1V3FA

Solution structure of the dep domain of mouse pleckstrin2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
120
structure length
120
Chain Sequence
b'GSSGSSGLHRIVDKMHDTSTGIRPSPNMEQGSTYKKTFLGSSLVDWLISSNFAASRLEAVTLASMLMEENFLRPVGVRSMGAIRSGDLAEQFLDDSTALYTFAESYKKKVSSKESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pleckstrin 2
publication title Solution structure of the DEP domain of mouse pleckstrin2
rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 18
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2003-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00610 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1v3fA00
4O6JA 4ZYGA 3P9CA 3NQOA 3U2RA 1BIAA 2DBBA 2RC4A 2QBYA 2E7WA 3J7AO 3QP5A 3G73A 1IXRC 4KN4X 5LRSA 3BDDA 3OV8A 5DEQA 3M7GA 5FD5A 3S2WA 4B8XA 2XAQA 2PMUA 3H3ZA 3L7WA 3FMRA 2FBKA 5J6XA 3Q9SA 4JQFA 2BYVE 1R1TA 1G3TA 3CO7C 5BQTA 2LF7A 1IN4A 3R4KA 4GO1A 1R1VA 4L5IA 3WU0A 5BPIA 1FBUA 2Y48A 2ZFWA 2XAJA 2JT1A 5D5XB 1KQ9A 1IN5A 4LK0F 3LFKA 5AONA 1MGTA 2X4HA 5D4SA 5FLXK 1LQ1A 3L2CA 2OA4A 4KDPA 4A0ZA 1LNWA 4NB5A 4WCGA 3IL2A 1WWXA 1OMIA 1KYZA 2HYFA 3SXYA 2XHKA 1C0WA 2EV6A 1TQPA 2L3DA 3WG9A 4NQWA 3F22A 4Q5SF 3F3XA 3N97A 2VC1A 4HA8A 1O3RA 4EM0B 2OQRA 2ZCWA 1Z6TA 4U0WA 4I0BA 1I5ZA 2QENA 5E20A 4LB6B 5CVJA 1SFEA 4K2EA 3FHZA 3WE3A 4ENKA 4AD9A 3ZMZA 2ACJA 2HQNA 4EVIA 1XSXA 1W7PA 1SFUA 4EGYA 2AS5F 2NYXA 2PBIA 1V3FA 2MC3A 1ZHFA 1AWCA 3GUDA 1ZLJA 3K69A 2HEOA 2GXGA 3JTGA 2YU3A 4MQVA 3IWZA 5BPDA 2K4BA 5JFRA 3U9GA 2Z5UA 1FZPB 2LDUA 3TOBA 3BPVA 1UB9A 2OZ6A 3JW4A 2W25A 5LGTA 2KKOA 4AIJA 4MEXF 2GXBA 1PP8F 3ML6A 4EJVA 2HFHA 1XCVA 4B09A 2IT0A 1Y0UA 4M73A 4Q4ZF 1Z1DA 1HSJA 3DV8A 4BHCA 3JAMZ 1FPQA 2XIGA 2COMA 2XKOA 3WGIA 4I09A 2IPQX 2WV0A 3KZYA 4IXAA 3EDPA 3GXOA 4YFNF 4PDKA 3WTSC 4EQQA 3ZMSA 2GWRA 5LLQA 2FMYA 1YYVA 3HSRA 2LSOA 3K1NA 3KLOA 3GEZA 1DDNA 2L02A 2JTVA 3QP6A 2HTSA 4U0YA 5AIQA 2H09A 1ZRFA 2DLLA 2MLKA 5LGUA 2ZNZA 3F6VA 2ETHA 2DK5A 4ZZDA 4KICA 1J7KA 3FXQA 1ZARA 3QPHA 2VBZA 3LQQA 2V9VA 5F64A 2PI0A 4CGZA 1EV7A 1IAWA 2HDCA 3G3ZA 2F5FA 4HX4A 1H9TA 4I01A 4UVCA 2HZTA 2HGCA 2XUBA 3KEQA 3ZQ7A 1PP7U 2DO7A 4KA4A 2CFXA 3FM3A 4M9SA 2NNNA 4A2UA 3F23A 1X3UA 1ZLKA 3W6JB 4LB5A 4KN7X 3ZMVA 2DAOA 3VEPA 4UV8A 1LVAA 3B02A 1HW1A 4DQ2A 1MJAA 4NHJA 2GZWA 1ON2A 3H92A 2FSWA 2FBHA 2IVMA 2PQ8A 4HX7A 5FD6A 3V7RA 5HS8A 2VT2A 3E6DA 4JBAA 1KU7A 3ULQB 1TW3A 3F6OA 4PCQA 2A5YB 3KZZA 5CVRA 4EV0A 5BS6A 3GFLA 1O7FA 1P4AA 3KCCA 5DCFA 1F4KA 3M9AA 1H0MA 1U5TC 4UUVA 4IRGA 1UFMA 4ZZLA 4ESFA 2ZBKA 4N9IA 3DKWA 3WTXC 4LLGF 4EJOA 2IRFG 2A6EF 5H6RA 1O3QA 1IZ1A 1R58A 1MD0A 4U88A 1SD6A 2MLGA 1LB2A 4FT8A 1P92A 3FXRA 5DD8A 3BJOA 4WF2A 4GYIA 4DNCA 5D6EA 3GLXA 3TKYA 3QU3A 3GX4X 2M8EA 1JHFA 4BXUA 1T38A 1TTYA 2LNBA 2PFBA 3CUOA 4HF2A 2VBXA 3FF5A 2UXNA 3V7SA 3E5XA 4GCVA 2Y0MA 4EM1A 4L9VA 1U3EM 5FFXA 4LD5A 3TO7A 1HKSA 3HIFA 2FOKA 3W6KB 3BJAA 4RGRA 3M8FA 3KFWX 3KETA 2VBWA 3I4PA 2HKOA 1XGMA 3I58A 2BEOA 4EGZA 1D8JA 2YX7A 4OMYA 2XROA 4Y13A 4HX8A 2KJBA 2O0YA 2E1CA 3GFJA 2FNAA 2VN2A 3SQNA 4MEYF 3BPXA 2Z3YA 2L01A 2OQGA 3E97A 4XBFA 3KP5A 1K7AA 2FNPA 3DF8A 4UXNA 1UHMA 2P5VA 3ZPLA 1VTNC 2OAZA 3RKXA 1IN6A 2BV6A 5TRDA 4EJUA 4P9UA 2D1VA 2HKXA 5HDNA 3KEOA 3Q9VA 4OMZA 1U5TB 2P8TA 4I98B 1S29A 5DD4A 4LG0B 4U7BA 3U1DA 1J9IA 2M5WA 1F1ZA 1BI0A 4MTEA 1CGPA 4G94A 4YFKF 1V4RA 1I27A 2C6YA 2W85A 1BIBA 4H0EA 4LJZF 5F1RA 1T6SA 3H3UA 1DPRA 1U5TA 3GO5A 4RB0A 3P7NA 3HSFA 2R3SA 1O57A 2GIVA 4ETSA 2W24A 4LG0A 3FMSA 2QQ9A 5EEGA 1DUXC 3BP8A 2EB7A 3HYIA 3L09A 4EMSA 1BI3A 2K02A 5ERIA 2MH2A 1D5VA 2O03A 1D8KA 1MJ9A 5CVVA 4I02A 4EJTA 4HQEA 5HS7A 1KQ0A 4RAYA 2IW5A 3RPQA 4A12A 1FOKA 1FYMA 5LBQA 4BNCA 4MQ9F 1TQIA 4WXDA 3CUQC 2QBYB 3ERED 5LEJA 3J80K 5L3FA 1QZYA 5ICFA 5HDKA 2BBYA 5K5OA 2FBIA 2DQLA 2CG4A 4PZJA 5ILVA 2Q2EA 3GZ5A 2K86A 5ICGA 3LA3A 4RB1A 5CJ9A 2W57A 4IHSA 2PEXA 2EFPA 3QAHA 2AXLA 3PQJA 3WTYC 2PLYA 1KA8A 1IXCA 1LEAA 1BOAA 2P5LC 1S8NA 4A6DA 3M1EA 5IT9K 1BI2A 1Z05A 2Y75A 2H6CA 3ZMUA 3MAJA 1TNSA 5D5VB 1FSEA 3DPTA 3F21A 1FP2A 3I0TA 1Z6RA 5LHGA 5ICEA 4UV9A 4YIFA 2IA2A 3FXUA 1I6XA 1OPCA 4AWXB 2QVOA 4OINF 4ESJA 5KVRA 3C3WA 4L0ZB 4M6YA 5CLSA 2P7VB 1IW7F 1GVJA 4A6EA 1B1BA 3F8FA 2EFOA 1W7PB 5E17F 2HYGD 5KK1A 1YO5C 1LJ9A 1H9GA 2XRNA 2F2EA 4GYGA 1FNNA 1BC7C 4ESBA 2YPRA 4UVAA 3SHFA 4MGRA 4FHTA 3WTWC 2FA5A 4Q48A 1KU3A 1SMYF 5ICCA 3HRUA 4EJWA 3V8KA 3I71A 3L00A 4IF4A 1TBXA 3I5UA 2GA2A 1W5SA 3J81K 2EK5A 2B0LA 3VODA 2DT5A 3CUQB 2RN7A 1QPMA 5ED4A 3HSEA 3COAC 1WKMA 3BY6A 4HF1A 5ILSA 1R5HA 3KP7A 3T5XA 2CYYA 1QO0D 5DV5A 2KIMA 4HDUA 1FWZA 5E8GA 3CUQA 1YQAA 1KGSA 2LKPA 1RUOA 4RAZA 2X0LA 1I1SA 5LGNA 1MKMA 4LMYA 3HHGA 2DPDA 1IRFA 2Q0OA 3L9FA 3NRVA 4KFCA 3QOPA 3JSOA 4L18B 2JSCA 2RDPA 1Z9CA 4N9HA 5JVTA 5L3GA 2PG4A 1IF1A 3RKYA 1U8RA 2FQ3A 5FLXZ 1YW8A 4IVNA 2M1BA 2G7HA 3R61A 1OR7A 1BC8C 3GFMA 3NEUA 4LLNA 3VB2A 1PDNC 1OKRA 1B9NA 1LDKB 2A3SA 1KU2A 2BE5F 3ISPA 3JSPA 1ULYA 1ONVA 2Z99A 2FEZA 1G3WA 1JHHA 2A6HF 3ABTA 2YX4A 3CDHA 2VODA 3DPLC 3PQKA 3Q5FA 2R7DA 5A2QK 2ELHA 1EH8A 4KIBA 2JPBA 3DQVC 1ON1A 3BJ6A 2D1HA 2K7LA 3LAPA 3WU1B 1I1GA 1O3TA 3IC7A 3C1DA 3FMQA 1GHCA 3RTRA 1HKQA 4IRIA 4LGWA 1XDUA 3DEUA 4TV7A 1IN7A 1XMAA 4L5JA 1HBXG 3TOAA 1LEBA 2HOEA 2G7UA 1B6AA 4HW0A 1SD4A 1G3SA 3R60A 4UHTA 1YG2A 5L3EA 3O3KA 2F5CA 2P6SA 4P96A 3KP2A 3JTHA 4XLNF 2WWYA 3DP7A 1ZG3A 3I54A 2PN6A 2H27A 3MFKA 5DDGA 3E6CC 2EV0A 1XCBA 2A68F 2KRFA 4ZYEA 3WE2A 2XKPA 3LA7A 1ZGAA 1T2KA 4CYDA 1BN5A 1L3LA 3E5UA 3ZN0A 5FGMA 2VXZA 1G6NA 1QNTA 2RKHA 3FZVA 5D8KB 2J5PA 3LAJA 1QZZA 2MBFA 4I0AA 4KUMA 2OBPA 1RZ4A 3GYHX 2VOPA 5J8FA 1U2WA 2IJLA 3CJNA 3F8MA 1XB4A 1NHAA 4LK1F 3N4MA 1BI1A 4IPAA 3I53A 3C18A 3RDIA 4YIIA 4MNUA 5D5WB 4LFUA 1PUEE 4HV6A 3VOEA 5D5UB 4RB3C 2YSRA 1HQCA 1BM9A 2V1DA 3K9TA 1TQMA 5D4RA 2KIFA 4P9FA 3ECHA 1P4WA 2RV8A 4HZFA 2VBYA 3HOTA 1FP1D 4OIRF 1YS7A 1BJAA 3O2PE 5L3CA 1BBYA 3KE2A 3O6BB 1XGNA 2P6TA 3SFZA 2Z9OA 4G7OF 2QQAA 2ISZA 1XSDA 1HW5A 2IA0A 2V79A 2RGVA 4XRFA 2CWEA 2GA1A 1YW9A 3FM5A 2M87A 4U0VA 3ZMTA 5K1YA 2FRHA 2WTEA 1IRGA 5E8IA 2CGPA 4GXOA 3GWZA 1XN7A 2DW4A 3WTZA 2QUFA 4G8XA 6PAXA 4QLCU 3MWMA 2L4AA 2CSOA 2HWVA 3TO6A 1G3YA 2V1UA 3ELKA 5D6FA 5JI6A 4ON0A 3HUGA 1GXPA 3R0AA 4UVBA 2HQRA 3IHUA 4QWQA 2QYOA 4AVPA 3RYPA 5K5QA 4F7ZA 1TNTA 4G7ZF 1STZA 2LF8A 3E5QA 1FBQA 3I64A 5CYVA 3TDUC 1XD7A 1EH6A 1R5GA 4BYYA 5E1XA 2E7XA 4Z2YA 3BROA 3RPUA 2M45A 1ZG5A 2IP2A 4R1HA 4OU0A 3V4GA 5CVUA 2NS0A 5BOXA 1J75A 3BZ6A 3EETA 5DCMB 3KP4A 2EA4A 3BOQA 2JZYA 3SZPA 3P9IA 4RB2C 1B59A 4M74A 4YG2F 1OYIA 1B9MA 4G9YA 2FU4A 2DFIA 4M71A 2FXAA 3EYYA 3HRMA 4AIKA 3FX3A 1S6LA 3ABUA 3WTUC 2EJRA 4KIGA 1R23A 2HS5A 1IUYA 3HTUA 5DCMA 1WRJA 1E17A 1QGPA 2JRTA 3HTSB 4CXFA 2FMLA 5DUIA 5JR3A 3MCZA 4WK8F 3D0SA 2DK8A 4Y17A 2EV5A 1OYYA 3HHHA 3F8BA 4Y15A 1TLHB 5EEHA 1XSVA 3F8CA 4GGGA 3R6SA 3K0LA 3I59B 3P9KA 1ZYRF 3E3VA 2VC0A 1R7JA 3T1BA 5LEKA 4WWCA 1R00A 2EWNA 5JHUA 3LQRA 2MH9A 4RGSA 3JAMK 4CO8A 3ZN1A 4KMUX 2L4MA 3IKVA 3TO9A 3D5LA 3K2ZA 4HOBA 2QWWA 1D3YA 1RUNA 1RNLA 4ZYDA 3I59A 3GW2A 1U6GA 3R0JA 3QU6A 1WQ2A 1ZREA 5H20A 3DXJF 5L3DA 2XAHA 3IRRA 4KMFA 1OYWA 5HDGA 4KT5C 3REOA 1K6OA 4E70A 4BQAA 1IXSB 2XVCA 2ZMEB 3V8LA 4ENNA 1R36A 2XAGA 3WGGA 1FC3A 1QQIA 2UWMA 3J80Z 2F5EA 2ZNYA 5D8LB 3QRFF 3V8JA 4KIFA 2EA2A 3IRQA 5F6FA 1FT9A 2ESNA 1W7PD 3F8NA 2ZMEA 2P5KA 3LWFA 4HLYA 2NRAC 4RGXA 4R8HA 2ZKZA 1K78B 1F5TA 1FYLA 2VOOA 3MZHA 1SFXA 1JE8A 2STTA 2GQQA 4HLXA 1QBJA 4IHTA 1T39A 5L3BA 4I2OA 2VE9A 3KP6A 3GFIA 5IT9Z 2E1NA 5HOOA 3TQNA 2DU9A 5H6QA 2A07F 4AIHA 1K78A 4WXCA 3DFGA 2O8XA 4OIOF 4I7HA 2UZKA 2GAUA 4L9TA 4ENMA 1LDDA 5LRRA 5LHHA 1K79A 1ODDA 3ZP5A 1B4AA 4R79A 4LLLA 2OD5A 1UCRA 4PGHA 4D0PA 2QLZA 1J0RA 4O5VA 1IN8A 5DYMA 1EH7A 4HF0A 2XGXA 3WTTC 2XASA 4OIPF 1TW2A 1HW2A 2VE8A 1S3JA 3CO6C 1FYKA 1WSUA 2RQPA 1UHWA 2VONA 5HLIA 2STWA 2MD5A 4BH9A 2M30A 3LA2A 3MQ0A 2ISYA 1JXSA 2JPCA 4HV5A 2P7CB 2NNYA 3J81Z 2G9WA 5CVIA 2ZJ2A 4M9ZA 3WGHA 1E2XA 1HSTA 2QZ8A 2RNJA 1ZRCA 4ZH4F 3HOSA 1ZRDA 4YFXF 1P2FA 4CZZA 5FFZA 5E1WA 4S04A 4P55A 2XAFA 3TDZC 3IWFA 1SD7A 1JGSA 2OZUA 3MZYA 1SD5A 2NAZA 4MHGA 1AOYA 1KYWA 5FO5A 1KU9A 2FF4A 3V7CA 1XGSA 3GVAA 2CQKA 1S7AA 3SZTA 5LHIA 2ZO4A 1FBSA 1MJBA 2H6BA 2KJCA 4MTDA 3KP3A 1R1UA 4IRHA 1J59A 3MEXA 1HXDA 3KLNA 4CICA 5TJJA 5HS9A 2DQRA 4WXHA 2V1XA 3WTVC 1T0FA 1USSA 3RIRA 1GXQA 2DPUA 1SMTA 2L54A 4N0BA 4BAYA 4UNOA 5E1ZB 5E18F 3GZ6A 1YS6A 4O3MA 2BGCA 2VT3A 2OU2A 3T8TA 5J8CA 1USTA 4FX4A 1FSHA 1FY7A 1MZBA 2XV4S 1T98A 4PGGA 1RIOH 1P4XA 1Z91A 1YLFA 1R22A 3EYIA 1MDMB 1DP7P 1LDJA 3RYRA 2K4JA 5A2QZ 1XDSA 2RVCA 1YIOA 4XSZF 1WI9A 1ZN2A 4XSXF 1XMKA 4FX0A 4HYEA 3OOPA 4HBLA 4L9NA 2UXXA 3AAFA 2HTJA 4OOIA 4L9JA 3ECOA 3BWGA 4L0YB 3PFIA 3IKTA 1MDMA 1O3SA 1ZH5A 1P6RA 4EM2A 2KIUA 5DUKA 2HR3A 4ASNA 3EUHA 3VFZA 3WODF 2O6GE 2EFNA 4A5MA 1YTYA 4M72A 3QPTA 1ZG1A 1YW7A 1L0OC 3GF2A 3HRSA 5ILUA 1W5TA 5HVQC 4HDVA 3B73A 3FWEA 2A61A 4HAMA 1A04A 3T8RA 3TGNA 2ADUA 4WX9A 1FLIA 3RKWA 2QM3A 4A0YA 4RS8A 2IA1A 4P5OA 3C7JA 2P4WA 3HRTA 4OIQF 2TDXA 2R7FA 4ENJA 5HLGA 1HKTA 4A0XA 5FB2A 1CF7B 1J2XA 2Z33A 2YR2A 3K1MA 5BMZA 3E6BA 1FX7A 4XLPF 1XGOA 1ZAOA 2Q8KA 1SAXA 3M8EA 2PMHA 2DI3A 4A5NA 1REPC 3K1PA 3T0YA 5K5RA 4M9XA 2QQBA 1U78A 1CF7A 1KQ8A 2O61A 1Z7UA 5HLHA 2D2WA 1S7OA 4G7HF 3EQLF 1W4MA 2EFWA 4HQMA 4CHUA 4CDGA 3ROUA 4G6QA 4G6DA 1RI7A 2H94A 4ZYHA 4KYWA 3E6MA 4RGUA 3RJPA 1O7LA 2J5OA 1F9NA 2CO5A 2WC2A 1ZGJA 5IT3A 5AIPA 4KNYA 2EFQA 4U7DA 3F72A 4M6XA 2MA3A 2ESHA 1DPUA 3RI4A 2DTRA 2F5DA 1Q1HA 4BHPA 4BHBA 2FE3A 2A69F 3ZMDA 2V6CA 3LSTA 2CW0F 1G4DA 4JK1X 2D45A 1J5YA 3CLOA 2W84A 4IJAA 4S05A 1YFHA 4Q47A 3CTAA 2K27A 2ZXJA 2O3FA 2PJPA
chains in the Genus database with same CATH superfamily
5IOZA 4NC6A 4O6JA 1VQ7I 3KX2A 2HYJA 5EJCA 4ZYGA 3P9CA 3NQOA 3U2RA 3CC4I 1BIAA 2DBBA 2M2EA 1T08B 2E5ZA 2RC4A 2PJRA 2QBYA 2IS1A 1LE8A 2DA3A 2E7WA 3J7AO 3QP5A 3G73A 1IXRC 4KN4X 5LRSA 3BDDA 2QA4I 3OV8A 2ELJA 2YUSA 3K7AJ 1X1AA 2E60A 5DEQA 3KEYA 2FJ1A 3H9JA 4CCNA 2I10A 4HEA2 5J4YA 3M7GA 4ZYAA 5FD5A 3S2WA 4B8XA 2XAQA 3I55I 1RC9A 1VNDA 2PMUA 3H3ZA 3L7WA 5F0FA 5IOYA 2BY0A 2FBKA 3FMRA 5IP6A 5J6XA 3Q9SA 4JQFA 3FISA 3HPHA 1VQMI 1QVTA 1JUPA 2BYVE 1R1TA 2E5NA 4D7MA 1G3TA 3CO7C 5BQTA 2LF7A 1IN4A 3R4KA 4GO1A 1TZLA 2R7XA 1R1VA 4L5IA 3WU0A 5BPIA 3DWLE 1FBUA 2Y48A 2ZFWA 2XAJA 3DBRB 2JT1A 5D5XB 1KQ9A 1IN5A 4LK0F 3FKJA 1DP3A 3G4SI 3RZOJ 3LFKA 4BUPA 3FXMA 4NQWB 5AONA 1MGTA 2VQHA 2QF7A 3M1CA 2X4HA 5D4SA 5C44J 3BLYA 1NG6A 3CESA 2IS4A 5F27A 4CZCA 5FLXK 4FETA 4MO7A 5TGTA 1LQ1A 3L2CA 3OYLA 2OA4A 4KDPA 4ZTJA 4A0ZA 1MBFA 1LNWA 4NB5A 1ZTRA 4B3XA 4WCGA 1WFXA 4DYCA 4PJLA 1D1BA 3IL2A 1WWXA 5B5EC 2JMWA 3SFIA 1OMIA 5J3LA 2HOSA 1KYZA 1HDPA 3GTMJ 2EILH 2HYFA 3SXYA 2XHKA 1R71A 1C0WA 3HEFA 2EV6A 1N25A 1TQPA 3JRDA 1XMXA 1S72I 2L3DA 3S2HJ 3WG9A 4NQWA 3F22A 4Q5SF 1RRJA 2MG4A 2WB1N 2KHMA 3F3XA 3N97A 2VC1A 4HA8A 1P9QC 2K9LA 2YU9J 1O3RA 4EM0B 2OQRA 2ZCWA 1Z6TA 1Y39A 1VQLI 4U0WA 4I0BA 1I5ZA 2QENA 2VJJA 5E20A 4LB6B 2FQ4A 5CVJA 4IHWA 1SFEA 4I6ZA 5CPRB 4K2EA 3FHZA 3WE3A 4ENKA 2X6OA 4AD9A 3ZMZA 4PSWA 2ACJA 2HQNA 4EVIA 1XSXA 2XB0X 1W7PA 1SFUA 4CSWA 4EGYA 2AS5F 2NYXA 2PBIA 1V3FA 2MC3A 3H9GA 1ZHFA 3K4CA 1AWCA 2DFHA 2X1DA 1VQ4I 3GUDA 1ZLJA 3K69A 3K70D 2HEOA 2EIJH 1WJFA 1WJCA 1K83J 2QKLB 2GXGA 3JTGA 5JLWA 4C2TA 1Y0NA 2YU3A 2VPLA 4XRMA 1NK3P 1ZKGA 4MQVA 1V5EA 3AG2H 2K4BA 3IWZA 5JFRA 5BPDA 3U9GA 1A31A 2CV0A 2DA1A 2XPVA 4M3BA 1FIAA 2Z5UA 1IG7A 1WJBA 1FZPB 2DYRH 2LDUA 3TOBA 3BPVA 5FKOA 4BJ5C 1UB9A 2OZ6A 1MNMC 1TWCJ 3JW4A 1VFCA 2W25A 5LGTA 3JRCA 1G2HA 4CH7A 2KKOA 4AVZA 1SAUA 3I4NJ 4AIJA 3M07A 4MEXF 2GXBA 4C30A 1X1CA 4CYCA 3CF2A 1PP8F 4J01A 3ML6A 3LSKA 4YEJA 4EJVA 1U8BA 1Q1VA 2HFHA 1XCVA 2PMZA 1ETOA 4CUGA 2JA6J 4B09A 2FOWA 2IT0A 3S17J 