ESBA 3M3YJ 2EWNA 2GOXB 3KP6A 1ZGJA 3J7AY 5C44J 2ECBA 1Z7UA 4J01A 1SAUA 1BM9A 1QGPA 3FKJA 3ZCOA 3G1MA 3JRHA 3I53A 1KQ9A 2CJJA 2X9DA 1MNMC 2BXYA 4HW0A 2O8KA 3TOAA 4C9YA 4A3CJ 2WB1N 2GA1A 2DTRA 3B73A 4NUBA 1X1CA 1JUMA 4YEJA 5BOXA 3WTWC 4A3IJ 1TTYA 4NB5A 3GZ6A 4UUSB 2E60A 2MSYA 4BQOA 1BW5A 1QZZA 3DLAA 3HRTA 5IP9J 4HLXA 4PSXA 2E2JJ 1QO0D 1OYWA 1G3WA 1U9NA 3N05A 4IEJA 4QPQA 1K4SA 2ZNYA 5LEKA 4YFNF 4H0EA 5IPAA 4EJOA 1XDUA 4ZDLA 3L09A 2IBDA 2Q8KA 3MFKA 1B1BA 3H5AA 3S3NA 2Q2EB 2XPVA 3BT9A 4RMNA 1U6GA 4B8XA 3J80K 3EPZA 3BG6A 1UHMA 2CW8A 2VXDA 4CCJA 2ID3A 3I3LA 1WWXA 1OCTC 4S04A 3HTSB 2F5DA 3IWFA 2A5WA 2ID6A 4G9YA 5EEGA 1A6QA 4KITB 3Q0UA 3I55I 1YOVB 1TP4A 2XRNA 1ETQA 2M8EA 1I39A 1MD0A 3ZN1A 2VOOA 1ZKGA 3ZOBA 4DYRA 5F0HA 3CCEI 2KJCA 4GXOA 1ITYA 3KZYA 4HF0A 4YRVA 3CUQA 1MJAA 1OLTA 4G8XA 1OCPA 2DBBA 3E0JB 2E34A 1J5YA 2ZJQF 2PEXA 2CQNA 1SVLA 3LSMA 1DUXC 1PP8F 4EJUA 1YW8A 5KAIC 5CVVA 1OJLA 3JAMZ 1J75A 5E17F 1R22A 2VJ5A 1S29A 3LA3A 4PSWA 1S72I 4FISA 2MLGA 3HKZA 4RAZA 1F1ZA 2EBIA 2N8GA 2ZSHB 3DLLF 2R3SA 1SFUA 1WH7A 1YX5A 3LAJA 1X4PA 2M0CA 2K9MA 1WSUA 2YSRA 3W6VA 3TMOA 5L3CA 4NHJA 4CCMA 1HBXG 3KPHA 1TT0A 4BBRJ 5D5UB 4A3GJ 1ON2A 2LK2A 4A6EA 2VPLA 1FTZA 2V1DA 2LOOA 3H0GJ 4KIBA 1IN7A 2HEOA 4OAZA 1QPMA 1W5TA 3LFKA 3UNGC 1ZARA 4HAMA 2VXZA 3ML6A 4XLEA 1C0WA 4E7ZA 1MH3A 2MD5A 1O3SA 2XF6A 4PUSA 2JA8J 1MGTA 3Q0VA 3H5NA 4A2UA 4V19K 1JUSA 3LA7A 2EV6A 2W00A 3EUHA 2QGUA 3F6OA 4BHBA 4DZJA 4Y4RA 3PJRA 4XONA 2I5UA 2HDDA 1RIOH 3TKYA 3J7AO 2M2EA 3FMSA 5LLQA 4BH9A 3MAJA 2HXOA 1OFCX 3GCMA 1SD4A 3BR6A 1LKXA 3LSKA 1X3UA 1K79A 1I3QJ 4L9TA 3OYCA 1FYKA 5DTDA 5FFXA 4E7IA 3OYLA 3HOYJ 1JT6A 3RPUD 3ZP5A 1GXQA 2CW7A 5BNGA 3PM1A 3G71I 2EFWA 1ZG1A 1YTYA 2KQRA 3WU2C 4MFDA 4YFXF 2PFBA 1W7PB 2DFHA 4RLQA 4HNUA 1I27A 3I4MJ 2J5OA 4WXCA 5TRDA 5D4SA 3MEXA 4UUVA 2Q1ZB 3TGNA 3QPLA 3OL4A 1F9NA 2OAZA 3H36A 3MKLA 3O6BB 4D7NA 1QZEA 3C7JA 4A0YA 3QP5A 1Z7LA 4C2MJ 5GAGJ 4O6JA 1XN7A 4PFOA 1ZGWA 2W25A 2L4AA 3G2BA 4ESFA 3RQIA 1SMYF 2DA4A 2ZMEB 2HZDA 5DCMB 2EINH 3JR9A 4RS8A 4XQFA 2Y30A 2M45A 3RYPA 3F6VA 3LSTA 3GUDA 4QTRA 1V4RA 1VTNC 2DMUA 1PJRA 4MNUA 3SDGA 3SXYA 1TW2A 2DMTA 2CUZA 1VZ0A 4D0PA 1KQ8A 1X1DA 3ABKH 2M34A 1JKQC 5M3FJ 4EM1A 5B3SH 2B9SA 1U9OA 3QU3A 3RKWA 3OIOA 4N4OB 2ZFUA 1RUOA 2BY2A 3OYMA 1PP7U 2IXSA 1G6NA 1EH8A 1J09A 3VPRA 2IS4A 4HV5A 3PSIA 3P9IA 4LK0F 5A2QK 1EJ9A 1MNDA 1QBJA 3DCFA 2EFPA 5F1JA 1N78A 4Q4ZF 3E3VA 2PJRB 2D1VA 4HX8A 5KCMA 2Z1DA 3JRDA 5CLSA 1ZK8A 2BEOA 3R0AA 1J7KA 1IN4A 2WY8Q 4BHPA 3ZR8X 4C2UA 4HDVA 2DAOA 3IRQA 2AXLA 1I6HJ 2DFIA 3E6CC 1TWGJ 4CDGA 2FRHA 2VQHA 1BI3A 3H92A 1ZRDA 1NG7A 5GPAA 5CKTA 4A3DJ 1XSXA 3VDXA 1O3RA 4EJTA 3GTKJ 5C4XJ 2L7KA 1P2FA 3AL0B 3GWZA 1Q1HA 3VOEA 2H94A 5GTHC 2DA5A 5H6RA 2PJRA 1L0OC 1YX3A 4EEFG 3BPXA 1YRNA 3BP8A 2KISA 1S9HA 4CZZA 1H0MA 1X3WB 4P9UA 5LBQA 2KIMA 3S14J 1XCBA 3F9KA 3L2VA 1ETVA 2QSHX 5FLMJ 1O7FA 2HS5A 2MBFA 2DMPA 2Z16A 2HOAA 1DP3A 2AQEA 2G7HA 1FBQA 6PAXA 1Y8QB 4B09A 4XIDA 3PUBA 2W57A 5KHDA 4BBSJ 2KIQA 5D5WB 5D8LB 4IHXA 1P92A 1UFMA 3FISA 1R1UA 4CYCA 1GT0C 3CLQA 5M5XJ 3S2WA 2HYFA 1XGSA 3BZ6A 3BCBA 3CCJI 4Y17A 4CCOA 1DQUA 3TEDA 2VQLA 3CESA 3QQAA 4AUXA 2IRFG 1MH4A 2A6TA 2DK8A 1STZA 3WU0A 3WTTC 4Y13A 1T56A 3OV8A 5D5VB 3OYNA 4ZH4F 2QQ8A 1U2WA 3LSJA 2X6WA 2VBYA 2G7UA 3OR2C 4I0BA 3KYDB 1IF1A 2L7FP 1IO2A 1HKQA 2DK5A 2K3FA 2K4BA 2KJBA 4HQMA 2EPFA 3F8MA 3KFWX 1HF0A 1FLIA 4RA2A 2GQQA 1HKSA 3IKTA 3OYJA 2M7AA 2NNYA 1R5ID 5IOZA 3MKZA 4EGZA 1FIPA 2WADA 4NBQA 5IT9Z 2KDZA 4EQQA 2Y48A 2COBA 2X1DA 2IW5A 3JRCA 4WXHA 4ETSA 1MSEC 2DPUA 3NQOA 4L9JA 1MW7A 3FKIJ 2K9LA 3E5UA 3SJMA 2OTJI 1IW7F 3GX4X 1PUEE 2EFOA 5E1WA 3F8BA 2JT1A 4D5CA 2F2EA 3FXOA 5IT3A 1OYIA 1N25A 1V5FA 1P7JA 2HQ5A 4WXDA 5L3BA 2HOSA 3H3UA 1ZG5A 1ZR4A 1X4OA 3DEWA 3GVAA 3PO2J 3GFLA 3H35A 3IKVA 3HTUA 2FF4A 1KU2A 2TCTA 2VKHA 3CQZJ 5EEHA 4D9JA 3MKYB 2J5PA 3K4MA 5L3FA 1FSHA 3IRRA 1HC8A 4BJ6C 1KONA 1QNTA 3PFYA 3QPSA 1VQ5I 3BWGA 1ZQ3P 5DD8A 1LFUP 2PMHA 3GFIA 4KMUX 2JVHA 1ZYRF 1MMDA 3FM5A 5IOYA 1B9NA 2DOAA 2JSCA 5JI6A 1IN5A 1LVAA 4GO1A 2OU2A 5JFRA 2VONA 3H5RA 5CVUA 3N97A 1CF7B 3R61A 4MIMA 1T0FC 1I50J 2L7MP 4KJZA 4IOAF 1FBSA 1YS7A 2LR8A 2MD0A 1WJ5A 3CDIA 5E1XA 3HOUJ 3RKXA 4DBRA 4MO7A 5AIPA 1W36D 3CCYA 4QIWN 1MBJA 4X1EA 2FBKA 3B02A 2X1CA 4GGGA 2X6XA 5M5YJ 3S2HJ 2V9PA 4Z6YA 1V54H 3HZJA 4A0XA 3DTIA 4A3FJ 2RREA 4NQWB 2CV1A 2XGEA 1AA7A 2K27A 1DGWY 2ISZA 4BL0B 4KYWA 3BR2A 4HYEA 1MDMA 4X6AJ 2X51A 3ABTA 2LREA 4N4NB 2PG4A 3CCMI 1PUFB 3K70D 4GYIA 5IP7J 2V9VA 3MZYA 2VQGA 3AKZA 1XDSA 2VBXA 4R1HA 3OS0A 4A3MJ 4ASNA 2ZC2A 3COAC 2JUCA 2IJLA 3S1QJ 2KL4A 3OYIA 1FOXA 1FOKA 1RI7A 4CH7A 2LVSA 2CW0F 3KE2A 4YIIA 1VQLI 1IUYA 5BPDA 2DYSH 3RKQA 1P4AA 2K9SA 2Y0SA 4CZCA 1EH6A 2QQ9A 4EGYA 4ZTFA 1W5SA 1IRGA 2JVGA 3GTOJ 1DPUA 1ZTRA 3QPHA 3IAS2 1XB4A 4XLNF 4G7HF 2L01A 3ESWB 3K9TA 5HVQC 5EEAA 4WF2A 5FJ8J 3K1NA 4F92B 3M4OJ 2Z2SB 4ZYAA 4HA8A 3FX3A 1X1PA 2LKPA 4HNVA 3P9KA 2EZHA 1G3TA 2ETHA 3DBRB 1T6SA 4NC6A 2R5ZA 2X4HA 2EFQA 2V26A 1RPWA 2R4GA 1BJZA 3RCOA 1W5CC 2QQBA 3ZQHA 2ZXWH 4S0HB 4DGWB 1E17A 1FPQA 2CRGA 3CUQC 3NEUA 3TOBA 1YJWI 2VI6A 4QWQA 1D5VA 3HB9A 1FP1D 4FTHA 2L9RA 3QOEA 1LB2A 4I02A 4HNTA 2R7XA 2QSGX 1QPIA 4GYGA 5J1UA 4HOBA 5CVJA 2L0KA 3W2AA 4MHGA 1H9TA 2JUGA 1D0ZA 1LDJA 1R58A 1JHFA 4II2A 4LK1F 3ZMUA 1R00A 1KYWA 4BQNA 2KRFA 1D1BA 2I8DA 3VYSB 2AXTC 2O8XA 3WTUC 2BW3A 4FHTA 2P4WA 3ZQCA 5B5EC 1QVTA 3L2CA 4ENNA 2I10A 2CU7A 2K40A 1FYMA 2VT3A 3IL2A 4G6TB 3KEOA 3BTLA 1P9QC 2DW4A 3FXKA 4E4HA 5JR3A 5LGTA 5EG0B 4OIQF 2KIUA 1YIOA 2DA7A 1BIBA 2W24A 2XGXA 1REPC 3HIFA 3KCCA 5C4JJ 3HL2A 1HOMA 1RESA 1SC7A 1UJ8A 1PUFA 4CA0A 2O6GE 4BAYA 3KIOA 3WTZA 2CS3A 3CDLA 4ZZLA 3BTCA 2YPRA 4J19A 2WAFA 4HX4A 2BY0A 1XCVA 4BACA 4L5JA 2P0WA 3J80Z 1HKTA 5KK1A 1U8BA 3CD6I 1XG1A 3V7SA 1YG2A 2V1NA 4JBAA 2IS2A 1Z21A 4C3JJ 3K70C 3BG7A 4LFUA 4CICA 4KICA 3NARA 2BVLA 2ZKZA 1ZELA 4A5MA 3KX2A 2ELJA 5HOOA 1J2XA 1JTYA 3O3KA 4DYQA 1T2KA 2EZIA 1WPKA 1WQ2A 2IVMA 4CUGA 4OINF 3OIQA 4O5VA 5FFZA 4IHYA 3QODA 3TP0A 5K7FA 1T33A 4ZYGA 3BG3A 4HF2A 2WAEA 2OF7A 4MQVA 1XX5A 4BXXJ 1Z3YA 3BQYA 1APLC 4IXAA 2UV1A 2Y0SN 1T8IA 4F7ZA 2YX7A 3ZGKA 4JQFA 2IT0A 1I1GA 4ZYHA 1WH5A 4S05A 1J9IA 5GPCA 2VC1A 1S6LA 2DA1A 2VPRA 1TQPA 2WV1A 2CO5A 4EJWA 1R71A 3ZMSA 1V3FA 1CGPA 2DO7A 2ESHA 2L7ZA 3FMRA 3NWSA 5EGOA 2CG4A 1JGGA 4W97A 1BI2A 4B3AA 5LEJA 3F0CA 1IN6A 3GFMA 2FXAA 2IA0A 4UVBA 5GP9A 3DPTA 2O9LA 2P7CB 3HM5A 5DUKA 2R7SA 4DZPA 4XNFA 2FU4A 4HRIA 5M5WJ 1ZGAA 2KT0A 2LY2A 3F21A 2FD5A 4GRIA 1DU6A 3MZ8A 2BHZA 3I56I 2ZNZA 2K9NA 1JHHA 2VE9A 3I4NJ 4IVNA 3KEQA 3U2RA 2X48A 2MABA 2Y69H 4XBFA 2DYRH 3CJQB 4Y15A 1X1AA 3WHBA 3A02A 2XHKA 3DBHB 4X0GA 2QUFA 5CYVA 4PGHA 1D0XA 1E3HA 2DQLA 1ZLKA 4A3JJ 2EJRA 5F6FA 5HDGA 4M6YA 1FIAA 1IAWA 1H9GA 1MBFA 5KVRA 3BCAA 3GXOA 4Y3OA 3SDBA 3IH4A 3DU6A 3FBIB 1B8IA 2ZFWA 2M8GX 1BN5A 1XTAA 1AWCA 2MC4A 3AL0C 2WTEA 2FBIA 2HQRA 4IHSA 1JKOC 1B9MA 1BI0A 1BBYA 2KZGA 1OCZH 1IDYA 4XOPA 3U1KA 5GADJ 3K4LA 4AD9A 4RGXA 3T8TA 5EYRA 3I5UA 5EJCA 2DODA 2FX0A 4DBQA 3JSPA 4M3DA 1TBXA 3BJ6A 1TLHB 3P7NA 3I59B 4FASD 1OPCA 1XGNA 5LRSA 3WE2A 3VYTB 1WI9A 1MBHA 2M4GA 3I9V2 2ISYA 2WB1A 2MH2A 1YRNB 3L7WA 1F4KA 2QBYB 2DOEA 5LHHA 4FE7A 3DF8A 5CJ9A 2XUBA 2OCEA 4A3KJ 2CUEA 3K4NA 1YI2I 2B63J 2LP0A 2FNPA 1K78A 4M6XA 1FJLA 1VQ7I 2LY1A 1ONVA 1MBGA 4UB8C 5FROA 2YX4A 2PLYA 4EMSA 2M4KA 3ZQFA 4IO9F 3V4GA 4XLAA 3HUGA 1FBUA 2QLZA 3RZOJ 2E5ZA 2WAQA 4PJJA 4PJNA 1OR7C 3KEYA 2GM4A 1T08B 2JRTA 1SVOA 3FHNA 3MQ0A 3ZQGA 4ZJZA 4HLYA 1VQ6I 2DFFA 5FRMA 2VKVA 4KMFA 4Y52J 3V7CA 2B7EA 5JHUA 1B6AA 4DYCA 3M07A 2BVMA 2A6HF 1UG2A 4QLCU 2OCCH 5E18F 5D4RA 4U0VA 2R7ZJ 3ZPLA 4DW6A 4L5EA 2DFEA 2DQRA 3OYGA 1ULYA 3PL8A 1QRYA 3IV5A 3P5JA 4I0AA 3FM3A 2L9NA 2AQFA 3S3OA 3PNVA 4PCQA 1KQ0A 2RVCA 1P4WA 4XORA 2BHYA 3ZQ7A 2HWVA 1V5GA 2ZMEC 1LJ9A 3F22A 3A0HC 3Q5FA 2CFXA 4LITA 1T98A 3HOZJ 3M1EA 2XC7A 3D5LA 3IC7A 2GLOA 5E3OA 3DV8A 1LDKB 4Y33A 2EK5A 1OYYA 1VQMI 5E79C 4XKBA 2FUG2 2BE5F 3DKWA 1UMQA 3V7RA 1YFHA 1GVDA 1LE8A 1BC7C 3M8EA 4MFEA 3LFUA 4RB0A 2BBYA 4XKVA 2E71A 2BY3A 3BJOA 3LSRA 2DA3A 3GTPJ 2VASA 2EILH 1ENHA 3ZN0A 2DCEA 2LTPA 5F0CA 1YO5C 2OBPA 1FY7A 4I99C 2XAHA 1EV7A 5E3LA 5LGUA 1Y6IA 2KMUA 3HOWJ 1D1CA 1E2XA 5EZHA 3DWLE 3HG9A 4LB6B 2MA3A 4IX7A 1RETA 3BJAA 1IDZA 4M73A 1Z67A 5ICEA 2MH9A 4A5NA 3FIWA 4LLGF 4QPOA 3DKYA 2P5VA 4RGSA 1T38A 1NG6A 1VNDA 3FK7A 3AG3H 4IPAA 1OISA 3MMYB 4MTEA 4Y7NJ 1H8AC 2W7NA 1KU7A 1EA3A 2CQKA 2Z99A 3DQVC 3TL4X 2XB0X 3HEFA 3ROUA 2ME0A 3RI4A 5DV5A 1IZ1A 1PVEA 2JSPA 1JTXA 1KA8A 2A68F 2JZYA 2K7LA 1GV5A 4PFPA 3DXJF 4OMZA 4HEA2 4ZC3A 1H88C 4LLNA 2JA7J 1MZBA 3PUFA 3OYKA 1WKMA 2JWTA 4MGRA 3WGGA 1FC3A 2A5YB 3OL3A 2LNBA 2K02A 2LH9A 2EZLA 1JGSA 3OSFA 3SFZA 3WTVC 3BPVA 1ERDA 2NS8A 3G73A 2HYGD 1O7LA 1VQOI 2Z33A 2LKSA 2V4JC 4ABZA 1X2MA 2ZXHA 3M8FA 1BA5A 2F5EA 2A07F 1FWZA 3GTGJ 3A1YA 4LGWA 4BEHA 5IYBJ 2MG4A 2ZXJA 4E7KA 1USSA 1WJFA 2L54A 3L2UA 3CMMA 4KFCA 4M74A 4XLCA 3WE3A 3HHHA 4YFKF 4HV6A 1JUPA 4BUPA 1MKMA 3TO7A 1AKHA 2E5NA 3A01B 1LUJB 2DPDA 4BHCA 4AM3A 3F3XA 4UUTA 2PMZN 5JHFA 3H0DA 2H1LA 4ZTJA 2ELHA 4JX4A 3OS2A 1DP7P 3CC4I 3G4SI 4HPQA 2R7DA 4ON0A 2DXIA 2RN7A 1YIJI 5F64A 2CQ7A 2NVUB 1ETOA 3AG4H 2LRDA 3TDUC 4A6DA 3ZMZA 2JA6J 3BDDA 3B6AA 3CJTB 3V42A 2F5VA 5FLVA 2Y2ZA 2IA1A 1I1SA 3BC8A 4F52A 4II3A 2R7OA 1ACIA 1ZN2A 3QAHA 1BOBA 3I0TA 2XAFA 2PMUA 3HKZN 2HXIA 5M3MJ 5GTIC 1P7IA 3TBIA 3TW7A 4BXUA 2X6YA 1R5HA 3REOA 3PFIA 4IJAA 1SAXA 4CHUA 2VJIA 2R7WA 2ELKA 2VJ4A 4FX0A 5E3NA 4RB3C 3MZHA 2R92J 3RSNA 3JAMK 5D6FA 5KNLA 5A2QZ 4G6QA 3M9AA 1YHQI 2QA4I 2EH3A 2RDPA 3LSHA 4ZDOA 3BG5A 3KETA 1MDMB 4JX6A 4CYCB 2H09A 3F8CA 3IH3A 1BW6A 2IAIA 5L3DA 4BYYA 1VQ4I 1FTTA 3D5RC 2FE3A 3BR0A 3BZCA 4M3BA 3PNTA 1TW3A 1IXRC 1HW1A 1ORKA 3U9GA 1YYVA 1XMAA 2DA2A 5FD6A 1RNLA 4ENMA 2V7FA 3JRBA 1KU9A 1FSEA 2CUJA 3C2BA 2FA5A 4KT6A 1M1EB 2EV5A 3CCSI 2L4MA 4E7HA 4YELA 1ZHFA 1XSVA 4J00A 5F27A 3S93A 5ED4A 2QKLB 1EH7A 2VN2A 4Q48A 1QA6A 2VT2A 2JPCA 1Z91A 3IP4B 4IRIA 3LQRA 1JJ8C 4RGUA 4D5FA 4ANJA 2IGMA 3Q9SA 2R5YA 1O4XA 3BQZA 3HHGA 3PNYA 1BOAA 1MBEA 3CCRI 4B44A 4MEXF 4FX4A 4M71A 1EKEA 5DCFA 1RKTA 4IRHA 4XRMA 2CV2A 1E3OC 3ERMA 3CO6C 4HF1A 2OQGA 2ZBKA 3WG9A 3GLLA 3VB2A 3OYDA 3C18A 2FQ3A 2VIXA 4JP0A 5L3GA 3E6MA 2GA2A 4ENKA 3CUOA 1BIAA 1UZCA 2A6EF 2HGCA 2XRLA 2XAJA 2M30A 3TO6A 4BE0A 3HSRA 1Z9CA 3OMYA 2KZVA 4BQAA 2DT6A 2HOEA 1T95A 3I71A 5FGMA 4BDYA 2GWRA 3RDIA 1FT9A 2HI3A 5LFAA 5JLWA 1MMGA 3QRFF 2QWWA 1Y1VJ 1AHDP 3T8RA 3LAPA 2QKMB 3D0SA 4I6ZA 3KYLA 2HTJA 1BL0A 3L00A 