1V3FA

Solution structure of the dep domain of mouse pleckstrin2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
120
structure length
120
Chain Sequence
GSSGSSGLHRIVDKMHDTSTGIRPSPNMEQGSTYKKTFLGSSLVDWLISSNFAASRLEAVTLASMLMEENFLRPVGVRSMGAIRSGDLAEQFLDDSTALYTFAESYKKKVSSKESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pleckstrin 2
publication title Solution structure of the DEP domain of mouse pleckstrin2
rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 18
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2003-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00610 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1v3fA00
1R22A 1XMAA 2RN7A 1YYVA 2PN6A 3F3XA 1J2XA 3GLXA 3R0AA 5HS8A 1KU2A 4WF2A 5LGNA 2E1NA 2O6GE 3E97A 4RB3C 4ESBA 2Y0MA 4A6DA 3HSFA 4M73A 2R7FA 1XGSA 2KRFA 2GQQA 2IP2A 1BI0A 3IWZA 2HKOA 4XRFA 3KP6A 3DF8A 2HGCA 5ICFA 1HW2A 1B9NA 2KIFA 4RS8A 5ICCA 4HV5A 1FSHA 3E6MA 1K7AA 4GGGA 1R1TA 4MGRA 4E70A 2EK5A 5KVRA 3CUQA 3N4MA 1IF1A 4HDUA 2QQ9A 5CVVA 3FHZA 2HYFA 1O3SA 2A6EF 3W6KB 4Q4ZF 1U6GA 4EV0A 4A2UA 3J7AO 4F7ZA 4AIJA 2LKPA 4IXAA 2WC2A 2C6YA 5E18F 1R36A 5D8LB 4XLNF 3E6DA 5D6EA 5BPIA 5D4RA 2LF7A 3HHGA 4NHJA 3B02A 1IN5A 1EH8A 2OQRA 2PBIA 3ZQ7A 1D5VA 2PJPA 4IHTA 1ZH5A 5TRDA 2EV0A 3GXOA 1UHMA 4ASNA 2B0LA 4ENJA 2XKPA 2QLZA 5E17F 1R58A 2IW5A 4Q5SF 5CVRA 3NRVA 1JE8A 4HYEA 2QZ8A 4TV7A 3GZ6A 1NHAA 4KNYA 4ETSA 3PQKA 3F21A 4EGZA 3HRTA 1HSTA 1TNSA 4ENMA 1B9MA 3KLOA 3IKTA 2EFNA 1B59A 5L3DA 3WTWC 4IVNA 5F64A 2HS5A 4M9SA 4MEXF 2MD5A 2H27A 3TDZC 2H6CA 2F5FA 2LNBA 3F8CA 1L0OC 3WTVC 5LHHA 2EV5A 1W5TA 6PAXA 2M45A 1KU3A 2M5WA 4ESFA 4WK8F 3HRUA 3KETA 3ML6A 2BBYA 2XAJA 3WU1B 3P9IA 2K27A 1QBJA 3QPTA 1LQ1A 3F6VA 5K5QA 2QUFA 5LBQA 3EYIA 3LA2A 2HDCA 3M8EA 4GXOA 4UVCA 4LB5A 4S05A 3VFZA 2ESNA 2GIVA 1T39A 3MZYA 1H9TA 2JPBA 2W25A 4OMYA 4FHTA 1ZG1A 3J81Z 4G8XA 2FSWA 1YFHA 5FFXA 1ZARA 4A0ZA 3FX3A 3RKYA 2KJBA 3K1MA 5HLIA 2UWMA 3FMSA 2V1UA 3PFIA 3GVAA 3RJPA 3E5QA 4KIFA 1SFUA 1AWCA 3IWFA 1YO5C 4G7HF 4RB2C 