4DZPA 1Y0UA 4M73A 4Q4ZF 3UNGC 1Z1DA 1HSJA 3DV8A 2EZHA 4BHCA 2MD0A 3JAMZ 1FPQA 2XIGA 2COMA 2XKOA 1HC8A 2BOLA 3WGIA 4I09A 4F92B 3GLLA 3NWTA 3NWSA 2IPQX 2WV0A 3KZYA 4IXAA 3GTLJ 3EDPA 3GXOA 2E35A 4YFNF 4PDKA 3WTSC 1W36C 1ZQ3P 3VYUB 4EQQA 1ETXA 2LFBA 3ZMSA 2GWRA 4F55A 5LLQA 2FMYA 3GTJJ 1YYVA 2IAIA 3HSRA 1IRXA 2LSOA 3K1NA 2QSGX 4PUSA 3KLOA 3GEZA 4A3IJ 1MIJA 1DDNA 2L02A 2JTVA 2BW3B 3A0HC 1Z21A 3QP6A 2HTSA 4U0YA 5AIQA 4BJTA 2H09A 4CCLA 1ZRFA 2DLLA 2MLKA 5LGUA 2ZNZA 3F6VA 3S3MA 2WV1A 2ETHA 2IGOA 5FRMA 1BOBA 1ZGWA 2DK5A 3BG5A 4ZZDA 4A3MJ 1H88C 2D5VA 4KICA 3CDLA 2V6EA 4QPQA 1FOXA 4X0GA 3PO3J 1J7KA 3FBNB 4NDLA 3FXQA 1ZARA 3QPHA 2VBZA 3S32A 2ZJRF 1AHDP 3LQQA 2Y9YA 3DKXA 3QQAA 4A3GJ 2TCTA 2V9VA 2XSDC 3LSIA 4ZDPA 5F64A 4IOCF 2PI0A 4CGZA 4FE4A 1EV7A 3LOCA 3MD2A 1IAWA 2HDCA 3G3ZA 2F5FA 4BQQA 3S93A 4HX4A 2Z16A 2K9SA 1H9TA 5IYBJ 3ABKH 3P5JA 4I01A 4UVCA 2HZTA 2HGCA 1X2MA 3OIPA 1ETWA 2XUBA 3KEQA 3ZQ7A 4ZTFA 1PP7U 4ZC3A 2DO7A 4XICA 3OR2C 1YX5A 4KA4A 3GTOJ 2CFXA 4PJJA 2JWTA 3FM3A 2LTPA 1K61A 1IRZA 4YELA 4M9SA 3H0DA 3DTEA 2NNNA 5LD2C 3RQIA 2OCCH 4A2UA 3AFHA 2A6TA 2CUFA 3F23A 1X3UA 5EZGA 4E7SA 4F91B 5HNHA 4FE7A 1ZLKA 3W6JB 2VPRA 1WH7A 4LB5A 2E2HJ 2H8WA 3ZQFA 4KN7X 3ZMVA 2DAOA 3VEPA 3AL0C 3H35A 2NS7A 4UV8A 3BR6A 3MKWB 1LVAA 3B02A 1HW1A 4DQ2A 1MJAA 4NHJA 2GZWA 2KDZA 1ON2A 3H1CA 2X85A 3A01B 3H92A 2FSWA 2FBHA 2FX0A 2IVMA 3CJTB 2PQ8A 3DCFA 4HX7A 3V7RA 5FD6A 2JA2A 1JTYA 3M8JA 5HS8A 5K7HA 2VT2A 1X4OA 3E6DA 4JBAA 1YHQI 1KU7A 2DA6A 3ULQB 1TW3A 2KPMA 3F6OA 4PCQA 2DMQA 2A5YB 2M4KA 3KZZA 5CVRA 4EV0A 4F3QA 5BS6A 5HLTA 3GFLA 1O7FA 2R7SA 1P4AA 3KCCA 5DCFA 4AYBA 5DS9A 1F4KA 5GPCA 5KHDA 1OJLA 3M9AA 2ID3A 1H0MA 1U5TC 2NVYJ 4UUVA 4FCYA 2ECCA 1UFMA 4IRGA 4ZZLA 1BW5A 3A01A 4DJAA 4ESFA 2LP0A 5GTHC 2ZBKA 4N9IA 4F52A 1ACIA 3DKWA 3WTXC 4LLGF 4EJOA 2IRFG 2A6EF 1ERDA 5H6RA 1O3QA 4B43A 3PIPF 2V9PA 1IZ1A 1T56A 1TWAJ 1R58A 1EF4A 2BY2A 2VKDA 1SEUA 1MD0A 3S15J 1S5LC 4CCJA 4U88A 1SD6A 4OAYA 1BL0A 2CFOA 2MLGA 2HDDA 4GDFA 4A3CJ 2Y0SN 1LB2A 4FT8A 1X3WB 1P92A 2JA5J 2R5YB 3FXRA 5DD8A 3HPGA 1X1DA 2CQXA 3BJOA 3FIWA 3SDGA 1OCTC 4WF2A 5JVGF 4GYIA 3DTKA 4IQJA 4BXXJ 4DNCA 5D6EA 3GLXA 3Q3SA 4HNVA 3TKYA 4JX4A 1DU6A 3BR0A 3QU3A 1GT0C 3GX4X 1BJZA 1N75A 2DN0A 2M8EA 2XC7A 1JHFA 4BXUA 3OYBA 3UKGA 1T38A 1TTYA 3PNYA 1JJ6C 5J40A 2LNBA 5F08A 3GMEA 2QCOA 2PFBA 2V7FA 2WAFA 3CUOA 3PO2J 1S9HA 4HF2A 2CUJA 2VBXA 2KIQA 3FF5A 1W1WE 1X1BA 1Y8RB 4J19A 2R5YA 3ZQGA 2UXNA 3V7SA 3QPSA 3E5XA 1Z3XA 2XPUA 4GCVA 2Y0MA 1OLTA 4EM1A 4L9VA 1U3EM 5FFXA 4LD5A 1LFPA 1SANA 2P0WA 3BT9A 4M3FA 3TO7A 1HKSA 2KQRA 2K3PA 3HIFA 2FOKA 3QODA 4C2MJ 2KT0A 2WAQA 2LVSA 4BDZA 1TL8A 3J7ZI 3PM1A 3W6KB 4RAFA 3BJAA 1W0TA 4RGRA 3U21A 4NC8A 1HA8A 3RKQA 4E7KA 1BW6A 3M8FA 3TL4X 1UHSA 3KFWX 4ANJA 5EG0A 3KETA 1P7IA 2VBWA 1Z0XA 3I4PA 2HKOA 3GTKJ 3CZ6A 1JKOC 1XGMA 1IGNA 3I58A 2BEOA 4EGZA 3CCJI 3TEDA 1D8JA 2YX7A 4OMYA 3M3YJ 1MBHA 5HNFA 3FDYA 3RZDJ 1MW7A 1H89C 2XROA 4Y13A 4HX8A 4MFEA 1JT6A 2KJBA 2O0YA 2E1CA 2HDWA 3GFJA 4D5CA 2FNAA 3FXJA 2VN2A 2ZXHA 3SQNA 1HOMA 4MEYF 3BPXA 2Z3YA 2NVUB 1OCPA 2LD5A 2L01A 2OQGA 3E97A 4XBFA 3KP5A 4B44A 1K7AA 2FNPA 3DF8A 3OOUA 1ETYA 1VQNI 4UXNA 1UHMA 2P5VA 3ZPLA 2IS6A 1VTNC 2OAZA 3IH4A 1DQUA 3RKXA 1NTCA 2HU9A 1IN6A 3U1KA 1GDTA 1D0ZA 2BV6A 5TRDA 4EJUA 1IC8A 4P9UA 4HNTA 2D1VA 1QVUA 2EZKA 2W1OA 2HKXA 3HG9A 5HDNA 2ZSHB 3KEOA 3Q9VA 4OMZA 2KRCA 3ASNH 3VYRB 5DM6F 1VQ6I 1U5TB 4DIQA 2P8TA 4I98B 4IKFA 1S29A 1JUMA 3BZKA 1MBGA 5DD4A 4LG0B 4U7BA 3U1DA 1J9IA 3JRFA 2M5WA 1F1ZA 1WCMJ 1BI0A 2F5VA 5KAFC 2HQ5A 4MTEA 2CQQA 1CGPA 1BR2A 4G94A 4XKCA 4YFKF 1V4RA 2KZVA 3D1NI 1I27A 1V54H 2GIZA 3ERMA 3VDXA 2C6YA 1E3OC 3S3NA 1X58A 2W85A 2ZSIB 1BIBA 4H0EA 2GXAA 4LJZF 5F1RA 1T6SA 3H3UA 1DPRA 1U5TA 3GO5A 1K6YA 1JKQC 3CDIA 4RB0A 3P7NA 3HSFA 2LY2A 2R3SA 1O57A 4OWRB 2GIVA 4ETSA 2HZDA 2W24A 1K4TA 3CMEI 1PVEA 2F4OB 3NARA 2DOAA 5CQEA 4LG0A 3FMSA 3SDBA 2QQ9A 5FROA 5EEGA 3K70C 3BP8A 2EB7A 1DUXC 3HYIA 3L09A 3QWLA 4EMSA 2X6XA 2QSFX 3MN2A 1D5YA 4I76A 4QIWN 3OYEA 1BI3A 2K02A 5ERIA 4BEHB 1OCCH 2MH2A 5IY5H 2EIMH 1D5VA 4PJMA 2O03A 5GP9A 1D8KA 1MJ9A 5B66C 5CVVA 1MMSA 1IUFA 4I02A 4EJTA 4HQEA 5HS7A 2DA5A 1B8IB 1KQ0A 2ZMEC 3LNQA 1R4MB 4RAYA 2IW5A 1ETVA 4E7IA 2M9HA 3RPQA 5IYDJ 3S16J 4A12A 4A3BJ 3BG3A 3OIQA 4W1UA 4CA0A 2JJ7A 1FOKA 2E1MC 1FYMA 5LBQA 1JT0A 4BNCA 4MQ9F 4PSXA 1TQIA 4NUBA 4WXDA 1W0UA 3CUQC 2QBYB 3ERED 5FKLA 4BEHA 5LEJA 3J80K 2B9SA 1MH4A 5L3FA 1QZYA 5ICFA 3CCMI 1VQ9I 5HDKA 3CCUI 2BBYA 1DGWY 4BE2A 1ENHA 1B8IA 2EINH 5GAEJ 4IL6C 5K5OA 2PX9A 2FBIA 2DQLA 2CG4A 3CCRI 3WHCA 1I39A 5KNLA 4PZJA 5ILVA 4LG3A 2DDAA 2Q2EA 3GZ5A 4A93J 2K86A 5ICGA 4BY1J 3LA3A 3DU6A 2BY1A 3D5SC 2L0KA 4RB1A 3D5RC 4D1QA 5CJ9A 2A05A 4E4HA 4JOMA 2V4JC 3W3CA 2F4IA 2W57A 2JRMA 3FK7A 4IHSA 1DGRM 2BHZA 2OTJI 2CRGA 2PEXA 2EFPA 3QAHA 2AXLA 4XN3A 2HVRA 3PQJA 4XONA 3WTYC 1OR7C 2PLYA 1KA8A 4ZJZA 2Z2SB 3JRIA 1IXCA 1LEAA 1BOAA 2P5LC 1S8NA 4A6DA 3K10A 3M1EA 1FJLA 1AU7A 2UV1A 5IT9K 1BI2A 1A36A 2R7TA 1Z05A 2Y75A 3ONQA 4KITB 2H6CA 5M5YJ 3ZMUA 3PL8A 3MAJA 4BE0A 2VUMJ 3ABLH 1JKPC 1APLC 1TNSA 5D5VB 1FSEA 3DPTA 3F21A 1FP2A 2DOEA 2L7FP 3I0TA 1Z6RA 5LHGA 5ICEA 3ZRGA 4UV9A 4YIFA 1GV5A 4NC7A 2IA2A 3FXUA 2R5ZB 1I6XA 3IV5A 1OPCA 3MMYB 4AWXB 1QHHD 4FISA 1R5ID 2KFDA 3HKZN 2QVOA 4OINF 3ZQCA 4ESJA 5KVRA 3C3WA 1MBKA 4L0ZB 4M6YA 5CLSA 2WBMA 2P7VB 1IW7F 2K85A 1GVJA 4A6EA 1B1BA 3F8FA 2L9SA 5E3MA 2EFOA 1W7PB 1VQKI 5E17F 2HYGD 2DT7B 4I99C 3CQZJ 2HPMA 4GRIA 5KK1A 1YO5C 1LJ9A 2IXSA 3OIOA 1H9GA 2XRNA 1Y6IA 2F2EA 1FNNA 4GYGA 3KYCB 1BC7C 4RLFA 2OCEA 1MMDA 4ESBA 2YPRA 4IOAF 4UVAA 3SHFA 3S14J 4MGRA 4FHTA 3WTWC 2R5ZA 2FA5A 4Q48A 3PSFA 3CC7I 1KU3A 1SMYF 3BR1A 5ICCA 3HRUA 2OV7A 4EJWA 4HRIA 1LPQA 3V8KA 3I71A 3L00A 2HOAA 4IF4A 2IEKA 1Z77A 4CCMA 4W97A 5F04A 1TBXA 1U9NA 2EH3A 3I5UA 4CYCB 3IAM2 2GA2A 1W5SA 3DEEA 2E1MB 4XLAA 3J81K 5F0CA 2EK5A 2B0LA 4B47A 3VODA 2DT5A 3CUQB 2RN7A 1QPMA 5ED4A 4L5EA 3HSEA 4BXFA 3WU2C 1HF0A 3COAC 3HOYJ 1WKMA 2OUMA 3BY6A 3S3OA 2IGKA 3HOZJ 1X19A 4HF1A 2HOTA 3EUAA 5ILSA 1R5HA 1GLNA 5M5WJ 3KP7A 3T5XA 3LFUA 2CYYA 1QO0D 4XKBA 5DV5A 1A5JA 2E2IJ 2OC6A 4BKXA 2XDVA 2W7NA 2KIMA 4HDUA 2E34A 1FWZA 2BHYA 2DXIA 5E8GA 3CUQA 4A3JJ 3A2KA 1D1AA 1YQAA 1KGSA 2LKPA 1RUOA 4RAZA 3G71I 2W82A 2X0LA 1I1SA 1T8IA 1V5FA 4RDUA 2X6YA 5LGNA 1MKMA 2CUEA 2V1NA 3HHGA 4LMYA 2DPDA 2EZLA 1IRFA 2Q0OA 3L9FA 2R7WA 3NRVA 4IHXA 4KFCA 3QOPA 3IH3A 3JSOA 5M5XJ 1U0JA 2CV1A 4L18B 2LBFB 2JSCA 2RDPA 1EKEA 4XM3A 1Z9CA 4N9HA 5JVTA 3ASOH 3CD6I 3E1SA 5B3SH 1P7JA 5L3GA 3J7YJ 2PG4A 3TMOA 3OYKA 1IF1A 1I3AA 3RKYA 3BTCA 4G6TB 4AU7A 1U8RA 2FQ3A 2EBIA 4YRVA 5FLXZ 1YW8A 4LIVA 3L2VA 5F0HA 2KP6A 1M1EB 4IVNA 2M1BA 2G7HA 2ZFUA 1OCOH 3R61A 1OR7A 1BC8C 3GFMA 3G1LA 2Y30A 4E7ZA 3NEUA 3G2BA 4LLNA 3VB2A 5FLVA 1PDNC 1OKRA 1B9NA 3HOXJ 5K7FA 2LBFA 2W00A 2JQ7A 1LDKB 1WGXA 2VJIA 1S7EA 2A3SA 1KU2A 2BE5F 3ISPA 4Y3OA 5IP9J 3JSPA 2UUZA 3CMAI 1ULYA 2QKMB 1ONVA 4PJNA 4A3EJ 2KL4A 2Z99A 1IO2A 2ZXIA 2FEZA 1G3WA 1JHHA 2A6HF 3ABTA 2YX4A 3CDHA 5IYCJ 3OYHA 3FBIB 1WH5A 2VODA 3DPLC 3PQKA 3Q5FA 4XORA 2L2OA 2R7DA 2VQLA 4XR6A 5A2QK 2ELHA 1EH8A 3OS2A 2R7VA 4UY8I 4KIBA 4MLOA 3HOWJ 2JPBA 3DQVC 3I3LA 4PFOA 3TW6A 4QTRA 1VQ8I 2WB1A 1OFCX 1ETQA 3OYMA 2E71A 2OPTA 1ON1A 2CV2A 2ME0A 3HBLA 3JRHA 3BJ6A 2D1HA 3GTGJ 2K7LA 4M3GA 2AQEA 2L7ZA 3LAPA 1I50J 3PNVA 3WU1B 1I1GA 1XX5A 2L7MP 4BL0B 3H9QA 3IUOA 1O3TA 3IC7A 2MGQA 2QGUA 2V9KA 3O8HA 2VJ5A 3BR5A 3C1DA 3FMQA 1GHCA 2LK2A 2O8KA 3Q0WA 1SVMA 3RTRA 5FKKA 3DEWA 3K2AA 1YJNI 1HKQA 4FQGA 4IRIA 1XG1A 2CW7A 3CCSI 2DMPA 2M0CA 4LGWA 1X2NA 3HDDA 4LOCA 1XDUA 3DEUA 4TV7A 1OQYA 1IN7A 1XMAA 3CJRB 2DFFA 4L5JA 1HBXG 3CMMA 1QU3A 1YX3A 3TOAA 1LEBA 3FHNA 2HOEA 2ELKA 2G7UA 1B6AA 2NXNB 3VSKA 3CCQI 4HW0A 2L9VA 1K4SA 1SD4A 2BZTA 1G3SA 3R60A 4UHTA 2HI3A 1YG2A 5L3EA 4AUXA 3O3KA 2F5CA 3GTPJ 2P6SA 4P96A 2ZJPF 3KP2A 4BDYA 3WHBA 3JTHA 1WZ2A 4XLNF 4JYKA 4BACA 1CQTA 2WWYA 3DP7A 2CQNA 3PJRA 5FJ8J 1ZG3A 3I54A 2PN6A 2H27A 3MFKA 3RCOA 2V26A 5DDGA 3E6CC 2EV0A 4RMNA 2HXOA 1XCBA 2P81A 5KAIC 4V2GA 2A68F 2KRFA 4ZYEA 3WE2A 2XKPA 4DZJA 1N77A 1D0XA 1MSFC 3LA7A 3LSPA 1ZGAA 3HB9A 1T2KA 4CYDA 1BN5A 1VI0A 1L3LA 2DT6A 3E5UA 2MC4A 3ZN0A 5EG0B 5FGMA 2M3AA 1UZCA 2HNHA 2VXZA 1G6NA 1QNTA 2I8DA 2RKHA 3FZVA 5D8KB 1T95A 5CKTA 3QOEA 4A69C 1RESA 2J5PA 1TC3C 3SZGA 3LAJA 4RM2A 2AHQA 3TP3A 1QZZA 2X6WA 2MBFA 1DU0A 1VZ0A 4MFDA 4I0AA 4KUMA 4G12A 2O5RA 4IO9F 2OBPA 1RZ4A 3GYHX 2Y69H 5C4JJ 2VOPA 2KDOA 5J8FA 1U2WA 3M4OJ 2NOJB 3JRBA 2IJLA 3CJNA 3F8MA 1XB4A 1RPWA 4GFBA 5E79C 1NHAA 4LK1F 3N4MA 1BI1A 2R7RA 3KYLA 4IPAA 2F6CA 3I53A 3C18A 1E3PA 3RDIA 3ZR8X 4YIIA 3H5RA 2JVGA 2CUZA 4A3DJ 4MNUA 4EEFG 5D5WB 4LFUA 1Z7LA 3JREA 4HV6A 1PUEE 3AL0B 1G8XA 1XS9A 3E7LA 3VOEA 5D5UB 2O7OA 2RQQA 4RB3C 2YSRA 2LY1A 3AG3H 1HQCA 3ZOBA 4IZZA 1BM9A 1NG7A 2V1DA 3K9TA 3AKZA 4EATA 1TQMA 4XOPA 5D4RA 4AC0A 2KIFA 3HGYA 1JUSA 2L9RA 3JRAA 4FTHA 1X1PA 3TP0A 2VKVA 1VF9A 2LY9A 4P9FA 2CMPA 3ECHA 1VQOI 1P4WA 1V5GA 2RV8A 4HZFA 4BU2A 2VBYA 2KLOA 1RR8C 5JLXA 3HOTA 2IS2A 1FP1D 3AG4H 3LSHA 4IHYA 1QZEA 2GBYA 4BE1A 4OIRF 1YS7A 1BJAA 2JSPA 3O2PE 5L3CA 1R9TJ 1BBYA 1D1CA 2E1OA 2K5CA 3KE2A 3O6BB 3FXLA 4S0HB 1XGNA 1UJ8A 2P6TA 1WJAA 4PFPA 3SFZA 2Z9OA 2HQAA 2ZXWH 2BXYA 4G7OF 2DMUA 3LMMA 2COBA 2JA7J 2CU7A 3OSGA 2GLOA 3QYFA 5GADJ 2QQAA 4M6VA 3F0CA 2ISZA 2H8RA 1XSDA 2EQRA 4E6KG 2TRTA 1HW5A 2IA0A 3AG1H 3BC8A 3HUGB 2V79A 2RGVA 4XLHA 1FIPA 3S1RJ 3H5AA 4D5FA 1ETKA 3HJEA 2Q1ZB 2Z1DA 4XRFA 2CWEA 2Y31A 2GA1A 1YW9A 3FM5A 3KPHA 2OTLI 9ANTA 2M87A 4U0VA 1D0YA 3ZMTA 5K1YA 2FRHA 3C2HA 4DW6A 2WTEA 1IRGA 3A0BC 5E8IA 2CGPA 4GXOA 3CF5F 3GWZA 4BQOA 1HCRA 1XN7A 2Y0SA 2DW4A 3WTZA 2QUFA 1GVDA 4G8XA 2LR8A 4ZDOA 6PAXA 5FKMA 4QLCU 4JX5A 4KISA 3MWMA 2L4AA 3ZQHA 2WA0A 2CSOA 2HWVA 3TO6A 1G3YA 2DMTA 2V1UA 2LYCA 3ELKA 5D6FA 5JI6A 3GTQJ 4BY7J 2MFZA 4ON0A 3HUGA 1GXPA 1SVLA 3JCUC 3R0AA 4UVBA 2HQRA 4M3EA 3IHUA 3L2QA 5J1YA 5TISC 4QWQA 2QYOA 3GZNB 4AVPA 1UAAA 3RYPA 2DODA 5K5QA 4F7ZA 1A6QA 1TNTA 3A1YA 4G7ZF 1E3HA 1STZA 4XRSG 2LF8A 3E5QA 1FBQA 2F4MB 4XQFA 4B4CA 3I64A 5CYVA 3TDUC 4KT6A 2XPWA 1WJ5A 1XD7A 1E0EA 3OYGA 3OYDA 4IHVA 1EH6A 2CJJA 2Q2EB 3LSMA 1R5GA 4BYYA 1PUFB 5E1XA 4JX6A 1ORKA 2E7XA 4Z2YA 3NAUA 3BROA 3RPUA 2W4SA 3EUKL 2M45A 1ZG5A 1LKXA 2IP2A 2O9LA 4R1HA 3BZCA 4OU0A 4V19K 2BVMA 3V4GA 1VQ5I 5CVUA 2NS0A 5BOXA 5E3LA 1WHUA 1J75A 5C4XJ 2R4GA 3B6AA 3BZ6A 3EETA 2HXIA 5DCMB 3KP4A 2XB5A 2EA4A 3L2UA 2R7OA 1MSEC 3F9KA 3BOQA 2JZYA 1TT5B 3OS0A 3SZPA 2LC2A 3FXOA 3P9IA 4RB2C 1LFUP 1B59A 4M74A 4B48A 4YG2F 1OYIA 1I6HJ 3FKIJ 1PUFA 1B9MA 1BR4A 4G9YA 2FU4A 4N4OB 1TWHJ 2DFIA 2NS8A 1W5CC 1FOYA 1WPKA 1FOWA 4M71A 3SJMA 2FXAA 3HL2A 3EYYA 1A6IA 3HRMA 2ZB9A 4AIKA 1IDYA 3FX3A 1S6LA 2JVHA 3ABUA 1SVOA 2EJRA 3WTUC 4KIGA 1R23A 2H1LA 2DJIA 4XLCA 2HS5A 1IUYA 3HTUA 5DCMA 1EA3A 3OYCA 1WRJA 1E17A 3A4CA 2ME6A 4A3FJ 1QGPA 1IV8A 2JRTA 2QQ8A 1X3ZB 4A3KJ 3HTSB 4XKWA 4CXFA 2FMLA 5DUIA 5JR3A 1OISA 3DU5A 3MCZA 2KRHA 2M0MA 1KZHA 3D0SA 4WK8F 3ABMH 2MSYA 2DK8A 2LRDA 2XF7A 2Y2ZA 2EV5A 4Y17A 5EGOB 1OYYA 3HHHA 3F8BA 4Y15A 1TLHB 1XSVA 3F8CA 4GGGA 5EEHA 3R6SA 3K0LA 4B3AA 3I59B 3P9KA 3CCEI 1ZYRF 3E3VA 2VC0A 1R7JA 3T1BA 4QSHA 5LEKA 4WWCA 3K4LA 4Y33A 4DBQA 3OS1A 1R00A 2EWNA 2YS9A 4RLQA 5JHUA 3CCLI 3OSFA 3LQRA 1MNDA 2MH9A 3SEZA 4XL9A 2VQCA 4RGSA 2M8GX 3JAMK 4RAGA 4CO8A 3ZN1A 2RAEA 4KMUX 1HDDC 2L4MA 3BCBA 4LITA 2DJNA 3IKVA 3S8PA 3TO9A 2VXDA 3D5LA 1TT0A 3A03A 3K2ZA 3KZIC 4HOBA 2QWWA 5EGOA 2NVTJ 1D3YA 1RUNA 1RNLA 2JUGA 4ZYDA 2X48A 2CW8A 3I59A 3GW2A 2JUCA 1U6GA 3X2QH 2DA2A 2H1KA 1FTTA 3R0JA 2I5UA 1TWFJ 1WQ2A 3QU6A 4E7LA 4HPQA 1MBJA 1N78A 1ZREA 5H20A 3DXJF 5L3DA 2XAHA 3IRRA 4KMFA 1OYWA 3BTLA 4CCKA 2JK3A 5HDGA 4KT5C 3BQZA 3REOA 3OL4A 1K6OA 2XF6A 3DTIA 4E70A 4BQAA 1IXSB 2EZIA 2IBDA 