1NHAA 1Z3XA 2AS5F 3HBLA 4BY7J 2H6BA 3BTIA 4U87A 3PQJA 5FKNA 9ANTA 2HTSA 3CP8A 3EUKL 3IH2A 4XK4A 1KZHA 2FOWA 2BW3B 3AAFA 1LEBA 2R7VA 3BOQA 3TO9A 4E7LA 5BQTA 3E5XA 2XF5A 2KKOA 2H27A 3S1NJ 3F8NA 5BS6A 4MEYF 1UAAA 3WU1B 3F72A 4BU2A 2GIZA 2LFBA 3CTAA 4PJLA 4UVAA 2K4JA 5K5QA 1JXSA 3W6KB 2CWEA 5GAEJ 3HOSA 2JTVA 4OIOF 2ICWG 2W84A 3EQLF 5C3EJ 4RDUA 5F1RA 2DI3A 1U5TC 2E35A 3H1CA 1XD7A 2GXBA 5J3LA 5FLXK 4K2EA 1XPXA 1BC8C 1OMIA 1R36A 3IWZA 1JT0A 2B0LA 4G6DA 2ZJ2A 2XKOA 2DJIA 4B43A 4XLPF 1RZ4A 2K3PA 3GEZA 2W1OA 4XKCA 1W4MA 1VQ8I 4P1WA 2L02A 3GYHX 4AVZA 4DQ2A 4EVIA 2E1CA 1IV8A 4L18B 1O57A 2MYSA 4RGRA 1IRFA 1YJ9I 1POGA 4WWCA 2E2IJ 2DLLA 5DUIA 3HRMA 2M0MA 1ZRFA 4LLLA 5HS9A 3PO3J 4HX7A 3RQ4A 2NRAC 2O7OA 2HOTA 1UELB 4XRFA 2D1HA 1W36C 4IL6C 1OKRA 1WCMJ 1GVJA 4G94A 1HXDA 1OR7A 1SMTA 2Q2EA 2XSDC 1UHWA 3CP2A 2LKXA 1VQPI 2DDAA 2OJED 3DU5A 4E7SA 3OYAA 2R7UA 5HLIA 5ILVA 4KT5C 2H6CA 2GXGA 1HQCA 3WTSC 2K86A 3E97A 2P7VB 4L5IA 3ASNH 3GTLJ 1SD5A 1SFOJ 5DD4A 4Q5SF 2CSOA 1ETWA 2DN0A 3WGIA 2GOMA 3P9CA 2ADUA 3K2ZA 5KAFC 1TT5B 3KP5A 3WGHA 2PJPA 3CF2A 3F8FA 1IG7A 5LHIA 2P8TA 2IGKA 3VFZA 1RUNA 4A93J 2EA2A 2VL8A 3KYCB 4BQQA 4IHTA 2OZUA 4M3EA 2CFOA 1K7AA 4XSZF 3ELKA 2VBZA 3DKXA 1A31A 2DT7B 2IP2A 4BXFA 2HPIA 1A04A 1S3JA 3QPTA 1R1TA 3CUQB 2XF7A 1P4XA 3A4CA 4UB6C 1MMAA 5CVRA 1BR1A 3VSLA 4ZYDA 2KFDA 3VEPA 4CCLA 5HS7A 4XLFA 2PI0A 4HZFA 4I7HA 4EATA 1SFXA 2DTZA 2YS9A 3ZRGA 1RR7A 3LMMA 3GBGA 4JOMA 2HZTA 4W1UA 2XKPA 3HSFA 4M3FA 2QM3A 3K7AJ 1Z0XA 4RLFA 3RTRA 5HS8A 3O8GA 5CQGA 1J59A 3ZMVA 4AIHA 5FO5A 1B72B 2P6TA 3KLOA 1Q1VA 3LSIA 2VLAA 1GV2A 4XOTA 3S15J 4Z2YA 1OCCH 4XRSA 2M9HA 1XGMA 5DM6F 1R9TJ 2AHQA 2UZKA 4CGZA 4C3IJ 1HSTA 4M3GA 2ZB9A 2P81A 4ZDPA 4I09A 3MN2A 3V8LA 1HA8A 3WTXC 1IXCA 1D3YA 2HVRA 5DS9A 1IRZA 4JX5A 3JTGA 5HLGA 1MMNA 3RKYA 3WG7H 3E5QA 4ZZDA 5B66C 3BR5A 1Y1WJ 2XPWA 3GTQJ 1EF4A 5J1RA 3EUAA 2ACJA 4B3XA 2KIFA 3E1SA 2STTA 3BZKA 1X19A 2QYOA 2JK3A 3CO7C 3R60A 3I4PA 3ZQLA 3TDZC 1W7PD 1ZG3A 2XDVA 4IZZA 4GFBA 2QENA 5IYCJ 2RC4A 1VQKI 3LOCA 3TP3A 2R7RA 3BLYA 2EFNA 2V1UA 3S3MA 4KISA 1GLNA 3VWBA 5ILSA 2M87A 3CCQI 1FMVA 1V55H 2E1NA 2L5QA 2MGQA 2MLKA 4AVPA 1LFBA 3KP7A 3OYBA 1VFCA 4C3HJ 2Z5UA 1XSDA 2D2WA 2CGPA 2NVYJ 2RAEA 4DIQA 3FMQA 3GLXA 3PIPF 3DPUA 2O0YA 2ZXIA 2IS6A 2CH0A 2ZCWA 1BJAA 3SZTA 5K5RA 2H8RA 2VKEA 3O2PE 2E1OA 2EZKA 1TWFJ 4OMYA 1J0RA 1YE9A 4XICA 2LBFA 3EDPA 1T0FA 4A3EJ 4BY1J 3W2VA 2XV4S 2O3FA 4FQGA 3SHFA 3HDDA 2CQQA 4UUSA 1W1WE 4UV9A 2XAGA 2JQ7A 2W48A 4IQ4A 3FXLA 2Y31A 2R7FA 2UUZA 2VJJA 3QYFA 2JA2A 2QQAA 2JA5J 1HW2A 4AIDA 2ECCA 2PN6A 1I5ZA 2EB7A 2XSJC 4CCKA 3J81K 3A2KA 3KP2A 3L2WA 4WCGA 2H1KA 3RPQA 3S17J 3ABMH 4EV0A 1GXPA 1MBKA 1YS6A 3KP3A 1GUUA 1N75A 3K0LA 3HYIA 3WODF 4FT8A 2UWMA 2FJ1A 3I64A 2KLOA 4UHTA 3EYYA 4HSRA 3KZIC 3TQNA 1VI0A 2HDWA 2RNJA 5TISC 2HDCA 1X1BA 1KU3A 2JJ7A 1LE8B 1SVMA 1IGNA 5F0FA 1XMKA 2C6YA 4KIFA 1GDTA 2A69F 3L2QA 1RC9A 2E7WA 4NC7A 2Y9YA 3FXRA 2MFZA 4CSWA 4E7JA 2QF7A 3OOPA 3FDYA 1JJ6C 1TL8A 1TQMA 4F91B 2GBYA 3GTMJ 4IOCF 1LDDA 5D6EA 4LOCA 1VQ9I 5TJJA 3X2QH 2O61A 3TW6A 2OUMA 1IXSB 1WGXA 4M9XA 4P55A 2WY7Q 4M6VA 1Z6RA 2WBMA 1MJ9A 1TC3C 5GAHJ 1R6RA 1FNNA 2FQ4A 3LL7A 2A05A 1TQIA 2QEXI 5TGTA 1FZPB 2QVOA 2P6SA 3FK6A 3DP7A 3S8PA 3QU6A 1QQIA 1VF9A 1K61A 2OC6A 1S7EA 1MMSA 5FRNA 1FEXA 3GZ5A 3G3ZA 1QU3A 2O5RA 2ZMEA 3ZQQA 4CYDA 4B1RA 2FEZA 3JRGA 3GW2A 3G1OA 3MWMA 1QVUA 3I54A 5FD5A 3UR3C 3HPHA 1A35A 3Q0WA 3SZGA 2RKHA 3HJEA 5ICCA 3AG1H 4F3QA 3BY6A 1U3EM 3SZPA 5JVTA 3OYEA 5E1ZB 2HVQA 2K9QA 2NAZA 3D5SC 1I3AA 3C2GA 3MD2A 4HG2A 4QSHA 3RJPA 4EJVA 1HDDC 2JN6A 1R7JA 2K85A 2PMZA 3KZZA 3MVPA 4RAYA 5E20A 3BROA 1B4AA 1ZR2A 4LIUA 4HSTA 4GDFA 1JKRC 3W3CA 1N77A 5EGOB 2X85A 2HQAA 4F55A 4ESJA 5EF6A 3CJNA 1HDPA 4U7BA 4MTDA 1OCRH 1T39A 2XAUA 1B72A 3KLNA 4G12A 3M1CA 1Y0UA 4LIVA 2R0QC 2HFHA 2IEKA 4A3LJ 5FKOA 3BR1A 2ZJRF 3E6DA 2IGNA 5AONA 2WAQN 2EIKH 4LJZF 3HXLA 1U5TA 4KIGA 5DDGA 3JRIA 4L9NA 2NOJB 2LY9A 2RQPA 2XVCA 4PK4A 1IC8A 3FBNB 3VODA 2Y9ZA 4WK8F 5LD2C 5J47A 4I98B 3J7ZI 2EA4A 4O3MA 2EV0A 2E19A 2V9KA 2HR3A 4BJTA 1ETYA 2LMDA 3WHCA 4RB1A 3CMEI 1TZLA 3NRVA 2ZO4A 3S32A 4B4CA 1W7PA 4OAYA 2PX9A 1P6RA 2DOFA 3OWTA 2BGCA 1WJEA 2MC3A 1SFKA 4XSXF 1QZYA 3DTEA 4Q47A 2CV0A 2V6EA 5IT9K 2EIJH 1G2HA 2EIMH 4KN7X 2HPMA 2IA2A 1Z05A 4XN3A 3L9FA 2P5KA 2V1XA 3M7GA 5LHGA 1G3YA 1SD7A 3V8KA 2V6CA 1K4TA 4CCNA 5J4YA 3G1LA 1YLFA 3R0JA 3ZMDA 1WHUA 5K1YA 2R5YB 4P9FA 3K2AA 3H9GA 4JYKA 4N9IA 5ICGA 1OCOH 1G8XA 4OIRF 1L3LA 4A69C 3JREA 1ODDA 5HLTA 4OU0A 3CCUI 5EZGA 4XMYA 3LWFA 3SQNA 1DDNA 1WVRA 4RM2A 2VC0A 5F08A 2FBHA 2OZ6A 1NH3A 2KRCA 3HSEA 2FMYA 2R5ZB 1U0JA 3W2WA 2PQ8A 5J40A 4C2TA 3L1PA 1AKHB 1G4DA 3M8JA 1QHGA 4P96A 4RBOA 4BDZA 2STWA 3K4BA 5FKMA 3SYTA 4YIFA 2FMLA 3C2HA 5ICFA 5H2FC 4IKFA 2BY1A 3CJRB 3HRUA 2XIGA 5HDNA 1GHCA 2HVSA 3JSOA 3JRAA 1S7OA 4UVCA 1X2NA 4XKWA 1MNEA 2XROA 2LYCA 3ULQB 2IPQX 4ENJA 2YR2A 1WJBA 3FXMA 4FCYA 2VQCA 4KUMA 1YW9A 4E70A 4IHVA 4MLOA 5F04A 4P5OA 2E1MC 2EQRA 5IP6A 5J6XA 2V79A 4AIKA 2KP6A 3G6EI 1XS9A 1V5EA 3SEZA 3ONQA 3K4KA 3LA2A 5H20A 3OYFA 2XB5A 3HC7A 2BV6A 4OWRB 1SD6A 4U0WA 5H6QA 3F23A 2JMWA 3VYRB 1LFPA 1ZRCA 1S7AA 3BG9A 3H3ZA 1K6YA 1ZREA 3LSGA 3J81Z 3T1BA 4UY8I 3BR3A 1X3ZB 3ZMTA 5EDNA 2L2OA 2ZJPF 1XMXA 2QCOA 4XL9A 1FYLA 5FB2A 4PJ0C 3H9QA 1O3QA 2L3DA 2QSFX 2RV8A 2YU9J 4C30A 3FHZA 2CMPA 1Z77A 3A03A 5DCMA 2CQXA 1Z6TA 1K6OA 3D1NI 3MCZA 4UNOA 2F6CA 4CXFA 3IHUA 3K1PA 2NS0A 3T0YA 1UG0A 3A01A 3OSGA 5BPIA 4E6KG 1AU7A 1D8KA 4NQWA 3K10A 4DJAA 1E3PA 2BOLA 1TNTA 2NNNA 4A0ZA 3OR1C 1PDNC 1ZH5A 3OYHA 4RAGA 4KDPA 3JW4A 4I76A 2X6OA 3OS1A 4EM2A 4PZJA 2DMNA 1TWAJ 1D1AA 4IQJA 1A5JA 1LEAA 2L9VA 4ITVA 5D8KB 1LNWA 2LLKA 1QHHD 1RRJA 2VUMJ 3ABUA 5DM7F 2LC2A 1WI3A 4G7OF 4V2FA 1YJNI 1FOYA 4NDLA 3CMYA 1WRJA 3DPLC 4D7MA 2JPBA 1VQNI 1WJCA 3FZVA 3RPUA 4XR6A 2JRMA 5IY5H 2HQNA 4AYBA 4B47A 1IV6A 2W82A 3FXJA 2D5VA 2VE8A 2OV7A 1OQYA 2HKOA 1I6XA 3K4JA 2Z3YA 3QYBA 4I01A 4M9ZA 2BYVE 2NOGA 3K6GA 4RAFA 2VOPA 2Q0OA 2M7BA 1HSJA 2OD5A 2W85A 1G59A 2OTLI 1Z1DA 2XGDA 4YIRX 2XAQA 1UCRA 3T5XA 1SEUA 1DGRM 1CF7A 3R6SA 4BE2A 4UXNA 1R1VA 3DEEA 3H3VK 2LF8A 3S16J 5JLXA 4OOIA 2GAUA 5J4VA 5J1YA 4EM0B 2D45A 1JE8A 3FXUA 1B59A 5J8CA 2BZTA 4LG3A 3H9JA 3S1MJ 1Y8RB 5JVGF 3NAUA 3B6CA 1WZ2A 3A0BC 3GTJJ 2DT5A 2E36A 5HDKA 4FETA 5DEQA 3QOPA 2UXNA 1FP2A 3CDHA 3OIPA 3VSKA 3KP4A 5CQEA 4LG0B 2G9WA 3R4KA 4M72A 5K7HA 3Q9VA 5J8FA 2LBFB 1NTCA 3K1MA 3HRSA 2HU9A 1KYZA 3CC7I 2XASA 3FWEA 2F4OB 3EETA 5DYMA 3HOVJ 5D5XB 3S1RJ 1Y56A 2QBYA 5AIQA 4XN0A 4N0BA 4HBLA 5LRRA 2NVQJ 5BMZA 4NC8A 3NWTA 5CVIA 3OY9A 1O3TA 1H89C 2A3SA 2KDOA 4B48A 3CF5F 5FKKA 2F5CA 3DBLB 2LD5A 1X58A 2F48A 4LMYA 4MQ9F 4BKXA 2F4IA 3EYIA 1E0EA 1R4NB 3EUHC 2P5LC 3GZNB 2F5FA 1NK2P 1IUFA 2G0EA 3PQKA 3RYRA 1D5YA 3HGYA 5ILUA 3BTJA 2LG4A 1A36A 1JKPC 1TNSA 1ZLJA 1S5LC 1XGOA 3ABLH 4L9VA 4PDKA 3U21A 4BJ5C 1NK3P 1USTA 4D1QA 2LDUA 4M9SA 4IF4A 4U7DA 1B8IB 4ZYEA 3CC2I 2KHMA 2Y75A 4AU7A 2VBWA 1IN8A 2OQRA 3ZQIA 4R8HA 4BEHB 3HPGA 2NYXA 1R23A 4KNYA 1YQAA 2HYJA 2X1EA 3CMAI 2IS1A 1G3SA 3IAM2 1Y0NA 1YW7A 2OPTA 3J7YJ 3Q3SA 2M3AA 5LGNA 3HOXJ 3CLOA 2QZ8A 2HKXA 3CCVI 2K5CA 2DA6A 1FX7A 4H4KC 3I59A 2R7TA 1ON1A 1U78A 3AFHA 3HOTA 4JK1X 3HUGB 4IRGA 4YG2F 3MKWB 1D0YA 1R49A 4I2OA 2L9SA 4FE4A 1HLVA 1TWHJ 3DFGA 2O03A 2RGVA 3N4MA 4LD5A 2GIVA 2YUSA 5HLHA 1K78B 4LB5A 3GFJA 3K69A 3VYUB 5IYDJ 4PGGA 2MW8A 2H8WA 4PJMA 4DNCA 1BI1A 5HNFA 3RZDJ 5B1AH 4UV8A 2WA0A 1UHSA 3C3WA 4N9HA 1LPQA 3U1DA 4IHWA 1WJAA 1RR8C 3WTYC 1SFEA 4GCVA 1MSFC 2E7XA 3L2RA 3S2DJ 3FXQA 1U8RA 2TDXA 1ZAOA 2TRTA 1SANA 2BXZA 2COMA 4TV7A 5FKLA 2DU9A 3ECOA 4R79A 1JI8A 2XGCA 3OOUA 2ME6A 4A3BJ 3PSFA 2Y0MA 2E1MB 2IGOA 2YU3A 2R93J 4BE1A 4LG0A 3SEQA 3ERED 3K4CA 3E6BA 2LF7A 3QYEA 2R7QA 5B1BH 5K5OA 3I58A 1PYVA 3JTHA 4AYBN 1R4MB 3IUOA 1F5TA 2GXAA 4AWXB 4RB2C 5E8GA 1ETKA 2GZWA 4HDUA 5CPRB 2OA4A 4KA4A 2VB6A 4AIJA 3JCUC 3LSPA 4L0YB 3GO5A 5E3MA 2VKDA 1S8NA 2WC2A 2M5WA 2WV0A 4HQEA 4BNCA 3UKGA 4XLHA 2ZSIB 5ERIA 2KRHA 2W4SA 3CZ6A 3AG2H 1AOYA 2FNAA 5E8IA 4KN4X 2DJNA 2RQQA 4DOZA 1MIJA 1TWCJ 3GMEA 3C1DA 4BS9A 2CYYA 1D8JA 2X0LA 3FF5A 1XC5A 2WWYA 2RNGA 3LQQA 1WJDA 3E7LA 1RKWA 3ASOH 3JRFA 3QP6A 4L0ZB 3O8HA 1W0TA 4NNJA 1K83J 1F43A 2CUFA 2FSWA 1FMWA 1CQTA 4A12A 3ECHA 4G7ZF 3PIOF 4V2GA 1HW5A 1HCRA 2Z9OA 1R5GA 2HNHA 1F36A 4OIPF 2KPMA 1LVKA 4WX9A 2NS7A 2XPUA 3RIRA 2UXXA 1IRXA 4XRSG 1WFXA 2DDBA 4AC0A 4RM3A 4F93B 1A6IA 1FOWA 1YITI 1Y39A 4XM3A 1UB9A 2A61A 1DPRA 5EG0A 4U0YA 5HNHA 3ISPA 2ESNA 1KGSA 1MJBA 1DU0A 1ETXA 3DTKA 2AO9A 5K7ZA 3GF2A 3SFIA 1LQ1A 3QWLA 2NVXJ 1U5TB 2F4MB 3LNQA 3ZXSA 2LSOA 1BR2A 3DEUA
chains in the Genus database with same CATH topology
2M1BA 2PBIA 3W6JB 4CO8A 5FLXZ 5L3EA 2FOKA 2VODA 3V8JA 4U88A 4ESBA 2EWNA 3KP6A 1ZGJA 1Z7UA 1BM9A 1QGPA 3I53A 1KQ9A 4HW0A 3TOAA 2GA1A 2DTRA 3B73A 5BOXA 3WTWC 1TTYA 4NB5A 3GZ6A 1QZZA 3HRTA 4HLXA 1QO0D 1OYWA 1G3WA 2ZNYA 5LEKA 4YFNF 4H0EA 4EJOA 1XDUA 3L09A 2Q8KA 3MFKA 1B1BA 1U6GA 4B8XA 3J80K 1UHMA 1WWXA 4S04A 3HTSB 2F5DA 3IWFA 4G9YA 5EEGA 2XRNA 2M8EA 1MD0A 3ZN1A 2VOOA 2KJCA 4GXOA 3KZYA 4HF0A 3CUQA 1MJAA 4G8XA 2DBBA 1J5YA 2PEXA 1DUXC 1PP8F 4EJUA 1YW8A 3JAMZ 5CVVA 1J75A 5E17F 1R22A 3LA3A 1S29A 2MLGA 4RAZA 1F1ZA 2R3SA 1SFUA 3LAJA 1WSUA 2YSRA 5L3CA 4NHJA 1HBXG 5D5UB 1ON2A 4A6EA 2V1DA 4KIBA 1IN7A 2HEOA 1QPMA 1W5TA 3LFKA 1ZARA 4HAMA 2VXZA 3ML6A 1C0WA 2MD5A 1O3SA 1MGTA 4A2UA 3LA7A 2EV6A 3EUHA 3F6OA 4BHBA 1RIOH 3TKYA 3J7AO 3FMSA 5LLQA 4BH9A 3MAJA 1SD4A 1X3UA 1K79A 4L9TA 1FYKA 5FFXA 3ZP5A 1GXQA 2EFWA 1ZG1A 1YTYA 4YFXF 2PFBA 1W7PB 1I27A 5TRDA 2J5OA 4WXCA 5D4SA 3MEXA 4UUVA 3TGNA 1F9NA 2OAZA 3O6BB 3C7JA 4A0YA 3QP5A 4O6JA 1XN7A 2W25A 2L4AA 4ESFA 1SMYF 2ZMEB 5DCMB 4RS8A 2M45A 3RYPA 3F6VA 3LSTA 3GUDA 1V4RA 1VTNC 4MNUA 3SXYA 1TW2A 4D0PA 1KQ8A 4EM1A 3QU3A 3RKWA 1RUOA 1PP7U 1G6NA 1EH8A 4HV5A 3P9IA 4LK0F 5A2QK 1QBJA 2EFPA 4Q4ZF 3E3VA 2D1VA 4HX8A 5CLSA 2BEOA 3R0AA 1J7KA 1IN4A 4BHPA 4HDVA 2DAOA 3IRQA 2AXLA 2DFIA 3E6CC 4CDGA 2FRHA 1BI3A 3H92A 1ZRDA 1XSXA 1O3RA 4EJTA 1P2FA 3GWZA 1Q1HA 3VOEA 2H94A 5H6RA 1L0OC 3BPXA 3BP8A 4CZZA 1H0MA 5LBQA 4P9UA 2KIMA 1XCBA 1O7FA 2HS5A 2MBFA 2G7HA 1FBQA 6PAXA 4B09A 2W57A 5D5WB 5D8LB 1P92A 1UFMA 1R1UA 3S2WA 2HYFA 1XGSA 3BZ6A 4Y17A 2IRFG 2DK8A 1STZA 3WU0A 3WTTC 4Y13A 3OV8A 5D5VB 4ZH4F 1U2WA 2VBYA 2G7UA 4I0BA 1IF1A 1HKQA 2DK5A 2K4BA 2KJBA 4HQMA 3F8MA 3KFWX 1FLIA 2GQQA 1HKSA 3IKTA 2NNYA 4EGZA 5IT9Z 4EQQA 2Y48A 2IW5A 4WXHA 4ETSA 2DPUA 3NQOA 4L9JA 3E5UA 1IW7F 3GX4X 1PUEE 2EFOA 5E1WA 3F8BA 2JT1A 2F2EA 5IT3A 