1TBXA 1XMKA 1XD7A 3KP4A 1QGPA 4YFKF 2EFWA 3J80K 2FQ3A 2Z9OA 2VOPA 4Y13A 2DK5A 1IN7A 1SMTA 2O3FA 2Z5UA 5E20A 4I01A 3WE3A 1JHFA 2UXNA 3K2ZA 1J0RA 4A12A 2DQLA 2P4WA 2HWVA 1KQ0A 2NNYA 2X0LA 3ROUA 4BH9A 2E7WA 1WRJA 2A6HF 4RB0A 3KCCA 1XSDA 4M71A 1O3TA 1YW8A 4BYYA 1IW7F 3JSOA 2L4AA 4R1HA 4G7ZF 1TW3A 1FWZA 2CG4A 3BPVA 2VODA 2A68F 2P5LC 2F2EA 2DK8A 2L3DA 1FT9A 3U9GA 3BY6A 2Z33A 1IXSB 4ZZLA 1I5ZA 1JXSA 1RZ4A 2ZXJA 1SAXA 2D45A 3ZN0A 2QQAA 4KIGA 1ZRFA 5CVIA 1FC3A 1MJ9A 2P6SA 4KA4A 5CYVA 3V7CA 2NRAC 1ON1A 1YQAA 3G73A 1ZYRF 3EQLF 1LDJA 4WCGA 2K4JA 3J80Z 3HTSB 2GZWA 2FRHA 4LJZF 2KJCA 4LLLA 2EFPA 3WU0A 2ZCWA 3E5UA 1V4RA 1ONVA 1KA8A 1ZGAA 2O61A 3QAHA 1O57A 3TKYA 4KIBA 4XBFA 1U78A 2XV4S 3L00A 4BAYA 1BC7C 1Q1HA 1FBUA 2CSOA 2UZKA 4H0EA 2BEOA 3NQOA 4I7HA 1DP7P 3JAMK 3K69A 1XDUA 3SQNA 2FF4A 4BXUA 3KEOA 2KIMA 3CO7C 1W4MA 2V1XA 3QRFF 4L5JA 3BOQA 1ZLKA 3T1BA 1SMYF 3TOBA 3CUOA 4G94A 5HDNA 4EMSA 3DPLC 1O3QA 2FE3A 2PQ8A 2FU4A 1OR7A 3JTHA 2Y48A 4L0YB 1ZG3A 2YSRA 4AVPA 4YG2F 1RNLA 3E3VA 5HDKA 1JGSA 2LF8A 2ZFWA 4FX4A 4DQ2A 1BM9A 5BQTA 3EYYA 1BI3A 1U8RA 2XIGA 5LRSA 5D8KB 1XCVA 2V1DA 4ESJA 4HW0A 5BOXA 4L9VA 1BIBA 5DUIA 3JW4A 3P9KA 1S3JA 3VEPA 3I54A 1IN8A 3ZMUA 1DUXC 1USSA 4MTDA 4EM2A 3I53A 2XAQA 5LHIA 2HR3A 5LHGA 3QOPA 1U5TB 2MLGA 4HBLA 4CXFA 3Q9SA 3QU6A 2V79A 5H20A 1LEBA 1FBSA 3F6OA 3I5UA 4BNCA 3GYHX 3OV8A 3F22A 3K9TA 3DP7A 4OIRF 4IJAA 1E2XA 1TNTA 4UNOA 3ZN1A 1WKMA 2JRTA 1XGMA 3QPHA 4KDPA 1WWXA 4RGSA 2A3SA 4L9JA 3L2CA 1V3FA 5E1XA 3BPXA 1SFXA 4U0YA 2VT2A 3V8LA 1IXCA 2DO7A 3JTGA 2W85A 2JTVA 3FWEA 2BE5F 1H0MA 3RDIA 5E8GA 1J59A 4I0AA 5HLGA 5LEJA 1J5YA 4MNUA 4EJTA 3M7GA 5ED4A 2CGPA 4R8HA 4BQAA 1F9NA 3KLNA 2XAFA 2ZNYA 4KN4X 4CO8A 2ZO4A 4ZYEA 2NAZA 3OOPA 2DBBA 1ZGJA 1S29A 2XUBA 1TQMA 4RGUA 5HS9A 1D8JA 4AWXB 2YU3A 3IKVA 3BP8A 2STTA 1OYWA 3ZPLA 2EWNA 3BWGA 1B1BA 4UV8A 3HHHA 3FXRA 4G6QA 1Z05A 3GUDA 5DV5A 1W7PB 2VXZA 3DFGA 2J5PA 5JFRA 1K79A 5CVUA 3F8BA 2BV6A 2DLLA 4JK1X 4RGXA 3FMQA 5HVQC 3L9FA 1QO0D 5KK1A 3TOAA 5K1YA 2VOOA 5D6FA 5H6RA 