1VQPI 2R92J 3A02A 3OYFA 2K9NA 4II2A 3PNTA 2XVCA 3I4MJ 2ZMEB 3BCAA 3V8LA 4ENNA 1R36A 2XAGA 3WGGA 2NVQJ 1FC3A 3Q0UA 2VQGA 1QQIA 2UWMA 3TW7A 3J80Z 1JKRC 5J1RA 4BBSJ 4FASD 3VWBA 2F5EA 2ZNYA 5D8LB 2HVSA 1B72B 1XC5A 1LVKA 3QRFF 2VI6A 3K4JA 3ZGKA 3V8JA 3SEQA 2JN6A 1RKTA 4KIFA 2EA2A 3IRQA 2DDBA 3IAS2 5F6FA 4N4NB 4XLFA 1FT9A 2ESNA 2XGCA 2ID6A 1W7PD 4NBQA 3F8NA 2ZMEA 2P5KA 3LWFA 4UB8C 4HLYA 2NRAC 2X1CA 4RGXA 3PUFA 4R8HA 1HLVA 1NK2P 2ZKZA 1K78B 1F5TA 1GV2A 3IP4B 1T0FC 1FYLA 3MZ8A 2VOOA 3MZHA 1SFXA 2E19A 2RREA 3OYJA 1JE8A 1IJWC 1B72A 2LH9A 2BXZA 2STTA 2GQQA 2ZC2A 1RETA 4HLXA 1QBJA 4P1WA 4IHTA 3HZJA 5B1AH 1T39A 1OCRH 3B6CA 5L3BA 4I2OA 2IGMA 2G0EA 3V42A 2VE9A 4C9YA 2ICWG 2DCEA 3KP6A 4AYBN 3GFIA 5IT9Z 2K40A 2R7ZJ 2E1NA 1UMQA 3CP8A 2WY7Q 5HOOA 3TQNA 2DU9A 5H6QA 1UELB 2A07F 4AIHA 1K78A 3KIOA 4WXCA 3HGGA 2WY8Q 3DFGA 1MBEA 2O8XA 2DMNA 2F48A 5EEAA 4OIOF 1LUJB 2NVXJ 1GUUA 4I7HA 2UZKA 4D9JA 1H8AC 3W2VA 2GAUA 4L9TA 4ENMA 1LDDA 5H2FC 5LRRA 5LHHA 4XKVA 1K79A 2LREA 1F43A 1ODDA 3ZP5A 1B4AA 4PJ0C 4R79A 1QPIA 4RM3A 4LLLA 2OD5A 1UCRA 3G6EI 3VPRA 4C3HJ 4PGHA 1T33A 3I9V2 2DYSH 4D0PA 2QLZA 1J0RA 3K4MA 4O5VA 4X6AJ 2QSHX 1IN8A 5GAGJ 5DYMA 1EH7A 4HF0A 3ZCOA 2XGXA 3LSJA 2XASA 3WTTC 3L2RA 4OIPF 4BQNA 1TW2A 1HW2A 2VE8A 1S3JA 2MW8A 3CO6C 1FYKA 3VSLA 2L5QA 1WSUA 3HKZA 2RQPA 3S1QJ 1YIJI 3EUHC 1UHWA 4Y52J 2VONA 1RKWA 5CQGA 5E3NA 4XIDA 3CJQB 5FLMJ 1EJ9A 4DYRA 5HLIA 2STWA 3MKYB 3HOVJ 3CC2I 3SYTA 3FK6A 2MD5A 1AA7A 4BH9A 4C3JJ 2M30A 2ZJQF 3LA2A 3MQ0A 3UR3C 1MMAA 5J4VA 1Y1WJ 2ISYA 1JXSA 4UB6C 2BVLA 5GPAA 1ZK8A 2JPCA 2WAQN 4HV5A 2WADA 2BW3A 2P7CB 2NNYA 4J00A 3J81Z 5J47A 1NH3A 2G9WA 4DYQA 5CVIA 2ZJ2A 4M9ZA 3G1OA 3WGHA 3CCYA 1E2XA 1HSTA 2QZ8A 2RNJA 1ZRCA 1TP4A 4ZH4F 3HOSA 1ZRDA 5EF6A 4YFXF 1Y8QB 2XGEA 1YJWI 1P2FA 3DLAA 4CZZA 2OJED 4ITVA 5FFZA 5E1WA 4S04A 2B7EA 1WJEA 4P55A 2K3FA 2XAFA 3TDZC 4BJ6C 2R7QA 1F36A 3IWFA 1ZR2A 2K9QA 1SD7A 1JGSA 4XNFA 2OZUA 2R0QC 2MYSA 4MIMA 3LL7A 3FXKA 3OYIA 3HM5A 3MZYA 1SD5A 2NAZA 2A5WA 4MHGA 2DOFA 3N05A 2OF7A 1AOYA 1KYWA 3L2WA 1XTAA 4II3A 2VASA 3GCMA 5FO5A 3DLLF 2ECBA 2DA7A 3MKLA 2L7KA 1KU9A 2FF4A 3DPUA 3V7CA 2CQ7A 1PYVA 1IV6A 1XGSA 1JI8A 1BA5A 4D7NA 3TBIA 3GVAA 2CQKA 1S7AA 3SZTA 5LHIA 2ZO4A 1FBSA 2K9MA 3I56I 3OR1C 3LSRA 1MJBA 1SFKA 2H6BA 2KJCA 3LSGA 4MTDA 1YI2I 3KP3A 1R1UA 4F93B 3OYNA 1U9OA 5M3MJ 4YIRX 4IRHA 3MKZA 1QA6A 1YJ9I 1J59A 3MEXA 1HXDA 1MMGA 2M7BA 3L1PA 3ZQQA 5EYRA 4NNJA 3KLNA 4CICA 4PK4A 4Y4RA 5TJJA 2E36A 2DQRA 4WXHA 5HS9A 2V1XA 3W6VA 3WTVC 1T0FA 1USSA 3RIRA 1SFOJ 3BTIA 2CH0A 1GXQA 2DPUA 1SMTA 2L54A 4N0BA 2VL8A 4BAYA 2RNGA 4UNOA 1MMNA 4KJZA 5E1ZB 5E18F 4HSRA 5EDNA 3GZ6A 2E2JJ 4XK4A 1MH3A 1YS6A 3CLQA 4O3MA 2BGCA 2VT3A 3DBHB 3ZXSA 2OU2A 3BR3A 4X1EA 3T8TA 5J8CA 1USTA 5K7ZA 5E3OA 4FX4A 1FSHA 3JRGA 1KONA 5EZHA 1UG2A 1FY7A 3RSNA 1MZBA 2XV4S 2KMUA 1T98A 4PGGA 4UUSB 1LFBA 1POGA 3HOUJ 1RIOH 2HVQA 4RA2A 1P4XA 1YLFA 1Z91A 3OL3A 1R22A 3DBLB 3EYIA 3S1MJ 1MDMB 2CS3A 3BTJA 1A35A 1YRNB 1DP7P 1LDJA 3RYRA 2K4JA 5A2QZ 1XDSA 1MNEA 2RVCA 1YIOA 4HNUA 4XSZF 1WI9A 3ESWB 1ZELA 2WAEA 1ZN2A 4BS9A 4XSXF 3H3VK 5C3EJ 1XMKA 1Z67A 3OWTA 3QYEA 4FX0A 4HYEA 3RQ4A 5GAHJ 3OOPA 1FMWA 4HBLA 5B1BH 4L9NA 1W36D 2UXXA 5BNGA 2VIXA 3AAFA 1FMVA 3IH2A 2B63J 2HTJA 4HSTA 2EIKH 4OOIA 4L9JA 3EPZA 3ECOA 5FRNA 4UUSA 3K4BA 2DTZA 2XRLA 3BWGA 4L0YB 3PFIA 3IKTA 1MDMA 1O3SA 1ZH5A 1YRNA 1FTZA 3QPLA 1P6RA 1UG0A 4EM2A 2KIUA 2LLKA 5DUKA 2AQFA 2KISA 2HR3A 4ASNA 3Q0VA 3EUHA 3PUBA 3VYTB 4V2FA 4C2UA 3VFZA 1JTXA 3WODF 3PSIA 2O6GE 2VKEA 4HG2A 2EFNA 1Y56A 4A5MA 4C3IJ 1V55H 4DGWB 1YTYA 4UUTA 4M72A 3QPTA 1ZG1A 1YW7A 2X1EA 1L0OC 3HC7A 3GF2A 4OAZA 2L9NA 3HRSA 1ITYA 4CCOA 4BGDA 5FKNA 2GOMA 2LOOA 5ILUA 4QPOA 1W5TA 3W2AA 2R93J 5HVQC 1J09A 3PFYA 4HDVA 3J7AY 3B73A 5J1UA 3OYAA 3FWEA 2A61A 4HAMA 4IX7A 4B1RA 1A04A 1TWGJ 3T8RA 4Z6YA 3TGNA 2ADUA 4WX9A 1ZR4A 1FLIA 3K4KA 3KYDB 3RKWA 2XF5A 2QM3A 2NOGA 2VKHA 4H4KC 4A0YA 4RS8A 3JR9A 2IA1A 4XMYA 1R6RA 1YITI 1Z3YA 2XSJC 3BG7A 3PIOF 4P5OA 3C7JA 4E7JA 3WG7H 2P4WA 3HRTA 4OIQF 1X4PA 2TDXA 2R7FA 4ABZA 4ENJA 4M3DA 5HLGA 1HKTA 4A0XA 3VYSB 3E0JB 3OY9A 5FB2A 2VB6A 1CF7B 1J2XA 5IPAA 5JHFA 2Z33A 3CMYA 2YR2A 5GTIC 3K1MA 4U87A 2DFEA 4IEJA 5BMZA 4JP0A 1O4XA 2GM4A 3E6BA 1FX7A 1XPXA 5F1JA 4XLPF 1XGOA 2X51A 1ZAOA 2VJ4A 1WJDA 2Q8KA 1SAXA 2JA8J 3M8EA 3S1NJ 2LG4A 2PMHA 2DI3A 4A5NA 2XGDA 1FEXA 1REPC 3K1PA 4XRSA 3T0YA 1I3QJ 2LMDA 2AO9A 5K5RA 2N8GA 2QEXI 4M9XA 4A3LJ 2QQBA 4XOTA 1IDZA 3C2BA 2DA4A 1U78A 3K4NA 1CF7A 3HXLA 1OCZH 1KQ8A 3BG9A 2O61A 4XLEA 1Z7UA 5LFAA 3BG6A 2EPFA 5HLHA 2D2WA 1S7OA 2FD5A 1R49A 4G7HF 3EQLF 3O8GA 1WI3A 1W4MA 2VLAA 3G1MA 2EFWA 4HQMA 1R4NB 4CHUA 4LIUA 4CDGA 3ROUA 4G6QA 5HODA 4G6DA 3K6GA 2R7UA 3C2GA 3CP2A 1RI7A 1QHGA 2H94A 4DBRA 3MVPA 4ZYHA 4AM3A 1RR7A 2GOXB 1WVRA 4KYWA 3H5NA 2W48A 3E6MA 1PJRA 4RGUA 1BR1A 2XAUA 3RJPA 4E7HA 1O7LA 2J5OA 1F9NA 2CO5A 5DM7F 3BR2A 3CCVI 2WC2A 1ZGJA 2M4GA 4XN0A 5IT3A 4RBOA 5AIPA 2IGNA 1Y1VJ 2FUG2 4KNYA 1YOVB 2M7AA 1AKHB 3DKYA 2EFQA 3GBGA 4IQ4A 3BQYA 5KCMA 1JGGA 2BY3A 4U7DA 1YE9A 3F72A 4M6XA 2KZGA 4DOZA 1QRYA 2MA3A 2ESHA 1DPUA 3RI4A 2DTRA 2HPIA 5DTDA 5M3FJ 2F5DA 4Y7NJ 3QYBA 1Q1HA 3RPUD 4BHPA 4BHBA 4BBRJ 2MABA 2PJRB 2FE3A 1G59A 3OMYA 2A69F 1LE8B 3ZMDA 2V6CA 2AXTC 2LKXA 3H36A 3H0GJ 3LSTA 2CW0F 1JJ8C 4JK1X 1G4DA 2LKSA 2D45A 2X9DA 1J5YA 3CLOA 2Y9ZA 4AIDA 2W84A 3ZQIA 4IJAA 4S05A 1YFHA 1AKHA 5IP7J 4Q47A 3CTAA 2M34A 3ZQLA 2K27A 2ZXJA 3S2DJ 2O3FA 2PJPA 3W2WA 4ZDLA 2PMZN 1SC7A
chains in the Genus database with same CATH topology
4O6JA 4ZYGA 3P9CA 3NQOA 3U2RA 1BIAA 2DBBA 2RC4A 2QBYA 2E7WA 3J7AO 3QP5A 3G73A 1IXRC 4KN4X 5LRSA 3BDDA 3OV8A 5DEQA 3M7GA 5FD5A 3S2WA 4B8XA 2XAQA 2PMUA 3H3ZA 3L7WA 3FMRA 2FBKA 5J6XA 3Q9SA 4JQFA 2BYVE 1R1TA 1G3TA 3CO7C 5BQTA 2LF7A 1IN4A 3R4KA 4GO1A 1R1VA 4L5IA 3WU0A 5BPIA 1FBUA 2Y48A 2ZFWA 2XAJA 2JT1A 5D5XB 1KQ9A 1IN5A 4LK0F 3LFKA 5AONA 1MGTA 2X4HA 5D4SA 5FLXK 1LQ1A 3L2CA 2OA4A 4KDPA 4A0ZA 1LNWA 4NB5A 4WCGA 3IL2A 1WWXA 1OMIA 1KYZA 2HYFA 3SXYA 2XHKA 1C0WA 2EV6A 1TQPA 2L3DA 3WG9A 4NQWA 3F22A 4Q5SF 3F3XA 3N97A 2VC1A 4HA8A 1O3RA 4EM0B 2OQRA 2ZCWA 1Z6TA 4U0WA 4I0BA 1I5ZA 2QENA 5E20A 4LB6B 5CVJA 1SFEA 4K2EA 3FHZA 3WE3A 4ENKA 4AD9A 3ZMZA 2ACJA 2HQNA 4EVIA 1XSXA 1W7PA 1SFUA 4EGYA 2AS5F 2NYXA 2PBIA 1V3FA 2MC3A 1ZHFA 1AWCA 3GUDA 1ZLJA 3K69A 2HEOA 2GXGA 3JTGA 2YU3A 4MQVA 3IWZA 5BPDA 2K4BA 5JFRA 3U9GA 2Z5UA 1FZPB 2LDUA 3TOBA 3BPVA 1UB9A 2OZ6A 3JW4A 2W25A 5LGTA 2KKOA 4AIJA 4MEXF 2GXBA 1PP8F 3ML6A 4EJVA 2HFHA 1XCVA 4B09A 2IT0A 1Y0UA 4M73A 4Q4ZF 1Z1DA 1HSJA 3DV8A 4BHCA 3JAMZ 1FPQA 2XIGA 2COMA 2XKOA 3WGIA 4I09A 2IPQX 2WV0A 3KZYA 4IXAA 3EDPA 3GXOA 4YFNF 4PDKA 3WTSC 4EQQA 3ZMSA 2GWRA 5LLQA 2FMYA 1YYVA 3HSRA 2LSOA 3K1NA 3KLOA 3GEZA 1DDNA 2L02A 2JTVA 3QP6A 2HTSA 4U0YA 5AIQA 2H09A 1ZRFA 2DLLA 2MLKA 5LGUA 2ZNZA 3F6VA 2ETHA 2DK5A 4ZZDA 4KICA 1J7KA 3FXQA 1ZARA 3QPHA 2VBZA 3LQQA 2V9VA 5F64A 2PI0A 4CGZA 1EV7A 1IAWA 2HDCA 3G3ZA 2F5FA 4HX4A 1H9TA 4I01A 4UVCA 2HZTA 2HGCA 2XUBA 3KEQA 3ZQ7A 1PP7U 2DO7A 4KA4A 2CFXA 3FM3A 4M9SA 2NNNA 4A2UA 3F23A 1X3UA 1ZLKA 3W6JB 4LB5A 4KN7X 3ZMVA 2DAOA 3VEPA 4UV8A 1LVAA 3B02A 1HW1A 4DQ2A 1MJAA 4NHJA 2GZWA 1ON2A 3H92A 2FSWA 2FBHA 2IVMA 2PQ8A 4HX7A 5FD6A 3V7RA 5HS8A 2VT2A 3E6DA 4JBAA 1KU7A 3ULQB 1TW3A 3F6OA 4PCQA 2A5YB 3KZZA 5CVRA 4EV0A 5BS6A 3GFLA 1O7FA 1P4AA 3KCCA 5DCFA 1F4KA 3M9AA 1H0MA 1U5TC 4UUVA 4IRGA 1UFMA 4ZZLA 4ESFA 2ZBKA 4N9IA 3DKWA 3WTXC 4LLGF 4EJOA 2IRFG 2A6EF 5H6RA 1O3QA 1IZ1A 1R58A 1MD0A 4U88A 1SD6A 2MLGA 1LB2A 4FT8A 1P92A 3FXRA 5DD8A 3BJOA 4WF2A 4GYIA 4DNCA 5D6EA 3GLXA 3TKYA 3QU3A 3GX4X 2M8EA 1JHFA 4BXUA 1T38A 1TTYA 2LNBA 2PFBA 3CUOA 4HF2A 2VBXA 3FF5A 2UXNA 3V7SA 3E5XA 4GCVA 2Y0MA 4EM1A 4L9VA 1U3EM 5FFXA 4LD5A 3TO7A 1HKSA 3HIFA 2FOKA 3W6KB 3BJAA 4RGRA 3M8FA 3KFWX 3KETA 2VBWA 3I4PA 2HKOA 1XGMA 3I58A 2BEOA 4EGZA 1D8JA 2YX7A 4OMYA 2XROA 4Y13A 4HX8A 2KJBA 2O0YA 2E1CA 3GFJA 2FNAA 2VN2A 3SQNA 4MEYF 3BPXA 2Z3YA 2L01A 2OQGA 3E97A 4XBFA 3KP5A 1K7AA 2FNPA 3DF8A 4UXNA 1UHMA 2P5VA 3ZPLA 1VTNC 2OAZA 3RKXA 1IN6A 2BV6A 5TRDA 4EJUA 4P9UA 2D1VA 2HKXA 5HDNA 3KEOA 3Q9VA 4OMZA 1U5TB 2P8TA 4I98B 1S29A 5DD4A 4LG0B 4U7BA 3U1DA 1J9IA 2M5WA 1F1ZA 1BI0A 4MTEA 1CGPA 4G94A 4YFKF 1V4RA 1I27A 2C6YA 2W85A 1BIBA 4H0EA 4LJZF 5F1RA 1T6SA 3H3UA 1DPRA 1U5TA 3GO5A 4RB0A 3P7NA 3HSFA 2R3SA 1O57A 2GIVA 4ETSA 2W24A 4LG0A 3FMSA 2QQ9A 5EEGA 1DUXC 3BP8A 2EB7A 3HYIA 3L09A 4EMSA 1BI3A 2K02A 5ERIA 2MH2A 1D5VA 2O03A 1D8KA 1MJ9A 5CVVA 4I02A 4EJTA 4HQEA 5HS7A 1KQ0A 4RAYA 2IW5A 3RPQA 4A12A 1FOKA 1FYMA 5LBQA 4BNCA 4MQ9F 1TQIA 4WXDA 3CUQC 2QBYB 3ERED 5LEJA 3J80K 5L3FA 1QZYA 5ICFA 5HDKA 2BBYA 5K5OA 2FBIA 2DQLA 2CG4A 4PZJA 5ILVA 2Q2EA 3GZ5A 2K86A 5ICGA 3LA3A 4RB1A 5CJ9A 2W57A 4IHSA 2PEXA 2EFPA 3QAHA 2AXLA 3PQJA 3WTYC 2PLYA 1KA8A 1IXCA 1LEAA 1BOAA 2P5LC 1S8NA 4A6DA 3M1EA 5IT9K 1BI2A 1Z05A 2Y75A 2H6CA 3ZMUA 3MAJA 1TNSA 5D5VB 1FSEA 3DPTA 3F21A 1FP2A 3I0TA 1Z6RA 5LHGA 5ICEA 4UV9A 4YIFA 2IA2A 3FXUA 1I6XA 1OPCA 4AWXB 2QVOA 4OINF 4ESJA 5KVRA 3C3WA 4L0ZB 4M6YA 5CLSA 2P7VB 1IW7F 1GVJA 4A6EA 1B1BA 3F8FA 2EFOA 1W7PB 5E17F 2HYGD 5KK1A 1YO5C 1LJ9A 1H9GA 2XRNA 2F2EA 4GYGA 1FNNA 1BC7C 4ESBA 2YPRA 4UVAA 3SHFA 4MGRA 4FHTA 3WTWC 2FA5A 4Q48A 1KU3A 1SMYF 5ICCA 3HRUA 4EJWA 3V8KA 3I71A 3L00A 4IF4A 1TBXA 3I5UA 2GA2A 1W5SA 3J81K 2EK5A 2B0LA 3VODA 2DT5A 3CUQB 2RN7A 1QPMA 5ED4A 3HSEA 3COAC 1WKMA 3BY6A 4HF1A 5ILSA 1R5HA 3KP7A 3T5XA 2CYYA 1QO0D 5DV5A 2KIMA 4HDUA 1FWZA 5E8GA 3CUQA 1YQAA 1KGSA 2LKPA 1RUOA 4RAZA 2X0LA 1I1SA 5LGNA 1MKMA 4LMYA 3HHGA 2DPDA 1IRFA 2Q0OA 3L9FA 3NRVA 4KFCA 3QOPA 3JSOA 4L18B 2JSCA 2RDPA 1Z9CA 4N9HA 5JVTA 5L3GA 2PG4A 1IF1A 3RKYA 1U8RA 2FQ3A 5FLXZ 1YW8A 4IVNA 2M1BA 2G7HA 3R61A 1OR7A 1BC8C 3GFMA 3NEUA 4LLNA 3VB2A 1PDNC 1OKRA 1B9NA 1LDKB 2A3SA 1KU2A 2BE5F 3ISPA 3JSPA 1ULYA 1ONVA 2Z99A 2FEZA 1G3WA 1JHHA 2A6HF 3ABTA 2YX4A 3CDHA 2VODA 3DPLC 3PQKA 3Q5FA 2R7DA 5A2QK 2ELHA 1EH8A 4KIBA 2JPBA 3DQVC 1ON1A 3BJ6A 2D1HA 2K7LA 3LAPA 3WU1B 1I1GA 1O3TA 3IC7A 3C1DA 3FMQA 1GHCA 3RTRA 1HKQA 4IRIA 4LGWA 1XDUA 3DEUA 4TV7A 1IN7A 1XMAA 4L5JA 1HBXG 3TOAA 1LEBA 2HOEA 2G7UA 1B6AA 4HW0A 1SD4A 1G3SA 3R60A 4UHTA 1YG2A 5L3EA 3O3KA 2F5CA 2P6SA 4P96A 3KP2A 3JTHA 4XLNF 2WWYA 3DP7A 1ZG3A 3I54A 2PN6A 2H27A 3MFKA 5DDGA 3E6CC 2EV0A 1XCBA 2A68F 2KRFA 4ZYEA 3WE2A 2XKPA 3LA7A 1ZGAA 1T2KA 4CYDA 1BN5A 1L3LA 3E5UA 3ZN0A 5FGMA 2VXZA 1G6NA 1QNTA 2RKHA 3FZVA 5D8KB 2J5PA 3LAJA 1QZZA 2MBFA 4I0AA 4KUMA 2OBPA 1RZ4A 3GYHX 2VOPA 5J8FA 1U2WA 2IJLA 3CJNA 3F8MA 1XB4A 1NHAA 4LK1F 3N4MA 1BI1A 4IPAA 3I53A 3C18A 3RDIA 4YIIA 4MNUA 5D5WB 4LFUA 1PUEE 4HV6A 3VOEA 5D5UB 4RB3C 2YSRA 1HQCA 1BM9A 2V1DA 3K9TA 1TQMA 5D4RA 2KIFA 4P9FA 3ECHA 1P4WA 2RV8A 4HZFA 2VBYA 3HOTA 1FP1D 4OIRF 1YS7A 1BJAA 3O2PE 5L3CA 1BBYA 3KE2A 3O6BB 1XGNA 2P6TA 3SFZA 2Z9OA 4G7OF 2QQAA 2ISZA 1XSDA 1HW5A 2IA0A 2V79A 2RGVA 4XRFA 2CWEA 2GA1A 1YW9A 3FM5A 2M87A 4U0VA 3ZMTA 5K1YA 2FRHA 2WTEA 1IRGA 5E8IA 2CGPA 4GXOA 3GWZA 1XN7A 2DW4A 3WTZA 2QUFA 4G8XA 6PAXA 4QLCU 3MWMA 2L4AA 2CSOA 2HWVA 3TO6A 1G3YA 2V1UA 3ELKA 5D6FA 5JI6A 4ON0A 3HUGA 1GXPA 3R0AA 4UVBA 2HQRA 3IHUA 4QWQA 2QYOA 4AVPA 3RYPA 5K5QA 4F7ZA 1TNTA 4G7ZF 1STZA 2LF8A 3E5QA 1FBQA 3I64A 5CYVA 3TDUC 1XD7A 1EH6A 1R5GA 4BYYA 5E1XA 2E7XA 4Z2YA 3BROA 3RPUA 2M45A 1ZG5A 2IP2A 4R1HA 4OU0A 3V4GA 5CVUA 2NS0A 5BOXA 1J75A 3BZ6A 3EETA 5DCMB 3KP4A 2EA4A 3BOQA 2JZYA 3SZPA 3P9IA 4RB2C 1B59A 4M74A 4YG2F 1OYIA 1B9MA 4G9YA 2FU4A 2DFIA 4M71A 2FXAA 3EYYA 3HRMA 4AIKA 3FX3A 1S6LA 3ABUA 3WTUC 2EJRA 4KIGA 1R23A 2HS5A 1IUYA 3HTUA 5DCMA 1WRJA 1E17A 1QGPA 2JRTA 3HTSB 4CXFA 2FMLA 5DUIA 5JR3A 3MCZA 4WK8F 3D0SA 2DK8A 4Y17A 2EV5A 1OYYA 3HHHA 3F8BA 4Y15A 1TLHB 5EEHA 1XSVA 3F8CA 4GGGA 3R6SA 3K0LA 3I59B 3P9KA 1ZYRF 3E3VA 2VC0A 1R7JA 3T1BA 5LEKA 