1OYIA 4WXDA 5L3BA 3H3UA 1ZG5A 3GVAA 3GFLA 3IKVA 3HTUA 2FF4A 1KU2A 5EEHA 2J5PA 5L3FA 1FSHA 3IRRA 1QNTA 3BWGA 5DD8A 2PMHA 3GFIA 4KMUX 1ZYRF 3FM5A 1B9NA 2JSCA 5JI6A 5JFRA 1IN5A 1LVAA 2OU2A 4GO1A 2VONA 5CVUA 3N97A 1CF7B 3R61A 1FBSA 1YS7A 5E1XA 3RKXA 5AIPA 2FBKA 3B02A 4GGGA 4A0XA 2K27A 2ISZA 4KYWA 4HYEA 1MDMA 3ABTA 2PG4A 4GYIA 2V9VA 3MZYA 1XDSA 2VBXA 4R1HA 4ASNA 3COAC 2IJLA 1FOKA 1RI7A 2CW0F 3KE2A 4YIIA 1IUYA 5BPDA 1P4AA 1EH6A 2QQ9A 4EGYA 1W5SA 1IRGA 1DPUA 3QPHA 1XB4A 4XLNF 4G7HF 2L01A 3K9TA 5HVQC 4WF2A 3K1NA 4HA8A 3FX3A 2LKPA 3P9KA 1G3TA 2ETHA 1T6SA 2X4HA 2EFQA 2QQBA 1E17A 1FPQA 3CUQC 3NEUA 3TOBA 4QWQA 1D5VA 1FP1D 1LB2A 4I02A 4GYGA 4HOBA 5CVJA 4MHGA 1H9TA 1LDJA 1R58A 1JHFA 4LK1F 3ZMUA 1R00A 1KYWA 2KRFA 2O8XA 3WTUC 4FHTA 2P4WA 3L2CA 4ENNA 1FYMA 2VT3A 3IL2A 5LGTA 3KEOA 2DW4A 5JR3A 4OIQF 2KIUA 1YIOA 1BIBA 2W24A 2XGXA 1REPC 3HIFA 3KCCA 2O6GE 4BAYA 3WTZA 4ZZLA 2YPRA 4HX4A 1XCVA 4L5JA 1HKTA 3J80Z 5KK1A 3V7SA 1YG2A 4JBAA 4LFUA 4CICA 4KICA 2ZKZA 4A5MA 5HOOA 1J2XA 3O3KA 1T2KA 1WQ2A 2IVMA 4OINF 4O5VA 5FFZA 4ZYGA 4HF2A 4MQVA 4IXAA 4F7ZA 2YX7A 4JQFA 2IT0A 1I1GA 4ZYHA 4S05A 1J9IA 2VC1A 1S6LA 1TQPA 2CO5A 4EJWA 3ZMSA 1V3FA 1CGPA 2DO7A 2ESHA 3FMRA 2CG4A 1BI2A 5LEJA 3GFMA 1IN6A 2FXAA 2IA0A 4UVBA 3DPTA 2P7CB 5DUKA 2FU4A 1ZGAA 3F21A 2ZNZA 1JHHA 2VE9A 4IVNA 3KEQA 3U2RA 4XBFA 4Y15A 2XHKA 2QUFA 5CYVA 4PGHA 1ZLKA 2DQLA 2EJRA 5F6FA 5HDGA 4M6YA 1IAWA 1H9GA 5KVRA 3GXOA 2ZFWA 1BN5A 1AWCA 2WTEA 2FBIA 2HQRA 4IHSA 1B9MA 1BI0A 1BBYA 4AD9A 4RGXA 3T8TA 3I5UA 3JSPA 1TBXA 3BJ6A 1TLHB 3P7NA 3I59B 1OPCA 1XGNA 5LRSA 3WE2A 1WI9A 2ISYA 2MH2A 3L7WA 1F4KA 2QBYB 5LHHA 3DF8A 5CJ9A 2XUBA 2FNPA 1K78A 4M6XA 1ONVA 2YX4A 2PLYA 4EMSA 3V4GA 3HUGA 1FBUA 2QLZA 2JRTA 3MQ0A 4HLYA 4KMFA 3V7CA 5JHUA 1B6AA 2A6HF 4QLCU 5E18F 5D4RA 4U0VA 3ZPLA 2DQRA 1ULYA 4I0AA 3FM3A 4PCQA 1KQ0A 2RVCA 1P4WA 3ZQ7A 2HWVA 1LJ9A 3F22A 3Q5FA 2CFXA 1T98A 3M1EA 3D5LA 3IC7A 3DV8A 1LDKB 2EK5A 1OYYA 2BE5F 3DKWA 3V7RA 1YFHA 1BC7C 3M8EA 4RB0A 2BBYA 3BJOA 3ZN0A 1YO5C 2OBPA 1FY7A 2XAHA 1EV7A 5LGUA 1E2XA 4LB6B 2MA3A 3BJAA 4M73A 5ICEA 2MH9A 4A5NA 4LLGF 2P5VA 4RGSA 1T38A 4IPAA 4MTEA 1KU7A 2CQKA 2Z99A 3DQVC 3ROUA 3RI4A 5DV5A 1IZ1A 1KA8A 2A68F 2JZYA 2K7LA 3DXJF 4OMZA 4LLNA 1MZBA 1WKMA 4MGRA 3WGGA 1FC3A 2A5YB 2LNBA 2K02A 1JGSA 3SFZA 3WTVC 3BPVA 3G73A 2HYGD 1O7LA 2Z33A 3M8FA 2F5EA 2A07F 1FWZA 4LGWA 2ZXJA 1USSA 2L54A 4KFCA 4M74A 3WE3A 3HHHA 4YFKF 4HV6A 1MKMA 3TO7A 2DPDA 4BHCA 3F3XA 2ELHA 1DP7P 2R7DA 4ON0A 2RN7A 5F64A 3TDUC 4A6DA 3ZMZA 3BDDA 2IA1A 1I1SA 1ZN2A 3QAHA 3I0TA 2XAFA 2PMUA 4BXUA 1R5HA 3REOA 3PFIA 4IJAA 1SAXA 4CHUA 4FX0A 4RB3C 3MZHA 3JAMK 5D6FA 5A2QZ 4G6QA 3M9AA 2RDPA 3KETA 1MDMB 2H09A 3F8CA 5L3DA 4BYYA 2FE3A 1TW3A 1HW1A 1IXRC 3U9GA 1YYVA 1XMAA 5FD6A 1RNLA 4ENMA 1KU9A 1FSEA 2FA5A 2EV5A 2L4MA 1ZHFA 1XSVA 5ED4A 1EH7A 2VN2A 4Q48A 2VT2A 2JPCA 1Z91A 4IRIA 3LQRA 4RGUA 3Q9SA 3HHGA 1BOAA 4MEXF 4FX4A 4M71A 5DCFA 4IRHA 3CO6C 4HF1A 2OQGA 2ZBKA 3WG9A 3VB2A 3C18A 2FQ3A 5L3GA 3E6MA 2GA2A 4ENKA 3CUOA 3TO6A 1BIAA 2HGCA 2A6EF 1Z9CA 2XAJA 2M30A 3HSRA 4BQAA 2HOEA 3I71A 5FGMA 2GWRA 3RDIA 1FT9A 3QRFF 2QWWA 3T8RA 3LAPA 3D0SA 2HTJA 3L00A 1NHAA 2AS5F 2H6BA 3PQJA 2HTSA 3AAFA 1LEBA 3BOQA 3TO9A 5BQTA 3E5XA 2KKOA 2H27A 3F8NA 5BS6A 4MEYF 3WU1B 3F72A 3CTAA 4UVAA 2K4JA 5K5QA 1JXSA 3W6KB 2CWEA 3HOSA 2JTVA 4OIOF 2W84A 3EQLF 5F1RA 2DI3A 1U5TC 1XD7A 2GXBA 5FLXK 4K2EA 1BC8C 1OMIA 1R36A 3IWZA 2B0LA 4G6DA 2ZJ2A 2XKOA 4XLPF 1RZ4A 3GEZA 1W4MA 2L02A 3GYHX 4DQ2A 4EVIA 2E1CA 4L18B 1O57A 4RGRA 1IRFA 4WWCA 2DLLA 5DUIA 3HRMA 1ZRFA 4LLLA 5HS9A 4HX7A 2NRAC 4XRFA 2D1HA 1OKRA 1GVJA 4G94A 1HXDA 1OR7A 1SMTA 2Q2EA 1UHWA 5HLIA 5ILVA 4KT5C 2H6CA 2GXGA 1HQCA 3WTSC 2K86A 3E97A 2P7VB 4L5IA 1SD5A 5DD4A 4Q5SF 2CSOA 3WGIA 3P9CA 2ADUA 3K2ZA 3KP5A 3WGHA 2PJPA 3F8FA 5LHIA 2P8TA 3VFZA 1RUNA 2EA2A 4IHTA 2OZUA 1K7AA 4XSZF 3ELKA 2VBZA 2IP2A 1A04A 1S3JA 3QPTA 1R1TA 3CUQB 1P4XA 5CVRA 4ZYDA 3VEPA 5HS7A 2PI0A 4HZFA 4I7HA 1SFXA 2HZTA 2XKPA 3HSFA 3RTRA 2QM3A 5HS8A 1J59A 3ZMVA 4AIHA 5FO5A 2P6TA 3KLOA 4Z2YA 1XGMA 2UZKA 4CGZA 1HSTA 4I09A 3V8LA 1IXCA 1D3YA 3JTGA 5HLGA 3RKYA 3E5QA 4ZZDA 2ACJA 2KIFA 2STTA 2QYOA 3CO7C 3R60A 3I4PA 3TDZC 1W7PD 1ZG3A 2QENA 2RC4A 2V1UA 2EFNA 5ILSA 2M87A 2E1NA 2MLKA 4AVPA 3KP7A 2Z5UA 1XSDA 2D2WA 2CGPA 3FMQA 3GLXA 2O0YA 2ZCWA 1BJAA 3SZTA 5K5RA 3O2PE 4OMYA 1J0RA 3EDPA 1T0FA 2XV4S 2O3FA 3SHFA 4UV9A 2XAGA 2R7FA 2QQAA 1HW2A 2PN6A 1I5ZA 2EB7A 3J81K 3KP2A 4WCGA 3RPQA 4EV0A 1GXPA 1YS6A 3KP3A 3K0LA 3HYIA 3WODF 4FT8A 2UWMA 3I64A 4UHTA 3EYYA 3TQNA 2RNJA 2HDCA 2C6YA 1KU3A 1XMKA 4KIFA 2A69F 2E7WA 3FXRA 3OOPA 1TQMA 1LDDA 5D6EA 5TJJA 2O61A 1IXSB 4M9XA 4P55A 1Z6RA 1MJ9A 1FNNA 1TQIA 1FZPB 2QVOA 2P6SA 3DP7A 3QU6A 1QQIA 3GZ5A 3G3ZA 2ZMEA 4CYDA 2FEZA 3GW2A 3MWMA 3I54A 5FD5A 2RKHA 5ICCA 1U3EM 3BY6A 3SZPA 5JVTA 5E1ZB 2NAZA 3RJPA 4EJVA 1R7JA 3KZZA 4RAYA 5E20A 3BROA 1B4AA 4ESJA 3CJNA 4U7BA 4MTDA 1T39A 3KLNA 1Y0UA 2HFHA 3E6DA 5AONA 4LJZF 5DDGA 1U5TA 4KIGA 4L9NA 2RQPA 2XVCA 3VODA 4WK8F 4I98B 2EA4A 4O3MA 2EV0A 2HR3A 4RB1A 3NRVA 2ZO4A 1W7PA 1P6RA 2BGCA 2MC3A 4XSXF 1QZYA 4Q47A 5IT9K 4KN7X 2IA2A 1Z05A 3L9FA 2P5KA 2V1XA 3M7GA 5LHGA 1G3YA 1SD7A 3V8KA 2V6CA 1YLFA 3R0JA 3ZMDA 5K1YA 4P9FA 4N9IA 5ICGA 4OIRF 1L3LA 1ODDA 4OU0A 3LWFA 3SQNA 1DDNA 2VC0A 2FBHA 2OZ6A 3HSEA 2FMYA 2PQ8A 1G4DA 4P96A 2STWA 4YIFA 2FMLA 5ICFA 3HRUA 2XIGA 5HDNA 1GHCA 3JSOA 1S7OA 4UVCA 2XROA 3ULQB 2IPQX 4ENJA 2YR2A 4KUMA 1YW9A 4E70A 4P5OA 5J6XA 2V79A 4AIKA 3LA2A 5H20A 2BV6A 5H6QA 1SD6A 4U0WA 3F23A 1ZRCA 1S7AA 3H3ZA 1ZREA 3J81Z 3T1BA 3ZMTA 1FYLA 5FB2A 1O3QA 2L3DA 2RV8A 3FHZA 5DCMA 1Z6TA 1K6OA 3MCZA 4UNOA 4CXFA 3IHUA 3K1PA 2NS0A 3T0YA 5BPIA 1D8KA 4NQWA 1TNTA 2NNNA 4A0ZA 1PDNC 1ZH5A 4KDPA 3JW4A 4EM2A 4PZJA 1LEAA 5D8KB 1LNWA 3ABUA 4G7OF 1WRJA 3DPLC 2JPBA 3FZVA 3RPUA 2HQNA 2VE8A 2HKOA 1I6XA 2Z3YA 4I01A 4M9ZA 2BYVE 2VOPA 2Q0OA 2OD5A 1HSJA 2W85A 1Z1DA 2XAQA 1UCRA 3T5XA 1CF7A 3R6SA 4UXNA 1R1VA 2LF8A 4OOIA 2GAUA 4EM0B 2D45A 1JE8A 3FXUA 1B59A 5J8CA 2DT5A 5HDKA 5DEQA 3QOPA 2UXNA 1FP2A 3CDHA 3KP4A 4LG0B 2G9WA 3R4KA 4M72A 3Q9VA 5J8FA 3K1MA 3HRSA 1KYZA 2XASA 3FWEA 3EETA 5DYMA 5D5XB 2QBYA 5AIQA 4N0BA 4HBLA 5LRRA 5BMZA 5CVIA 1O3TA 2A3SA 2F5CA 4MQ9F 4LMYA 3EYIA 2P5LC 2F5FA 3PQKA 3RYRA 5ILUA 1TNSA 1ZLJA 4L9VA 1XGOA 4PDKA 1USTA 2LDUA 4M9SA 4IF4A 4U7DA 4ZYEA 2Y75A 2VBWA 1IN8A 2OQRA 4R8HA 2NYXA 1R23A 4KNYA 1YQAA 1G3SA 1YW7A 5LGNA 3CLOA 2QZ8A 2HKXA 1FX7A 3I59A 1ON1A 1U78A 3HOTA 4JK1X 4IRGA 4YG2F 4I2OA 3DFGA 3N4MA 2O03A 2RGVA 4LD5A 2GIVA 5HLHA 1K78B 4LB5A 3GFJA 3K69A 4PGGA 4DNCA 1BI1A 4UV8A 3C3WA 4N9HA 3U1DA 3WTYC 1SFEA 4GCVA 2E7XA 3FXQA 1U8RA 2TDXA 1ZAOA 2COMA 4TV7A 4R79A 2DU9A 3ECOA 2Y0MA 2YU3A 4LG0A 3ERED 3E6BA 2LF7A 5K5OA 3I58A 3JTHA 1F5TA 4AWXB 4RB2C 5E8GA 2GZWA 4HDUA 2OA4A 4KA4A 4AIJA 4L0YB 3GO5A 2WC2A 1S8NA 2M5WA 2WV0A 4HQEA 4BNCA 5ERIA 1AOYA 2FNAA 5E8IA 4KN4X 3C1DA 2CYYA 1D8JA 2X0LA 3FF5A 2WWYA 3LQQA 3QP6A 4L0ZB 2FSWA 4A12A 3ECHA 4G7ZF 1HW5A 2Z9OA 1R5GA 4OIPF 4WX9A 3RIRA 2UXXA 1UB9A 2A61A 1DPRA 4U0YA 3ISPA 2ESNA 1KGSA 1MJBA 1LQ1A 3GF2A 1U5TB 2LSOA 3WTXC 3DEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M1B A;  2PBI A;  3W6J B;  4CO8 A;  5FLX Z;  5L3E A;  2FOK A;  2VOD A;  3V8J A;  4U88 A;  4ESB A;  2EWN A;  3KP6 A;  1ZGJ A;  1Z7U A;  1BM9 A;  1QGP A;  3I53 A;  1KQ9 A;  4HW0 A;  3TOA A;  2GA1 A;  2DTR A;  3B73 A;  5BOX A;  3WTW C;  1TTY A;  4NB5 A;  3GZ6 A;  1QZZ A;  3HRT A;  4HLX A;  1QO0 D;  1OYW A;  1G3W A;  2ZNY A;  5LEK A;  4YFN F;  4H0E A;  4EJO A;  1XDU A;  3L09 A;  2Q8K A;  3MFK A;  1B1B A;  1U6G A;  4B8X A;  3J80 K;  1UHM A;  1WWX A;  4S04 A;  3HTS B;  2F5D A;  3IWF A;  4G9Y A;  5EEG A;  2XRN A;  2M8E A;  1MD0 A;  3ZN1 A;  2VOO A;  2KJC A;  4GXO A;  3KZY A;  4HF0 A;  3CUQ A;  1MJA A;  4G8X A;  2DBB A;  1J5Y A;  2PEX A;  1DUX C;  1PP8 F;  4EJU A;  1YW8 A;  3JAM Z;  5CVV A;  1J75 A;  5E17 F;  1R22 A;  3LA3 A;  1S29 A;  2MLG A;  4RAZ A;  1F1Z A;  2R3S A;  1SFU A;  3LAJ A;  1WSU A;  2YSR A;  5L3C A;  4NHJ A;  1HBX G;  5D5U B;  1ON2 A;  4A6E A;  2V1D A;  4KIB A;  1IN7 A;  2HEO A;  1QPM A;  1W5T A;  3LFK A;  1ZAR A;  4HAM A;  2VXZ A;  3ML6 A;  1C0W A;  2MD5 A;  1O3S A;  1MGT A;  4A2U A;  3LA7 A;  2EV6 A;  3EUH A;  3F6O A;  4BHB A;  1RIO H;  3TKY A;  3J7A O;  3FMS A;  5LLQ A;  4BH9 A;  3MAJ A;  1SD4 A;  1X3U A;  1K79 A;  4L9T A;  1FYK A;  5FFX A;  3ZP5 A;  1GXQ A;  2EFW A;  1ZG1 A;  1YTY A;  4YFX F;  2PFB A;  1W7P B;  1I27 A;  5TRD A;  2J5O A;  4WXC A;  5D4S A;  3MEX A;  4UUV A;  3TGN A;  1F9N A;  2OAZ A;  3O6B B;  3C7J A;  4A0Y A;  3QP5 A;  4O6J A;  1XN7 A;  2W25 A;  2L4A A;  4ESF A;  1SMY F;  2ZME B;  5DCM B;  4RS8 A;  2M45 A;  3RYP A;  3F6V A;  3LST A;  3GUD A;  1V4R A;  1VTN C;  4MNU A;  3SXY A;  1TW2 A;  4D0P A;  1KQ8 A;  4EM1 A;  3QU3 A;  3RKW A;  1RUO A;  1PP7 U;  1G6N A;  1EH8 A;  4HV5 A;  3P9I A;  4LK0 F;  5A2Q K;  1QBJ A;  2EFP A;  4Q4Z F;  3E3V A;  2D1V A;  4HX8 A;  5CLS A;  2BEO A;  3R0A A;  1J7K A;  1IN4 A;  4BHP A;  4HDV A;  2DAO A;  3IRQ A;  2AXL A;  2DFI A;  3E6C C;  4CDG A;  2FRH A;  1BI3 A;  3H92 A;  1ZRD A;  1XSX A;  1O3R A;  4EJT A;  1P2F A;  3GWZ A;  1Q1H A;  3VOE A;  2H94 A;  5H6R A;  1L0O C;  3BPX A;  3BP8 A;  4CZZ A;  1H0M A;  5LBQ A;  4P9U A;  2KIM A;  1XCB A;  1O7F A;  2HS5 A;  2MBF A;  2G7H A;  1FBQ A;  6PAX A;  4B09 A;  2W57 A;  5D5W B;  5D8L B;  1P92 A;  1UFM A;  1R1U A;  3S2W A;  2HYF A;  1XGS A;  3BZ6 A;  4Y17 A;  2IRF G;  2DK8 A;  1STZ A;  3WU0 A;  3WTT C;  4Y13 A;  3OV8 A;  5D5V B;  4ZH4 F;  1U2W A;  2VBY A;  2G7U A;  4I0B A;  1IF1 A;  1HKQ A;  2DK5 A;  2K4B A;  2KJB A;  4HQM A;  3F8M A;  3KFW X;  1FLI A;  2GQQ A;  1HKS A;  3IKT A;  2NNY A;  4EGZ A;  5IT9 Z;  4EQQ A;  2Y48 A;  2IW5 A;  4WXH A;  4ETS A;  2DPU A;  3NQO A;  4L9J A;  3E5U A;  1IW7 F;  3GX4 X;  1PUE E;  2EFO A;  5E1W A;  3F8B A;  2JT1 A;  2F2E A;  5IT3 A;  1OYI A;  4WXD A;  5L3B A;  3H3U A;  1ZG5 A;  3GVA A;  3GFL A;  3IKV A;  3HTU A;  2FF4 A;  1KU2 A;  5EEH A;  2J5P A;  5L3F A;  1FSH A;  3IRR A;  1QNT A;  3BWG A;  5DD8 A;  2PMH A;  3GFI A;  4KMU X;  1ZYR F;  3FM5 A;  1B9N A;  2JSC A;  5JI6 A;  5JFR A;  1IN5 A;  1LVA A;  2OU2 A;  4GO1 A;  2VON A;  5CVU A;  3N97 A;  1CF7 B;  3R61 A;  1FBS A;  1YS7 A;  5E1X A;  3RKX A;  5AIP A;  2FBK A;  3B02 A;  4GGG A;  4A0X A;  2K27 A;  2ISZ A;  4KYW A;  4HYE A;  1MDM A;  3ABT A;  2PG4 A;  4GYI A;  2V9V A;  3MZY A;  1XDS A;  2VBX A;  4R1H A;  4ASN A;  3COA