3FM5A 3KFWX 4YIFA 2GAUA 2E7XA 5DD8A 1R1UA 2RGVA 4L0ZB 3DKWA 1CGPA 2RNJA 3ZP5A 1U5TA 2A69F 4JBAA 5EEHA 1FNNA 5HOOA 3T5XA 2NNNA 2GA1A 1QPMA 3J81K 3K0LA 1YS6A 1G3YA 3HUGA 4CDGA 1P4WA 2R7DA 5L3GA 2FMLA 4O5VA 1ZN2A 5BS6A 5JR3A 4EJOA 3SZTA 1TW2A 3CJNA 1FPQA 2R3SA 1J75A 5BPDA 2WWYA 3GFJA 1P4XA 4HA8A 2A61A 2L4MA 4YFNF 5DYMA 5AIQA 4U7BA 2P5VA 1OKRA 3GO5A 1OPCA 2VC0A 4M72A 2K86A 3FM3A 2X4HA 3EUHA 1T2KA 2VBZA 2A07F 3WGGA 2L01A 1MZBA 5HDGA 3MQ0A 2OZUA 2DU9A 5E1WA 1S8NA 3L7WA 3U1DA 1TQPA 4HLYA 3GEZA 5FFZA 5AONA 1P2FA 4Q48A 3DV8A 1SD5A 5IT9Z 1EH7A 1W7PA 4A5NA 3ULQB 2DFIA 1P4AA 3ABTA 1W7PD 4B8XA 2OQGA 4I2OA 2K7LA 3CUQC 1EV7A 5ICEA 4IF4A 2EA4A 1FYKA 4EJWA 1F4KA 4RAYA 5D5VB 1TLHB 4KMFA 4I09A 3RYRA 4HLXA 1F5TA 1FX7A 1R5HA 2XAGA 3LFKA 4AIHA 4HF1A 2KKOA 2Q2EA 2RDPA 3ZMTA 4XLPF 4ZZDA 1IN6A 5AIPA 3SFZA 5ILVA 3E5XA 1T98A 2P7CB 2QENA 2Y75A 5K5OA 1O7FA 3IRRA 3JSPA 1TTYA 5J8FA 2IT0A 4U0WA 3CLOA 1YW9A 4OU0A 4RAZA 2CWEA 2ELHA 1AOYA 1P6RA 3C1DA 4UVBA 1FYMA 2D1VA 5FB2A 5LRRA 5CJ9A 5J6XA 5LLQA 2CO5A 4Q47A 4P55A 1IN4A 3F8FA 5L3EA 1KQ8A 4N9HA 3D5LA 2ETHA 2VE9A 4HX7A 3ZMVA 5J8CA 1XGOA 1S6LA 4HDVA 4KFCA 2FBIA 1OYIA 3V7SA 2DAOA 4A6EA 4CYDA 3FXQA 2HKXA 3WTXC 3PQJA 1IRGA 4ZH4F 5K5RA 2ISZA 2ZKZA 2XGXA 4ZYDA 4ON0A 4GYIA 1HW1A 1YIOA 4LK0F 3O6BB 4UV9A 3RKWA 1KYZA 4M74A 2IVMA 2GA2A 4YFXF 3HRSA 3R60A 1PP8F 3ISPA 2FXAA 4DNCA 1ULYA 1FLIA 3WTTC 2XKOA 4AD9A 2CW0F 4P96A 1STZA 3M1EA 4QLCU 4PGHA 4OINF 5E8IA 2WTEA 3KZZA 4HX8A 2XROA 1XN7A 1JHHA 1BBYA 5D5UB 2STWA 1Z7UA 2ZBKA 2OZ6A 3RYPA 1X3UA 4G6DA 1QZYA 1OMIA 2PI0A 1R00A 3WGIA 2DPUA 3TQNA 4L5IA 2K4BA 1LEAA 5LGTA 2BGCA 3HTUA 2VE8A 2NS0A 3DEUA 2RC4A 2Z3YA 2EA2A 4G7OF 3H92A 2M8EA 2DQRA 3MEXA 3BJ6A 1G4DA 4A5MA 2HYGD 2J5OA 4WXDA 3CO6C 1J9IA 4RB1A 3GZ5A 4MTEA 4HF2A 4HF0A 5DEQA 5H6QA 4KT5C 3SHFA 1LJ9A 2F5DA 2EB7A 2FNAA 1QQIA 2M1BA 4HZFA 2EJRA 4ENKA 1F1ZA 4OOIA 3ABUA 1UHWA 3WTZA 2IA0A 2OAZA 4XSZF 3VB2A 2HQRA 2W24A 3COAC 1UCRA 3WGHA 1ZHFA 4JQFA 1DDNA 3I58A 1FBQA 3I59B 1G3WA 2P8TA 4L9NA 4M9ZA 1BI1A 3REOA 