4WWCA 1R00A 2EWNA 5JHUA 3LQRA 2MH9A 4RGSA 3JAMK 4CO8A 3ZN1A 4KMUX 2L4MA 3IKVA 3TO9A 3D5LA 3K2ZA 4HOBA 2QWWA 1D3YA 1RUNA 1RNLA 4ZYDA 3I59A 3GW2A 1U6GA 3R0JA 3QU6A 1WQ2A 1ZREA 5H20A 3DXJF 5L3DA 2XAHA 3IRRA 4KMFA 1OYWA 5HDGA 4KT5C 3REOA 1K6OA 4E70A 4BQAA 1IXSB 2XVCA 2ZMEB 3V8LA 4ENNA 1R36A 2XAGA 3WGGA 1FC3A 1QQIA 2UWMA 3J80Z 2F5EA 2ZNYA 5D8LB 3QRFF 3V8JA 4KIFA 2EA2A 3IRQA 5F6FA 1FT9A 2ESNA 1W7PD 3F8NA 2ZMEA 2P5KA 3LWFA 4HLYA 2NRAC 4RGXA 4R8HA 2ZKZA 1K78B 1F5TA 1FYLA 2VOOA 3MZHA 1SFXA 1JE8A 2STTA 2GQQA 4HLXA 1QBJA 4IHTA 1T39A 5L3BA 4I2OA 2VE9A 3KP6A 3GFIA 5IT9Z 2E1NA 5HOOA 3TQNA 2DU9A 5H6QA 2A07F 4AIHA 1K78A 4WXCA 3DFGA 2O8XA 4OIOF 4I7HA 2UZKA 2GAUA 4L9TA 4ENMA 1LDDA 5LRRA 5LHHA 1K79A 1ODDA 3ZP5A 1B4AA 4R79A 4LLLA 2OD5A 1UCRA 4PGHA 4D0PA 2QLZA 1J0RA 4O5VA 1IN8A 5DYMA 1EH7A 4HF0A 2XGXA 3WTTC 2XASA 4OIPF 1TW2A 1HW2A 2VE8A 1S3JA 3CO6C 1FYKA 1WSUA 2RQPA 1UHWA 2VONA 5HLIA 2STWA 2MD5A 4BH9A 2M30A 3LA2A 3MQ0A 2ISYA 1JXSA 2JPCA 4HV5A 2P7CB 2NNYA 3J81Z 2G9WA 5CVIA 2ZJ2A 4M9ZA 3WGHA 1E2XA 1HSTA 2QZ8A 2RNJA 1ZRCA 4ZH4F 3HOSA 1ZRDA 4YFXF 1P2FA 4CZZA 5FFZA 5E1WA 4S04A 4P55A 2XAFA 3TDZC 3IWFA 1SD7A 1JGSA 2OZUA 3MZYA 1SD5A 2NAZA 4MHGA 1AOYA 1KYWA 5FO5A 1KU9A 2FF4A 3V7CA 1XGSA 3GVAA 2CQKA 1S7AA 3SZTA 5LHIA 2ZO4A 1FBSA 1MJBA 2H6BA 2KJCA 4MTDA 3KP3A 1R1UA 4IRHA 1J59A 3MEXA 1HXDA 3KLNA 4CICA 5TJJA 5HS9A 2DQRA 4WXHA 2V1XA 3WTVC 1T0FA 1USSA 3RIRA 1GXQA 2DPUA 1SMTA 2L54A 4N0BA 4BAYA 4UNOA 5E1ZB 5E18F 3GZ6A 1YS6A 4O3MA 2BGCA 2VT3A 2OU2A 3T8TA 5J8CA 1USTA 4FX4A 1FSHA 1FY7A 1MZBA 2XV4S 1T98A 4PGGA 1RIOH 1P4XA 1Z91A 1YLFA 1R22A 3EYIA 1MDMB 1DP7P 1LDJA 3RYRA 2K4JA 5A2QZ 1XDSA 2RVCA 1YIOA 4XSZF 1WI9A 1ZN2A 4XSXF 1XMKA 4FX0A 4HYEA 3OOPA 4HBLA 4L9NA 2UXXA 3AAFA 2HTJA 4OOIA 4L9JA 3ECOA 3BWGA 4L0YB 3PFIA 3IKTA 1MDMA 1O3SA 1ZH5A 1P6RA 4EM2A 2KIUA 5DUKA 2HR3A 4ASNA 3EUHA 3VFZA 3WODF 2O6GE 2EFNA 4A5MA 1YTYA 4M72A 3QPTA 1ZG1A 1YW7A 1L0OC 3GF2A 3HRSA 5ILUA 1W5TA 5HVQC 4HDVA 3B73A 3FWEA 2A61A 4HAMA 1A04A 3T8RA 3TGNA 2ADUA 4WX9A 1FLIA 3RKWA 2QM3A 4A0YA 4RS8A 2IA1A 4P5OA 3C7JA 2P4WA 3HRTA 4OIQF 2TDXA 2R7FA 4ENJA 5HLGA 1HKTA 4A0XA 5FB2A 1CF7B 1J2XA 2Z33A 2YR2A 3K1MA 5BMZA 3E6BA 1FX7A 4XLPF 1XGOA 1ZAOA 2Q8KA 1SAXA 3M8EA 2PMHA 2DI3A 4A5NA 1REPC 3K1PA 3T0YA 5K5RA 4M9XA 2QQBA 1U78A 1CF7A 1KQ8A 2O61A 1Z7UA 5HLHA 2D2WA 1S7OA 4G7HF 3EQLF 1W4MA 2EFWA 4HQMA 4CHUA 4CDGA 3ROUA 4G6QA 4G6DA 1RI7A 2H94A 4ZYHA 4KYWA 3E6MA 4RGUA 3RJPA 1O7LA 2J5OA 1F9NA 2CO5A 2WC2A 1ZGJA 5IT3A 5AIPA 4KNYA 2EFQA 4U7DA 3F72A 4M6XA 2MA3A 2ESHA 1DPUA 3RI4A 2DTRA 2F5DA 1Q1HA 4BHPA 4BHBA 2FE3A 2A69F 3ZMDA 2V6CA 3LSTA 2CW0F 1G4DA 4JK1X 2D45A 1J5YA 3CLOA 2W84A 4IJAA 4S05A 1YFHA 4Q47A 3CTAA 2K27A 2ZXJA 2O3FA 2PJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O6J A;  4ZYG A;  3P9C A;  3NQO A;  3U2R A;  1BIA A;  2DBB A;  2RC4 A;  2QBY A;  2E7W A;  3J7A O;  3QP5 A;  3G73 A;  1IXR C;  4KN4 X;  5LRS A;  3BDD A;  3OV8 A;  5DEQ A;  3M7G A;  5FD5 A;  3S2W A;  4B8X A;  2XAQ A;  2PMU A;  3H3Z A;  3L7W A;  3FMR A;  2FBK A;  5J6X A;  3Q9S A;  4JQF A;  2BYV E;  1R1T A;  1G3T A;  3CO7 C;  5BQT A;  2LF7 A;  1IN4 A;  3R4K A;  4GO1 A;  1R1V A;  4L5I A;  3WU0 A;  5BPI A;  1FBU A;  2Y48 A;  2ZFW A;  2XAJ A;  2JT1 A;  5D5X B;  1KQ9 A;  1IN5 A;  4LK0 F;  3LFK A;  5AON A;  1MGT A;  2X4H A;  5D4S A;  5FLX K;  1LQ1 A;  3L2C A;  2OA4 A;  4KDP A;  4A0Z A;  1LNW A;  4NB5 A;  4WCG A;  3IL2 A;  1WWX A;  1OMI A;  1KYZ A;  2HYF A;  3SXY A;  2XHK A;  1C0W A;  2EV6 A;  1TQP A;  2L3D A;  3WG9 A;  4NQW A;  3F22 A;  4Q5S F;  3F3X A;  3N97 A;  2VC1 A;  4HA8 A;  1O3R A;  4EM0 B;  2OQR A;  2ZCW A;  1Z6T A;  4U0W A;  4I0B A;  1I5Z A;  2QEN A;  5E20 A;  4LB6 B;  5CVJ A;  1SFE A;  4K2E A;  3FHZ A;  3WE3 A;  4ENK A;  4AD9 A;  3ZMZ A;  2ACJ A;  2HQN A;  4EVI A;  1XSX A;  1W7P A;  1SFU A;  4EGY A;  2AS5 F;  2NYX A;  2PBI A;  1V3F A;  2MC3 A;  1ZHF A;  1AWC A;  3GUD A;  1ZLJ A;  3K69 A;  2HEO A;  2GXG A;  3JTG A;  2YU3 A;  4MQV A;  3IWZ A;  5BPD A;  2K4B A;  5JFR A;  3U9G A;  2Z5U A;  1FZP B;  2LDU A;  3TOB A;  3BPV A;  1UB9 A;  2OZ6 A;  3JW4 A;  2W25 A;  5LGT A;  2KKO A;  4AIJ A;  4MEX F;  2GXB A;  1PP8 F;  3ML6 A;  4EJV A;  2HFH A;  1XCV A;  4B09 A;  2IT0 A;  1Y0U A;  4M73 A;  4Q4Z F;  1Z1D A;  1HSJ A;  3DV8 A;  4BHC A;  3JAM Z;  1FPQ A;  2XIG A;  2COM A;  2XKO A;  3WGI A;  4I09 A;  2IPQ X;  2WV0 A;  3KZY A;  4IXA A;  3EDP A;  3GXO A;  4YFN F;  4PDK A;  3WTS C;  4EQQ A;  3ZMS A;  2GWR A;  5LLQ A;  2FMY A;  1YYV A;  3HSR A;  2LSO A;  3K1N A;  3KLO A;  3GEZ A;  1DDN A;  2L02 A;  2JTV A;  3QP6 A;  2HTS A;  4U0Y A;  5AIQ A;  2H09 A;  1ZRF A;  2DLL A;  2MLK A;  5LGU A;  2ZNZ A;  3F6V A;  2ETH A;  2DK5 A;  4ZZD A;  4KIC A;  1J7K A;  3FXQ A;  1ZAR A;  3QPH A;  2VBZ A;  3LQQ A;  2V9V A;  5F64 A;  2PI0 A;  4CGZ A;  1EV7 A;  1IAW A;  2HDC A;  3G3Z A;  2F5F A;  4HX4 A;  1H9T A;  4I01 A;  4UVC A;  2HZT A;  2HGC A;  2XUB A;  3KEQ A;  3ZQ7 A;  1PP7 U;  2DO7 A;  4KA4 A;  2CFX A;  3FM3 A;  4M9S A;  2NNN A;  4A2U A;  3F23 A;  1X3U A;  1ZLK A;  3W6J B;  4LB5 A;  4KN7 X;  3ZMV A;  2DAO A;  3VEP A;  4UV8 A;  1LVA A;  3B02 A;  1HW1 A;  4DQ2 A;  1MJA A;  4NHJ A;  2GZW A;  1ON2 A;  3H92 A;  2FSW A;  2FBH A;  2IVM A;  2PQ8 A;  4HX7 A;  5FD6 A;  3V7R A;  5HS8 A;  2VT2 A;  3E6D A;  4JBA A;  1KU7 A;  3ULQ B;  1TW3 A;  3F6O A;  4PCQ A;  2A5Y B;  3KZZ A;  5CVR A;  4EV0 A;  5BS6 A;  3GFL A;  1O7F A;  1P4A A;  3KCC A;  5DCF A;  1F4K A;  3M9A A;  1H0M A;  1U5T C;  4UUV A;  4IRG A;  1UFM A;  4ZZL A;  4ESF A;  2ZBK A;  4N9I A;  3DKW A;  3WTX C;  4LLG F;  4EJO A;  2IRF G;  2A6E F;  5H6R A;  1O3Q A;  1IZ1 A;  1R58 A;  1MD0 A;  4U88 A;  1SD6 A;  2MLG A;  1LB2 A;  4FT8 A;  1P92 A;  3FXR A;  5DD8 A;  3BJO A;  4WF2 A;  4GYI A;  4DNC A;  5D6E A;  3GLX A;  3TKY A;  3QU3 A;  3GX4 X;  2M8E A;  1JHF A;  4BXU A;  1T38 A;  1TTY A;  2LNB A;  2PFB A;  3CUO A;  4HF2 A;  2VBX A;  3FF5 A;  2UXN A;  3V7S A;  3E5X A;  4GCV A;  2Y0M A;  4EM1 A;  4L9V A;  1U3E M;  5FFX A;  4LD5 A;  3TO7 A;  1HKS A;  3HIF A;  2FOK A;  3W6K B;  3BJA A;  4RGR A;  3M8F A;  3KFW X;  3KET A;  2VBW A;  3I4P A;  2HKO A;  1XGM A;  3I58 A;  2BEO A;  4EGZ A;  1D8J A;  2YX7 A;  4OMY A;  2XRO A;  4Y13 A;  4HX8 A;  2KJB A;  2O0Y A;  2E1C A;  3GFJ A;  2FNA A;  2VN2 A;  3SQN A;  4MEY F;  3BPX A;  2Z3Y A;  2L01 A;  2OQG A;  3E97 A;  4XBF A;  3KP5 A;  1K7A A;  2FNP A;  3DF8 A;  4UXN A;  1UHM A;  2P5V A;  3ZPL A;  1VTN C;  2OAZ A;  3RKX A;  1IN6 A;  2BV6 A;  5TRD A;  4EJU A;  4P9U A;  2D1V A;  2HKX A;  5HDN A;  3KEO A;  3Q9V A;  4OMZ A;  1U5T B;  2P8T A;  4I98 B;  1S29 A;  5DD4 A;  4LG0 B;  4U7B A;  3U1D A;  1J9I A;  2M5W A;  1F1Z A;  1BI0 A;  4MTE A;  1CGP A;  4G94 A;  4YFK F;  1V4R A;  1I27 A;  2C6Y A;  2W85 A;  1BIB A;  4H0E A;  4LJZ F;  5F1R A;  1T6S A;  3H3U A;  1DPR A;  1U5T A;  3GO5 A;  4RB0 A;  3P7N A;  3HSF A;  2R3S A;  1O57 A;  2GIV A;  4ETS A;  2W24 A;  4LG0 A;  3FMS A;  2QQ9 A;  5EEG A;  1DUX C;  3BP8 A;  2EB7 A;  3HYI A;  3L09 A;  4EMS A;  1BI3 A;  2K02 A;  5ERI A;  2MH2 A;  1D5V A;  2O03 A;  1D8K A;  1MJ9 A;  5CVV A;  4I02 A;  4EJT A;  4HQE A;  5HS7 A;  1KQ0 A;  4RAY A;  2IW5 A;  3RPQ A;  4A12 A;  1FOK A;  1FYM A;  5LBQ A;  4BNC A;  4MQ9 F;  1TQI A;  4WXD A;  3CUQ C;  2QBY B;  3ERE D;  5LEJ A;  3J80 K;  5L3F A;  1QZY A;  5ICF A;  5HDK A;  2BBY A;  5K5O A;  2FBI A;  2DQL A;  2CG4 A;  4PZJ A;  5ILV A;  2Q2E A;  3GZ5 A;  2K86 A;  5ICG A;  3LA3 A;  4RB1 A;  5CJ9 A;  2W57 A;  4IHS A;  2PEX A;  2EFP A;  3QAH A;  2AXL A;  3PQJ A;  3WTY C;  2PLY A;  1KA8 A;  1IXC A;  1LEA A;  1BOA A;  2P5L C;  1S8N A;  4A6D A;  3M1E A;  5IT9 K;  1BI2 A;  1Z05 A;  2Y75 A;  2H6C A;  3ZMU A;  3MAJ A;  1TNS A;  5D5V B;  1FSE A;  3DPT A;  3F21 A;  1FP2 A;  3I0T A;  1Z6R A;  5LHG A;  5ICE A;  4UV9 A;  4YIF A;  2IA2 A;  3FXU A;  1I6X A;  1OPC A;  4AWX B;  2QVO A;  4OIN F;  4ESJ A;  5KVR A;  3C3W A;  4L0Z B;  4M6Y A;  5CLS A;  2P7V B;  1IW7 F;  1GVJ A;  4A6E A;  1B1B A;  3F8F A;  2EFO A;  1W7P B;  5E17 F;  2HYG D;  5KK1 A;  1YO5 C;  1LJ9 A;  1H9G A;  2XRN A;  2F2E A;  4GYG A;  1FNN A;  1BC7 C;  4ESB A;  2YPR A;  4UVA A;  3SHF A;  4MGR A;  4FHT A;  3WTW C;  2FA5 A;  4Q48 A;  1KU3 A;  1SMY F;  5ICC A;  3HRU A;  4EJW A;  3V8K A;  3I71 A;  3L00 A;  4IF4 A;  1TBX A;  3I5U A;  2GA2 A;  1W5S A;  3J81 K;  2EK5 A;  2B0L A;  3VOD A;  2DT5 A;  3CUQ B;  2RN7 A;  1QPM A;  5ED4 A;  3HSE A;  3COA C;  1WKM A;  3BY6 A;  4HF1 A;  5ILS A;  1R5H A;  3KP7 A;  3T5X A;  2CYY A;  1QO0 D;  5DV5 A;  2KIM A;  4HDU A;  1FWZ A;  5E8G A;  3CUQ A;  1YQA A;  1KGS A;  2LKP A;  1RUO A;  4RAZ A;  2X0L A;  1I1S A;  5LGN A;  1MKM A;  4LMY A;  3HHG A;  2DPD A;  1IRF A;  2Q0O A;  3L9F A;  3NRV A;  4KFC A;  3QOP A;  3JSO A;  4L18 B;  2JSC A;  2RDP A;  1Z9C A;  4N9H A;  5JVT A;  5L3G A;  2PG4 A;  1IF1 A;  3RKY A;  1U8R A;  2FQ3 A;  5FLX Z;  1YW8 A;  4IVN A;  2M1B A;  2G7H A;  3R61 A;  1OR7 A;  1BC8 C;  3GFM A;  3NEU A;  4LLN A;  3VB2 A;  1PDN C;  1OKR A;  1B9N A;  1LDK B;  2A3S A;  1KU2 A;  2BE5 F;  3ISP A;  3JSP A;  1ULY A;  1ONV A;  2Z99 A;  2FEZ A;  1G3W A;  1JHH A;  2A6H F;  3ABT A;  2YX4 A;  3CDH A;  2VOD A;  3DPL C;  3PQK A;  3Q5F A;  2R7D A;  5A2Q K;  2ELH A;  1EH8 A;  4KIB A;  2JPB A;  3DQV C;  1ON1 A;  3BJ6 A;  2D1H A;  2K7L A;  3LAP A;  3WU1 B;  1I1G A;  1O3T A;  3IC7 A;  3C1D A;  3FMQ A;  1GHC A;  3RTR A;  1HKQ A;  4IRI A;  4LGW A;  1XDU A;  3DEU A;  4TV7 A;  1IN7 A;  1XMA A;  4L5J A;  1HBX G;  3TOA A;  1LEB A;  2HOE A;  2G7U A;  1B6A A;  4HW0 A;  1SD4 A;  1G3S A;  3R60 A;  4UHT A;  1YG2 A;  5L3E A;  3O3K A;  2F5C A;  2P6S A;  4P96 A;  3KP2 A;  3JTH A;  4XLN F;  2WWY A;  3DP7 A;  1ZG3 A;  3I54 A;  2PN6 A;  2H27 A;  3MFK A;  5DDG A;  3E6C C;  2EV0 A;  1XCB A;  2A68 F;  2KRF A;  4ZYE A;  3WE2 A;  2XKP A;  3LA7 A;  1ZGA A;  1T2K A;  4CYD A;  1BN5 A;  1L3L A;  3E5U A;  3ZN0 A;  5FGM A;  2VXZ A;  1G6N A;  1QNT A;  2RKH A;  3FZV A;  5D8K B;  2J5P A;  3LAJ A;  1QZZ A;  2MBF A;  4I0A A;  4KUM A;  2OBP A;  1RZ4 A;  3GYH X;  2VOP A;  5J8F A;  1U2W A;  2IJL A;  3CJN A;  3F8M A;  1XB4 A;  1NHA A;  4LK1 F;  3N4M A;  1BI1 A;  4IPA A;  3I53 A;  3C18 A;  3RDI A;  4YII A;  4MNU A;  5D5W B;  4LFU A;  1PUE E;  4HV6 A;  3VOE A;  5D5U B;  4RB3 C;  2YSR A;  1HQC A;  1BM9 A;  2V1D A;  3K9T A;  1TQM A;  5D4R A;  2KIF A;  4P9F A;  3ECH A;  1P4W A;  2RV8 A;  4HZF A;  2VBY A;  3HOT A;  1FP1 D;  4OIR F;  1YS7 A;  1BJA A;  3O2P E;  5L3C A;  1BBY A;  3KE2 A;  3O6B B;  1XGN A;  2P6T A;  3SFZ A;  2Z9O A;  4G7O F;  2QQA A;  2ISZ A;  1XSD A;  1HW5 A;  2IA0 A;  2V79 A;  2RGV A;  4XRF A;  2CWE A;  2GA1 A;  1YW9 A;  3FM5 A;  2M87 A;  4U0V A;  3ZMT A;  5K1Y A;  2FRH A;  2WTE A;  1IRG A;  5E8I A;  2CGP A;  4GXO A;  3GWZ A;  1XN7 A;  2DW4 A;  3WTZ A;  2QUF A;  4G8X A;  6PAX A;  4QLC U;  3MWM A;  2L4A A;  2CSO A;  2HWV A;  3TO6 A;  1G3Y A;  2V1U A;  3ELK A;  5D6F A;  5JI6 A;  4ON0 A;  3HUG A;  1GXP A;  3R0A A;  4UVB A;  2HQR A;  3IHU A;  4QWQ A;  2QYO A;  4AVP A;  3RYP A;  5K5Q A;  4F7Z A;  1TNT A;  4G7Z F;  1STZ A;  2LF8 A;  3E5Q A;  1FBQ A;  3I64 A;  5CYV A;  3TDU C;  1XD7 A;  1EH6 A;  1R5G A;  4BYY A;  5E1X A;  2E7X A;  4Z2Y A;  3BRO A;  3RPU A;  2M45 A;  1ZG5 A;  2IP2 A;  4R1H A;  4OU0 A;  3V4G A;  5CVU A;  2NS0 A;  5BOX A;  1J75 A;  3BZ6 A;  3EET A;  5DCM B;  3KP4 A;  2EA4 A;  3BOQ A;  2JZY A;  3SZP A;  3P9I A;  4RB2 C;  1B59 A;  4M74 A;  4YG2 F;  1OYI A;  1B9M A;  4G9Y A;  2FU4 A;  2DFI A;  4M71 A;  2FXA A;  3EYY A;  3HRM A;  4AIK A;  3FX3 A;  1S6L A;  3ABU A;  3WTU C;  2EJR A;  4KIG A;  1R23 