C;  2IJL A;  1FOK A;  1RI7 A;  2CW0 F;  3KE2 A;  4YII A;  1IUY A;  5BPD A;  1P4A A;  1EH6 A;  2QQ9 A;  4EGY A;  1W5S A;  1IRG A;  1DPU A;  3QPH A;  1XB4 A;  4XLN F;  4G7H F;  2L01 A;  3K9T A;  5HVQ C;  4WF2 A;  3K1N A;  4HA8 A;  3FX3 A;  2LKP A;  3P9K A;  1G3T A;  2ETH A;  1T6S A;  2X4H A;  2EFQ A;  2QQB A;  1E17 A;  1FPQ A;  3CUQ C;  3NEU A;  3TOB A;  4QWQ A;  1D5V A;  1FP1 D;  1LB2 A;  4I02 A;  4GYG A;  4HOB A;  5CVJ A;  4MHG A;  1H9T A;  1LDJ A;  1R58 A;  1JHF A;  4LK1 F;  3ZMU A;  1R00 A;  1KYW A;  2KRF A;  2O8X A;  3WTU C;  4FHT A;  2P4W A;  3L2C A;  4ENN A;  1FYM A;  2VT3 A;  3IL2 A;  5LGT A;  3KEO A;  2DW4 A;  5JR3 A;  4OIQ F;  2KIU A;  1YIO A;  1BIB A;  2W24 A;  2XGX A;  1REP C;  3HIF A;  3KCC A;  2O6G E;  4BAY A;  3WTZ A;  4ZZL A;  2YPR A;  4HX4 A;  1XCV A;  4L5J A;  1HKT A;  3J80 Z;  5KK1 A;  3V7S A;  1YG2 A;  4JBA A;  4LFU A;  4CIC A;  4KIC A;  2ZKZ A;  4A5M A;  5HOO A;  1J2X A;  3O3K A;  1T2K A;  1WQ2 A;  2IVM A;  4OIN F;  4O5V A;  5FFZ A;  4ZYG A;  4HF2 A;  4MQV A;  4IXA A;  4F7Z A;  2YX7 A;  4JQF A;  2IT0 A;  1I1G A;  4ZYH A;  4S05 A;  1J9I A;  2VC1 A;  1S6L A;  1TQP A;  2CO5 A;  4EJW A;  3ZMS A;  1V3F A;  1CGP A;  2DO7 A;  2ESH A;  3FMR A;  2CG4 A;  1BI2 A;  5LEJ A;  3GFM A;  1IN6 A;  2FXA A;  2IA0 A;  4UVB A;  3DPT A;  2P7C B;  5DUK A;  2FU4 A;  1ZGA A;  3F21 A;  2ZNZ A;  1JHH A;  2VE9 A;  4IVN A;  3KEQ A;  3U2R A;  4XBF A;  4Y15 A;  2XHK A;  2QUF A;  5CYV A;  4PGH A;  1ZLK A;  2DQL A;  2EJR A;  5F6F A;  5HDG A;  4M6Y A;  1IAW A;  1H9G A;  5KVR A;  3GXO A;  2ZFW A;  1BN5 A;  1AWC A;  2WTE A;  2FBI A;  2HQR A;  4IHS A;  1B9M A;  1BI0 A;  1BBY A;  4AD9 A;  4RGX A;  3T8T A;  3I5U A;  3JSP A;  1TBX A;  3BJ6 A;  1TLH B;  3P7N A;  3I59 B;  1OPC A;  1XGN A;  5LRS A;  3WE2 A;  1WI9 A;  2ISY A;  2MH2 A;  3L7W A;  1F4K A;  2QBY B;  5LHH A;  3DF8 A;  5CJ9 A;  2XUB A;  2FNP A;  1K78 A;  4M6X A;  1ONV A;  2YX4 A;  2PLY A;  4EMS A;  3V4G A;  3HUG A;  1FBU A;  2QLZ A;  2JRT A;  3MQ0 A;  4HLY A;  4KMF A;  3V7C A;  5JHU A;  1B6A A;  2A6H F;  4QLC U;  5E18 F;  5D4R A;  4U0V A;  3ZPL A;  2DQR A;  1ULY A;  4I0A A;  3FM3 A;  4PCQ A;  1KQ0 A;  2RVC A;  1P4W A;  3ZQ7 A;  2HWV A;  1LJ9 A;  3F22 A;  3Q5F A;  2CFX A;  1T98 A;  3M1E A;  3D5L A;  3IC7 A;  3DV8 A;  1LDK B;  2EK5 A;  1OYY A;  2BE5 F;  3DKW A;  3V7R A;  1YFH A;  1BC7 C;  3M8E A;  4RB0 A;  2BBY A;  3BJO A;  3ZN0 A;  1YO5 C;  2OBP A;  1FY7 A;  2XAH A;  1EV7 A;  5LGU A;  1E2X A;  4LB6 B;  2MA3 A;  3BJA A;  4M73 A;  5ICE A;  2MH9 A;  4A5N A;  4LLG F;  2P5V A;  4RGS A;  1T38 A;  4IPA A;  4MTE A;  1KU7 A;  2CQK A;  2Z99 A;  3DQV C;  3ROU A;  3RI4 A;  5DV5 A;  1IZ1 A;  1KA8 A;  2A68 F;  2JZY A;  2K7L A;  3DXJ F;  4OMZ A;  4LLN A;  1MZB A;  1WKM A;  4MGR A;  3WGG A;  1FC3 A;  2A5Y B;  2LNB A;  2K02 A;  1JGS A;  3SFZ A;  3WTV C;  3BPV A;  3G73 A;  2HYG D;  1O7L A;  2Z33 A;  3M8F A;  2F5E A;  2A07 F;  1FWZ A;  4LGW A;  2ZXJ A;  1USS A;  2L54 A;  4KFC A;  4M74 A;  3WE3 A;  3HHH A;  4YFK F;  4HV6 A;  1MKM A;  3TO7 A;  2DPD A;  4BHC A;  3F3X A;  2ELH A;  1DP7 P;  2R7D A;  4ON0 A;  2RN7 A;  5F64 A;  3TDU C;  4A6D A;  3ZMZ A;  3BDD A;  2IA1 A;  1I1S A;  1ZN2 A;  3QAH A;  3I0T A;  2XAF A;  2PMU A;  4BXU A;  1R5H A;  3REO A;  3PFI A;  4IJA A;  1SAX A;  4CHU A;  4FX0 A;  4RB3 C;  3MZH A;  3JAM K;  5D6F A;  5A2Q Z;  4G6Q A;  3M9A A;  2RDP A;  3KET A;  1MDM B;  2H09 A;  3F8C A;  5L3D A;  4BYY A;  2FE3 A;  1TW3 A;  1HW1 A;  1IXR C;  3U9G A;  1YYV A;  1XMA A;  5FD6 A;  1RNL A;  4ENM A;  1KU9 A;  1FSE A;  2FA5 A;  2EV5 A;  2L4M A;  1ZHF A;  1XSV A;  5ED4 A;  1EH7 A;  2VN2 A;  4Q48 A;  2VT2 A;  2JPC A;  1Z91 A;  4IRI A;  3LQR A;  4RGU A;  3Q9S A;  3HHG A;  1BOA A;  4MEX F;  4FX4 A;  4M71 A;  5DCF A;  4IRH A;  3CO6 C;  4HF1 A;  2OQG A;  2ZBK A;  3WG9 A;  3VB2 A;  3C18 A;  2FQ3 A;  5L3G A;  3E6M A;  2GA2 A;  4ENK A;  3CUO A;  3TO6 A;  1BIA A;  2HGC A;  2A6E F;  1Z9C A;  2XAJ A;  2M30 A;  3HSR A;  4BQA A;  2HOE A;  3I71 A;  5FGM A;  2GWR A;  3RDI A;  1FT9 A;  3QRF F;  2QWW A;  3T8R A;  3LAP A;  3D0S A;  2HTJ A;  3L00 A;  1NHA A;  2AS5 F;  2H6B A;  3PQJ A;  2HTS A;  3AAF A;  1LEB A;  3BOQ A;  3TO9 A;  5BQT A;  3E5X A;  2KKO A;  2H27 A;  3F8N A;  5BS6 A;  4MEY F;  3WU1 B;  3F72 A;  3CTA A;  4UVA A;  2K4J A;  5K5Q A;  1JXS A;  3W6K B;  2CWE A;  3HOS A;  2JTV A;  4OIO F;  2W84 A;  3EQL F;  5F1R A;  2DI3 A;  1U5T C;  1XD7 A;  2GXB A;  5FLX K;  4K2E A;  1BC8 C;  1OMI A;  1R36 A;  3IWZ A;  2B0L A;  4G6D A;  2ZJ2 A;  2XKO A;  4XLP F;  1RZ4 A;  3GEZ A;  1W4M A;  2L02 A;  3GYH X;  4DQ2 A;  4EVI A;  2E1C A;  4L18 B;  1O57 A;  4RGR A;  1IRF A;  4WWC A;  2DLL A;  5DUI A;  3HRM A;  1ZRF A;  4LLL A;  5HS9 A;  4HX7 A;  2NRA C;  4XRF A;  2D1H A;  1OKR A;  1GVJ A;  4G94 A;  1HXD A;  1OR7 A;  1SMT A;  2Q2E A;  1UHW A;  5HLI A;  5ILV A;  4KT5 C;  2H6C A;  2GXG A;  1HQC A;  3WTS C;  2K86 A;  3E97 A;  2P7V B;  4L5I A;  1SD5 A;  5DD4 A;  4Q5S F;  2CSO A;  3WGI A;  3P9C A;  2ADU A;  3K2Z A;  3KP5 A;  3WGH A;  2PJP A;  3F8F A;  5LHI A;  2P8T A;  3VFZ A;  1RUN A;  2EA2 A;  4IHT A;  2OZU A;  1K7A A;  4XSZ F;  3ELK A;  2VBZ A;  2IP2 A;  1A04 A;  1S3J A;  3QPT A;  1R1T A;  3CUQ B;  1P4X A;  5CVR A;  4ZYD A;  3VEP A;  5HS7 A;  2PI0 A;  4HZF A;  4I7H A;  1SFX A;  2HZT A;  2XKP A;  3HSF A;  3RTR A;  2QM3 A;  5HS8 A;  1J59 A;  3ZMV A;  4AIH A;  5FO5 A;  2P6T A;  3KLO A;  4Z2Y A;  1XGM A;  2UZK A;  4CGZ A;  1HST A;  4I09 A;  3V8L A;  1IXC A;  1D3Y A;  3JTG A;  5HLG A;  3RKY A;  3E5Q A;  4ZZD A;  2ACJ A;  2KIF A;  2STT A;  2QYO A;  3CO7 C;  3R60 A;  3I4P A;  3TDZ C;  1W7P D;  1ZG3 A;  2QEN A;  2RC4 A;  2V1U A;  2EFN A;  5ILS A;  2M87 A;  2E1N A;  2MLK A;  4AVP A;  3KP7 A;  2Z5U A;  1XSD A;  2D2W A;  2CGP A;  3FMQ A;  3GLX A;  2O0Y A;  2ZCW A;  1BJA A;  3SZT A;  5K5R A;  3O2P E;  4OMY A;  1J0R A;  3EDP A;  1T0F A;  2XV4 S;  2O3F A;  3SHF A;  4UV9 A;  2XAG A;  2R7F A;  2QQA A;  1HW2 A;  2PN6 A;  1I5Z A;  2EB7 A;  3J81 K;  3KP2 A;  4WCG A;  3RPQ A;  4EV0 A;  1GXP A;  1YS6 A;  3KP3 A;  3K0L A;  3HYI A;  3WOD F;  4FT8 A;  2UWM A;  3I64 A;  4UHT A;  3EYY A;  3TQN A;  2RNJ A;  2HDC A;  2C6Y A;  1KU3 A;  1XMK A;  4KIF A;  2A69 F;  2E7W A;  3FXR A;  3OOP A;  1TQM A;  1LDD A;  5D6E A;  5TJJ A;  2O61 A;  1IXS B;  4M9X A;  4P55 A;  1Z6R A;  1MJ9 A;  1FNN A;  1TQI A;  1FZP B;  2QVO A;  2P6S A;  3DP7 A;  3QU6 A;  1QQI A;  3GZ5 A;  3G3Z A;  2ZME A;  4CYD A;  2FEZ A;  3GW2 A;  3MWM A;  3I54 A;  5FD5 A;  2RKH A;  5ICC A;  1U3E M;  3BY6 A;  3SZP A;  5JVT A;  5E1Z B;  2NAZ A;  3RJP A;  4EJV A;  1R7J A;  3KZZ A;  4RAY A;  5E20 A;  3BRO A;  1B4A A;  4ESJ A;  3CJN A;  4U7B A;  4MTD A;  1T39 A;  3KLN A;  1Y0U A;  2HFH A;  3E6D A;  5AON A;  4LJZ F;  5DDG A;  1U5T A;  4KIG A;  4L9N A;  2RQP A;  2XVC A;  3VOD A;  4WK8 F;  4I98 B;  2EA4 A;  4O3M A;  2EV0 A;  2HR3 A;  4RB1 A;  3NRV A;  2ZO4 A;  1W7P A;  1P6R A;  2BGC A;  2MC3 A;  4XSX F;  1QZY A;  4Q47 A;  5IT9 K;  4KN7 X;  2IA2 A;  1Z05 A;  3L9F A;  2P5K A;  2V1X A;  3M7G A;  5LHG A;  1G3Y A;  1SD7 A;  3V8K A;  2V6C A;  1YLF A;  3R0J A;  3ZMD A;  5K1Y A;  4P9F A;  4N9I A;  5ICG A;  4OIR F;  1L3L A;  1ODD A;  4OU0 A;  3LWF A;  3SQN A;  1DDN A;  2VC0 A;  2FBH A;  2OZ6 A;  3HSE A;  2FMY A;  2PQ8 A;  1G4D A;  4P96 A;  2STW A;  4YIF A;  2FML A;  5ICF A;  3HRU A;  2XIG A;  5HDN A;  1GHC A;  3JSO A;  1S7O A;  4UVC A;  2XRO A;  3ULQ B;  2IPQ X;  4ENJ A;  2YR2 A;  4KUM A;  1YW9 A;  4E70 A;  4P5O A;  5J6X A;  2V79 A;  4AIK A;  3LA2 A;  5H20 A;  2BV6 A;  5H6Q A;  1SD6 A;  4U0W A;  3F23 A;  1ZRC A;  1S7A A;  3H3Z A;  1ZRE A;  3J81 Z;  3T1B A;  3ZMT A;  1FYL A;  5FB2 A;  1O3Q A;  2L3D A;  2RV8 A;  3FHZ A;  5DCM A;  1Z6T A;  1K6O A;  3MCZ A;  4UNO A;  4CXF A;  3IHU A;  3K1P A;  2NS0 A;  3T0Y A;  5BPI A;  1D8K A;  4NQW A;  1TNT A;  2NNN A;  4A0Z A;  1PDN C;  1ZH5 A;  4KDP A;  3JW4 A;  4EM2 A;  4PZJ A;  1LEA A;  5D8K B;  1LNW A;  3ABU A;  4G7O F;  1WRJ A;  3DPL C;  2JPB A;  3FZV A;  3RPU A;  2HQN A;  2VE8 A;  2HKO A;  1I6X A;  2Z3Y A;  4I01 A;  4M9Z A;  2BYV E;  2VOP A;  2Q0O A;  2OD5 A;  1HSJ A;  2W85 A;  1Z1D A;  2XAQ A;  1UCR A;  3T5X A;  1CF7 A;  3R6S A;  4UXN A;  1R1V A;  2LF8 A;  4OOI A;  2GAU A;  4EM0 B;  2D45 A;  1JE8 A;  3FXU A;  1B59 A;  5J8C A;  2DT5 A;  5HDK A;  5DEQ A;  3QOP A;  2UXN A;  1FP2 A;  3CDH A;  3KP4 A;  4LG0 B;  2G9W A;  3R4K A;  4M72 A;  3Q9V A;  5J8F A;  3K1M A;  3HRS A;  1KYZ A;  2XAS A;  3FWE A;  3EET A;  5DYM A;  5D5X B;  2QBY A;  5AIQ A;  4N0B A;  4HBL A;  5LRR A;  5BMZ A;  5CVI A;  1O3T A;  2A3S A;  2F5C A;  4MQ9 F;  4LMY A;  3EYI A;  2P5L C;  2F5F A;  3PQK A;  3RYR A;  5ILU A;  1TNS A;  1ZLJ A;  4L9V A;  1XGO A;  4PDK A;  1UST A;  2LDU A;  4M9S A;  4IF4 A;  4U7D A;  4ZYE A;  2Y75 A;  2VBW A;  1IN8 A;  2OQR A;  4R8H A;  2NYX A;  1R23 A;  4KNY A;  1YQA A;  1G3S A;  1YW7 A;  5LGN A;  3CLO A;  2QZ8 A;  2HKX A;  1FX7 A;  3I59 A;  1ON1 A;  1U78 A;  3HOT A;  4JK1 X;  4IRG A;  4YG2 F;  4I2O A;  3DFG A;  3N4M A;  2O03 A;  2RGV A;  4LD5 A;  2GIV A;  5HLH A;  1K78 B;  4LB5 A;  3GFJ A;  3K69 A;  4PGG A;  4DNC A;  1BI1 A;  4UV8 A;  3C3W A;  4N9H A;  3U1D A;  3WTY C;  1SFE A;  4GCV A;  2E7X A;  3FXQ A;  1U8R A;  2TDX A;  1ZAO A;  2COM A;  4TV7 A;  4R79 A;  2DU9 A;  3ECO A;  2Y0M A;  2YU3 A;  4LG0 A;  3ERE D;  3E6B A;  2LF7 A;  5K5O A;  3I58 A;  3JTH A;  1F5T A;  4AWX B;  4RB2 C;  5E8G A;  2GZW A;  4HDU A;  2OA4 A;  4KA4 A;  4AIJ A;  4L0Y B;  3GO5 A;  2WC2 A;  1S8N A;  2M5W A;  2WV0 A;  4HQE A;  4BNC A;  5ERI A;  1AOY A;  2FNA A;  5E8I A;  4KN4 X;  3C1D A;  2CYY A;  1D8J A;  2X0L A;  3FF5 A;  2WWY A;  3LQQ A;  3QP6 A;  4L0Z B;  2FSW A;  4A12 A;  3ECH A;  4G7Z F;  1HW5 A;  2Z9O A;  1R5G A;  4OIP F;  4WX9 A;  3RIR A;  2UXX A;  1UB9 A;  2A61 A;  1DPR A;  4U0Y A;  3ISP A;  2ESN A;  1KGS A;  1MJB A;  1LQ1 A;  3GF2 A;  1U5T B;  2LSO A;  3WTX C;  3DEU A; 
#chains in the Genus database with same CATH topology