2K02A 3ZMSA 4HV6A 2DT5A 3DPTA 4ZYHA 1O7LA 4M9XA 3M9AA 3R4KA 2HQNA 2M87A 3V8JA 4IHSA 1MGTA 1I1GA 3I0TA 3T8TA 1U3EM 3F23A 2FA5A 4OMZA 2COMA 4CICA 2QM3A 3HOTA 4CZZA 1W5SA 2D2WA 3QP5A 1A04A 3CTAA 1KGSA 1ON2A 3KP3A 2H6BA 2VBWA 3L09A 1GXQA 2M30A 3RPQA 3Q9VA 3C3WA 3LA3A 3I71A 3WTUC 2DW4A 5E1ZB 2L54A 1K78B 2FNPA 4MHGA 4Z2YA 4MQVA 1FOKA 5LGUA 2LSOA 2YPRA 3LWFA 1XGNA 4KUMA 5ICGA 4U88A 3GF2A 4P9UA 1IUYA 4YIIA 1QNTA 4L9TA 4PCQA 1BC8C 3LA7A 4OIPF 1Y0UA 3IHUA 4WXCA 2FMYA 1MDMB 1B4AA 3I64A 5FD5A 4GYGA 4LG0B 5JHUA 2O03A 2YX7A 3BROA 2CYYA 3QP6A 5F1RA 2V6CA 4LD5A 2JPCA 2H09A 4P5OA 1BI2A 2QQBA 2OBPA 3MWMA 2FEZA 4I98B 1USTA 1IRFA 2MH9A 5D5XB 4HQMA 2QYOA 1FYLA 3GFIA 4FX0A 3V4GA 3I4PA 1Z6RA 2XHKA 5CVJA 1I1SA 1BN5A 3I59A 4NQWA 3KEQA 1SD4A 2O8XA 2RVCA 2JT1A 4WWCA 4UXNA 4GO1A 1BJAA 3GFLA 3W6JB 1MJBA 1E17A 1PP7U 2HFHA 2IPQX 3FZVA 3GWZA 4P9FA 2P6TA 4XSXF 3O2PE 3RTRA 2QWWA 5DCMB 5JI6A 2DI3A 5IT9K 2ZMEB 1T38A 3FF5A 1CF7B 3F72A 4EJUA 4KICA 4N9IA 4BHPA 5FLXK 3BJAA 4EM1A 2IA2A 3LAJA 1GHCA 2VBYA 3R0JA 2CQKA 2Z99A 2OD5A 3WG9A 2ZJ2A 1KQ9A 3U2RA 3IL2A 4FT8A 3GW2A 4A0XA 3KZYA 4LFUA 3HIFA 1IZ1A 5D4SA 1K78A 3QU3A 3MCZA 3R6SA 4EM0B 2BYVE 1HKQA 3DQVC 1UB9A 1HQCA 4AIKA 2G9WA 3RIRA 2F5EA 2MBFA 5CLSA 2DPDA 5HS7A 3BZ6A 3CDHA 1EH6A 1SD7A 2G7UA 2FBHA 2MLKA 4U0VA 1SD6A 2V9VA 1MDMA 3C7JA 3ZMZA 3VOEA 3ZMDA 1YTYA 2CFXA 3R61A 1PUEE 4LG0A 1U2WA 2YR2A 4U7DA 5L3FA 1I6XA 3DXJF 4HAMA 3SXYA 3RI4A 2F5CA 3IC7A 3B73A 1ZAOA 1ZLJA 4Y15A 4HOBA 2AS5F 2XVCA 1LNWA 2O0YA 4I02A 1T6SA 2FOKA 4NB5A 3BDDA 5FLXZ 2ISYA 2NYXA 1DPUA 5JVTA 3ERED 4I0BA 3KP7A 2EFOA 3P7NA 4CHUA 3G3ZA 3TO9A 2VN2A 2HZTA 2ACJA 3MFKA 4M6XA 2AXLA 3WODF 1LVAA 4OIOF 3ECHA 1T0FA 5DCMA 2IJLA 2JSCA 1RUNA 2VBXA 2ZMEA 2QBYB 3AAFA 3HSEA 3M8FA 1D8KA 2YX4A 1CF7A 4BHCA 4LB6B 3LSTA 3SZPA 5LEKA 1R7JA 2JZYA 2OU2A 4LLGF 3K1NA 1RIOH 4HX4A 2ZNZA 1U5TC 2HTJA 3TGNA 1FSEA 3MAJA 1LDDA 2UXXA 3MZHA 4RGRA 1RUOA 4GCVA 2VT3A 4UVAA 3HYIA 2QVOA 3HSRA 3S2WA 3WTYC 4O6JA 1K6OA 1KU9A 3V8KA 2IRFG 1VTNC 1C0WA 2EV6A 4D0PA 2L02A 