A;  2HS5 A;  1IUY A;  3HTU A;  5DCM A;  1WRJ A;  1E17 A;  1QGP A;  2JRT A;  3HTS B;  4CXF A;  2FML A;  5DUI A;  5JR3 A;  3MCZ A;  4WK8 F;  3D0S A;  2DK8 A;  4Y17 A;  2EV5 A;  1OYY A;  3HHH A;  3F8B A;  4Y15 A;  1TLH B;  5EEH A;  1XSV A;  3F8C A;  4GGG A;  3R6S A;  3K0L A;  3I59 B;  3P9K A;  1ZYR F;  3E3V A;  2VC0 A;  1R7J A;  3T1B A;  5LEK A;  4WWC A;  1R00 A;  2EWN A;  5JHU A;  3LQR A;  2MH9 A;  4RGS A;  3JAM K;  4CO8 A;  3ZN1 A;  4KMU X;  2L4M A;  3IKV A;  3TO9 A;  3D5L A;  3K2Z A;  4HOB A;  2QWW A;  1D3Y A;  1RUN A;  1RNL A;  4ZYD A;  3I59 A;  3GW2 A;  1U6G A;  3R0J A;  3QU6 A;  1WQ2 A;  1ZRE A;  5H20 A;  3DXJ F;  5L3D A;  2XAH A;  3IRR A;  4KMF A;  1OYW A;  5HDG A;  4KT5 C;  3REO A;  1K6O A;  4E70 A;  4BQA A;  1IXS B;  2XVC A;  2ZME B;  3V8L A;  4ENN A;  1R36 A;  2XAG A;  3WGG A;  1FC3 A;  1QQI A;  2UWM A;  3J80 Z;  2F5E A;  2ZNY A;  5D8L B;  3QRF F;  3V8J A;  4KIF A;  2EA2 A;  3IRQ A;  5F6F A;  1FT9 A;  2ESN A;  1W7P D;  3F8N A;  2ZME A;  2P5K A;  3LWF A;  4HLY A;  2NRA C;  4RGX A;  4R8H A;  2ZKZ A;  1K78 B;  1F5T A;  1FYL A;  2VOO A;  3MZH A;  1SFX A;  1JE8 A;  2STT A;  2GQQ A;  4HLX A;  1QBJ A;  4IHT A;  1T39 A;  5L3B A;  4I2O A;  2VE9 A;  3KP6 A;  3GFI A;  5IT9 Z;  2E1N A;  5HOO A;  3TQN A;  2DU9 A;  5H6Q A;  2A07 F;  4AIH A;  1K78 A;  4WXC A;  3DFG A;  2O8X A;  4OIO F;  4I7H A;  2UZK A;  2GAU A;  4L9T A;  4ENM A;  1LDD A;  5LRR A;  5LHH A;  1K79 A;  1ODD A;  3ZP5 A;  1B4A A;  4R79 A;  4LLL A;  2OD5 A;  1UCR A;  4PGH A;  4D0P A;  2QLZ A;  1J0R A;  4O5V A;  1IN8 A;  5DYM A;  1EH7 A;  4HF0 A;  2XGX A;  3WTT C;  2XAS A;  4OIP F;  1TW2 A;  1HW2 A;  2VE8 A;  1S3J A;  3CO6 C;  1FYK A;  1WSU A;  2RQP A;  1UHW A;  2VON A;  5HLI A;  2STW A;  2MD5 A;  4BH9 A;  2M30 A;  3LA2 A;  3MQ0 A;  2ISY A;  1JXS A;  2JPC A;  4HV5 A;  2P7C B;  2NNY A;  3J81 Z;  2G9W A;  5CVI A;  2ZJ2 A;  4M9Z A;  3WGH A;  1E2X A;  1HST A;  2QZ8 A;  2RNJ A;  1ZRC A;  4ZH4 F;  3HOS A;  1ZRD A;  4YFX F;  1P2F A;  4CZZ A;  5FFZ A;  5E1W A;  4S04 A;  4P55 A;  2XAF A;  3TDZ C;  3IWF A;  1SD7 A;  1JGS A;  2OZU A;  3MZY A;  1SD5 A;  2NAZ A;  4MHG A;  1AOY A;  1KYW A;  5FO5 A;  1KU9 A;  2FF4 A;  3V7C A;  1XGS A;  3GVA A;  2CQK A;  1S7A A;  3SZT A;  5LHI A;  2ZO4 A;  1FBS A;  1MJB A;  2H6B A;  2KJC A;  4MTD A;  3KP3 A;  1R1U A;  4IRH A;  1J59 A;  3MEX A;  1HXD A;  3KLN A;  4CIC A;  5TJJ A;  5HS9 A;  2DQR A;  4WXH A;  2V1X A;  3WTV C;  1T0F A;  1USS A;  3RIR A;  1GXQ A;  2DPU A;  1SMT A;  2L54 A;  4N0B A;  4BAY A;  4UNO A;  5E1Z B;  5E18 F;  3GZ6 A;  1YS6 A;  4O3M A;  2BGC A;  2VT3 A;  2OU2 A;  3T8T A;  5J8C A;  1UST A;  4FX4 A;  1FSH A;  1FY7 A;  1MZB A;  2XV4 S;  1T98 A;  4PGG A;  1RIO H;  1P4X A;  1Z91 A;  1YLF A;  1R22 A;  3EYI A;  1MDM B;  1DP7 P;  1LDJ A;  3RYR A;  2K4J A;  5A2Q Z;  1XDS A;  2RVC A;  1YIO A;  4XSZ F;  1WI9 A;  1ZN2 A;  4XSX F;  1XMK A;  4FX0 A;  4HYE A;  3OOP A;  4HBL A;  4L9N A;  2UXX A;  3AAF A;  2HTJ A;  4OOI A;  4L9J A;  3ECO A;  3BWG A;  4L0Y B;  3PFI A;  3IKT A;  1MDM A;  1O3S A;  1ZH5 A;  1P6R A;  4EM2 A;  2KIU A;  5DUK A;  2HR3 A;  4ASN A;  3EUH A;  3VFZ A;  3WOD F;  2O6G E;  2EFN A;  4A5M A;  1YTY A;  4M72 A;  3QPT A;  1ZG1 A;  1YW7 A;  1L0O C;  3GF2 A;  3HRS A;  5ILU A;  1W5T A;  5HVQ C;  4HDV A;  3B73 A;  3FWE A;  2A61 A;  4HAM A;  1A04 A;  3T8R A;  3TGN A;  2ADU A;  4WX9 A;  1FLI A;  3RKW A;  2QM3 A;  4A0Y A;  4RS8 A;  2IA1 A;  4P5O A;  3C7J A;  2P4W A;  3HRT A;  4OIQ F;  2TDX A;  2R7F A;  4ENJ A;  5HLG A;  1HKT A;  4A0X A;  5FB2 A;  1CF7 B;  1J2X A;  2Z33 A;  2YR2 A;  3K1M A;  5BMZ A;  3E6B A;  1FX7 A;  4XLP F;  1XGO A;  1ZAO A;  2Q8K A;  1SAX A;  3M8E A;  2PMH A;  2DI3 A;  4A5N A;  1REP C;  3K1P A;  3T0Y A;  5K5R A;  4M9X A;  2QQB A;  1U78 A;  1CF7 A;  1KQ8 A;  2O61 A;  1Z7U A;  5HLH A;  2D2W A;  1S7O A;  4G7H F;  3EQL F;  1W4M A;  2EFW A;  4HQM A;  4CHU A;  4CDG A;  3ROU A;  4G6Q A;  4G6D A;  1RI7 A;  2H94 A;  4ZYH A;  4KYW A;  3E6M A;  4RGU A;  3RJP A;  1O7L A;  2J5O A;  1F9N A;  2CO5 A;  2WC2 A;  1ZGJ A;  5IT3 A;  5AIP A;  4KNY A;  2EFQ A;  4U7D A;  3F72 A;  4M6X A;  2MA3 A;  2ESH A;  1DPU A;  3RI4 A;  2DTR A;  2F5D A;  1Q1H A;  4BHP A;  4BHB A;  2FE3 A;  2A69 F;  3ZMD A;  2V6C A;  3LST A;  2CW0 F;  1G4D A;  4JK1 X;  2D45 A;  1J5Y A;  3CLO A;  2W84 A;  4IJA A;  4S05 A;  1YFH A;  4Q47 A;  3CTA A;  2K27 A;  2ZXJ A;  2O3F A;  2PJP A; 
#chains in the Genus database with same CATH topology
 5IOZ A;  4NC6 A;  4O6J A;  1VQ7 I;  3KX2 A;  2HYJ A;  5EJC A;  4ZYG A;  3P9C A;  3NQO A;  3U2R A;  3CC4 I;  1BIA A;  2DBB A;  2M2E A;  1T08 B;  2E5Z A;  2RC4 A;  2PJR A;  2QBY A;  2IS1 A;  1LE8 A;  2DA3 A;  2E7W A;  3J7A O;  3QP5 A;  3G73 A;  1IXR C;  4KN4 X;  5LRS A;  3BDD A;  2QA4 I;  3OV8 A;  2ELJ A;  2YUS A;  3K7A J;  1X1A A;  2E60 A;  5DEQ A;  3KEY A;  2FJ1 A;  3H9J A;  4CCN A;  2I10 A;  4HEA 2;  5J4Y A;  3M7G A;  4ZYA A;  5FD5 A;  3S2W A;  4B8X A;  2XAQ A;  3I55 I;  1RC9 A;  1VND A;  2PMU A;  3H3Z A;  3L7W A;  5F0F A;  5IOY A;  2BY0 A;  2FBK A;  3FMR A;  5IP6 A;  5J6X A;  3Q9S A;  4JQF A;  3FIS A;  3HPH A;  1VQM I;  1QVT A;  1JUP A;  2BYV E;  1R1T A;  2E5N A;  4D7M A;  1G3T A;  3CO7 C;  5BQT A;  2LF7 A;  1IN4 A;  3R4K A;  4GO1 A;  1TZL A;  2R7X A;  1R1V A;  4L5I A;  3WU0 A;  5BPI A;  3DWL E;  1FBU A;  2Y48 A;  2ZFW A;  2XAJ A;  3DBR B;  2JT1 A;  5D5X B;  1KQ9 A;  1IN5 A;  4LK0 F;  3FKJ A;  1DP3 A;  3G4S I;  3RZO J;  3LFK A;  4BUP A;  3FXM A;  4NQW B;  5AON A;  1MGT A;  2VQH A;  2QF7 A;  3M1C A;  2X4H A;  5D4S A;  5C44 J;  3BLY A;  1NG6 A;  3CES A;  2IS4 A;  5F27 A;  4CZC A;  5FLX K;  4FET A;  4MO7 A;  5TGT A;  1LQ1 A;  3L2C A;  3OYL A;  2OA4 A;  4KDP A;  4ZTJ A;  4A0Z A;  1MBF A;  1LNW A;  4NB5 A;  1ZTR A;  4B3X A;  4WCG A;  1WFX A;  4DYC A;  4PJL A;  1D1B A;  3IL2 A;  1WWX A;  5B5E C;  2JMW A;  3SFI A;  1OMI A;  5J3L A;  2HOS A;  1KYZ A;  1HDP A;  3GTM J;  2EIL H;  2HYF A;  3SXY A;  2XHK A;  1R71 A;  1C0W A;  3HEF A;  2EV6 A;  1N25 A;  1TQP A;  3JRD A;  1XMX A;  1S72 I;  2L3D A;  3S2H J;  3WG9 A;  4NQW A;  3F22 A;  4Q5S F;  1RRJ A;  2MG4 A;  2WB1 N;  2KHM A;  3F3X A;  3N97 A;  2VC1 A;  4HA8 A;  1P9Q C;  2K9L A;  2YU9 J;  1O3R A;  4EM0 B;  2OQR A;  2ZCW A;  1Z6T A;  1Y39 A;  1VQL I;  4U0W A;  4I0B A;  1I5Z A;  2QEN A;  2VJJ A;  5E20 A;  4LB6 B;  2FQ4 A;  5CVJ A;  4IHW A;  1SFE A;  4I6Z A;  5CPR B;  4K2E A;  3FHZ A;  3WE3 A;  4ENK A;  2X6O A;  4AD9 A;  3ZMZ A;  4PSW A;  2ACJ A;  2HQN A;  4EVI A;  1XSX A;  2XB0 X;  1W7P A;  1SFU A;  4CSW A;  4EGY A;  2AS5 F;  2NYX A;  2PBI A;  1V3F A;  2MC3 A;  3H9G A;  1ZHF A;  3K4C A;  1AWC A;  2DFH A;  2X1D A;  1VQ4 I;  3GUD A;  1ZLJ A;  3K69 A;  3K70 D;  2HEO A;  2EIJ H;  1WJF A;  1WJC A;  1K83 J;  2QKL B;  2GXG A;  3JTG A;  5JLW A;  4C2T A;  1Y0N A;  2YU3 A;  2VPL A;  4XRM A;  1NK3 P;  1ZKG A;  4MQV A;  1V5E A;  3AG2 H;  2K4B A;  3IWZ A;  5JFR A;  5BPD A;  3U9G A;  1A31 A;  2CV0 A;  2DA1 A;  2XPV A;  4M3B A;  1FIA A;  2Z5U A;  1IG7 A;  1WJB A;  1FZP B;  2DYR H;  2LDU A;  3TOB A;  3BPV A;  5FKO A;  4BJ5 C;  1UB9 A;  2OZ6 A;  1MNM C;  1TWC J;  3JW4 A;  1VFC A;  2W25 A;  5LGT A;  3JRC A;  1G2H A;  4CH7 A;  2KKO A;  4AVZ A;  1SAU A;  3I4N J;  4AIJ A;  3M07 A;  4MEX F;  2GXB A;  4C30 A;  1X1C A;  4CYC A;  3CF2 A;  1PP8 F;  4J01 A;  3ML6 A;  3LSK A;  4YEJ A;  4EJV A;  1U8B A;  1Q1V A;  2HFH A;  1XCV A;  2PMZ A;  1ETO A;  4CUG A;  2JA6 J;  4B09 A;  2FOW A;  2IT0 A;  3S17 J;  4DZP A;  1Y0U A;  4M73 A;  4Q4Z F;  3UNG C;  1Z1D A;  1HSJ A;  3DV8 A;  2EZH A;  4BHC A;  2MD0 A;  3JAM Z;  1FPQ A;  2XIG A;  2COM A;  2XKO A;  1HC8 A;  2BOL A;  3WGI A;  4I09 A;  4F92 B;  3GLL A;  3NWT A;  3NWS A;  2IPQ X;  2WV0 A;  3KZY A;  4IXA A;  3GTL J;  3EDP A;  3GXO A;  2E35 A;  4YFN F;  4PDK A;  3WTS C;  1W36 C;  1ZQ3 P;  3VYU B;  4EQQ A;  1ETX A;  2LFB A;  3ZMS A;  2GWR A;  4F55 A;  5LLQ A;  2FMY A;  3GTJ J;  1YYV A;  2IAI A;  3HSR A;  1IRX A;  2LSO A;  3K1N A;  2QSG X;  4PUS A;  3KLO A;  3GEZ A;  4A3I J;  1MIJ A;  1DDN A;  2L02 A;  2JTV A;  2BW3 B;  3A0H C;  1Z21 A;  3QP6 A;  2HTS A;  4U0Y A;  5AIQ A;  4BJT A;  2H09 A;  4CCL A;  1ZRF A;  2DLL A;  2MLK A;  5LGU A;  2ZNZ A;  3F6V A;  3S3M A;  2WV1 A;  2ETH A;  2IGO A;  5FRM A;  1BOB A;  1ZGW A;  2DK5 A;  3BG5 A;  4ZZD A;  4A3M J;  1H88 C;  2D5V A;  4KIC A;  3CDL A;  2V6E A;  4QPQ A;  1FOX A;  4X0G A;  3PO3 J;  1J7K A;  3FBN B;  4NDL A;  3FXQ A;  1ZAR A;  3QPH A;  2VBZ A;  3S32 A;  2ZJR F;  1AHD P;  3LQQ A;  2Y9Y A;  3DKX A;  3QQA A;  4A3G J;  2TCT A;  2V9V A;  2XSD C;  3LSI A;  4ZDP A;  5F64 A;  4IOC F;  2PI0 A;  4CGZ A;  4FE4 A;  1EV7 A;  3LOC A;  3MD2 A;  1IAW A;  2HDC A;  3G3Z A;  2F5F A;  4BQQ A;  3S93 A;  4HX4 A;  2Z16 A;  2K9S A;  1H9T A;  5IYB J;  3ABK H;  3P5J A;  4I01 A;  4UVC A;  2HZT A;  2HGC A;  1X2M A;  3OIP A;  1ETW A;  2XUB A;  3KEQ A;  3ZQ7 A;  4ZTF A;  1PP7 U;  4ZC3 A;  2DO7 A;  4XIC A;  3OR2 C;  1YX5 A;  4KA4 A;  3GTO J;  2CFX A;  4PJJ A;  2JWT A;  3FM3 A;  2LTP A;  1K61 A;  1IRZ A;  4YEL A;  4M9S A;  3H0D A;  3DTE A;  2NNN A;  5LD2 C;  3RQI A;  2OCC H;  4A2U A;  3AFH A;  2A6T A;  2CUF A;  3F23 A;  1X3U A;  5EZG A;  4E7S A;  4F91 B;  5HNH A;  4FE7 A;  1ZLK A;  3W6J B;  2VPR A;  1WH7 A;  4LB5 A;  2E2H J;  2H8W A;  3ZQF A;  4KN7 X;  3ZMV A;  2DAO A;  3VEP A;  3AL0 C;  3H35 A;  2NS7 A;  4UV8 A;  3BR6 A;  3MKW B;  1LVA A;  3B02 A;  1HW1 A;  4DQ2 A;  1MJA A;  4NHJ A;  2GZW A;  2KDZ A;  1ON2 A;  3H1C A;  2X85 A;  3A01 B;  3H92 A;  2FSW A;  2FBH A;  2FX0 A;  2IVM A;  3CJT B;  2PQ8 A;  3DCF A;  4HX7 A;  3V7R A;  5FD6 A;  2JA2 A;  1JTY A;  3M8J A;  5HS8 A;  5K7H A;  2VT2 A;  1X4O A;  3E6D A;  4JBA A;  1YHQ I;  1KU7 A;  2DA6 A;  3ULQ B;  1TW3 A;  2KPM A;  3F6O A;  4PCQ A;  2DMQ A;  2A5Y B;  2M4K A;  3KZZ A;  5CVR A;  4EV0 A;  4F3Q A;  5BS6 A;  5HLT A;  3GFL A;  1O7F A;  2R7S A;  1P4A A;  3KCC A;  5DCF A;  4AYB A;  5DS9 A;  1F4K A;  5GPC A;  5KHD A;  1OJL A;  3M9A A;  2ID3 A;  1H0M A;  1U5T C;  2NVY J;  4UUV A;  4FCY A;  2ECC A;  1UFM A;  4IRG A;  4ZZL A;  1BW5 A;  3A01 A;  4DJA A;  4ESF A;  2LP0 A;  5GTH C;  2ZBK A;  4N9I A;  4F52 A;  1ACI A;  3DKW A;  3WTX C;  4LLG F;  4EJO A;  2IRF G;  2A6E F;  1ERD A;  5H6R A;  1O3Q A;  4B43 A;  3PIP F;  2V9P A;  1IZ1 A;  1T56 A;  1TWA J;  1R58 A;  1EF4 A;  2BY2 A;  2VKD A;  1SEU A;  1MD0 A;  3S15 J;  1S5L C;  4CCJ A;  4U88 A;  1SD6 A;  4OAY A;  1BL0 A;  2CFO A;  2MLG A;  2HDD A;  4GDF A;  4A3C J;  2Y0S N;  1LB2 A;  4FT8 A;  1X3W B;  1P92 A;  2JA5 J;  2R5Y B;  3FXR A;  5DD8 A;  3HPG A;  1X1D A;  2CQX A;  3BJO A;  3FIW A;  3SDG A;  1OCT C;  4WF2 A;  5JVG F;  4GYI A;  3DTK A;  4IQJ A;  4BXX J;  4DNC A;  5D6E A;  3GLX A;  3Q3S A;  4HNV A;  3TKY A;  4JX4 A;  1DU6 A;  3BR0 A;  3QU3 A;  1GT0 C;  3GX4 X;  1BJZ A;  1N75 A;  2DN0 A;  2M8E A;  2XC7 A;  1JHF A;  4BXU A;  3OYB A;  3UKG A;  1T38 A;  1TTY A;  3PNY A;  1JJ6 C;  5J40 A;  2LNB A;  5F08 A;  3GME A;  2QCO A;  2PFB A;  2V7F A;  2WAF A;  3CUO A;  3PO2 J;  1S9H A;  4HF2 A;  2CUJ A;  2VBX A;  2KIQ A;  3FF5 A;  1W1W E;  1X1B A;  1Y8R B;  4J19 A;  2R5Y A;  3ZQG A;  2UXN A;  3V7S A;  3QPS A;  3E5X A;  1Z3X A;  2XPU A;  4GCV A;  2Y0M A;  1OLT A;  4EM1 A;  4L9V A;  1U3E M;  5FFX A;  4LD5 A;  1LFP A;  1SAN A;  2P0W A;  3BT9 A;  4M3F A;  3TO7 A;  1HKS A;  2KQR A;  2K3P A;  3HIF A;  2FOK A;  3QOD A;  4C2M J;  2KT0 A;  2WAQ A;  2LVS A;  4BDZ A;  1TL8 A;  3J7Z I;  3PM1 A;  3W6K B;  4RAF A;  3BJA A;  1W0T A;  4RGR A;  3U21 A;  4NC8 A;  1HA8 A;  3RKQ A;  4E7K A;  1BW6 A;  3M8F A;  