 3CCL I;  2M1B A;  2PBI A;  2NXN B;  3W6J B;  4CO8 A;  5FLX Z;  3HGG A;  5L3E A;  2FOK A;  1W0U A;  2VOD A;  2E2H J;  1IJW C;  5HOD A;  4BGD A;  1BR4 A;  2NVT J;  3V8J A;  4U88 A;  2DMQ A;  4ESB A;  3M3Y J;  2EWN A;  2GOX B;  3KP6 A;  1ZGJ A;  3J7A Y;  5C44 J;  2ECB A;  1Z7U A;  4J01 A;  1SAU A;  1BM9 A;  1QGP A;  3FKJ A;  3ZCO A;  3G1M A;  3JRH A;  3I53 A;  1KQ9 A;  2CJJ A;  2X9D A;  1MNM C;  2BXY A;  4HW0 A;  2O8K A;  3TOA A;  4C9Y A;  4A3C J;  2WB1 N;  2GA1 A;  2DTR A;  3B73 A;  4NUB A;  1X1C A;  1JUM A;  4YEJ A;  5BOX A;  3WTW C;  4A3I J;  1TTY A;  4NB5 A;  3GZ6 A;  4UUS B;  2E60 A;  2MSY A;  4BQO A;  1BW5 A;  1QZZ A;  3DLA A;  3HRT A;  5IP9 J;  4HLX A;  4PSX A;  2E2J J;  1QO0 D;  1OYW A;  1G3W A;  1U9N A;  3N05 A;  4IEJ A;  4QPQ A;  1K4S A;  2ZNY A;  5LEK A;  4YFN F;  4H0E A;  5IPA A;  4EJO A;  1XDU A;  4ZDL A;  3L09 A;  2IBD A;  2Q8K A;  3MFK A;  1B1B A;  3H5A A;  3S3N A;  2Q2E B;  2XPV A;  3BT9 A;  4RMN A;  1U6G A;  4B8X A;  3J80 K;  3EPZ A;  3BG6 A;  1UHM A;  2CW8 A;  2VXD A;  4CCJ A;  2ID3 A;  3I3L A;  1WWX A;  1OCT C;  4S04 A;  3HTS B;  2F5D A;  3IWF A;  2A5W A;  2ID6 A;  4G9Y A;  5EEG A;  1A6Q A;  4KIT B;  3Q0U A;  3I55 I;  1YOV B;  1TP4 A;  2XRN A;  1ETQ A;  2M8E A;  1I39 A;  1MD0 A;  3ZN1 A;  2VOO A;  1ZKG A;  3ZOB A;  4DYR A;  5F0H A;  3CCE I;  2KJC A;  4GXO A;  1ITY A;  3KZY A;  4HF0 A;  4YRV A;  3CUQ A;  1MJA A;  1OLT A;  4G8X A;  1OCP A;  2DBB A;  3E0J B;  2E34 A;  1J5Y A;  2ZJQ F;  2PEX A;  2CQN A;  1SVL A;  3LSM A;  1DUX C;  1PP8 F;  4EJU A;  1YW8 A;  5KAI C;  5CVV A;  1OJL A;  3JAM Z;  1J75 A;  5E17 F;  1R22 A;  2VJ5 A;  1S29 A;  3LA3 A;  4PSW A;  1S72 I;  4FIS A;  2MLG A;  3HKZ A;  4RAZ A;  1F1Z A;  2EBI A;  2N8G A;  2ZSH B;  3DLL F;  2R3S A;  1SFU A;  1WH7 A;  1YX5 A;  3LAJ A;  1X4P A;  2M0C A;  2K9M A;  1WSU A;  2YSR A;  3W6V A;  3TMO A;  5L3C A;  4NHJ A;  4CCM A;  1HBX G;  3KPH A;  1TT0 A;  4BBR J;  5D5U B;  4A3G J;  1ON2 A;  2LK2 A;  4A6E A;  2VPL A;  1FTZ A;  2V1D A;  2LOO A;  3H0G J;  4KIB A;  1IN7 A;  2HEO A;  4OAZ A;  1QPM A;  1W5T A;  3LFK A;  3UNG C;  1ZAR A;  4HAM A;  2VXZ A;  3ML6 A;  4XLE A;  1C0W A;  4E7Z A;  1MH3 A;  2MD5 A;  1O3S A;  2XF6 A;  4PUS A;  2JA8 J;  1MGT A;  3Q0V A;  3H5N A;  4A2U A;  4V19 K;  1JUS A;  3LA7 A;  2EV6 A;  2W00 A;  3EUH A;  2QGU A;  3F6O A;  4BHB A;  4DZJ A;  4Y4R A;  3PJR A;  4XON A;  2I5U A;  2HDD A;  1RIO H;  3TKY A;  3J7A O;  2M2E A;  3FMS A;  5LLQ A;  4BH9 A;  3MAJ A;  2HXO A;  1OFC X;  3GCM A;  1SD4 A;  3BR6 A;  1LKX A;  3LSK A;  1X3U A;  1K79 A;  1I3Q J;  4L9T A;  3OYC A;  1FYK A;  5DTD A;  5FFX A;  4E7I A;  3OYL A;  3HOY J;  1JT6 A;  3RPU D;  3ZP5 A;  1GXQ A;  2CW7 A;  5BNG A;  3PM1 A;  3G71 I;  2EFW A;  1ZG1 A;  1YTY A;  2KQR A;  3WU2 C;  4MFD A;  4YFX F;  2PFB A;  1W7P B;  2DFH A;  4RLQ A;  4HNU A;  1I27 A;  3I4M J;  2J5O A;  4WXC A;  5TRD A;  5D4S A;  3MEX A;  4UUV A;  2Q1Z B;  3TGN A;  3QPL A;  3OL4 A;  1F9N A;  2OAZ A;  3H36 A;  3MKL A;  3O6B B;  4D7N A;  1QZE A;  3C7J A;  4A0Y A;  3QP5 A;  1Z7L A;  4C2M J;  5GAG J;  4O6J A;  1XN7 A;  4PFO A;  1ZGW A;  2W25 A;  2L4A A;  3G2B A;  4ESF A;  3RQI A;  1SMY F;  2DA4 A;  2ZME B;  2HZD A;  5DCM B;  2EIN H;  3JR9 A;  4RS8 A;  4XQF A;  2Y30 A;  2M45 A;  3RYP A;  3F6V A;  3LST A;  3GUD A;  4QTR A;  1V4R A;  1VTN C;  2DMU A;  1PJR A;  4MNU A;  3SDG A;  3SXY A;  1TW2 A;  2DMT A;  2CUZ A;  1VZ0 A;  4D0P A;  1KQ8 A;  1X1D A;  3ABK H;  2M34 A;  1JKQ C;  5M3F J;  4EM1 A;  5B3S H;  2B9S A;  1U9O A;  3QU3 A;  3RKW A;  3OIO A;  4N4O B;  2ZFU A;  1RUO A;  2BY2 A;  3OYM A;  1PP7 U;  2IXS A;  1G6N A;  1EH8 A;  1J09 A;  3VPR A;  2IS4 A;  4HV5 A;  3PSI A;  3P9I A;  4LK0 F;  5A2Q K;  1EJ9 A;  1MND A;  1QBJ A;  3DCF A;  2EFP A;  5F1J A;  1N78 A;  4Q4Z F;  3E3V A;  2PJR B;  2D1V A;  4HX8 A;  5KCM A;  2Z1D A;  3JRD A;  5CLS A;  1ZK8 A;  2BEO A;  3R0A A;  1J7K A;  1IN4 A;  2WY8 Q;  4BHP A;  3ZR8 X;  4C2U A;  4HDV A;  2DAO A;  3IRQ A;  2AXL A;  1I6H J;  2DFI A;  3E6C C;  1TWG J;  4CDG A;  2FRH A;  2VQH A;  1BI3 A;  3H92 A;  1ZRD A;  1NG7 A;  5GPA A;  5CKT A;  4A3D J;  1XSX A;  3VDX A;  1O3R A;  4EJT A;  3GTK J;  5C4X J;  2L7K A;  1P2F A;  3AL0 B;  3GWZ A;  1Q1H A;  3VOE A;  2H94 A;  5GTH C;  2DA5 A;  5H6R A;  2PJR A;  1L0O C;  1YX3 A;  4EEF G;  3BPX A;  1YRN A;  3BP8 A;  2KIS A;  1S9H A;  4CZZ A;  1H0M A;  1X3W B;  4P9U A;  5LBQ A;  2KIM A;  3S14 J;  1XCB A;  3F9K A;  3L2V A;  1ETV A;  2QSH X;  5FLM J;  1O7F A;  2HS5 A;  2MBF A;  2DMP A;  2Z16 A;  2HOA A;  1DP3 A;  2AQE A;  2G7H A;  1FBQ A;  6PAX A;  1Y8Q B;  4B09 A;  4XID A;  3PUB A;  2W57 A;  5KHD A;  4BBS J;  2KIQ A;  5D5W B;  5D8L B;  4IHX A;  1P92 A;  1UFM A;  3FIS A;  1R1U A;  4CYC A;  1GT0 C;  3CLQ A;  5M5X J;  3S2W A;  2HYF A;  1XGS A;  3BZ6 A;  3BCB A;  3CCJ I;  4Y17 A;  4CCO A;  1DQU A;  3TED A;  2VQL A;  3CES A;  3QQA A;  4AUX A;  2IRF G;  1MH4 A;  2A6T A;  2DK8 A;  1STZ A;  3WU0 A;  3WTT C;  4Y13 A;  1T56 A;  3OV8 A;  5D5V B;  3OYN A;  4ZH4 F;  2QQ8 A;  1U2W A;  3LSJ A;  2X6W A;  2VBY A;  2G7U A;  3OR2 C;  4I0B A;  3KYD B;  1IF1 A;  2L7F P;  1IO2 A;  1HKQ A;  2DK5 A;  2K3F A;  2K4B A;  2KJB A;  4HQM A;  2EPF A;  3F8M A;  3KFW X;  1HF0 A;  1FLI A;  4RA2 A;  2GQQ A;  1HKS A;  3IKT A;  3OYJ A;  2M7A A;  2NNY A;  1R5I D;  5IOZ A;  3MKZ A;  4EGZ A;  1FIP A;  2WAD A;  4NBQ A;  5IT9 Z;  2KDZ A;  4EQQ A;  2Y48 A;  2COB A;  2X1D A;  2IW5 A;  3JRC A;  4WXH A;  4ETS A;  1MSE C;  2DPU A;  3NQO A;  4L9J A;  1MW7 A;  3FKI J;  2K9L A;  3E5U A;  3SJM A;  2OTJ I;  1IW7 F;  3GX4 X;  1PUE E;  2EFO A;  5E1W A;  3F8B A;  2JT1 A;  4D5C A;  2F2E A;  3FXO A;  5IT3 A;  1OYI A;  1N25 A;  1V5F A;  1P7J A;  2HQ5 A;  4WXD A;  5L3B A;  2HOS A;  3H3U A;  1ZG5 A;  1ZR4 A;  1X4O A;  3DEW A;  3GVA A;  3PO2 J;  3GFL A;  3H35 A;  3IKV A;  3HTU A;  2FF4 A;  1KU2 A;  2TCT A;  2VKH A;  3CQZ J;  5EEH A;  4D9J A;  3MKY B;  2J5P A;  3K4M A;  5L3F A;  1FSH A;  3IRR A;  1HC8 A;  4BJ6 C;  1KON A;  1QNT A;  3PFY A;  3QPS A;  1VQ5 I;  3BWG A;  1ZQ3 P;  5DD8 A;  1LFU P;  2PMH A;  3GFI A;  4KMU X;  2JVH A;  1ZYR F;  1MMD A;  3FM5 A;  5IOY A;  1B9N A;  2DOA A;  2JSC A;  5JI6 A;  1IN5 A;  1LVA A;  4GO1 A;  2OU2 A;  5JFR A;  2VON A;  3H5R A;  5CVU A;  3N97 A;  1CF7 B;  3R61 A;  4MIM A;  1T0F C;  1I50 J;  2L7M P;  4KJZ A;  4IOA F;  1FBS A;  1YS7 A;  2LR8 A;  2MD0 A;  1WJ5 A;  3CDI A;  5E1X A;  3HOU J;  3RKX A;  4DBR A;  4MO7 A;  5AIP A;  1W36 D;  3CCY A;  4QIW N;  1MBJ A;  4X1E A;  2FBK A;  3B02 A;  2X1C A;  4GGG A;  2X6X A;  5M5Y J;  3S2H J;  2V9P A;  4Z6Y A;  1V54 H;  3HZJ A;  4A0X A;  3DTI A;  4A3F J;  2RRE A;  4NQW B;  2CV1 A;  2XGE A;  1AA7 A;  2K27 A;  1DGW Y;  2ISZ A;  4BL0 B;  4KYW A;  3BR2 A;  4HYE A;  1MDM A;  4X6A J;  2X51 A;  3ABT A;  2LRE A;  4N4N B;  2PG4 A;  3CCM I;  1PUF B;  3K70 D;  4GYI A;  5IP7 J;  2V9V A;  3MZY A;  2VQG A;  3AKZ A;  1XDS A;  2VBX A;  4R1H A;  3OS0 A;  4A3M J;  4ASN A;  2ZC2 A;  3COA C;  2JUC A;  2IJL A;  3S1Q J;  2KL4 A;  3OYI A;  1FOX A;  1FOK A;  1RI7 A;  4CH7 A;  2LVS A;  2CW0 F;  3KE2 A;  4YII A;  1VQL I;  1IUY A;  5BPD A;  2DYS H;  3RKQ A;  1P4A A;  2K9S A;  2Y0S A;  4CZC A;  1EH6 A;  2QQ9 A;  4EGY A;  4ZTF A;  1W5S A;  1IRG A;  2JVG A;  3GTO J;  1DPU A;  1ZTR A;  3QPH A;  3IAS 2;  1XB4 A;  4XLN F;  4G7H F;  2L01 A;  3ESW B;  3K9T A;  5HVQ C;  5EEA A;  4WF2 A;  5FJ8 J;  3K1N A;  4F92 B;  3M4O J;  2Z2S B;  4ZYA A;  4HA8 A;  3FX3 A;  1X1P A;  2LKP A;  4HNV A;  3P9K A;  2EZH A;  1G3T A;  2ETH A;  3DBR B;  1T6S A;  4NC6 A;  2R5Z A;  2X4H A;  2EFQ A;  2V26 A;  1RPW A;  2R4G A;  1BJZ A;  3RCO A;  1W5C C;  2QQB A;  3ZQH A;  2ZXW H;  4S0H B;  4DGW B;  1E17 A;  1FPQ A;  2CRG A;  3CUQ C;  3NEU A;  3TOB A;  1YJW I;  2VI6 A;  4QWQ A;  1D5V A;  3HB9 A;  1FP1 D;  4FTH A;  2L9R A;  3QOE A;  1LB2 A;  4I02 A;  4HNT A;  2R7X A;  2QSG X;  1QPI A;  4GYG A;  5J1U A;  4HOB A;  5CVJ A;  2L0K A;  3W2A A;  4MHG A;  1H9T A;  2JUG A;  1D0Z A;  1LDJ A;  1R58 A;  1JHF A;  4II2 A;  4LK1 F;  3ZMU A;  1R00 A;  1KYW A;  4BQN A;  2KRF A;  1D1B A;  2I8D A;  3VYS B;  2AXT C;  2O8X A;  3WTU C;  2BW3 A;  4FHT A;  2P4W A;  3ZQC A;  5B5E C;  1QVT A;  3L2C A;  4ENN A;  2I10 A;  2CU7 A;  2K40 A;  1FYM A;  2VT3 A;  3IL2 A;  4G6T B;  3KEO A;  3BTL A;  1P9Q C;  2DW4 A;  3FXK A;  4E4H A;  5JR3 A;  5LGT A;  5EG0 B;  4OIQ F;  2KIU A;  1YIO A;  2DA7 A;  1BIB A;  2W24 A;  2XGX A;  1REP C;  3HIF A;  3KCC A;  5C4J J;  3HL2 A;  1HOM A;  1RES A;  1SC7 A;  1UJ8 A;  1PUF A;  4CA0 A;  2O6G E;  4BAY A;  3KIO A;  3WTZ A;  2CS3 A;  3CDL A;  4ZZL A;  3BTC A;  2YPR A;  4J19 A;  2WAF A;  4HX4 A;  2BY0 A;  1XCV A;  4BAC A;  4L5J A;  2P0W A;  3J80 Z;  1HKT A;  5KK1 A;  1U8B A;  3CD6 I;  1XG1 A;  3V7S A;  1YG2 A;  2V1N A;  4JBA A;  2IS2 A;  1Z21 A;  4C3J J;  3K70 C;  3BG7 A;  4LFU A;  4CIC A;  4KIC A;  3NAR A;  2BVL A;  2ZKZ A;  1ZEL A;  4A5M A;  3KX2 A;  2ELJ A;  5HOO A;  1J2X A;  1JTY A;  3O3K A;  4DYQ A;  1T2K A;  2EZI A;  1WPK A;  1WQ2 A;  2IVM A;  4CUG A;  4OIN F;  3OIQ A;  4O5V A;  5FFZ A;  4IHY A;  3QOD A;  3TP0 A;  5K7F A;  1T33 A;  4ZYG A;  3BG3 A;  4HF2 A;  2WAE A;  2OF7 A;  4MQV A;  1XX5 A;  4BXX J;  1Z3Y A;  3BQY A;  1APL C;  4IXA A;  2UV1 A;  2Y0S N;  1T8I A;  4F7Z A;  2YX7 A;  3ZGK A;  4JQF A;  2IT0 A;  1I1G A;  4ZYH A;  1WH5 A;  4S05 A;  1J9I A;  5GPC A;  2VC1 A;  1S6L A;  2DA1 A;  2VPR A;  1TQP A;  2WV1 A;  2CO5 A;  4EJW A;  1R71 A;  3ZMS A;  1V3F A;  1CGP A;  2DO7 A;  2ESH A;  2L7Z A;  3FMR A;  3NWS A;  5EGO A;  2CG4 A;  1JGG A;  4W97 A;  1BI2 A;  4B3A A;  5LEJ A;  3F0C A;  1IN6 A;  3GFM A;  2FXA A;  2IA0 A;  4UVB A;  5GP9 A;  3DPT A;  2O9L A;  2P7C B;  3HM5 A;  5DUK A;  2R7S A;  4DZP A;  4XNF A;  2FU4 A;  4HRI A;  5M5W J;  1ZGA A;  2KT0 A;  2LY2 A;  3F21 A;  2FD5 A;  4GRI A;  1DU6 A;  3MZ8 A;  2BHZ A;  3I56 I;  2ZNZ A;  2K9N A;  1JHH A;  2VE9 A;  3I4N J;  4IVN A;  3KEQ A;  3U2R A;  2X48 A;  2MAB A;  2Y69 H;  4XBF A;  2DYR H;  3CJQ B;  4Y15 A;  1X1A A;  3WHB A;  3A02 A;  2XHK A;  3DBH B;  4X0G A;  2QUF A;  5CYV A;  4PGH A;  1D0X A;  1E3H A;  2DQL A;  1ZLK A;  4A3J J;  2EJR A;  5F6F A;  5HDG A;  4M6Y A;  1FIA A;  1IAW A;  1H9G A;  1MBF A;  5KVR A;  3BCA A;  3GXO A;  4Y3O A;  3SDB A;  3IH4 A;  3DU6 A;  3FBI B;  1B8I A;  2ZFW A;  2M8G X;  1BN5 A;  1XTA A;  1AWC A;  2MC4 A;  3AL0 C;  2WTE A;  2FBI A;  2HQR A;  4IHS A;  1JKO C;  1B9M A;  1BI0 A;  1BBY A;  2KZG A;  1OCZ H;  1IDY A;  4XOP A;  3U1K A;  5GAD J;  3K4L A;  4AD9 A;  4RGX A;  3T8T A;  5EYR A;  3I5U A;  5EJC A;  2DOD A;  2FX0 A;  4DBQ A;  3JSP A;  4M3D A;  1TBX A;  3BJ6 A;  1TLH B;  3P7N A;  3I59 B;  4FAS D;  1OPC A;  1XGN A;  5LRS A;  3WE2 A;  3VYT B;  1WI9 A;  1MBH