3LAPA 2XASA 2E1CA 1UFMA 4KMUX 4A0YA 3E6CC 2DTRA 1HKSA 3TDUC 2LDUA 2HOEA 1R1VA 5A2QK 3FMRA 1OYYA 3EDPA 1YS7A 3P9CA 1H9GA 4MQ9F 4LMYA 4PDKA 2IA1A 4PZJA 3N97A 3O3KA 4S04A 4QWQA 1J7KA 3T8RA 3GFMA 1Z9CA 3T0YA 4LGWA 3GX4X 1REPC 2RV8A 2HEOA 1G3SA 1ODDA 4WX9A 4EVIA 2WV0A 3EETA 2RQPA 3F8MA 1LDKB 2PFBA 3LQRA 2EFQA 1Z91A 5ERIA 3LQQA 2FBKA 1QZZA 5DUKA 1HKTA 3TO6A 5HLHA 5FGMA 5FD6A 1IXRC 2VC1A 4N0BA 4KN7X 2W57A 1R5GA 5L3CA 1O3RA 3RPUA 2Q8KA 1Z6TA 4MEYF 5TJJA 4L18B 3KP5A 3WE2A 1YW7A 3NEUA 2GWRA 1L3LA 4WXHA 2ESHA 1LB2A 1DPRA 1GXPA 4IRIA 1ZRCA 1PDNC 3F8NA 2GXBA 4PGGA 2QBYA 1YLFA 2OA4A 2PG4A 5F6FA 2A5YB 4ENNA 3KE2A 4LK1F 5ILSA 5D5WB 1TQIA 5FO5A 1I27A 4KYWA 4R79A 2RKHA 2XRNA 1XB4A 5DCFA 5DDGA 1HBXG 5BMZA 1S7AA 5A2QZ 1Z1DA 4ZYGA 1G3TA 4EQQA 2MA3A 5IT3A 2H94A 4IPAA 1P92A 1MD0A 1G6NA 4HQEA 4IRHA 2G7HA 3HRMA 3IRQA 1MKMA 1FP1D 3ELKA 3H3ZA 2MC3A 5ILUA 5EEGA 2W84A 1KYWA 1YG2A 1HXDA 3CUQB 4M6YA 1FY7A 2VONA 1R23A 1ZREA 1GVJA 1KU7A 1FP2A 1B6AA 1FZPB 3E6BA 1ZG5A 4O3MA 2Q0OA 1XCBA 4EGYA 1HW5A 1RI7A 3VODA 1WSUA 1HSJA 1IAWA 3H3UA 2P7VB 1ZRDA 4CGZA 1WI9A 4UHTA 3D0SA 2KIUA 3HOSA 3KP2A 1XDSA 1XSVA 2D1HA 2PLYA 3K1PA 4IRGA 3BJOA 1WQ2A 1D3YA 2MH2A 4BHBA 3WTSC 5L3BA 2ADUA 5DD4A 3TO7A 2XAHA 4B09A 2PEXA 4G9YA 2PMHA 1SFEA 2PMUA 3JAMZ 4UUVA 2TDXA 1MJAA 4Y17A 1XSXA 3RKXA 3ECOA 2HTSA 2GXGA 3V7RA 3Q5FA 1S7OA 3FXUA 1BIAA 4K2EA 4LLNA 4EJVA 2P5KA 1BOAA 3C18A 4OIQF
chains in the Genus database with same CATH superfamily
4BUPA 3W2AA 1R22A 3WHCA 4HNUA 1XMAA 1SFKA 1VQPI 2RN7A 4M3DA 2R93J 1YYVA 4KT6A 2PN6A 2R7VA 3F3XA 3JRDA 1DGWY 1J2XA 3GLXA 3R0AA 5HS8A 2DA6A 3VYUB 2JA7J 1KU2A 2EIKH 3QPSA 1OQYA 1VQ8I 5JHFA 3S1QJ 4WF2A 1PUFB 4C3IJ 5LGNA 2E1NA 2O6GE 4DYQA 5IP6A 2LBFB 3E97A 4RB3C 2R5YB 4A3IJ 4ESBA 2JUGA 2Y0MA 4A6DA 1AKHA 3HSFA 4M73A 2R7FA 3ZOBA 4B48A 2L9RA 4XKWA 2GLOA 1XGSA 5GPCA 2R7UA 2KRFA 4M3GA 2GQQA 2IP2A 1BI0A 4KISA 3IWZA 2HKOA 4XRFA 3KP6A 1E3PA 1T33A 3DF8A 2HGCA 5ICFA 1HW2A 1B9NA 2KIFA 3OR1C 4IHYA 3OYHA 4RS8A 2F4OB 4A93J 5ICCA 4HV5A 1FSHA 1YE9A 3E6MA 1K7AA 3E1SA 4GGGA 2OTJI 1JKRC 1R1TA 1SANA 1H89C 4MGRA 3GTKJ 4E70A 2EK5A 3KPHA 4XL9A 4YELA 5KVRA 5EJCA 3CUQA 3N4MA 1IF1A 2XGCA 3OYLA 4HDUA 2QQ9A 5CVVA 5FKOA 2ZJPF 1D0ZA 4FTHA 3FHZA 2HYFA 1O3SA 2A6EF 3W6KB 1Z3XA 4CYCA 3I3LA 2LKSA 4NNJA 4Q4ZF 1U9NA 1Z7LA 3HOZJ 4PFPA 3OYBA 1QHGA 1U6GA 4EV0A 2WY8Q 4A2UA 4Y4RA 3J7AO 3FXKA 4F7ZA 4BU2A 4AIJA 5EG0A 4N4NB 2V9PA 2IBDA 2VQCA 3LSJA 5B1BH 5F0HA 1YOVB 4XOTA 2LKPA 4NDLA 4IXAA 2K85A 1FOWA 2ECBA 2JSPA 2WC2A 2UV1A 2C6YA 2IS1A 2JVHA 2EIJH 5E18F 1R36A 2FUG2 2HXIA 4ITVA 5D8LB 1X1BA 1PJRA 4UY8I 2F5VA 4XLNF 3E6DA 5D6EA 5B3SH 5BPIA 1YJ9I 3CD6I 5CQGA 3JREA 5D4RA 2LF7A 3HHGA 1QPIA 4NHJA 2W82A 3QYBA 3B02A 1IN5A 1D0YA 1EH8A 2OQRA 4E7JA 2PBIA 3ZQ7A 4F55A 1VNDA 1A6IA 2JA8J 2PJPA 1D5VA 4IHTA 3HBLA 1Z21A 2ZSHB 1ZH5A 3OL3A 5TRDA 1JI8A 2MW8A 2EV0A 3GXOA 2HXOA 1UHMA 4ASNA 2B0LA 2QSHX 4ENJA 2XKPA 4UUTA 2QLZA 5E17F 1R58A 1U9OA 1ZTRA 2IW5A 4Q5SF 3LFUA 1WJCA 5CVRA 2DA4A 3G2BA 3HGYA 3NRVA 4HYEA 4BEHB 4E7HA 1JE8A 2IGOA 2QZ8A 2KL4A 3G71I 4A3CJ 5J3LA 4TV7A 3GBGA 3GZ6A 3S16J 4OAYA 1NHAA 2W48A 4KNYA 2E71A 2B63J 1I3AA 2XSJC 1XG1A 4M3FA 4ETSA 2DJIA 3PQKA 3W2VA 1IDZA 3F21A 4E7IA 5C44J 1WVRA 2KIQA 4EGZA 3WG7H 2JA2A 3HRTA 4I6ZA 1HSTA 1TNSA 4ENMA 1MSEC 1B9MA 2FX0A 3KLOA 4G6TB 1MH3A 4ZJZA 3IKTA 4IOCF 2EFNA 1B59A 5L3DA 3WTWC 4IVNA 4XIDA 2LY1A 5F64A 2FOWA 2HS5A 4M9SA 1VFCA 1PUFA 4MEXF 1V5EA 2LBFA 1X4PA 1LUJB 2MD5A 2R5YA 2H27A 3TDZC 1HF0A 3HB9A 1YRNB 2H6CA 3GTLJ 2F5FA 2LNBA 3F8CA 3NWSA 5J1UA 1L0OC 3HPHA 3WTVC 5LHHA 1G59A 1BL0A 3CMAI 2EV5A 3K4CA 1FJLA 1EF4A 1W5TA 6PAXA 5JLWA 2M45A 1WZ2A 1E0EA 1KU3A 2M5WA 2R0QC 4ESFA 4WK8F 1ETWA 3ZQCA 5M3MJ 3DTIA 3HRUA 2K9SA 3QODA 3B6AA 3KETA 3ML6A 5CPRB 4MFEA 2ECCA 2BBYA 2BY2A 3HGGA 1Q1VA 2XAJA 3WU1B 1K4TA 4PSXA 3ESWB 3P9IA 2K27A 1QBJA 1LFBA 3QPTA 1LQ1A 2Z16A 3F6VA 2YS9A 1LE8B 5K5QA 2QUFA 5LBQA 1BW6A 3EYIA 4XRSA 3LA2A 5JLXA 2HDCA 3M8EA 3S1MJ 4GXOA 1JKOC 4CCJA 2JJ7A 4UVCA 4LB5A 4S05A 2R7SA 3VFZA 2OCEA 3M8JA 2ESNA 2GIVA 1T39A 1TT5B 3MZYA 4X0GA 1H9TA 2JPBA 2W25A 