3TL4 X;  1UHS A;  3KFW X;  4ANJ A;  5EG0 A;  3KET A;  1P7I A;  2VBW A;  1Z0X A;  3I4P A;  2HKO A;  3GTK J;  3CZ6 A;  1JKO C;  1XGM A;  1IGN A;  3I58 A;  2BEO A;  4EGZ A;  3CCJ I;  3TED A;  1D8J A;  2YX7 A;  4OMY A;  3M3Y J;  1MBH A;  5HNF A;  3FDY A;  3RZD J;  1MW7 A;  1H89 C;  2XRO A;  4Y13 A;  4HX8 A;  4MFE A;  1JT6 A;  2KJB A;  2O0Y A;  2E1C A;  2HDW A;  3GFJ A;  4D5C A;  2FNA A;  3FXJ A;  2VN2 A;  2ZXH A;  3SQN A;  1HOM A;  4MEY F;  3BPX A;  2Z3Y A;  2NVU B;  1OCP A;  2LD5 A;  2L01 A;  2OQG A;  3E97 A;  4XBF A;  3KP5 A;  4B44 A;  1K7A A;  2FNP A;  3DF8 A;  3OOU A;  1ETY A;  1VQN I;  4UXN A;  1UHM A;  2P5V A;  3ZPL A;  2IS6 A;  1VTN C;  2OAZ A;  3IH4 A;  1DQU A;  3RKX A;  1NTC A;  2HU9 A;  1IN6 A;  3U1K A;  1GDT A;  1D0Z A;  2BV6 A;  5TRD A;  4EJU A;  1IC8 A;  4P9U A;  4HNT A;  2D1V A;  1QVU A;  2EZK A;  2W1O A;  2HKX A;  3HG9 A;  5HDN A;  2ZSH B;  3KEO A;  3Q9V A;  4OMZ A;  2KRC A;  3ASN H;  3VYR B;  5DM6 F;  1VQ6 I;  1U5T B;  4DIQ A;  2P8T A;  4I98 B;  4IKF A;  1S29 A;  1JUM A;  3BZK A;  1MBG A;  5DD4 A;  4LG0 B;  4U7B A;  3U1D A;  1J9I A;  3JRF A;  2M5W A;  1F1Z A;  1WCM J;  1BI0 A;  2F5V A;  5KAF C;  2HQ5 A;  4MTE A;  2CQQ A;  1CGP A;  1BR2 A;  4G94 A;  4XKC A;  4YFK F;  1V4R A;  2KZV A;  3D1N I;  1I27 A;  1V54 H;  2GIZ A;  3ERM A;  3VDX A;  2C6Y A;  1E3O C;  3S3N A;  1X58 A;  2W85 A;  2ZSI B;  1BIB A;  4H0E A;  2GXA A;  4LJZ F;  5F1R A;  1T6S A;  3H3U A;  1DPR A;  1U5T A;  3GO5 A;  1K6Y A;  1JKQ C;  3CDI A;  4RB0 A;  3P7N A;  3HSF A;  2LY2 A;  2R3S A;  1O57 A;  4OWR B;  2GIV A;  4ETS A;  2HZD A;  2W24 A;  1K4T A;  3CME I;  1PVE A;  2F4O B;  3NAR A;  2DOA A;  5CQE A;  4LG0 A;  3FMS A;  3SDB A;  2QQ9 A;  5FRO A;  5EEG A;  3K70 C;  3BP8 A;  2EB7 A;  1DUX C;  3HYI A;  3L09 A;  3QWL A;  4EMS A;  2X6X A;  2QSF X;  3MN2 A;  1D5Y A;  4I76 A;  4QIW N;  3OYE A;  1BI3 A;  2K02 A;  5ERI A;  4BEH B;  1OCC H;  2MH2 A;  5IY5 H;  2EIM H;  1D5V A;  4PJM A;  2O03 A;  5GP9 A;  1D8K A;  1MJ9 A;  5B66 C;  5CVV A;  1MMS A;  1IUF A;  4I02 A;  4EJT A;  4HQE A;  5HS7 A;  2DA5 A;  1B8I B;  1KQ0 A;  2ZME C;  3LNQ A;  1R4M B;  4RAY A;  2IW5 A;  1ETV A;  4E7I A;  2M9H A;  3RPQ A;  5IYD J;  3S16 J;  4A12 A;  4A3B J;  3BG3 A;  3OIQ A;  4W1U A;  4CA0 A;  2JJ7 A;  1FOK A;  2E1M C;  1FYM A;  5LBQ A;  1JT0 A;  4BNC A;  4MQ9 F;  4PSX A;  1TQI A;  4NUB A;  4WXD A;  1W0U A;  3CUQ C;  2QBY B;  3ERE D;  5FKL A;  4BEH A;  5LEJ A;  3J80 K;  2B9S A;  1MH4 A;  5L3F A;  1QZY A;  5ICF A;  3CCM I;  1VQ9 I;  5HDK A;  3CCU I;  2BBY A;  1DGW Y;  4BE2 A;  1ENH A;  1B8I A;  2EIN H;  5GAE J;  4IL6 C;  5K5O A;  2PX9 A;  2FBI A;  2DQL A;  2CG4 A;  3CCR I;  3WHC A;  1I39 A;  5KNL A;  4PZJ A;  5ILV A;  4LG3 A;  2DDA A;  2Q2E A;  3GZ5 A;  4A93 J;  2K86 A;  5ICG A;  4BY1 J;  3LA3 A;  3DU6 A;  2BY1 A;  3D5S C;  2L0K A;  4RB1 A;  3D5R C;  4D1Q A;  5CJ9 A;  2A05 A;  4E4H A;  4JOM A;  2V4J C;  3W3C A;  2F4I A;  2W57 A;  2JRM A;  3FK7 A;  4IHS A;  1DGR M;  2BHZ A;  2OTJ I;  2CRG A;  2PEX A;  2EFP A;  3QAH A;  2AXL A;  4XN3 A;  2HVR A;  3PQJ A;  4XON A;  3WTY C;  1OR7 C;  2PLY A;  1KA8 A;  4ZJZ A;  2Z2S B;  3JRI A;  1IXC A;  1LEA A;  1BOA A;  2P5L C;  1S8N A;  4A6D A;  3K10 A;  3M1E A;  1FJL A;  1AU7 A;  2UV1 A;  5IT9 K;  1BI2 A;  1A36 A;  2R7T A;  1Z05 A;  2Y75 A;  3ONQ A;  4KIT B;  2H6C A;  5M5Y J;  3ZMU A;  3PL8 A;  3MAJ A;  4BE0 A;  2VUM J;  3ABL H;  1JKP C;  1APL C;  1TNS A;  5D5V B;  1FSE A;  3DPT A;  3F21 A;  1FP2 A;  2DOE A;  2L7F P;  3I0T A;  1Z6R A;  5LHG A;  5ICE A;  3ZRG A;  4UV9 A;  4YIF A;  1GV5 A;  4NC7 A;  2IA2 A;  3FXU A;  2R5Z B;  1I6X A;  3IV5 A;  1OPC A;  3MMY B;  4AWX B;  1QHH D;  4FIS A;  1R5I D;  2KFD A;  3HKZ N;  2QVO A;  4OIN F;  3ZQC A;  4ESJ A;  5KVR A;  3C3W A;  1MBK A;  4L0Z B;  4M6Y A;  5CLS A;  2WBM A;  2P7V B;  1IW7 F;  2K85 A;  1GVJ A;  4A6E A;  1B1B A;  3F8F A;  2L9S A;  5E3M A;  2EFO A;  1W7P B;  1VQK I;  5E17 F;  2HYG D;  2DT7 B;  4I99 C;  3CQZ J;  2HPM A;  4GRI A;  5KK1 A;  1YO5 C;  1LJ9 A;  2IXS A;  3OIO A;  1H9G A;  2XRN A;  1Y6I A;  2F2E A;  1FNN A;  4GYG A;  3KYC B;  1BC7 C;  4RLF A;  2OCE A;  1MMD A;  4ESB A;  2YPR A;  4IOA F;  4UVA A;  3SHF A;  3S14 J;  4MGR A;  4FHT A;  3WTW C;  2R5Z A;  2FA5 A;  4Q48 A;  3PSF A;  3CC7 I;  1KU3 A;  1SMY F;  3BR1 A;  5ICC A;  3HRU A;  2OV7 A;  4EJW A;  4HRI A;  1LPQ A;  3V8K A;  3I71 A;  3L00 A;  2HOA A;  4IF4 A;  2IEK A;  1Z77 A;  4CCM A;  4W97 A;  5F04 A;  1TBX A;  1U9N A;  2EH3 A;  3I5U A;  4CYC B;  3IAM 2;  2GA2 A;  1W5S A;  3DEE A;  2E1M B;  4XLA A;  3J81 K;  5F0C A;  2EK5 A;  2B0L A;  4B47 A;  3VOD A;  2DT5 A;  3CUQ B;  2RN7 A;  1QPM A;  5ED4 A;  4L5E A;  3HSE A;  4BXF A;  3WU2 C;  1HF0 A;  3COA C;  3HOY J;  1WKM A;  2OUM A;  3BY6 A;  3S3O A;  2IGK A;  3HOZ J;  1X19 A;  4HF1 A;  2HOT A;  3EUA A;  5ILS A;  1R5H A;  1GLN A;  5M5W J;  3KP7 A;  3T5X A;  3LFU A;  2CYY A;  1QO0 D;  4XKB A;  5DV5 A;  1A5J A;  2E2I J;  2OC6 A;  4BKX A;  2XDV A;  2W7N A;  2KIM A;  4HDU A;  2E34 A;  1FWZ A;  2BHY A;  2DXI A;  5E8G A;  3CUQ A;  4A3J J;  3A2K A;  1D1A A;  1YQA A;  1KGS A;  2LKP A;  1RUO A;  4RAZ A;  3G71 I;  2W82 A;  2X0L A;  1I1S A;  1T8I A;  1V5F A;  4RDU A;  2X6Y A;  5LGN A;  1MKM A;  2CUE A;  2V1N A;  3HHG A;  4LMY A;  2DPD A;  2EZL A;  1IRF A;  2Q0O A;  3L9F A;  2R7W A;  3NRV A;  4IHX A;  4KFC A;  3QOP A;  3IH3 A;  3JSO A;  5M5X J;  1U0J A;  2CV1 A;  4L18 B;  2LBF B;  2JSC A;  2RDP A;  1EKE A;  4XM3 A;  1Z9C A;  4N9H A;  5JVT A;  3ASO H;  3CD6 I;  3E1S A;  5B3S H;  1P7J A;  5L3G A;  3J7Y J;  2PG4 A;  3TMO A;  3OYK A;  1IF1 A;  1I3A A;  3RKY A;  3BTC A;  4G6T B;  4AU7 A;  1U8R A;  2FQ3 A;  2EBI A;  4YRV A;  5FLX Z;  1YW8 A;  4LIV A;  3L2V A;  5F0H A;  2KP6 A;  1M1E B;  4IVN A;  2M1B A;  2G7H A;  2ZFU A;  1OCO H;  3R61 A;  1OR7 A;  1BC8 C;  3GFM A;  3G1L A;  2Y30 A;  4E7Z A;  3NEU A;  3G2B A;  4LLN A;  3VB2 A;  5FLV A;  1PDN C;  1OKR A;  1B9N A;  3HOX J;  5K7F A;  2LBF A;  2W00 A;  2JQ7 A;  1LDK B;  1WGX A;  2VJI A;  1S7E A;  2A3S A;  1KU2 A;  2BE5 F;  3ISP A;  4Y3O A;  5IP9 J;  3JSP A;  2UUZ A;  3CMA I;  1ULY A;  2QKM B;  1ONV A;  4PJN A;  4A3E J;  2KL4 A;  2Z99 A;  1IO2 A;  2ZXI A;  2FEZ A;  1G3W A;  1JHH A;  2A6H F;  3ABT A;  2YX4 A;  3CDH A;  5IYC J;  3OYH A;  3FBI B;  1WH5 A;  2VOD A;  3DPL C;  3PQK A;  3Q5F A;  4XOR A;  2L2O A;  2R7D A;  2VQL A;  4XR6 A;  5A2Q K;  2ELH A;  1EH8 A;  3OS2 A;  2R7V A;  4UY8 I;  4KIB A;  4MLO A;  3HOW J;  2JPB A;  3DQV C;  3I3L A;  4PFO A;  3TW6 A;  4QTR A;  1VQ8 I;  2WB1 A;  1OFC X;  1ETQ A;  3OYM A;  2E71 A;  2OPT A;  1ON1 A;  2CV2 A;  2ME0 A;  3HBL A;  3JRH A;  3BJ6 A;  2D1H A;  3GTG J;  2K7L A;  4M3G A;  2AQE A;  2L7Z A;  3LAP A;  1I50 J;  3PNV A;  3WU1 B;  1I1G A;  1XX5 A;  2L7M P;  4BL0 B;  3H9Q A;  3IUO A;  1O3T A;  3IC7 A;  2MGQ A;  2QGU A;  2V9K A;  3O8H A;  2VJ5 A;  3BR5 A;  3C1D A;  3FMQ A;  1GHC A;  2LK2 A;  2O8K A;  3Q0W A;  1SVM A;  3RTR A;  5FKK A;  3DEW A;  3K2A A;  1YJN I;  1HKQ A;  4FQG A;  4IRI A;  1XG1 A;  2CW7 A;  3CCS I;  2DMP A;  2M0C A;  4LGW A;  1X2N A;  3HDD A;  4LOC A;  1XDU A;  3DEU A;  4TV7 A;  1OQY A;  1IN7 A;  1XMA A;  3CJR B;  2DFF A;  4L5J A;  1HBX G;  3CMM A;  1QU3 A;  1YX3 A;  3TOA A;  1LEB A;  3FHN A;  2HOE A;  2ELK A;  2G7U A;  1B6A A;  2NXN B;  3VSK A;  3CCQ I;  4HW0 A;  2L9V A;  1K4S A;  1SD4 A;  2BZT A;  1G3S A;  3R60 A;  4UHT A;  2HI3 A;  1YG2 A;  5L3E A;  4AUX A;  3O3K A;  2F5C A;  3GTP J;  2P6S A;  4P96 A;  2ZJP F;  3KP2 A;  4BDY A;  3WHB A;  3JTH A;  1WZ2 A;  4XLN F;  4JYK A;  4BAC A;  1CQT A;  2WWY A;  3DP7 A;  2CQN A;  3PJR A;  5FJ8 J;  1ZG3 A;  3I54 A;  2PN6 A;  2H27 A;  3MFK A;  3RCO A;  2V26 A;  5DDG A;  3E6C C;  2EV0 A;  4RMN A;  2HXO A;  1XCB A;  2P81 A;  5KAI C;  4V2G A;  2A68 F;  2KRF A;  4ZYE A;  3WE2 A;  2XKP A;  4DZJ A;  1N77 A;  1D0X A;  1MSF C;  3LA7 A;  3LSP A;  1ZGA A;  3HB9 A;  1T2K A;  4CYD A;  1BN5 A;  1VI0 A;  1L3L A;  2DT6 A;  3E5U A;  2MC4 A;  3ZN0 A;  5EG0 B;  5FGM A;  2M3A A;  1UZC A;  2HNH A;  2VXZ A;  1G6N A;  1QNT A;  2I8D A;  2RKH A;  3FZV A;  5D8K B;  1T95 A;  5CKT A;  3QOE A;  4A69 C;  1RES A;  2J5P A;  1TC3 C;  3SZG A;  3LAJ A;  4RM2 A;  2AHQ A;  3TP3 A;  1QZZ A;  2X6W A;  2MBF A;  1DU0 A;  1VZ0 A;  4MFD A;  4I0A A;  4KUM A;  4G12 A;  2O5R A;  4IO9 F;  2OBP A;  1RZ4 A;  3GYH X;  2Y69 H;  5C4J J;  2VOP A;  2KDO A;  5J8F A;  1U2W A;  3M4O J;  2NOJ B;  3JRB A;  2IJL A;  3CJN A;  3F8M A;  1XB4 A;  1RPW A;  4GFB A;  5E79 C;  1NHA A;  4LK1 F;  3N4M A;  1BI1 A;  2R7R A;  3KYL A;  4IPA A;  2F6C A;  3I53 A;  3C18 A;  1E3P A;  3RDI A;  3ZR8 X;  4YII A;  3H5R A;  2JVG A;  2CUZ A;  4A3D J;  4MNU A;  4EEF G;  5D5W B;  4LFU A;  1Z7L A;  3JRE A;  4HV6 A;  1PUE E;  3AL0 B;  1G8X A;  1XS9 A;  3E7L A;  3VOE A;  5D5U B;  2O7O A;  2RQQ A;  4RB3 C;  2YSR A;  2LY1 A;  3AG3 H;  1HQC A;  3ZOB A;  4IZZ A;  1BM9 A;  1NG7 A;  2V1D A;  3K9T A;  3AKZ A;  4EAT A;  1TQM A;  4XOP A;  5D4R A;  4AC0 A;  2KIF A;  3HGY A;  1JUS A;  2L9R A;  3JRA A;  4FTH A;  1X1P A;  3TP0 A;  2VKV A;  1VF9 A;  2LY9 A;  4P9F A;  2CMP A;  3ECH A;  1VQO I;  1P4W A;  1V5G A;  2RV8 A;  4HZF A;  4BU2 A;  2VBY A;  2KLO A;  1RR8 C;  5JLX A;  3HOT A;  2IS2 A;  1FP1 D;  3AG4 H;  3LSH A;  4IHY A;  1QZE A;  2GBY A;  4BE1 A;  4OIR F;  1YS7 A;  1BJA A;  2JSP A;  3O2P E;  5L3C A;  1R9T J;  1BBY A;  1D1C A;  2E1O A;  2K5C A;  3KE2 A;  3O6B B;  3FXL A;  4S0H B;  1XGN A;  1UJ8 A;  2P6T A;  1WJA A;  4PFP A;  3SFZ A;  2Z9O A;  2HQA A;  2ZXW H;  2BXY A;  4G7O F;  2DMU A;  3LMM A;  2COB A;  2JA7 J;  2CU7 A;  3OSG A;  2GLO A;  3QYF A;  5GAD J;  2QQA A;  4M6V A;  3F0C A;  2ISZ A;  2H8R A;  1XSD A;  2EQR A;  4E6K G;  2TRT A;  1HW5 A;  2IA0 A;  3AG1 H;  3BC8 A;  3HUG B;  2V79 A;  2RGV A;  4XLH A;  1FIP A;  3S1R J;  3H5A A;  4D5F A;  1ETK A;  3HJE A;  2Q1Z B;  2Z1D A;  4XRF A;  2CWE A;  2Y31 A;  2GA1 A;  1YW9 A;  3FM5 A;  3KPH A;  2OTL I;  9ANT A;  2M87 A;  4U0V A;  1D0Y A;  3ZMT A;  5K1Y A;  2FRH A;  3C2H A;  4DW6 A;  2WTE A;  1IRG A;  3A0B C;  5E8I A;  2CGP A;  4GXO A;  3CF5 F;  3GWZ A;  4BQO A;  1HCR A;  1XN7 A;  2Y0S A;  2DW4 A;  3WTZ A;  2QUF A;  1GVD A;  4G8X A;  2LR8 A;  4ZDO A;  6PAX A;  5FKM A;  4QLC U;  4JX5 A;  4KIS A;  3MWM A;  2L4A A;  3ZQH A;  2WA0 A;  2CSO A;  2HWV A;  3TO6 A;  1G3Y A;  2DMT A;  2V1U A;  2LYC A;  3ELK A;  5D6F A;  5JI6 A;  3GTQ J;  4BY7 J;  2MFZ A;  4ON0 A;  3HUG A;  1GXP A;  1SVL A;  3JCU C;  3R0A A;  4UVB A;  2HQR A;  4M3E A;  3IHU A;  3L2Q A;  5J1Y A;  5TIS C;  4QWQ A;  2QYO A;  3GZN B;  4AVP A;  1UAA A;  3RYP A;  2DOD A;  5K5Q A;  4F7Z A;  1A6Q A;  1TNT A;  3A1Y A;  4G7Z F;  1E3H A;  1STZ A;  4XRS G;  2LF8 A;  3E5Q A;  1FBQ A;  2F4M B;  4XQF A;  4B4C A;  3I64 A;  5CYV A;  3TDU C;  4KT6 A;  2XPW A;  1WJ5 A;  1XD7 A;  1E0E A;  3OYG A;  3OYD A;  4IHV A;  1EH6 A;  2CJJ A;  2Q2E B;  3LSM A;  1R5G A;  4BYY A;  1PUF B;  5E1X A;  4JX6 A;  1ORK A;  2E7X A;  4Z2Y A;  3NAU A;  3BRO A;  3RPU A;  2W4S A;  3EUK L;  2M45 A;  1ZG5 A;  1LKX A;  2IP2 A;  2O9L A;  4R1H A;  3BZC A;  4OU0 A;  4V19 K;  2BVM A;  3V4G A;  1VQ5 I;  5CVU A;  2NS0 A;  5BOX A;  5E3L A;  1WHU A;  1J75 A;  5C4X J;  2R4G A;  3B6A A;  3BZ6 A;  3EET A;  2HXI A;  5DCM B;  3KP4 A;  2XB5 A;  2EA4 A;  3L2U A;  2R7O A;  1MSE C;  3F9K A;  3BOQ A;  2JZY A;  1TT5 B;  3OS0 A;  3SZP A;  2LC2 A;  3FXO A;  3P9I A;  4RB2 C;  1LFU P;  1B59 A;  4M74 A;  4B48 A;  4YG2 F;  1OYI A;  1I6H J;  3FKI J;  1PUF A;  1B9M A;  1BR4 A;  4G9Y A;  2FU4 A;  4N4O B;  1TWH J;  2DFI A;  2NS8 A;  