A;  2M4G A;  3I9V 2;  2ISY A;  2WB1 A;  2MH2 A;  1YRN B;  3L7W A;  1F4K A;  2QBY B;  2DOE A;  5LHH A;  4FE7 A;  3DF8 A;  5CJ9 A;  2XUB A;  2OCE A;  4A3K J;  2CUE A;  3K4N A;  1YI2 I;  2B63 J;  2LP0 A;  2FNP A;  1K78 A;  4M6X A;  1FJL A;  1VQ7 I;  2LY1 A;  1ONV A;  1MBG A;  4UB8 C;  5FRO A;  2YX4 A;  2PLY A;  4EMS A;  2M4K A;  3ZQF A;  4IO9 F;  3V4G A;  4XLA A;  3HUG A;  1FBU A;  2QLZ A;  3RZO J;  2E5Z A;  2WAQ A;  4PJJ A;  4PJN A;  1OR7 C;  3KEY A;  2GM4 A;  1T08 B;  2JRT A;  1SVO A;  3FHN A;  3MQ0 A;  3ZQG A;  4ZJZ A;  4HLY A;  1VQ6 I;  2DFF A;  5FRM A;  2VKV A;  4KMF A;  4Y52 J;  3V7C A;  2B7E A;  5JHU A;  1B6A A;  4DYC A;  3M07 A;  2BVM A;  2A6H F;  1UG2 A;  4QLC U;  2OCC H;  5E18 F;  5D4R A;  4U0V A;  2R7Z J;  3ZPL A;  4DW6 A;  4L5E A;  2DFE A;  2DQR A;  3OYG A;  1ULY A;  3PL8 A;  1QRY A;  3IV5 A;  3P5J A;  4I0A A;  3FM3 A;  2L9N A;  2AQF A;  3S3O A;  3PNV A;  4PCQ A;  1KQ0 A;  2RVC A;  1P4W A;  4XOR A;  2BHY A;  3ZQ7 A;  2HWV A;  1V5G A;  2ZME C;  1LJ9 A;  3F22 A;  3A0H C;  3Q5F A;  2CFX A;  4LIT A;  1T98 A;  3HOZ J;  3M1E A;  2XC7 A;  3D5L A;  3IC7 A;  2GLO A;  5E3O A;  3DV8 A;  1LDK B;  4Y33 A;  2EK5 A;  1OYY A;  1VQM I;  5E79 C;  4XKB A;  2FUG 2;  2BE5 F;  3DKW A;  1UMQ A;  3V7R A;  1YFH A;  1GVD A;  1LE8 A;  1BC7 C;  3M8E A;  4MFE A;  3LFU A;  4RB0 A;  2BBY A;  4XKV A;  2E71 A;  2BY3 A;  3BJO A;  3LSR A;  2DA3 A;  3GTP J;  2VAS A;  2EIL H;  1ENH A;  3ZN0 A;  2DCE A;  2LTP A;  5F0C A;  1YO5 C;  2OBP A;  1FY7 A;  4I99 C;  2XAH A;  1EV7 A;  5E3L A;  5LGU A;  1Y6I A;  2KMU A;  3HOW J;  1D1C A;  1E2X A;  5EZH A;  3DWL E;  3HG9 A;  4LB6 B;  2MA3 A;  4IX7 A;  1RET A;  3BJA A;  1IDZ A;  4M73 A;  1Z67 A;  5ICE A;  2MH9 A;  4A5N A;  3FIW A;  4LLG F;  4QPO A;  3DKY A;  2P5V A;  4RGS A;  1T38 A;  1NG6 A;  1VND A;  3FK7 A;  3AG3 H;  4IPA A;  1OIS A;  3MMY B;  4MTE A;  4Y7N J;  1H8A C;  2W7N A;  1KU7 A;  1EA3 A;  2CQK A;  2Z99 A;  3DQV C;  3TL4 X;  2XB0 X;  3HEF A;  3ROU A;  2ME0 A;  3RI4 A;  5DV5 A;  1IZ1 A;  1PVE A;  2JSP A;  1JTX A;  1KA8 A;  2A68 F;  2JZY A;  2K7L A;  1GV5 A;  4PFP A;  3DXJ F;  4OMZ A;  4HEA 2;  4ZC3 A;  1H88 C;  4LLN A;  2JA7 J;  1MZB A;  3PUF A;  3OYK A;  1WKM A;  2JWT A;  4MGR A;  3WGG A;  1FC3 A;  2A5Y B;  3OL3 A;  2LNB A;  2K02 A;  2LH9 A;  2EZL A;  1JGS A;  3OSF A;  3SFZ A;  3WTV C;  3BPV A;  1ERD A;  2NS8 A;  3G73 A;  2HYG D;  1O7L A;  1VQO I;  2Z33 A;  2LKS A;  2V4J C;  4ABZ A;  1X2M A;  2ZXH A;  3M8F A;  1BA5 A;  2F5E A;  2A07 F;  1FWZ A;  3GTG J;  3A1Y A;  4LGW A;  4BEH A;  5IYB J;  2MG4 A;  2ZXJ A;  4E7K A;  1USS A;  1WJF A;  2L54 A;  3L2U A;  3CMM A;  4KFC A;  4M74 A;  4XLC A;  3WE3 A;  3HHH A;  4YFK F;  4HV6 A;  1JUP A;  4BUP A;  1MKM A;  3TO7 A;  1AKH A;  2E5N A;  3A01 B;  1LUJ B;  2DPD A;  4BHC A;  4AM3 A;  3F3X A;  4UUT A;  2PMZ N;  5JHF A;  3H0D A;  2H1L A;  4ZTJ A;  2ELH A;  4JX4 A;  3OS2 A;  1DP7 P;  3CC4 I;  3G4S I;  4HPQ A;  2R7D A;  4ON0 A;  2DXI A;  2RN7 A;  1YIJ I;  5F64 A;  2CQ7 A;  2NVU B;  1ETO A;  3AG4 H;  2LRD A;  3TDU C;  4A6D A;  3ZMZ A;  2JA6 J;  3BDD A;  3B6A A;  3CJT B;  3V42 A;  2F5V A;  5FLV A;  2Y2Z A;  2IA1 A;  1I1S A;  3BC8 A;  4F52 A;  4II3 A;  2R7O A;  1ACI A;  1ZN2 A;  3QAH A;  1BOB A;  3I0T A;  2XAF A;  2PMU A;  3HKZ N;  2HXI A;  5M3M J;  5GTI C;  1P7I A;  3TBI A;  3TW7 A;  4BXU A;  2X6Y A;  1R5H A;  3REO A;  3PFI A;  4IJA A;  1SAX A;  4CHU A;  2VJI A;  2R7W A;  2ELK A;  2VJ4 A;  4FX0 A;  5E3N A;  4RB3 C;  3MZH A;  2R92 J;  3RSN A;  3JAM K;  5D6F A;  5KNL A;  5A2Q Z;  4G6Q A;  3M9A A;  1YHQ I;  2QA4 I;  2EH3 A;  2RDP A;  3LSH A;  4ZDO A;  3BG5 A;  3KET A;  1MDM B;  4JX6 A;  4CYC B;  2H09 A;  3F8C A;  3IH3 A;  1BW6 A;  2IAI A;  5L3D A;  4BYY A;  1VQ4 I;  1FTT A;  3D5R C;  2FE3 A;  3BR0 A;  3BZC A;  4M3B A;  3PNT A;  1TW3 A;  1IXR C;  1HW1 A;  1ORK A;  3U9G A;  1YYV A;  1XMA A;  2DA2 A;  5FD6 A;  1RNL A;  4ENM A;  2V7F A;  3JRB A;  1KU9 A;  1FSE A;  2CUJ A;  3C2B A;  2FA5 A;  4KT6 A;  1M1E B;  2EV5 A;  3CCS I;  2L4M A;  4E7H A;  4YEL A;  1ZHF A;  1XSV A;  4J00 A;  5F27 A;  3S93 A;  5ED4 A;  2QKL B;  1EH7 A;  2VN2 A;  4Q48 A;  1QA6 A;  2VT2 A;  2JPC A;  1Z91 A;  3IP4 B;  4IRI A;  3LQR A;  1JJ8 C;  4RGU A;  4D5F A;  4ANJ A;  2IGM A;  3Q9S A;  2R5Y A;  1O4X A;  3BQZ A;  3HHG A;  3PNY A;  1BOA A;  1MBE A;  3CCR I;  4B44 A;  4MEX F;  4FX4 A;  4M71 A;  1EKE A;  5DCF A;  1RKT A;  4IRH A;  4XRM A;  2CV2 A;  1E3O C;  3ERM A;  3CO6 C;  4HF1 A;  2OQG A;  2ZBK A;  3WG9 A;  3GLL A;  3VB2 A;  3OYD A;  3C18 A;  2FQ3 A;  2VIX A;  4JP0 A;  5L3G A;  3E6M A;  2GA2 A;  4ENK A;  3CUO A;  1BIA A;  1UZC A;  2A6E F;  2HGC A;  2XRL A;  2XAJ A;  2M30 A;  3TO6 A;  4BE0 A;  3HSR A;  1Z9C A;  3OMY A;  2KZV A;  4BQA A;  2DT6 A;  2HOE A;  1T95 A;  3I71 A;  5FGM A;  4BDY A;  2GWR A;  3RDI A;  1FT9 A;  2HI3 A;  5LFA A;  5JLW A;  1MMG A;  3QRF F;  2QWW A;  1Y1V J;  1AHD P;  3T8R A;  3LAP A;  2QKM B;  3D0S A;  4I6Z A;  3KYL A;  2HTJ A;  1BL0 A;  3L00 A;  1NHA A;  1Z3X A;  2AS5 F;  3HBL A;  4BY7 J;  2H6B A;  3BTI A;  4U87 A;  3PQJ A;  5FKN A;  9ANT A;  2HTS A;  3CP8 A;  3EUK L;  3IH2 A;  4XK4 A;  1KZH A;  2FOW A;  2BW3 B;  3AAF A;  1LEB A;  2R7V A;  3BOQ A;  3TO9 A;  4E7L A;  5BQT A;  3E5X A;  2XF5 A;  2KKO A;  2H27 A;  3S1N J;  3F8N A;  5BS6 A;  4MEY F;  1UAA A;  3WU1 B;  3F72 A;  4BU2 A;  2GIZ A;  2LFB A;  3CTA A;  4PJL A;  4UVA A;  2K4J A;  5K5Q A;  1JXS A;  3W6K B;  2CWE A;  5GAE J;  3HOS A;  2JTV A;  4OIO F;  2ICW G;  2W84 A;  3EQL F;  5C3E J;  4RDU A;  5F1R A;  2DI3 A;  1U5T C;  2E35 A;  3H1C A;  1XD7 A;  2GXB A;  5J3L A;  5FLX K;  4K2E A;  1XPX A;  1BC8 C;  1OMI A;  1R36 A;  3IWZ A;  1JT0 A;  2B0L A;  4G6D A;  2ZJ2 A;  2XKO A;  2DJI A;  4B43 A;  4XLP F;  1RZ4 A;  2K3P A;  3GEZ A;  2W1O A;  4XKC A;  1W4M A;  1VQ8 I;  4P1W A;  2L02 A;  3GYH X;  4AVZ A;  4DQ2 A;  4EVI A;  2E1C A;  1IV8 A;  4L18 B;  1O57 A;  2MYS A;  4RGR A;  1IRF A;  1YJ9 I;  1POG A;  4WWC A;  2E2I J;  2DLL A;  5DUI A;  3HRM A;  2M0M A;  1ZRF A;  4LLL A;  5HS9 A;  3PO3 J;  4HX7 A;  3RQ4 A;  2NRA C;  2O7O A;  2HOT A;  1UEL B;  4XRF A;  2D1H A;  1W36 C;  4IL6 C;  1OKR A;  1WCM J;  1GVJ A;  4G94 A;  1HXD A;  1OR7 A;  1SMT A;  2Q2E A;  2XSD C;  1UHW A;  3CP2 A;  2LKX A;  1VQP I;  2DDA A;  2OJE D;  3DU5 A;  4E7S A;  3OYA A;  2R7U A;  5HLI A;  5ILV A;  4KT5 C;  2H6C A;  2GXG A;  1HQC A;  3WTS C;  2K86 A;  3E97 A;  2P7V B;  4L5I A;  3ASN H;  3GTL J;  1SD5 A;  1SFO J;  5DD4 A;  4Q5S F;  2CSO A;  1ETW A;  2DN0 A;  3WGI A;  2GOM A;  3P9C A;  2ADU A;  3K2Z A;  5KAF C;  1TT5 B;  3KP5 A;  3WGH A;  2PJP A;  3CF2 A;  3F8F A;  1IG7 A;  5LHI A;  2P8T A;  2IGK A;  3VFZ A;  1RUN A;  4A93 J;  2EA2 A;  2VL8 A;  3KYC B;  4BQQ A;  4IHT A;  2OZU A;  4M3E A;  2CFO A;  1K7A A;  4XSZ F;  3ELK A;  2VBZ A;  3DKX A;  1A31 A;  2DT7 B;  2IP2 A;  4BXF A;  2HPI A;  1A04 A;  1S3J A;  3QPT A;  1R1T A;  3CUQ B;  2XF7 A;  1P4X A;  3A4C A;  4UB6 C;  1MMA A;  5CVR A;  1BR1 A;  3VSL A;  4ZYD A;  2KFD A;  3VEP A;  4CCL A;  5HS7 A;  4XLF A;  2PI0 A;  4HZF A;  4I7H A;  4EAT A;  1SFX A;  2DTZ A;  2YS9 A;  3ZRG A;  1RR7 A;  3LMM A;  3GBG A;  4JOM A;  2HZT A;  4W1U A;  2XKP A;  3HSF A;  4M3F A;  2QM3 A;  3K7A J;  1Z0X A;  4RLF A;  3RTR A;  5HS8 A;  3O8G A;  5CQG A;  1J59 A;  3ZMV A;  4AIH A;  5FO5 A;  1B72 B;  2P6T A;  3KLO A;  1Q1V A;  3LSI A;  2VLA A;  1GV2 A;  4XOT A;  3S15 J;  4Z2Y A;  1OCC H;  4XRS A;  2M9H A;  1XGM A;  5DM6 F;  1R9T J;  2AHQ A;  2UZK A;  4CGZ A;  4C3I J;  1HST A;  4M3G A;  2ZB9 A;  2P81 A;  4ZDP A;  4I09 A;  3MN2 A;  3V8L A;  1HA8 A;  3WTX C;  1IXC A;  1D3Y A;  2HVR A;  5DS9 A;  1IRZ A;  4JX5 A;  3JTG A;  5HLG A;  1MMN A;  3RKY A;  3WG7 H;  3E5Q A;  4ZZD A;  5B66 C;  3BR5 A;  1Y1W J;  2XPW A;  3GTQ J;  1EF4 A;  5J1R A;  3EUA A;  2ACJ A;  4B3X A;  2KIF A;  3E1S A;  2STT A;  3BZK A;  1X19 A;  2QYO A;  2JK3 A;  3CO7 C;  3R60 A;  3I4P A;  3ZQL A;  3TDZ C;  1W7P D;  1ZG3 A;  2XDV A;  4IZZ A;  4GFB A;  2QEN A;  5IYC J;  2RC4 A;  1VQK I;  3LOC A;  3TP3 A;  2R7R A;  3BLY A;  2EFN A;  2V1U A;  3S3M A;  4KIS A;  1GLN A;  3VWB A;  5ILS A;  2M87 A;  3CCQ I;  1FMV A;  1V55 H;  2E1N A;  2L5Q A;  2MGQ A;  2MLK A;  4AVP A;  1LFB A;  3KP7 A;  3OYB A;  1VFC A;  4C3H J;  2Z5U A;  1XSD A;  2D2W A;  2CGP A;  2NVY J;  2RAE A;  4DIQ A;  3FMQ A;  3GLX A;  3PIP F;  3DPU A;  2O0Y A;  2ZXI A;  2IS6 A;  2CH0 A;  2ZCW A;  1BJA A;  3SZT A;  5K5R A;  2H8R A;  2VKE A;  3O2P E;  2E1O A;  2EZK A;  1TWF J;  4OMY A;  1J0R A;  1YE9 A;  4XIC A;  2LBF A;  3EDP A;  1T0F A;  4A3E J;  4BY1 J;  3W2V A;  2XV4 S;  2O3F A;  4FQG A;  3SHF A;  3HDD A;  2CQQ A;  4UUS A;  1W1W E;  4UV9 A;  2XAG A;  2JQ7 A;  2W48 A;  4IQ4 A;  3FXL A;  2Y31 A;  2R7F A;  2UUZ A;  2VJJ A;  3QYF A;  2JA2 A;  2QQA A;  2JA5 J;  1HW2 A;  4AID A;  2ECC A;  2PN6 A;  1I5Z A;  2EB7 A;  2XSJ C;  4CCK A;  3J81 K;  3A2K A;  3KP2 A;  3L2W A;  4WCG A;  2H1K A;  3RPQ A;  3S17 J;  3ABM H;  4EV0 A;  1GXP A;  1MBK A;  1YS6 A;  3KP3 A;  1GUU A;  1N75 A;  3K0L A;  3HYI A;  3WOD F;  4FT8 A;  2UWM A;  2FJ1 A;  3I64 A;  2KLO A;  4UHT A;  3EYY A;  4HSR A;  3KZI C;  3TQN A;  1VI0 A;  2HDW A;  2RNJ A;  5TIS C;  2HDC A;  1X1B A;  1KU3 A;  2JJ7 A;  1LE8 B;  1SVM A;  1IGN A;  5F0F A;  1XMK A;  2C6Y A;  4KIF A;  1GDT A;  2A69 F;  3L2Q A;  1RC9 A;  2E7W A;  4NC7 A;  2Y9Y A;  3FXR A;  2MFZ A;  4CSW A;  4E7J A;  2QF7 A;  3OOP A;  3FDY A;  1JJ6 C;  1TL8 A;  1TQM A;  4F91 B;  2GBY A;  3GTM J;  4IOC F;  1LDD A;  5D6E A;  4LOC A;  1VQ9 I;  5TJJ A;  3X2Q H;  2O61 A;  3TW6 A;  2OUM A;  1IXS B;  1WGX A;  4M9X A;  4P55 A;  2WY7 Q;  4M6V A;  1Z6R A;  2WBM A;  1MJ9 A;  1TC3 C;  5GAH J;  1R6R A;  1FNN A;  2FQ4 A;  3LL7 A;  2A05 A;  1TQI A;  2QEX I;  5TGT A;  1FZP B;  2QVO A;  2P6S A;  3FK6 A;  3DP7 A;  3S8P A;  3QU6 A;  1QQI A;  1VF9 A;  1K61 A;  2OC6 A;  1S7E A;  1MMS A;  5FRN A;  1FEX A;  3GZ5 A;  3G3Z A;  1QU3 A;  2O5R A;  2ZME A;  3ZQQ A;  4CYD A;  4B1R A;  2FEZ A;  3JRG A;  3GW2 A;  3G1O A;  3MWM A;  1QVU A;  3I54 A;  5FD5 A;  3UR3 C;  3HPH A;  1A35 A;  3Q0W A;  3SZG A;  2RKH A;  3HJE A;  5ICC A;  3AG1 H;  4F3Q A;  3BY6 A;  1U3E M;  3SZP A;  5JVT A;  3OYE A;  5E1Z B;  2HVQ A;  2K9Q A;  2NAZ A;  3D5S C;  1I3A A;  3C2G A;  3MD2 A;  4HG2 A;  4QSH A;  3RJP A;  4EJV A;  1HDD C;  2JN6 A;  1R7J A;  2K85 A;  2PMZ A;  3KZZ A;  3MVP A;  4RAY A;  5E20 A;  3BRO A;  1B4A A;  1ZR2 A;  4LIU A;  4HST A;  4GDF A;  1JKR C;  3W3C A;  1N77 A;  5EGO B;  2X85 A;  2HQA A;  4F55 A;  4ESJ A;  5EF6 A;  3CJN A;  1HDP A;  4U7B A;  4MTD A;  1OCR H;  1T39 A;  2XAU A;  1B72 A;  3KLN A;  4G12 A;  3M1C A;  1Y0U A;  4LIV A;  2R0Q C;  2HFH A;  2IEK A;  4A3L J;  5FKO A;  3BR1 A;  2ZJR F;  3E6D A;  2IGN A;  5AON A;  2WAQ N;  2EIK H;  4LJZ F;  3HXL A;  1U5T A;  4KIG A;  5DDG A;  3JRI A;  4L9N A;  2NOJ B;  2LY9 A;  2RQP A;  2XVC A;  4PK4 A;  1IC8 A;  3FBN B;  3VOD A;  2Y9Z A;  4WK8 F;  5LD2 C;  5J47 A;  4I98 B;  3J7Z I;  2EA4 A;  4O3M A;  2EV0 A;  2E19 A;  2V9K A;  2HR3 A;  4BJT A;  1ETY A;  2LMD A;  3WHC A;  4RB1 A;  3CME I;  1TZL A;  3NRV A;  2ZO4 A;  3S32 A;  4B4C A;  1W7P A;  4OAY A;  2PX9 A;  1P6R A;  2DOF A;  3OWT A;  2BGC A;  1WJE A;  2MC3 A;  1SFK A;  4XSX F;  1QZY A;  3DTE A;  4Q47 A;  2CV0 A;  2V6E A;  5IT9 K;  2EIJ H;  1G2H A;  2EIM H;  4KN7 X;  2HPM A;  2IA2 A;  1Z05 A;  4XN3 A;  3L9F A;  2P5K A;  2V1X A;  3M7G A;  5LHG A;  1G3Y A;  1SD7 A;  3V8K A;  2V6C A;  1K4T A;  4CCN A;  5J4Y A;  3G1L A;  1YLF A;  3R0J A;  3ZMD A;  1WHU A;  5K1Y A;  2R5Y B;  4P9F A;  3K2A A;  3H9G A;  4JYK A;  4N9I A;  5ICG A;  1OCO H;  1G8X A;  4OIR F;  1L3L A;  4A69 C;  3JRE A;  1ODD A;  5HLT A;  4OU0 A;  3CCU I;  5EZG A;  4XMY A;  3LWF A;  3SQN A;  1DDN A;  1WVR A;  4RM2 A;  2VC0 A;  5F08 A;  2FBH A;  2OZ6 A;  1NH3 A;  2KRC A;  3HSE A;  2FMY A;  2R5Z B;  1U0J A;  3W2W A;  2PQ8 A;  5J40 A;  4C2T A;  3L1P A;  1AKH B;  1G4D A;  3M8J A;  1QHG A;  4P96 A;  4RBO A;  4BDZ A;  2STW A;  3K4B A;  5FKM A;  3SYT A;  4YIF A;  2FML A;  3C2H A;  5ICF A;  5H2F C;  4IKF A;  2BY1 A;  3CJR B;  3HRU A;  2XIG A;  5HDN A;  1GHC A;  2HVS A;  3JSO A;  3JRA A;  1S7O A;  4UVC A;  1X2N A;  4XKW A;  1MNE A;  2XRO A;  2LYC A;  3ULQ B;  2IPQ X;  4ENJ A;  2YR2 A;  1WJB A;  3FXM A;  4FCY A;  2VQC A;  4KUM A;  1YW9 A;  4E70 A;  4IHV A;  4MLO A;  5F04 A;  4P5O A;  2E1M C;  2EQR A;  5IP6 A;  5J6X A;  2V79 A;  4AIK A;  2KP6 A;  3G6E I;  1XS9 A;  1V5E A;  3SEZ A;  3ONQ A;  3K4K A;  3LA2 A;  5H20 A;  3OYF A;  2XB5 A;  3HC7 A;  2BV6 A;  4OWR B;  1SD6 A;  4U0W A;  5H6Q A;  3F23 A;  2JMW A;  3VYR B;  1LFP A;  1ZRC A;  1S7A A;  3BG9 A;  3H3Z A;  1K6Y A;  1ZRE A;  3LSG A;  3J81 Z;  3T1B A;  4UY8 I;  3BR3 A;  1X3Z B;  3ZMT A;  5EDN A;  2L2O A;  2ZJP F;  1XMX A;  2QCO A;  4XL9 A;  1FYL A;  5FB2 A;  4PJ0 C;  3H9Q A;  1O3Q A;  2L3D A;  2QSF X;  2RV8 A;  2YU9 J;  4C30 A;  3FHZ A;  2CMP A;  1Z77 A;  3A03 A;  5DCM A;  2CQX A;  1Z6T A;  1K6O A;  3D1N I;  3MCZ A;  4UNO A;  2F6C A;  4CXF A;  3IHU A;  3K1P A;  2NS0 A;  3T0Y A;  1UG0 A;  3A01 A;  3OSG A;  5BPI A;  4E6K G;  1AU7 A;  1D8K A;  4NQW A;  3K10 A;  4DJA A;  1E3P A;  2BOL A;  1TNT A;  2NNN A;  4A0Z A;  3OR1 C;  1PDN C;  1ZH5 A;  3OYH A;  4RAG A;  4KDP A;  3JW4 A;  4I76 A;  2X6O A;  3OS1 A;  4EM2 A;  4PZJ A;  2DMN A;  1TWA J;  1D1A A;  4IQJ A;  1A5J A;  1LEA A;  2L9V A;  4ITV A;  5D8K B;  1LNW A;  2LLK A;  1QHH D;  1RRJ A;  2VUM J;  3ABU A;  5DM7 F;  2LC2 A;  1WI3 A;  4G7O F;  4V2F A;  1YJN I;  1FOY A;  4NDL A;  3CMY A;  1WRJ A;  3DPL C;  4D7M A;  2JPB A;  1VQN I;  1WJC A;  3FZV A;  3RPU A;  4XR6 A;  2JRM A;  5IY5 H;  2HQN A;  4AYB A;  4B47 A;  1IV6 A;  2W82 A;  3FXJ A;  2D5V A;  2VE8 A;  2OV7 A;  1OQY A;  2HKO A;  1I6X A;  3K4J A;  2Z3Y A;  3QYB A;  4I01 A;  4M9Z A;  2BYV E;  2NOG A;  3K6G A;  4RAF A;  2VOP A;  2Q0O A;  2M7B A;  1HSJ A;  2OD5 A;  2W85 A;  1G59 A;  2OTL I;  1Z1D A;  2XGD A;  4YIR X;  2XAQ A;  1UCR A;  3T5X A;  1SEU A;  1DGR M;  1CF7 A;  3R6S A;  4BE2 A;  4UXN A;  1R1V A;  3DEE A;  3H3V K;  2LF8 A;  3S16 J;  5JLX A;  4OOI A;  2GAU A;  5J4V A;  5J1Y A;  4EM0 B;  2D45 A;  1JE8 A;  3FXU A;  1B59 A;  5J8C A;  2BZT A;  4LG3 A;  3H9J A;  3S1M J;  1Y8R B;  5JVG F;  3NAU A;  3B6C A;  1WZ2 A;  3A0B C;  3GTJ J;  2DT5 A;  2E36 A;  5HDK A;  4FET A;  5DEQ A;  3QOP A;  2UXN A;  1FP2 A;  3CDH A;  3OIP A;  3VSK A;  3KP4 A;  5CQE A;  4LG0 B;  2G9W A;  3R4K A;  4M72 A;  5K7H A;  3Q9V A;  5J8F A;  2LBF B;  1NTC A;  3K1M A;  3HRS A;  2HU9 A;  1KYZ A;  3CC7 I;  2XAS A;  3FWE A;  2F4O B;  3EET A;  5DYM A;  3HOV J;  5D5X B;  3S1R J;  1Y56 A;  2QBY A;  5AIQ A;  4XN0 A;  4N0B A;  4HBL A;  5LRR A;  2NVQ J;  5BMZ A;  4NC8 A;  3NWT A;  5CVI A;  3OY9 A;  1O3T A;  1H89 C;  2A3S A;  2KDO A;  4B48 A;  3CF5 F;  5FKK A;  2F5C A;  3DBL B;  2LD5 A;  1X58 A;  2F48 A;  4LMY A;  4MQ9 F;  4BKX A;  2F4I A;  3EYI A;  1E0E A;  1R4N B;  3EUH C;  2P5L C;  3GZN B;  2F5F A;  1NK2 P;  1IUF A;  2G0E A;  3PQK A;  3RYR A;  1D5Y A;  3HGY A;  5ILU A;  3BTJ A;  2LG4 A;  1A36 A;  1JKP C;  1TNS A;  1ZLJ A;  1S5L C;  1XGO A;  3ABL H;  4L9V A;  4PDK A;  3U21 A;  4BJ5 C;  1NK3 P;  1UST A;  4D1Q A;  2LDU A;  4M9S A;  4IF4 A;  4U7D A;  1B8I B;  4ZYE A;  3CC2 I;  2KHM A;  2Y75 A;  4AU7 A;  2VBW A;  1IN8 A;  2OQR A;  3ZQI A;  4R8H A;  4BEH B;  3HPG A;  2NYX A;  1R23 A;  4KNY A;  1YQA A;  2HYJ A;  2X1E A;  3CMA I;  2IS1 A;  1G3S A;  3IAM 2;  1Y0N A;  1YW7 A;  2OPT A;  3J7Y J;  3Q3S A;  2M3A A;  5LGN A;  3HOX J;  3CLO A;  2QZ8 A;  2HKX A;  3CCV I;  2K5C A;  2DA6 A;  1FX7 A;  4H4K C;  3I59 A;  2R7T A;  1ON1 A;  1U78 A;  3AFH A;  3HOT A;  4JK1 X;  3HUG B;  4IRG A;  4YG2 F;  3MKW B;  1D0Y A;  1R49 A;  4I2O A;  2L9S A;  4FE4 A;  1HLV A;  1TWH J;  3DFG A;  2O03 A;  2RGV A;  3N4M A;  4LD5 A;  2GIV A;  2YUS A;  5HLH A;  1K78 B;  4LB5 A;  3GFJ A;  3K69 A;  3VYU B;  5IYD J;  4PGG A;  2MW8 A;  2H8W A;  4PJM A;  4DNC A;  1BI1 A;  5HNF A;  3RZD J;  5B1A H;  4UV8 A;  2WA0 A;  1UHS A;  3C3W A;  4N9H A;  1LPQ A;  3U1D A;  4IHW A;  1WJA A;  1RR8 C;  3WTY C;  1SFE A;  4GCV A;  1MSF C;  2E7X A;  3L2R A;  3S2D J;  3FXQ A;  1U8R A;  2TDX A;  1ZAO A;  2TRT A;  1SAN A;  2BXZ A;  2COM A;  4TV7 A;  5FKL A;  2DU9 A;  3ECO A;  4R79 A;  1JI8 A;  2XGC A;  3OOU A;  2ME6 A;  4A3B J;  3PSF A;  2Y0M A;  2E1M B;  2IGO A;  2YU3 A;  2R93 J;  4BE1 A;  4LG0 A;  3SEQ A;  3ERE D;  3K4C A;  3E6B A;  2LF7 A;  3QYE A;  2R7Q A;  5B1B H;  5K5O A;  3I58 A;  1PYV A;  3JTH A;  4AYB N;  1R4M B;  3IUO A;  1F5T A;  2GXA A;  4AWX B;  4RB2 C;  5E8G A;  1ETK A;  2GZW A;  4HDU A;  5CPR B;  2OA4 A;  4KA4 A;  2VB6 A;  4AIJ A;  3JCU C;  3LSP A;  4L0Y B;  3GO5 A;  5E3M A;  2VKD A;  1S8N A;  2WC2 A;  2M5W A;  2WV0 A;  4HQE A;  4BNC A;  3UKG A;  4XLH A;  2ZSI B;  5ERI A;  2KRH A;  2W4S A;  3CZ6 A;  3AG2 H;  1AOY A;  2FNA A;  5E8I A;  4KN4 X;  2DJN A;  2RQQ A;  4DOZ A;  1MIJ A;  1TWC J;  3GME A;  3C1D A;  4BS9 A;  2CYY A;  1D8J A;  2X0L A;  3FF5 A;  1XC5 A;  2WWY A;  2RNG A;  3LQQ A;  1WJD A;  3E7L A;  1RKW A;  3ASO H;  3JRF A;  3QP6 A;  4L0Z B;  3O8H A;  1W0T A;  4NNJ A;  1K83 J;  1F43 A;  2CUF A;  2FSW A;  1FMW A;  1CQT A;  4A12 A;  3ECH A;  4G7Z F;  3PIO F;  4V2G A;  1HW5 A;  1HCR A;  2Z9O A;  1R5G A;  2HNH A;  1F36 A;  4OIP F;  2KPM A;  1LVK A;  4WX9 A;  2NS7 A;  2XPU A;  3RIR A;  2UXX A;  1IRX A;  4XRS G;  1WFX A;  2DDB A;  4AC0 A;  4RM3 A;  4F93 B;  1A6I A;  1FOW A;  1YIT I;  1Y39 A;  4XM3 A;  1UB9 A;  2A61 A;  1DPR A;  5EG0 A;  4U0Y A;  5HNH A;  3ISP A;  2ESN A;  1KGS A;  1MJB A;  1DU0 A;  1ETX A;  3DTK A;  2AO9 A;  5K7Z A;  3GF2 A;  3SFI A;  1LQ1 A;  3QWL A;  2NVX J;  1U5T B;  2F4M B;  3LNQ A;  3ZXS A;  2LSO A;  1BR2 A;  3DEU A; 
#chains in the Genus database with same CATH homology
 2M1B A;  2PBI A;  3W6J B;  4CO8 A;  5FLX Z;  5L3E A;  2FOK A;  2VOD A;  3V8J A;  4U88 A;  4ESB A;  2EWN A;  3KP6 A;  1ZGJ A;  1Z7U A;  1BM9 A;  1QGP A;  3I53 A;  1KQ9 A;  4HW0 A;  3TOA A;  2GA1 A;  2DTR A;  3B73 A;  5BOX A;  3WTW C;  1TTY A;  4NB5 A;  3GZ6 A;  1QZZ A;  3HRT A;  4HLX A;  1QO0 D;  1OYW A;  1G3W A;  2ZNY A;  5LEK A;  4YFN F;  4H0E A;  4EJO A;  1XDU A;  3L09 A;  2Q8K A;  3MFK A;  1B1B A;  1U6G A;  4B8X A;  3J80 K;  1UHM A;  1WWX A;  4S04 A;  3HTS B;  2F5D A;  3IWF A;  4G9Y A;  5EEG A;  2XRN A;  2M8E A;  1MD0 A;  3ZN1 A;  2VOO A;  2KJC A;  4GXO A;  3KZY A;  4HF0 A;  3CUQ A;  1MJA A;  4G8X A;  2DBB A;  1J5Y A;  2PEX A;  1DUX C;  1PP8 F;  4EJU A;  1YW8 A;  3JAM Z;  5CVV A;  1J75 A;  5E17 F;  1R22 A;  3LA3 A;  1S29 A;  2MLG A;  4RAZ A;  1F1Z A;  2R3S A;  1SFU A;  3LAJ A;  1WSU A;  2YSR A;  5L3C A;  4NHJ A;  1HBX G;  5D5U B;  1ON2 A;  4A6E A;  2V1D A;  4KIB A;  1IN7 A;  2HEO A;  1QPM A;  1W5T A;  3LFK A;  1ZAR A;  4HAM A;  2VXZ A;  3ML6 A;  1C0W A;  2MD5 A;  1O3S A;  1MGT A;  4A2U A;  3LA7 A;  2EV6 A;  3EUH A;  3F6O A;  4BHB A;  1RIO H;  3TKY A;  3J7A O;  3FMS A;  5LLQ A;  4BH9 A;  3MAJ A;  1SD4 A;  1X3U A;  1K79 A;  4L9T A;  1FYK A;  5FFX A;  3ZP5 A;  1GXQ A;  2EFW A;  1ZG1 A;  1YTY A;  4YFX F;  2PFB A;  1W7P B;  1I27 A;  5TRD A;  2J5O A;  4WXC A;  5D4S A;  3MEX A;  4UUV A;  3TGN A;  1F9N A;  2OAZ A;  3O6B B;  3C7J A;  4A0Y A;  3QP5 A;  4O6J A;  1XN7 A;  2W25 A;  2L4A A;  4ESF A;  1SMY F;  2ZME B;  5DCM B;  4RS8 A;  2M45 A;  3RYP A;  3F6V A;  3LST A;  3GUD A;  1V4R A;  1VTN C;  4MNU A;  3SXY A;  1TW2 A;  4D0P A;  1KQ8 A;  4EM1 A;  3QU3 A;  3RKW A;  1RUO A;  1PP7 U;  1G6N A;  1EH8 A;  4HV5 A;  3P9I A;  4LK0 F;  5A2Q K;  1QBJ A;  2EFP A;  4Q4Z F;  3E3V A;  2D1V A;  4HX8 A;  5CLS A;  2BEO A;  3R0A A;  1J7K A;  1IN4 A;  4BHP A;  4HDV A;  2DAO A;  3IRQ A;  2AXL A;  2DFI A;  3E6C C;  4CDG A;  2FRH A;  1BI3 A;  3H92 A;  1ZRD A;  1XSX A;  1O3R A;  4EJT A;  1P2F A;  3GWZ A;  1Q1H A;  3VOE A;  2H94 A;  5H6R A;  1L0O C;  3BPX A;  3BP8 A;  4CZZ A;  1H0M A;  5LBQ A;  4P9U A;  2KIM A;  1XCB A;  1O7F A;  2HS5 A;  2MBF A;  2G7H A;  1FBQ A;  6PAX A;  4B09 A;  2W57 A;  5D5W B;  5D8L B;  1P92 A;  1UFM A;  1R1U A;  3S2W A;  2HYF A;  1XGS A;  3BZ6 A;  4Y17 A;  2IRF G;  2DK8 A;  1STZ A;  3WU0 A;  3WTT C;  4Y13 A;  3OV8 A;  5D5V B;  4ZH4 F;  1U2W A;  2VBY A;  2G7U A;  4I0B A;  1IF1 A;  1HKQ A;  2DK5 A;  2K4B A;  2KJB A;  4HQM A;  3F8M A;  3KFW X;  1FLI A;  2GQQ A;  1HKS A;  3IKT A;  2NNY A;  4EGZ A;  5IT9 Z;  4EQQ A;  2Y48 A;  2IW5 A;  4WXH A;  4ETS A;  2DPU A;  3NQO A;  4L9J A;  3E5U A;  1IW7 F;  3GX4 X;  1PUE E;  2EFO A;  5E1W A;  3F8B A;  2JT1 A;  2F2E A;  5IT3 A;  1OYI A;  4WXD A;  5L3B A;  3H3U A;  1ZG5 A;  3GVA A;  3GFL A;  3IKV A;  3HTU A;  2FF4 A;  1KU2 A;  5EEH A;  2J5P A;  5L3F A;  1FSH A;  3IRR A;  1QNT A;  3BWG A;  5DD8 A;  2PMH A;  3GFI