3BTLA 3K4LA 4OMYA 4FHTA 3IH2A 1ZG1A 3J81Z 4G8XA 2FSWA 4FE7A 1YFHA 4QIWN 5FFXA 1ZARA 3M4OJ 4ANJA 2X1DA 3A0HC 4DIQA 2R7ZJ 4A0ZA 1W36D 2X6WA 3W3CA 2R5ZB 3FX3A 3RKYA 2KJBA 1ZR2A 1T08B 1NK3P 3K1MA 1GLNA 4II2A 5HLIA 2UWMA 3H36A 1OLTA 3FMSA 2V1UA 1Z67A 3PFIA 1MH4A 3S8PA 1EA3A 2XPUA 3GVAA 4B1RA 3RJPA 3E5QA 4KIFA 3PM1A 1SFUA 3EUAA 1AWCA 3IWFA 1N25A 3TP3A 1YO5C 3PJRA 4G7HF 4W97A 1BW5A 4RB2C 1TBXA 1XMKA 4UUSB 3I55I 1XD7A 3ABLH 3KP4A 1QGPA 4YFKF 1LFPA 2HNHA 1S7EA 2EFWA 2UUZA 3J80K 3BTIA 2YU9J 2FQ3A 4BBRJ 2BHYA 4J00A 2Z9OA 2OPTA 3LSGA 2VOPA 2XF5A 4JP0A 4Y13A 5DM6F 3OYIA 2KQRA 2BHZA 2DK5A 4BXFA 4XMYA 3OYEA 4HSRA 4XN3A 1IN7A 1SMTA 4BEHA 4IQJA 2O3FA 2Z5UA 5E20A 4I01A 5GAHJ 5IOZA 2EH3A 3MKLA 1JHFA 3WE3A 2UXNA 3K2ZA 3ZR8X 1J0RA 4A12A 3FXLA 2IS2A 1S72I 2DQLA 2P4WA 2HWVA 1RESA 1KQ0A 2NNYA 2X0LA 3ROUA 1QA6A 4IEJA 4BH9A 1VF9A 1LFUP 2E7WA 1OCPA 1WRJA 2A6HF 3ZQIA 4RB0A 1JJ8C 2ZSIB 3KCCA 5DS9A 3H0GJ 4JOMA 1MW7A 1MBKA 4JX6A 1XSDA 4M71A 1O3TA 1YW8A 5B1AH 1QU3A 3GTQJ 4BYYA 1IW7F 2ZFUA 3JSOA 1OCRH 1Y8RB 2L4AA 4R1HA 4G7ZF 1TW3A 3JRIA 1FWZA 1YRNA 2Y31A 2CG4A 3BPVA 2VODA 4NUBA 1IJWC 2A68F 4ZTJA 2CV1A 2P5LC 3BR1A 2F2EA 2JA5J 2DT6A 2JVGA 2EIMH 2DK8A 1Y6IA 2EBIA 2L3DA 4XRMA 5CKTA 1WJEA 1FT9A 3U9GA 4BJTA 3BY6A 2Z33A 1IXSB 2M0MA 4ZZLA 1I5ZA 1JXSA 1RZ4A 2ZXJA 1SAXA 2D45A 3ZN0A 2QQAA 4XR6A 4KIGA 1ZRFA 2VJIA 5CVIA 1I3QJ 4BQNA 3OYGA 1FC3A 2WAEA 1MJ9A 3BR2A 2P6SA 4KA4A 1YHQI 5CYVA 3V7CA 2NRAC 1ON1A 2DMTA 1YQAA 3G73A 2X48A 3H1CA 1LE8A 2VQHA 4XN0A 1ZYRF 3CDIA 4Z6YA 2DYRH 3EQLF 1LDJA 4UB6C 1IDYA 3IAM2 4AIDA 4WCGA 2CUFA 2K4JA 3J80Z 3HTSB 4D1QA 2VB6A 2GZWA 4C3JJ 3BG9A 1HCRA 2FRHA 1ZK8A 4LJZF 4IZZA 2KJCA 4LLLA 1JJ6C 1NG6A 4XKBA 1OISA 2EFPA 3WU0A 4NC8A 2NVUB 2ZCWA 3E5UA 4PK4A 1V4RA 2EZHA 1ONVA 1MMGA 1ZKGA 1KA8A 1ZGAA 2O61A 2XGDA 3QAHA 4F3QA 1H88C 5J1RA 1WCMJ 4XRSG 1W5CC 4GRIA 1O57A 2R5ZA 3DLAA 3AG3H 1V54H 3TKYA 4KIBA 4XBFA 1U78A 4XKVA 1BA5A 2E1MC 1MBJA 2XV4S 3L00A 4BAYA 1DP3A 2A05A 4CCLA 4D5CA 1UZCA 3J7AY 1BC7C 4DZPA 4A3EJ 4MFDA 1GVDA 3Q3SA 