1W5C C;  1FOY A;  1WPK A;  1FOW A;  4M71 A;  3SJM A;  2FXA A;  3HL2 A;  3EYY A;  1A6I A;  3HRM A;  2ZB9 A;  4AIK A;  1IDY A;  3FX3 A;  1S6L A;  2JVH A;  3ABU A;  1SVO A;  2EJR A;  3WTU C;  4KIG A;  1R23 A;  2H1L A;  2DJI A;  4XLC A;  2HS5 A;  1IUY A;  3HTU A;  5DCM A;  1EA3 A;  3OYC A;  1WRJ A;  1E17 A;  3A4C A;  2ME6 A;  4A3F J;  1QGP A;  1IV8 A;  2JRT A;  2QQ8 A;  1X3Z B;  4A3K J;  3HTS B;  4XKW A;  4CXF A;  2FML A;  5DUI A;  5JR3 A;  1OIS A;  3DU5 A;  3MCZ A;  2KRH A;  2M0M A;  1KZH A;  3D0S A;  4WK8 F;  3ABM H;  2MSY A;  2DK8 A;  2LRD A;  2XF7 A;  2Y2Z A;  2EV5 A;  4Y17 A;  5EGO B;  1OYY A;  3HHH A;  3F8B A;  4Y15 A;  1TLH B;  1XSV A;  3F8C A;  4GGG A;  5EEH A;  3R6S A;  3K0L A;  4B3A A;  3I59 B;  3P9K A;  3CCE I;  1ZYR F;  3E3V A;  2VC0 A;  1R7J A;  3T1B A;  4QSH A;  5LEK A;  4WWC A;  3K4L A;  4Y33 A;  4DBQ A;  3OS1 A;  1R00 A;  2EWN A;  2YS9 A;  4RLQ A;  5JHU A;  3CCL I;  3OSF A;  3LQR A;  1MND A;  2MH9 A;  3SEZ A;  4XL9 A;  2VQC A;  4RGS A;  2M8G X;  3JAM K;  4RAG A;  4CO8 A;  3ZN1 A;  2RAE A;  4KMU X;  1HDD C;  2L4M A;  3BCB A;  4LIT A;  2DJN A;  3IKV A;  3S8P A;  3TO9 A;  2VXD A;  3D5L A;  1TT0 A;  3A03 A;  3K2Z A;  3KZI C;  4HOB A;  2QWW A;  5EGO A;  2NVT J;  1D3Y A;  1RUN A;  1RNL A;  2JUG A;  4ZYD A;  2X48 A;  2CW8 A;  3I59 A;  3GW2 A;  2JUC A;  1U6G A;  3X2Q H;  2DA2 A;  2H1K A;  1FTT A;  3R0J A;  2I5U A;  1TWF J;  1WQ2 A;  3QU6 A;  4E7L A;  4HPQ A;  1MBJ A;  1N78 A;  1ZRE A;  5H20 A;  3DXJ F;  5L3D A;  2XAH A;  3IRR A;  4KMF A;  1OYW A;  3BTL A;  4CCK A;  2JK3 A;  5HDG A;  4KT5 C;  3BQZ A;  3REO A;  3OL4 A;  1K6O A;  2XF6 A;  3DTI A;  4E70 A;  4BQA A;  1IXS B;  2EZI A;  2IBD A;  1VQP I;  2R92 J;  3A02 A;  3OYF A;  2K9N A;  4II2 A;  3PNT A;  2XVC A;  3I4M J;  2ZME B;  3BCA A;  3V8L A;  4ENN A;  1R36 A;  2XAG A;  3WGG A;  2NVQ J;  1FC3 A;  3Q0U A;  2VQG A;  1QQI A;  2UWM A;  3TW7 A;  3J80 Z;  1JKR C;  5J1R A;  4BBS J;  4FAS D;  3VWB A;  2F5E A;  2ZNY A;  5D8L B;  2HVS A;  1B72 B;  1XC5 A;  1LVK A;  3QRF F;  2VI6 A;  3K4J A;  3ZGK A;  3V8J A;  3SEQ A;  2JN6 A;  1RKT A;  4KIF A;  2EA2 A;  3IRQ A;  2DDB A;  3IAS 2;  5F6F A;  4N4N B;  4XLF A;  1FT9 A;  2ESN A;  2XGC A;  2ID6 A;  1W7P D;  4NBQ A;  3F8N A;  2ZME A;  2P5K A;  3LWF A;  4UB8 C;  4HLY A;  2NRA C;  2X1C A;  4RGX A;  3PUF A;  4R8H A;  1HLV A;  1NK2 P;  2ZKZ A;  1K78 B;  1F5T A;  1GV2 A;  3IP4 B;  1T0F C;  1FYL A;  3MZ8 A;  2VOO A;  3MZH A;  1SFX A;  2E19 A;  2RRE A;  3OYJ A;  1JE8 A;  1IJW C;  1B72 A;  2LH9 A;  2BXZ A;  2STT A;  2GQQ A;  2ZC2 A;  1RET A;  4HLX A;  1QBJ A;  4P1W A;  4IHT A;  3HZJ A;  5B1A H;  1T39 A;  1OCR H;  3B6C A;  5L3B A;  4I2O A;  2IGM A;  2G0E A;  3V42 A;  2VE9 A;  4C9Y A;  2ICW G;  2DCE A;  3KP6 A;  4AYB N;  3GFI A;  5IT9 Z;  2K40 A;  2R7Z J;  2E1N A;  1UMQ A;  3CP8 A;  2WY7 Q;  5HOO A;  3TQN A;  2DU9 A;  5H6Q A;  1UEL B;  2A07 F;  4AIH A;  1K78 A;  3KIO A;  4WXC A;  3HGG A;  2WY8 Q;  3DFG A;  1MBE A;  2O8X A;  2DMN A;  2F48 A;  5EEA A;  4OIO F;  1LUJ B;  2NVX J;  1GUU A;  4I7H A;  2UZK A;  4D9J A;  1H8A C;  3W2V A;  2GAU A;  4L9T A;  4ENM A;  1LDD A;  5H2F C;  5LRR A;  5LHH A;  4XKV A;  1K79 A;  2LRE A;  1F43 A;  1ODD A;  3ZP5 A;  1B4A A;  4PJ0 C;  4R79 A;  1QPI A;  4RM3 A;  4LLL A;  2OD5 A;  1UCR A;  3G6E I;  3VPR A;  4C3H J;  4PGH A;  1T33 A;  3I9V 2;  2DYS H;  4D0P A;  2QLZ A;  1J0R A;  3K4M A;  4O5V A;  4X6A J;  2QSH X;  1IN8 A;  5GAG J;  5DYM A;  1EH7 A;  4HF0 A;  3ZCO A;  2XGX A;  3LSJ A;  2XAS A;  3WTT C;  3L2R A;  4OIP F;  4BQN A;  1TW2 A;  1HW2 A;  2VE8 A;  1S3J A;  2MW8 A;  3CO6 C;  1FYK A;  3VSL A;  2L5Q A;  1WSU A;  3HKZ A;  2RQP A;  3S1Q J;  1YIJ I;  3EUH C;  1UHW A;  4Y52 J;  2VON A;  1RKW A;  5CQG A;  5E3N A;  4XID A;  3CJQ B;  5FLM J;  1EJ9 A;  4DYR A;  5HLI A;  2STW A;  3MKY B;  3HOV J;  3CC2 I;  3SYT A;  3FK6 A;  2MD5 A;  1AA7 A;  4BH9 A;  4C3J J;  2M30 A;  2ZJQ F;  3LA2 A;  3MQ0 A;  3UR3 C;  1MMA A;  5J4V A;  1Y1W J;  2ISY A;  1JXS A;  4UB6 C;  2BVL A;  5GPA A;  1ZK8 A;  2JPC A;  2WAQ N;  4HV5 A;  2WAD A;  2BW3 A;  2P7C B;  2NNY A;  4J00 A;  3J81 Z;  5J47 A;  1NH3 A;  2G9W A;  4DYQ A;  5CVI A;  2ZJ2 A;  4M9Z A;  3G1O A;  3WGH A;  3CCY A;  1E2X A;  1HST A;  2QZ8 A;  2RNJ A;  1ZRC A;  1TP4 A;  4ZH4 F;  3HOS A;  1ZRD A;  5EF6 A;  4YFX F;  1Y8Q B;  2XGE A;  1YJW I;  1P2F A;  3DLA A;  4CZZ A;  2OJE D;  4ITV A;  5FFZ A;  5E1W A;  4S04 A;  2B7E A;  1WJE A;  4P55 A;  2K3F A;  2XAF A;  3TDZ C;  4BJ6 C;  2R7Q A;  1F36 A;  3IWF A;  1ZR2 A;  2K9Q A;  1SD7 A;  1JGS A;  4XNF A;  2OZU A;  2R0Q C;  2MYS A;  4MIM A;  3LL7 A;  3FXK A;  3OYI A;  3HM5 A;  3MZY A;  1SD5 A;  2NAZ A;  2A5W A;  4MHG A;  2DOF A;  3N05 A;  2OF7 A;  1AOY A;  1KYW A;  3L2W A;  1XTA A;  4II3 A;  2VAS A;  3GCM A;  5FO5 A;  3DLL F;  2ECB A;  2DA7 A;  3MKL A;  2L7K A;  1KU9 A;  2FF4 A;  3DPU A;  3V7C A;  2CQ7 A;  1PYV A;  1IV6 A;  1XGS A;  1JI8 A;  1BA5 A;  4D7N A;  3TBI A;  3GVA A;  2CQK A;  1S7A A;  3SZT A;  5LHI A;  2ZO4 A;  1FBS A;  2K9M A;  3I56 I;  3OR1 C;  3LSR A;  1MJB A;  1SFK A;  2H6B A;  2KJC A;  3LSG A;  4MTD A;  1YI2 I;  3KP3 A;  1R1U A;  4F93 B;  3OYN A;  1U9O A;  5M3M J;  4YIR X;  4IRH A;  3MKZ A;  1QA6 A;  1YJ9 I;  1J59 A;  3MEX A;  1HXD A;  1MMG A;  2M7B A;  3L1P A;  3ZQQ A;  5EYR A;  4NNJ A;  3KLN A;  4CIC A;  4PK4 A;  4Y4R A;  5TJJ A;  2E36 A;  2DQR A;  4WXH A;  5HS9 A;  2V1X A;  3W6V A;  3WTV C;  1T0F A;  1USS A;  3RIR A;  1SFO J;  3BTI A;  2CH0 A;  1GXQ A;  2DPU A;  1SMT A;  2L54 A;  4N0B A;  2VL8 A;  4BAY A;  2RNG A;  4UNO A;  1MMN A;  4KJZ A;  5E1Z B;  5E18 F;  4HSR A;  5EDN A;  3GZ6 A;  2E2J J;  4XK4 A;  1MH3 A;  1YS6 A;  3CLQ A;  4O3M A;  2BGC A;  2VT3 A;  3DBH B;  3ZXS A;  2OU2 A;  3BR3 A;  4X1E A;  3T8T A;  5J8C A;  1UST A;  5K7Z A;  5E3O A;  4FX4 A;  1FSH A;  3JRG A;  1KON A;  5EZH A;  1UG2 A;  1FY7 A;  3RSN A;  1MZB A;  2XV4 S;  2KMU A;  1T98 A;  4PGG A;  4UUS B;  1LFB A;  1POG A;  3HOU J;  1RIO H;  2HVQ A;  4RA2 A;  1P4X A;  1YLF A;  1Z91 A;  3OL3 A;  1R22 A;  3DBL B;  3EYI A;  3S1M J;  1MDM B;  2CS3 A;  3BTJ A;  1A35 A;  1YRN B;  1DP7 P;  1LDJ A;  3RYR A;  2K4J A;  5A2Q Z;  1XDS A;  1MNE A;  2RVC A;  1YIO A;  4HNU A;  4XSZ F;  1WI9 A;  3ESW B;  1ZEL A;  2WAE A;  1ZN2 A;  4BS9 A;  4XSX F;  3H3V K;  5C3E J;  1XMK A;  1Z67 A;  3OWT A;  3QYE A;  4FX0 A;  4HYE A;  3RQ4 A;  5GAH J;  3OOP A;  1FMW A;  4HBL A;  5B1B H;  4L9N A;  1W36 D;  2UXX A;  5BNG A;  2VIX A;  3AAF A;  1FMV A;  3IH2 A;  2B63 J;  2HTJ A;  4HST A;  2EIK H;  4OOI A;  4L9J A;  3EPZ A;  3ECO A;  5FRN A;  4UUS A;  3K4B A;  2DTZ A;  2XRL A;  3BWG A;  4L0Y B;  3PFI A;  3IKT A;  1MDM A;  1O3S A;  1ZH5 A;  1YRN A;  1FTZ A;  3QPL A;  1P6R A;  1UG0 A;  4EM2 A;  2KIU A;  2LLK A;  5DUK A;  2AQF A;  2KIS A;  2HR3 A;  4ASN A;  3Q0V A;  3EUH A;  3PUB A;  3VYT B;  4V2F A;  4C2U A;  3VFZ A;  1JTX A;  3WOD F;  3PSI A;  2O6G E;  2VKE A;  4HG2 A;  2EFN A;  1Y56 A;  4A5M A;  4C3I J;  1V55 H;  4DGW B;  1YTY A;  4UUT A;  4M72 A;  3QPT A;  1ZG1 A;  1YW7 A;  2X1E A;  1L0O C;  3HC7 A;  3GF2 A;  4OAZ A;  2L9N A;  3HRS A;  1ITY A;  4CCO A;  4BGD A;  5FKN A;  2GOM A;  2LOO A;  5ILU A;  4QPO A;  1W5T A;  3W2A A;  2R93 J;  5HVQ C;  1J09 A;  3PFY A;  4HDV A;  3J7A Y;  3B73 A;  5J1U A;  3OYA A;  3FWE A;  2A61 A;  4HAM A;  4IX7 A;  4B1R A;  1A04 A;  1TWG J;  3T8R A;  4Z6Y A;  3TGN A;  2ADU A;  4WX9 A;  1ZR4 A;  1FLI A;  3K4K A;  3KYD B;  3RKW A;  2XF5 A;  2QM3 A;  2NOG A;  2VKH A;  4H4K C;  4A0Y A;  4RS8 A;  3JR9 A;  2IA1 A;  4XMY A;  1R6R A;  1YIT I;  1Z3Y A;  2XSJ C;  3BG7 A;  3PIO F;  4P5O A;  3C7J A;  4E7J A;  3WG7 H;  2P4W A;  3HRT A;  4OIQ F;  1X4P A;  2TDX A;  2R7F A;  4ABZ A;  4ENJ A;  4M3D A;  5HLG A;  1HKT A;  4A0X A;  3VYS B;  3E0J B;  3OY9 A;  5FB2 A;  2VB6 A;  1CF7 B;  1J2X A;  5IPA A;  5JHF A;  2Z33 A;  3CMY A;  2YR2 A;  5GTI C;  3K1M A;  4U87 A;  2DFE A;  4IEJ A;  5BMZ A;  4JP0 A;  1O4X A;  2GM4 A;  3E6B A;  1FX7 A;  1XPX A;  5F1J A;  4XLP F;  1XGO A;  2X51 A;  1ZAO A;  2VJ4 A;  1WJD A;  2Q8K A;  1SAX A;  2JA8 J;  3M8E A;  3S1N J;  2LG4 A;  2PMH A;  2DI3 A;  4A5N A;  2XGD A;  1FEX A;  1REP C;  3K1P A;  4XRS A;  3T0Y A;  1I3Q J;  2LMD A;  2AO9 A;  5K5R A;  2N8G A;  2QEX I;  4M9X A;  4A3L J;  2QQB A;  4XOT A;  1IDZ A;  3C2B A;  2DA4 A;  1U78 A;  3K4N A;  1CF7 A;  3HXL A;  1OCZ H;  1KQ8 A;  3BG9 A;  2O61 A;  4XLE A;  1Z7U A;  5LFA A;  3BG6 A;  2EPF A;  5HLH A;  2D2W A;  1S7O A;  2FD5 A;  1R49 A;  4G7H F;  3EQL F;  3O8G A;  1WI3 A;  1W4M A;  2VLA A;  3G1M A;  2EFW A;  4HQM A;  1R4N B;  4CHU A;  4LIU A;  4CDG A;  3ROU A;  4G6Q A;  5HOD A;  4G6D A;  3K6G A;  2R7U A;  3C2G A;  3CP2 A;  1RI7 A;  1QHG A;  2H94 A;  4DBR A;  3MVP A;  4ZYH A;  4AM3 A;  1RR7 A;  2GOX B;  1WVR A;  4KYW A;  3H5N A;  2W48 A;  3E6M A;  1PJR A;  4RGU A;  1BR1 A;  2XAU A;  3RJP A;  4E7H A;  1O7L A;  2J5O A;  1F9N A;  2CO5 A;  5DM7 F;  3BR2 A;  3CCV I;  2WC2 A;  1ZGJ A;  2M4G A;  4XN0 A;  5IT3 A;  4RBO A;  5AIP A;  2IGN A;  1Y1V J;  2FUG 2;  4KNY A;  1YOV B;  2M7A A;  1AKH B;  3DKY A;  2EFQ A;  3GBG A;  4IQ4 A;  3BQY A;  5KCM A;  1JGG A;  2BY3 A;  4U7D A;  1YE9 A;  3F72 A;  4M6X A;  2KZG A;  4DOZ A;  1QRY A;  2MA3 A;  2ESH A;  1DPU A;  3RI4 A;  2DTR A;  2HPI A;  5DTD A;  5M3F J;  2F5D A;  4Y7N J;  3QYB A;  1Q1H A;  3RPU D;  4BHP A;  4BHB A;  4BBR J;  2MAB A;  2PJR B;  2FE3 A;  1G59 A;  3OMY A;  2A69 F;  1LE8 B;  3ZMD A;  2V6C A;  2AXT C;  2LKX A;  3H36 A;  3H0G J;  3LST A;  2CW0 F;  1JJ8 C;  4JK1 X;  1G4D A;  2LKS A;  2D45 A;  2X9D A;  1J5Y A;  3CLO A;  2Y9Z A;  4AID A;  2W84 A;  3ZQI A;  4IJA A;  4S05 A;  1YFH A;  1AKH A;  5IP7 J;  4Q47 A;  3CTA A;  2M34 A;  3ZQL A;  2K27 A;  2ZXJ A;  3S2D J;  2O3F A;  2PJP A;  3W2W A;  4ZDL A;  2PMZ N;  1SC7 A; 
#chains in the Genus database with same CATH homology