A;  4KMU X;  1ZYR F;  3FM5 A;  1B9N A;  2JSC A;  5JI6 A;  5JFR A;  1IN5 A;  1LVA A;  2OU2 A;  4GO1 A;  2VON A;  5CVU A;  3N97 A;  1CF7 B;  3R61 A;  1FBS A;  1YS7 A;  5E1X A;  3RKX A;  5AIP A;  2FBK A;  3B02 A;  4GGG A;  4A0X A;  2K27 A;  2ISZ A;  4KYW A;  4HYE A;  1MDM A;  3ABT A;  2PG4 A;  4GYI A;  2V9V A;  3MZY A;  1XDS A;  2VBX A;  4R1H A;  4ASN A;  3COA C;  2IJL A;  1FOK A;  1RI7 A;  2CW0 F;  3KE2 A;  4YII A;  1IUY A;  5BPD A;  1P4A A;  1EH6 A;  2QQ9 A;  4EGY A;  1W5S A;  1IRG A;  1DPU A;  3QPH A;  1XB4 A;  4XLN F;  4G7H F;  2L01 A;  3K9T A;  5HVQ C;  4WF2 A;  3K1N A;  4HA8 A;  3FX3 A;  2LKP A;  3P9K A;  1G3T A;  2ETH A;  1T6S A;  2X4H A;  2EFQ A;  2QQB A;  1E17 A;  1FPQ A;  3CUQ C;  3NEU A;  3TOB A;  4QWQ A;  1D5V A;  1FP1 D;  1LB2 A;  4I02 A;  4GYG A;  4HOB A;  5CVJ A;  4MHG A;  1H9T A;  1LDJ A;  1R58 A;  1JHF A;  4LK1 F;  3ZMU A;  1R00 A;  1KYW A;  2KRF A;  2O8X A;  3WTU C;  4FHT A;  2P4W A;  3L2C A;  4ENN A;  1FYM A;  2VT3 A;  3IL2 A;  5LGT A;  3KEO A;  2DW4 A;  5JR3 A;  4OIQ F;  2KIU A;  1YIO A;  1BIB A;  2W24 A;  2XGX A;  1REP C;  3HIF A;  3KCC A;  2O6G E;  4BAY A;  3WTZ A;  4ZZL A;  2YPR A;  4HX4 A;  1XCV A;  4L5J A;  1HKT A;  3J80 Z;  5KK1 A;  3V7S A;  1YG2 A;  4JBA A;  4LFU A;  4CIC A;  4KIC A;  2ZKZ A;  4A5M A;  5HOO A;  1J2X A;  3O3K A;  1T2K A;  1WQ2 A;  2IVM A;  4OIN F;  4O5V A;  5FFZ A;  4ZYG A;  4HF2 A;  4MQV A;  4IXA A;  4F7Z A;  2YX7 A;  4JQF A;  2IT0 A;  1I1G A;  4ZYH A;  4S05 A;  1J9I A;  2VC1 A;  1S6L A;  1TQP A;  2CO5 A;  4EJW A;  3ZMS A;  1V3F A;  1CGP A;  2DO7 A;  2ESH A;  3FMR A;  2CG4 A;  1BI2 A;  5LEJ A;  3GFM A;  1IN6 A;  2FXA A;  2IA0 A;  4UVB A;  3DPT A;  2P7C B;  5DUK A;  2FU4 A;  1ZGA A;  3F21 A;  2ZNZ A;  1JHH A;  2VE9 A;  4IVN A;  3KEQ A;  3U2R A;  4XBF A;  4Y15 A;  2XHK A;  2QUF A;  5CYV A;  4PGH A;  1ZLK A;  2DQL A;  2EJR A;  5F6F A;  5HDG A;  4M6Y A;  1IAW A;  1H9G A;  5KVR A;  3GXO A;  2ZFW A;  1BN5 A;  1AWC A;  2WTE A;  2FBI A;  2HQR A;  4IHS A;  1B9M A;  1BI0 A;  1BBY A;  4AD9 A;  4RGX A;  3T8T A;  3I5U A;  3JSP A;  1TBX A;  3BJ6 A;  1TLH B;  3P7N A;  3I59 B;  1OPC A;  1XGN A;  5LRS A;  3WE2 A;  1WI9 A;  2ISY A;  2MH2 A;  3L7W A;  1F4K A;  2QBY B;  5LHH A;  3DF8 A;  5CJ9 A;  2XUB A;  2FNP A;  1K78 A;  4M6X A;  1ONV A;  2YX4 A;  2PLY A;  4EMS A;  3V4G A;  3HUG A;  1FBU A;  2QLZ A;  2JRT A;  3MQ0 A;  4HLY A;  4KMF A;  3V7C A;  5JHU A;  1B6A A;  2A6H F;  4QLC U;  5E18 F;  5D4R A;  4U0V A;  3ZPL A;  2DQR A;  1ULY A;  4I0A A;  3FM3 A;  4PCQ A;  1KQ0 A;  2RVC A;  1P4W A;  3ZQ7 A;  2HWV A;  1LJ9 A;  3F22 A;  3Q5F A;  2CFX A;  1T98 A;  3M1E A;  3D5L A;  3IC7 A;  3DV8 A;  1LDK B;  2EK5 A;  1OYY A;  2BE5 F;  3DKW A;  3V7R A;  1YFH A;  1BC7 C;  3M8E A;  4RB0 A;  2BBY A;  3BJO A;  3ZN0 A;  1YO5 C;  2OBP A;  1FY7 A;  2XAH A;  1EV7 A;  5LGU A;  1E2X A;  4LB6 B;  2MA3 A;  3BJA A;  4M73 A;  5ICE A;  2MH9 A;  4A5N A;  4LLG F;  2P5V A;  4RGS A;  1T38 A;  4IPA A;  4MTE A;  1KU7 A;  2CQK A;  2Z99 A;  3DQV C;  3ROU A;  3RI4 A;  5DV5 A;  1IZ1 A;  1KA8 A;  2A68 F;  2JZY A;  2K7L A;  3DXJ F;  4OMZ A;  4LLN A;  1MZB A;  1WKM A;  4MGR A;  3WGG A;  1FC3 A;  2A5Y B;  2LNB A;  2K02 A;  1JGS A;  3SFZ A;  3WTV C;  3BPV A;  3G73 A;  2HYG D;  1O7L A;  2Z33 A;  3M8F A;  2F5E A;  2A07 F;  1FWZ A;  4LGW A;  2ZXJ A;  1USS A;  2L54 A;  4KFC A;  4M74 A;  3WE3 A;  3HHH A;  4YFK F;  4HV6 A;  1MKM A;  3TO7 A;  2DPD A;  4BHC A;  3F3X A;  2ELH A;  1DP7 P;  2R7D A;  4ON0 A;  2RN7 A;  5F64 A;  3TDU C;  4A6D A;  3ZMZ A;  3BDD A;  2IA1 A;  1I1S A;  1ZN2 A;  3QAH A;  3I0T A;  2XAF A;  2PMU A;  4BXU A;  1R5H A;  3REO A;  3PFI A;  4IJA A;  1SAX A;  4CHU A;  4FX0 A;  4RB3 C;  3MZH A;  3JAM K;  5D6F A;  5A2Q Z;  4G6Q A;  3M9A A;  2RDP A;  3KET A;  1MDM B;  2H09 A;  3F8C A;  5L3D A;  4BYY A;  2FE3 A;  1TW3 A;  1HW1 A;  1IXR C;  3U9G A;  1YYV A;  1XMA A;  5FD6 A;  1RNL A;  4ENM A;  1KU9 A;  1FSE A;  2FA5 A;  2EV5 A;  2L4M A;  1ZHF A;  1XSV A;  5ED4 A;  1EH7 A;  2VN2 A;  4Q48 A;  2VT2 A;  2JPC A;  1Z91 A;  4IRI A;  3LQR A;  4RGU A;  3Q9S A;  3HHG A;  1BOA A;  4MEX F;  4FX4 A;  4M71 A;  5DCF A;  4IRH A;  3CO6 C;  4HF1 A;  2OQG A;  2ZBK A;  3WG9 A;  3VB2 A;  3C18 A;  2FQ3 A;  5L3G A;  3E6M A;  2GA2 A;  4ENK A;  3CUO A;  3TO6 A;  1BIA A;  2HGC A;  2A6E F;  1Z9C A;  2XAJ A;  2M30 A;  3HSR A;  4BQA A;  2HOE A;  3I71 A;  5FGM A;  2GWR A;  3RDI A;  1FT9 A;  3QRF F;  2QWW A;  3T8R A;  3LAP A;  3D0S A;  2HTJ A;  3L00 A;  1NHA A;  2AS5 F;  2H6B A;  3PQJ A;  2HTS A;  3AAF A;  1LEB A;  3BOQ A;  3TO9 A;  5BQT A;  3E5X A;  2KKO A;  2H27 A;  3F8N A;  5BS6 A;  4MEY F;  3WU1 B;  3F72 A;  3CTA A;  4UVA A;  2K4J A;  5K5Q A;  1JXS A;  3W6K B;  2CWE A;  3HOS A;  2JTV A;  4OIO F;  2W84 A;  3EQL F;  5F1R A;  2DI3 A;  1U5T C;  1XD7 A;  2GXB A;  5FLX K;  4K2E A;  1BC8 C;  1OMI A;  1R36 A;  3IWZ A;  2B0L A;  4G6D A;  2ZJ2 A;  2XKO A;  4XLP F;  1RZ4 A;  3GEZ A;  1W4M A;  2L02 A;  3GYH X;  4DQ2 A;  4EVI A;  2E1C A;  4L18 B;  1O57 A;  4RGR A;  1IRF A;  4WWC A;  2DLL A;  5DUI A;  3HRM A;  1ZRF A;  4LLL A;  5HS9 A;  4HX7 A;  2NRA C;  4XRF A;  2D1H A;  1OKR A;  1GVJ A;  4G94 A;  1HXD A;  1OR7 A;  1SMT A;  2Q2E A;  1UHW A;  5HLI A;  5ILV A;  4KT5 C;  2H6C A;  2GXG A;  1HQC A;  3WTS C;  2K86 A;  3E97 A;  2P7V B;  4L5I A;  1SD5 A;  5DD4 A;  4Q5S F;  2CSO A;  3WGI A;  3P9C A;  2ADU A;  3K2Z A;  3KP5 A;  3WGH A;  2PJP A;  3F8F A;  5LHI A;  2P8T A;  3VFZ A;  1RUN A;  2EA2 A;  4IHT A;  2OZU A;  1K7A A;  4XSZ F;  3ELK A;  2VBZ A;  2IP2 A;  1A04 A;  1S3J A;  3QPT A;  1R1T A;  3CUQ B;  1P4X A;  5CVR A;  4ZYD A;  3VEP A;  5HS7 A;  2PI0 A;  4HZF A;  4I7H A;  1SFX A;  2HZT A;  2XKP A;  3HSF A;  3RTR A;  2QM3 A;  5HS8 A;  1J59 A;  3ZMV A;  4AIH A;  5FO5 A;  2P6T A;  3KLO A;  4Z2Y A;  1XGM A;  2UZK A;  4CGZ A;  1HST A;  4I09 A;  3V8L A;  1IXC A;  1D3Y A;  3JTG A;  5HLG A;  3RKY A;  3E5Q A;  4ZZD A;  2ACJ A;  2KIF A;  2STT A;  2QYO A;  3CO7 C;  3R60 A;  3I4P A;  3TDZ C;  1W7P D;  1ZG3 A;  2QEN A;  2RC4 A;  2V1U A;  2EFN A;  5ILS A;  2M87 A;  2E1N A;  2MLK A;  4AVP A;  3KP7 A;  2Z5U A;  1XSD A;  2D2W A;  2CGP A;  3FMQ A;  3GLX A;  2O0Y A;  2ZCW A;  1BJA A;  3SZT A;  5K5R A;  3O2P E;  4OMY A;  1J0R A;  3EDP A;  1T0F A;  2XV4 S;  2O3F A;  3SHF A;  4UV9 A;  2XAG A;  2R7F A;  2QQA A;  1HW2 A;  2PN6 A;  1I5Z A;  2EB7 A;  3J81 K;  3KP2 A;  4WCG A;  3RPQ A;  4EV0 A;  1GXP A;  1YS6 A;  3KP3 A;  3K0L A;  3HYI A;  3WOD F;  4FT8 A;  2UWM A;  3I64 A;  4UHT A;  3EYY A;  3TQN A;  2RNJ A;  2HDC A;  2C6Y A;  1KU3 A;  1XMK A;  4KIF A;  2A69 F;  2E7W A;  3FXR A;  3OOP A;  1TQM A;  1LDD A;  5D6E A;  5TJJ A;  2O61 A;  1IXS B;  4M9X A;  4P55 A;  1Z6R A;  1MJ9 A;  1FNN A;  1TQI A;  1FZP B;  2QVO A;  2P6S A;  3DP7 A;  3QU6 A;  1QQI A;  3GZ5 A;  3G3Z A;  2ZME A;  4CYD A;  2FEZ A;  3GW2 A;  3MWM A;  3I54 A;  5FD5 A;  2RKH A;  5ICC A;  1U3E M;  3BY6 A;  3SZP A;  5JVT A;  5E1Z B;  2NAZ A;  3RJP A;  4EJV A;  1R7J A;  3KZZ A;  4RAY A;  5E20 A;  3BRO A;  1B4A A;  4ESJ A;  3CJN A;  4U7B A;  4MTD A;  1T39 A;  3KLN A;  1Y0U A;  2HFH A;  3E6D A;  5AON A;  4LJZ F;  5DDG A;  1U5T A;  4KIG A;  4L9N A;  2RQP A;  2XVC A;  3VOD A;  4WK8 F;  4I98 B;  2EA4 A;  4O3M A;  2EV0 A;  2HR3 A;  4RB1 A;  3NRV A;  2ZO4 A;  1W7P A;  1P6R A;  2BGC A;  2MC3 A;  4XSX F;  1QZY A;  4Q47 A;  5IT9 K;  4KN7 X;  2IA2 A;  1Z05 A;  3L9F A;  2P5K A;  2V1X A;  3M7G A;  5LHG A;  1G3Y A;  1SD7 A;  3V8K A;  2V6C A;  1YLF A;  3R0J A;  3ZMD A;  5K1Y A;  4P9F A;  4N9I A;  5ICG A;  4OIR F;  1L3L A;  1ODD A;  4OU0 A;  3LWF A;  3SQN A;  1DDN A;  2VC0 A;  2FBH A;  2OZ6 A;  3HSE A;  2FMY A;  2PQ8 A;  1G4D A;  4P96 A;  2STW A;  4YIF A;  2FML A;  5ICF A;  3HRU A;  2XIG A;  5HDN A;  1GHC A;  3JSO A;  1S7O A;  4UVC A;  2XRO A;  3ULQ B;  2IPQ X;  4ENJ A;  2YR2 A;  4KUM A;  1YW9 A;  4E70 A;  4P5O A;  5J6X A;  2V79 A;  4AIK A;  3LA2 A;  5H20 A;  2BV6 A;  5H6Q A;  1SD6 A;  4U0W A;  3F23 A;  1ZRC A;  1S7A A;  3H3Z A;  1ZRE A;  3J81 Z;  3T1B A;  3ZMT A;  1FYL A;  5FB2 A;  1O3Q A;  2L3D A;  2RV8 A;  3FHZ A;  5DCM A;  1Z6T A;  1K6O A;  3MCZ A;  4UNO A;  4CXF A;  3IHU A;  3K1P A;  2NS0 A;  3T0Y A;  5BPI A;  1D8K A;  4NQW A;  1TNT A;  2NNN A;  4A0Z A;  1PDN C;  1ZH5 A;  4KDP A;  3JW4 A;  4EM2 A;  4PZJ A;  1LEA A;  5D8K B;  1LNW A;  3ABU A;  4G7O F;  1WRJ A;  3DPL C;  2JPB A;  3FZV A;  3RPU A;  2HQN A;  2VE8 A;  2HKO A;  1I6X A;  2Z3Y A;  4I01 A;  4M9Z A;  2BYV E;  2VOP A;  2Q0O A;  2OD5 A;  1HSJ A;  2W85 A;  1Z1D A;  2XAQ A;  1UCR A;  3T5X A;  1CF7 A;  3R6S A;  4UXN A;  1R1V A;  2LF8 A;  4OOI A;  2GAU A;  4EM0 B;  2D45 A;  1JE8 A;  3FXU A;  1B59 A;  5J8C A;  2DT5 A;  5HDK A;  5DEQ A;  3QOP A;  2UXN A;  1FP2 A;  3CDH A;  3KP4 A;  4LG0 B;  2G9W A;  3R4K A;  4M72 A;  3Q9V A;  5J8F A;  3K1M A;  3HRS A;  1KYZ A;  2XAS A;  3FWE A;  3EET A;  5DYM A;  5D5X B;  2QBY A;  5AIQ A;  4N0B A;  4HBL A;  5LRR A;  5BMZ A;  5CVI A;  1O3T A;  2A3S A;  2F5C A;  4MQ9 F;  4LMY A;  3EYI A;  2P5L C;  2F5F A;  3PQK A;  3RYR A;  5ILU A;  1TNS A;  1ZLJ A;  4L9V A;  1XGO A;  4PDK A;  1UST A;  2LDU A;  4M9S A;  4IF4 A;  4U7D A;  4ZYE A;  2Y75 A;  2VBW A;  1IN8 A;  2OQR A;  4R8H A;  2NYX A;  1R23 A;  4KNY A;  1YQA A;  1G3S A;  1YW7 A;  5LGN A;  3CLO A;  2QZ8 A;  2HKX A;  1FX7 A;  3I59 A;  1ON1 A;  1U78 A;  3HOT A;  4JK1 X;  4IRG A;  4YG2 F;  4I2O A;  3DFG A;  3N4M A;  2O03 A;  2RGV A;  4LD5 A;  2GIV A;  5HLH A;  1K78 B;  4LB5 A;  3GFJ A;  3K69 A;  4PGG A;  4DNC A;  1BI1 A;  4UV8 A;  3C3W A;  4N9H A;  3U1D A;  3WTY C;  1SFE A;  4GCV A;  2E7X A;  3FXQ A;  1U8R A;  2TDX A;  1ZAO A;  2COM A;  4TV7 A;  4R79 A;  2DU9 A;  3ECO A;  2Y0M A;  2YU3 A;  4LG0 A;  3ERE D;  3E6B A;  2LF7 A;  5K5O A;  3I58 A;  3JTH A;  1F5T A;  4AWX B;  4RB2 C;  5E8G A;  2GZW A;  4HDU A;  2OA4 A;  4KA4 A;  4AIJ A;  4L0Y B;  3GO5 A;  2WC2 A;  1S8N A;  2M5W A;  2WV0 A;  4HQE A;  4BNC A;  5ERI A;  1AOY A;  2FNA A;  5E8I A;  4KN4 X;  3C1D A;  2CYY A;  1D8J A;  2X0L A;  3FF5 A;  2WWY A;  3LQQ A;  3QP6 A;  4L0Z B;  2FSW A;  4A12 A;  3ECH A;  4G7Z F;  1HW5 A;  2Z9O A;  1R5G A;  4OIP F;  4WX9 A;  3RIR A;  2UXX A;  1UB9 A;  2A61 A;  1DPR A;  4U0Y A;  3ISP A;  2ESN A;  1KGS A;  1MJB A;  1LQ1 A;  3GF2 A;  1U5T B;  2LSO A;  3WTX C;  3DEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...