 4O6J A;  4ZYG A;  3P9C A;  3NQO A;  3U2R A;  1BIA A;  2DBB A;  2RC4 A;  2QBY A;  2E7W A;  3J7A O;  3QP5 A;  3G73 A;  1IXR C;  4KN4 X;  5LRS A;  3BDD A;  3OV8 A;  5DEQ A;  3M7G A;  5FD5 A;  3S2W A;  4B8X A;  2XAQ A;  2PMU A;  3H3Z A;  3L7W A;  3FMR A;  2FBK A;  5J6X A;  3Q9S A;  4JQF A;  2BYV E;  1R1T A;  1G3T A;  3CO7 C;  5BQT A;  2LF7 A;  1IN4 A;  3R4K A;  4GO1 A;  1R1V A;  4L5I A;  3WU0 A;  5BPI A;  1FBU A;  2Y48 A;  2ZFW A;  2XAJ A;  2JT1 A;  5D5X B;  1KQ9 A;  1IN5 A;  4LK0 F;  3LFK A;  5AON A;  1MGT A;  2X4H A;  5D4S A;  5FLX K;  1LQ1 A;  3L2C A;  2OA4 A;  4KDP A;  4A0Z A;  1LNW A;  4NB5 A;  4WCG A;  3IL2 A;  1WWX A;  1OMI A;  1KYZ A;  2HYF A;  3SXY A;  2XHK A;  1C0W A;  2EV6 A;  1TQP A;  2L3D A;  3WG9 A;  4NQW A;  3F22 A;  4Q5S F;  3F3X A;  3N97 A;  2VC1 A;  4HA8 A;  1O3R A;  4EM0 B;  2OQR A;  2ZCW A;  1Z6T A;  4U0W A;  4I0B A;  1I5Z A;  2QEN A;  5E20 A;  4LB6 B;  5CVJ A;  1SFE A;  4K2E A;  3FHZ A;  3WE3 A;  4ENK A;  4AD9 A;  3ZMZ A;  2ACJ A;  2HQN A;  4EVI A;  1XSX A;  1W7P A;  1SFU A;  4EGY A;  2AS5 F;  2NYX A;  2PBI A;  1V3F A;  2MC3 A;  1ZHF A;  1AWC A;  3GUD A;  1ZLJ A;  3K69 A;  2HEO A;  2GXG A;  3JTG A;  2YU3 A;  4MQV A;  3IWZ A;  5BPD A;  2K4B A;  5JFR A;  3U9G A;  2Z5U A;  1FZP B;  2LDU A;  3TOB A;  3BPV A;  1UB9 A;  2OZ6 A;  3JW4 A;  2W25 A;  5LGT A;  2KKO A;  4AIJ A;  4MEX F;  2GXB A;  1PP8 F;  3ML6 A;  4EJV A;  2HFH A;  1XCV A;  4B09 A;  2IT0 A;  1Y0U A;  4M73 A;  4Q4Z F;  1Z1D A;  1HSJ A;  3DV8 A;  4BHC A;  3JAM Z;  1FPQ A;  2XIG A;  2COM A;  2XKO A;  3WGI A;  4I09 A;  2IPQ X;  2WV0 A;  3KZY A;  4IXA A;  3EDP A;  3GXO A;  4YFN F;  4PDK A;  3WTS C;  4EQQ A;  3ZMS A;  2GWR A;  5LLQ A;  2FMY A;  1YYV A;  3HSR A;  2LSO A;  3K1N A;  3KLO A;  3GEZ A;  1DDN A;  2L02 A;  2JTV A;  3QP6 A;  2HTS A;  4U0Y A;  5AIQ A;  2H09 A;  1ZRF A;  2DLL A;  2MLK A;  5LGU A;  2ZNZ A;  3F6V A;  2ETH A;  2DK5 A;  4ZZD A;  4KIC A;  1J7K A;  3FXQ A;  1ZAR A;  3QPH A;  2VBZ A;  3LQQ A;  2V9V A;  5F64 A;  2PI0 A;  4CGZ A;  1EV7 A;  1IAW A;  2HDC A;  3G3Z A;  2F5F A;  4HX4 A;  1H9T A;  4I01 A;  4UVC A;  2HZT A;  2HGC A;  2XUB A;  3KEQ A;  3ZQ7 A;  1PP7 U;  2DO7 A;  4KA4 A;  2CFX A;  3FM3 A;  4M9S A;  2NNN A;  4A2U A;  3F23 A;  1X3U A;  1ZLK A;  3W6J B;  4LB5 A;  4KN7 X;  3ZMV A;  2DAO A;  3VEP A;  4UV8 A;  1LVA A;  3B02 A;  1HW1 A;  4DQ2 A;  1MJA A;  4NHJ A;  2GZW A;  1ON2 A;  3H92 A;  2FSW A;  2FBH A;  2IVM A;  2PQ8 A;  4HX7 A;  5FD6 A;  3V7R A;  5HS8 A;  2VT2 A;  3E6D A;  4JBA A;  1KU7 A;  3ULQ B;  1TW3 A;  3F6O A;  4PCQ A;  2A5Y B;  3KZZ A;  5CVR A;  4EV0 A;  5BS6 A;  3GFL A;  1O7F A;  1P4A A;  3KCC A;  5DCF A;  1F4K A;  3M9A A;  1H0M A;  1U5T C;  4UUV A;  4IRG A;  1UFM A;  4ZZL A;  4ESF A;  2ZBK A;  4N9I A;  3DKW A;  3WTX C;  4LLG F;  4EJO A;  2IRF G;  2A6E F;  5H6R A;  1O3Q A;  1IZ1 A;  1R58 A;  1MD0 A;  4U88 A;  1SD6 A;  2MLG A;  1LB2 A;  4FT8 A;  1P92 A;  3FXR A;  5DD8 A;  3BJO A;  4WF2 A;  4GYI A;  4DNC A;  5D6E A;  3GLX A;  3TKY A;  3QU3 A;  3GX4 X;  2M8E A;  1JHF A;  4BXU A;  1T38 A;  1TTY A;  2LNB A;  2PFB A;  3CUO A;  4HF2 A;  2VBX A;  3FF5 A;  2UXN A;  3V7S A;  3E5X A;  4GCV A;  2Y0M A;  4EM1 A;  4L9V A;  1U3E M;  5FFX A;  4LD5 A;  3TO7 A;  1HKS A;  3HIF A;  2FOK A;  3W6K B;  3BJA A;  4RGR A;  3M8F A;  3KFW X;  3KET A;  2VBW A;  3I4P A;  2HKO A;  1XGM A;  3I58 A;  2BEO A;  4EGZ A;  1D8J A;  2YX7 A;  4OMY A;  2XRO A;  4Y13 A;  4HX8 A;  2KJB A;  2O0Y A;  2E1C A;  3GFJ A;  2FNA A;  2VN2 A;  3SQN A;  4MEY F;  3BPX A;  2Z3Y A;  2L01 A;  2OQG A;  3E97 A;  4XBF A;  3KP5 A;  1K7A A;  2FNP A;  3DF8 A;  4UXN A;  1UHM A;  2P5V A;  3ZPL A;  1VTN C;  2OAZ A;  3RKX A;  1IN6 A;  2BV6 A;  5TRD A;  4EJU A;  4P9U A;  2D1V A;  2HKX A;  5HDN A;  3KEO A;  3Q9V A;  4OMZ A;  1U5T B;  2P8T A;  4I98 B;  1S29 A;  5DD4 A;  4LG0 B;  4U7B A;  3U1D A;  1J9I A;  2M5W A;  1F1Z A;  1BI0 A;  4MTE A;  1CGP A;  4G94 A;  4YFK F;  1V4R A;  1I27 A;  2C6Y A;  2W85 A;  1BIB A;  4H0E A;  4LJZ F;  5F1R A;  1T6S A;  3H3U A;  1DPR A;  1U5T A;  3GO5 A;  4RB0 A;  3P7N A;  3HSF A;  2R3S A;  1O57 A;  2GIV A;  4ETS A;  2W24 A;  4LG0 A;  3FMS A;  2QQ9 A;  5EEG A;  1DUX C;  3BP8 A;  2EB7 A;  3HYI A;  3L09 A;  4EMS A;  1BI3 A;  2K02 A;  5ERI A;  2MH2 A;  1D5V A;  2O03 A;  1D8K A;  1MJ9 A;  5CVV A;  4I02 A;  4EJT A;  4HQE A;  5HS7 A;  1KQ0 A;  4RAY A;  2IW5 A;  3RPQ A;  4A12 A;  1FOK A;  1FYM A;  5LBQ A;  4BNC A;  4MQ9 F;  1TQI A;  4WXD A;  3CUQ C;  2QBY B;  3ERE D;  5LEJ A;  3J80 K;  5L3F A;  1QZY A;  5ICF A;  5HDK A;  2BBY A;  5K5O A;  2FBI A;  2DQL A;  2CG4 A;  4PZJ A;  5ILV A;  2Q2E A;  3GZ5 A;  2K86 A;  5ICG A;  3LA3 A;  4RB1 A;  5CJ9 A;  2W57 A;  4IHS A;  2PEX A;  2EFP A;  3QAH A;  2AXL A;  3PQJ A;  3WTY C;  2PLY A;  1KA8 A;  1IXC A;  1LEA A;  1BOA A;  2P5L C;  1S8N A;  4A6D A;  3M1E A;  5IT9 K;  1BI2 A;  1Z05 A;  2Y75 A;  2H6C A;  3ZMU A;  3MAJ A;  1TNS A;  5D5V B;  1FSE A;  3DPT A;  3F21 A;  1FP2 A;  3I0T A;  1Z6R A;  5LHG A;  5ICE A;  4UV9 A;  4YIF A;  2IA2 A;  3FXU A;  1I6X A;  1OPC A;  4AWX B;  2QVO A;  4OIN F;  4ESJ A;  5KVR A;  3C3W A;  4L0Z B;  4M6Y A;  5CLS A;  2P7V B;  1IW7 F;  1GVJ A;  4A6E A;  1B1B A;  3F8F A;  2EFO A;  1W7P B;  5E17 F;  2HYG D;  5KK1 A;  1YO5 C;  1LJ9 A;  1H9G A;  2XRN A;  2F2E A;  4GYG A;  1FNN A;  1BC7 C;  4ESB A;  2YPR A;  4UVA A;  3SHF A;  4MGR A;  4FHT A;  3WTW C;  2FA5 A;  4Q48 A;  1KU3 A;  1SMY F;  5ICC A;  3HRU A;  4EJW A;  3V8K A;  3I71 A;  3L00 A;  4IF4 A;  1TBX A;  3I5U A;  2GA2 A;  1W5S A;  3J81 K;  2EK5 A;  2B0L A;  3VOD A;  2DT5 A;  3CUQ B;  2RN7 A;  1QPM A;  5ED4 A;  3HSE A;  3COA C;  1WKM A;  3BY6 A;  4HF1 A;  5ILS A;  1R5H A;  3KP7 A;  3T5X A;  2CYY A;  1QO0 D;  5DV5 A;  2KIM A;  4HDU A;  1FWZ A;  5E8G A;  3CUQ A;  1YQA A;  1KGS A;  2LKP A;  1RUO A;  4RAZ A;  2X0L A;  1I1S A;  5LGN A;  1MKM A;  4LMY A;  3HHG A;  2DPD A;  1IRF A;  2Q0O A;  3L9F A;  3NRV A;  4KFC A;  3QOP A;  3JSO A;  4L18 B;  2JSC A;  2RDP A;  1Z9C A;  4N9H A;  5JVT A;  5L3G A;  2PG4 A;  1IF1 A;  3RKY A;  1U8R A;  2FQ3 A;  5FLX Z;  1YW8 A;  4IVN A;  2M1B A;  2G7H A;  3R61 A;  1OR7 A;  1BC8 C;  3GFM A;  3NEU A;  4LLN A;  3VB2 A;  1PDN C;  1OKR A;  1B9N A;  1LDK B;  2A3S A;  1KU2 A;  2BE5 F;  3ISP A;  3JSP A;  1ULY A;  1ONV A;  2Z99 A;  2FEZ A;  1G3W A;  1JHH A;  2A6H F;  3ABT A;  2YX4 A;  3CDH A;  2VOD A;  3DPL C;  3PQK A;  3Q5F A;  2R7D A;  5A2Q K;  2ELH A;  1EH8 A;  4KIB A;  2JPB A;  3DQV C;  1ON1 A;  3BJ6 A;  2D1H A;  2K7L A;  3LAP A;  3WU1 B;  1I1G A;  1O3T A;  3IC7 A;  3C1D A;  3FMQ A;  1GHC A;  3RTR A;  1HKQ A;  4IRI A;  4LGW A;  1XDU A;  3DEU A;  4TV7 A;  1IN7 A;  1XMA A;  4L5J A;  1HBX G;  3TOA A;  1LEB A;  2HOE A;  2G7U A;  1B6A A;  4HW0 A;  1SD4 A;  1G3S A;  3R60 A;  4UHT A;  1YG2 A;  5L3E A;  3O3K A;  2F5C A;  2P6S A;  4P96 A;  3KP2 A;  3JTH A;  4XLN F;  2WWY A;  3DP7 A;  1ZG3 A;  3I54 A;  2PN6 A;  2H27 A;  3MFK A;  5DDG A;  3E6C C;  2EV0 A;  1XCB A;  2A68 F;  2KRF A;  4ZYE A;  3WE2 A;  2XKP A;  3LA7 A;  1ZGA A;  1T2K A;  4CYD A;  1BN5 A;  1L3L A;  3E5U A;  3ZN0 A;  5FGM A;  2VXZ A;  1G6N A;  1QNT A;  2RKH A;  3FZV A;  5D8K B;  2J5P A;  3LAJ A;  1QZZ A;  2MBF A;  4I0A A;  4KUM A;  2OBP A;  1RZ4 A;  3GYH X;  2VOP A;  5J8F A;  1U2W A;  2IJL A;  3CJN A;  3F8M A;  1XB4 A;  1NHA A;  4LK1 F;  3N4M A;  1BI1 A;  4IPA A;  3I53 A;  3C18 A;  3RDI A;  4YII A;  4MNU A;  5D5W B;  4LFU A;  1PUE E;  4HV6 A;  3VOE A;  5D5U B;  4RB3 C;  2YSR A;  1HQC A;  1BM9 A;  2V1D A;  3K9T A;  1TQM A;  5D4R A;  2KIF A;  4P9F A;  3ECH A;  1P4W A;  2RV8 A;  4HZF A;  2VBY A;  3HOT A;  1FP1 D;  4OIR F;  1YS7 A;  1BJA A;  3O2P E;  5L3C A;  1BBY A;  3KE2 A;  3O6B B;  1XGN A;  2P6T A;  3SFZ A;  2Z9O A;  4G7O F;  2QQA A;  2ISZ A;  1XSD A;  1HW5 A;  2IA0 A;  2V79 A;  2RGV A;  4XRF A;  2CWE A;  2GA1 A;  1YW9 A;  3FM5 A;  2M87 A;  4U0V A;  3ZMT A;  5K1Y A;  2FRH A;  2WTE A;  1IRG A;  5E8I A;  2CGP A;  4GXO A;  3GWZ A;  1XN7 A;  2DW4 A;  3WTZ A;  2QUF A;  4G8X A;  6PAX A;  4QLC U;  3MWM A;  2L4A A;  2CSO A;  2HWV A;  3TO6 A;  1G3Y A;  2V1U A;  3ELK A;  5D6F A;  5JI6 A;  4ON0 A;  3HUG A;  1GXP A;  3R0A A;  4UVB A;  2HQR A;  3IHU A;  4QWQ A;  2QYO A;  4AVP A;  3RYP A;  5K5Q A;  4F7Z A;  1TNT A;  4G7Z F;  1STZ A;  2LF8 A;  3E5Q A;  1FBQ A;  3I64 A;  5CYV A;  3TDU C;  1XD7 A;  1EH6 A;  1R5G A;  4BYY A;  5E1X A;  2E7X A;  4Z2Y A;  3BRO A;  3RPU A;  2M45 A;  1ZG5 A;  2IP2 A;  4R1H A;  4OU0 A;  3V4G A;  5CVU A;  2NS0 A;  5BOX A;  1J75 A;  3BZ6 A;  3EET A;  5DCM B;  3KP4 A;  2EA4 A;  3BOQ A;  2JZY A;  3SZP A;  3P9I A;  4RB2 C;  1B59 A;  4M74 A;  4YG2 F;  1OYI A;  1B9M A;  4G9Y A;  2FU4 A;  2DFI A;  4M71 A;  2FXA A;  3EYY A;  3HRM A;  4AIK A;  3FX3 A;  1S6L A;  3ABU A;  3WTU C;  2EJR A;  4KIG A;  1R23 A;  2HS5 A;  1IUY A;  3HTU A;  5DCM A;  1WRJ A;  1E17 A;  1QGP A;  2JRT A;  3HTS B;  4CXF A;  2FML A;  5DUI A;  5JR3 A;  3MCZ A;  4WK8 F;  3D0S A;  2DK8 A;  4Y17 A;  2EV5 A;  1OYY A;  3HHH A;  3F8B A;  4Y15 A;  1TLH B;  5EEH A;  1XSV A;  3F8C A;  4GGG A;  3R6S A;  3K0L A;  3I59 B;  3P9K A;  1ZYR F;  3E3V A;  2VC0 A;  1R7J A;  3T1B A;  5LEK A;  4WWC A;  1R00 A;  2EWN A;  5JHU A;  3LQR A;  2MH9 A;  4RGS A;  3JAM K;  4CO8 A;  3ZN1 A;  4KMU X;  2L4M A;  3IKV A;  3TO9 A;  3D5L A;  3K2Z A;  4HOB A;  2QWW A;  1D3Y A;  1RUN A;  1RNL A;  4ZYD A;  3I59 A;  3GW2 A;  1U6G A;  3R0J A;  3QU6 A;  1WQ2 A;  1ZRE A;  5H20 A;  3DXJ F;  5L3D A;  2XAH A;  3IRR A;  4KMF A;  1OYW A;  5HDG A;  4KT5 C;  3REO A;  1K6O A;  4E70 A;  4BQA A;  1IXS B;  2XVC A;  2ZME B;  3V8L A;  4ENN A;  1R36 A;  2XAG A;  3WGG A;  1FC3 A;  1QQI A;  2UWM A;  3J80 Z;  2F5E A;  2ZNY A;  5D8L B;  3QRF F;  3V8J A;  4KIF A;  2EA2 A;  3IRQ A;  5F6F A;  1FT9 A;  2ESN A;  1W7P D;  3F8N A;  2ZME A;  2P5K A;  3LWF A;  4HLY A;  2NRA C;  4RGX A;  4R8H A;  2ZKZ A;  1K78 B;  1F5T A;  1FYL A;  2VOO A;  3MZH A;  1SFX A;  1JE8 A;  2STT A;  2GQQ A;  4HLX A;  1QBJ A;  4IHT A;  1T39 A;  5L3B A;  4I2O A;  2VE9 A;  3KP6 A;  3GFI A;  5IT9 Z;  2E1N A;  5HOO A;  3TQN A;  2DU9 A;  5H6Q A;  2A07 F;  4AIH A;  1K78 A;  4WXC A;  3DFG A;  2O8X A;  4OIO F;  4I7H A;  2UZK A;  2GAU A;  4L9T A;  4ENM A;  1LDD A;  5LRR A;  5LHH A;  1K79 A;  1ODD A;  3ZP5 A;  1B4A A;  4R79 A;  4LLL A;  2OD5 A;  1UCR A;  4PGH A;  4D0P A;  2QLZ A;  1J0R A;  4O5V A;  1IN8 A;  5DYM A;  1EH7 A;  4HF0 A;  2XGX A;  3WTT C;  2XAS A;  4OIP F;  1TW2 A;  1HW2 A;  2VE8 A;  1S3J A;  3CO6 C;  1FYK A;  1WSU A;  2RQP A;  1UHW A;  2VON A;  5HLI A;  2STW A;  2MD5 A;  4BH9 A;  2M30 A;  3LA2 A;  3MQ0 A;  2ISY A;  1JXS A;  2JPC A;  4HV5 A;  2P7C B;  2NNY A;  3J81 Z;  2G9W A;  5CVI A;  2ZJ2 A;  4M9Z A;  3WGH A;  1E2X A;  1HST A;  2QZ8 A;  2RNJ A;  1ZRC A;  4ZH4 F;  3HOS A;  1ZRD A;  4YFX F;  1P2F A;  4CZZ A;  5FFZ A;  5E1W A;  4S04 A;  4P55 A;  2XAF A;  3TDZ C;  3IWF A;  1SD7 A;  1JGS A;  2OZU A;  3MZY A;  1SD5 A;  2NAZ A;  4MHG A;  1AOY A;  1KYW A;  5FO5 A;  1KU9 A;  2FF4 A;  3V7C A;  1XGS A;  3GVA A;  2CQK A;  1S7A A;  3SZT A;  5LHI A;  2ZO4 A;  1FBS A;  1MJB A;  2H6B A;  2KJC A;  4MTD A;  3KP3 A;  1R1U A;  4IRH A;  1J59 A;  3MEX A;  1HXD A;  3KLN A;  4CIC A;  5TJJ A;  5HS9 A;  2DQR A;  4WXH A;  2V1X A;  3WTV C;  1T0F A;  1USS A;  3RIR A;  1GXQ A;  2DPU A;  1SMT A;  2L54 A;  4N0B A;  4BAY A;  4UNO A;  5E1Z B;  5E18 F;  3GZ6 A;  1YS6 A;  4O3M A;  2BGC A;  2VT3 A;  2OU2 A;  3T8T A;  5J8C A;  1UST A;  4FX4 A;  1FSH A;  1FY7 A;  1MZB A;  2XV4 S;  1T98 A;  4PGG A;  1RIO H;  1P4X A;  1Z91 A;  1YLF A;  1R22 A;  3EYI A;  1MDM B;  1DP7 P;  1LDJ A;  3RYR A;  2K4J A;  5A2Q Z;  1XDS A;  2RVC A;  1YIO A;  4XSZ F;  1WI9 A;  1ZN2 A;  4XSX F;  1XMK A;  4FX0 A;  4HYE A;  3OOP A;  4HBL A;  4L9N A;  2UXX A;  3AAF A;  2HTJ A;  4OOI A;  4L9J A;  3ECO A;  3BWG A;  4L0Y B;  3PFI A;  3IKT A;  1MDM A;  1O3S A;  1ZH5 A;  1P6R A;  4EM2 A;  2KIU A;  5DUK A;  2HR3 A;  4ASN A;  3EUH A;  3VFZ A;  3WOD F;  2O6G E;  2EFN A;  4A5M A;  1YTY A;  4M72 A;  3QPT A;  1ZG1 A;  1YW7 A;  1L0O C;  3GF2 A;  3HRS A;  5ILU A;  1W5T A;  5HVQ C;  4HDV A;  3B73 A;  3FWE A;  2A61 A;  4HAM A;  1A04 A;  3T8R A;  3TGN A;  2ADU A;  4WX9 A;  1FLI A;  3RKW A;  2QM3 A;  4A0Y A;  4RS8 A;  2IA1 A;  4P5O A;  3C7J A;  2P4W A;  3HRT A;  4OIQ F;  2TDX A;  2R7F A;  4ENJ A;  5HLG A;  1HKT A;  4A0X A;  5FB2 A;  1CF7 B;  1J2X A;  2Z33 A;  2YR2 A;  3K1M A;  5BMZ A;  3E6B A;  1FX7 A;  4XLP F;  1XGO A;  1ZAO A;  2Q8K A;  1SAX A;  3M8E A;  2PMH A;  2DI3 A;  4A5N A;  1REP C;  3K1P A;  3T0Y A;  5K5R A;  4M9X A;  2QQB A;  1U78 A;  1CF7 A;  1KQ8 A;  2O61 A;  1Z7U A;  5HLH A;  2D2W A;  1S7O A;  4G7H F;  3EQL F;  1W4M A;  2EFW A;  4HQM A;  4CHU A;  4CDG A;  3ROU A;  4G6Q A;  4G6D A;  1RI7 A;  2H94 A;  4ZYH A;  4KYW A;  3E6M A;  4RGU A;  3RJP A;  1O7L A;  2J5O A;  1F9N A;  2CO5 A;  2WC2 A;  1ZGJ A;  5IT3 A;  5AIP A;  4KNY A;  2EFQ A;  4U7D A;  3F72 A;  4M6X A;  2MA3 A;  2ESH A;  1DPU A;  3RI4 A;  2DTR A;  2F5D A;  1Q1H A;  4BHP A;  4BHB A;  2FE3 A;  2A69 F;  3ZMD A;  2V6C A;  3LST A;  2CW0 F;  1G4D A;  4JK1 X;  2D45 A;  1J5Y A;  3CLO A;  2W84 A;  4IJA A;  4S05 A;  1YFH A;  4Q47 A;  3CTA A;  2K27 A;  2ZXJ A;  2O3F A;  2PJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...