1Q1HA 3S2HJ 5GADJ 1FBUA 2CRGA 2CSOA 2UZKA 4H0EA 4UUSA 2BEOA 2ICWG 3NQOA 4XOPA 1ETQA 4X6AJ 1XC5A 2CUJA 4I7HA 3BLYA 1DP7P 2JK3A 1Z3YA 3JAMK 3K69A 1XDUA 4AYBN 3SQNA 2FF4A 1WJBA 3L2WA 3HXLA 3DBHB 1WJFA 1FIAA 1T0FC 4BXUA 3G4SI 3ABKH 2QF7A 3KEOA 5F0CA 1VQNI 2KIMA 4FETA 3CO7C 2ZMEC 1W4MA 2V1XA 1X1PA 1QVUA 3QRFF 1P7IA 3FKJA 1RPWA 4L5JA 3BOQA 1ZLKA 3T1BA 2MGQA 1SMYF 5EYRA 2Y30A 3CUOA 4IQ4A 3TOBA 4G94A 5HDNA 1OJLA 3RQIA 3W6VA 4EMSA 2M7BA 2Z1DA 3DPLC 1O3QA 2FE3A 2PQ8A 2FU4A 1MBEA 1OR7A 3JTHA 2Y48A 4LITA 1QZEA 4L0YB 4PJLA 3HL2A 2E2HJ 1ZG3A 2K40A 2YSRA 4AVPA 4YG2F 3FISA 1RNLA 1ZQ3P 2L9VA 3H9QA 2CU7A 3A02A 3E3VA 2L2OA 1X3WB 1JGSA 5HDKA 1X1CA 2X85A 1TWCJ 2LF8A 2ZFWA 3VDXA 2JMWA 2VLAA 2DA2A 4FX4A 2OCCH 2HQAA 4DQ2A 1BM9A 5BQTA 3EYYA 1BI3A 1U8RA 2XIGA 1JGGA 5LRSA 3TL4X 5D8KB 1XCVA 4HNVA 2V1DA 4ESJA 3ZQFA 3D5SC 4HW0A 2K3PA 5BOXA 3DCFA 1FEXA 2HQ5A 4L9VA 4JYKA 1BIBA 5DUIA 1FIPA 4AVZA 3JW4A 2GOXB 4DOZA 1AHDP 2M0CA 1GDTA 3P9KA 1S3JA 3BT9A 3VEPA 3I54A 4EATA 2XPVA 1IN8A 1QVTA 5LFAA 3ZMUA 4BE0A 1WHUA 5CQEA 1DUXC 1USSA 2KLOA 4EM2A 3VSLA 4MTDA 4F91B 3DEWA 2CQQA 3I53A 3L1PA 1H8AC 2XAQA 5LHIA 3SDGA 3K70D 2HR3A 1X4OA 5LHGA 4BKXA 2RQQA 3QOPA 2E2JJ 1U5TB 5GPAA 2MLGA 1OFCX 1Y39A 4OAZA 4HBLA 4CXFA 2VKHA 3OYJA 3Q9SA 3QU6A 2V79A 4IHXA 5H20A 1LEBA 4RM3A 4D5FA 2DCEA 3JR9A 3JRFA 1A31A 1FBSA 1JT6A 4HNTA 3F6OA 3I5UA 1JKQC 4XNFA 4I99C 4BNCA 3GYHX 3OV8A 3HUGB 3F22A 3K9TA 3GTOJ 3DP7A 2DJNA 4OIRF 4IJAA 1MMNA 4A3FJ 3ZQHA 1E2XA 4RM2A 2QA4I 1TNTA 4UNOA 3ZN1A 3CLQA 2DFHA 2AXTC 1WKMA 2JRTA 1XGMA 3QPHA 4KDPA 1WWXA 4RGSA 3SDBA 2LC2A 2F48A 2A3SA 4L9JA 2G0EA 2HZDA 3L2CA 1V3FA 2BVLA 5E1XA 3BPXA 1SFXA 1LPQA 4U0YA 2VT2A 3G1OA 3V8LA 1UJ8A 2PMZN 3VPRA 1IXCA 3VSKA 2DO7A 3JTGA 2W85A 2AQEA 2JTVA 1Z77A 2L0KA 3FWEA 5F08A 3D1NI 2HOAA 2BE5F 1H0MA 3RDIA 2GXAA 2K9LA 4B3XA 3G6EI 3FBIB 5E8GA 2KMUA 5IP7J 1XPXA 3HM5A 1J59A 4I0AA 1D1BA 1SVLA 5HLGA 5LEJA 1J5YA 4MNUA 2LRDA 3LSIA 4EJTA 3M7GA 1E3HA 1TT0A 3OY9A 5ED4A 3VYSB 2CGPA 4R8HA 4CA0A 4BQAA 1F9NA 3KLNA 2XAFA 2ZNYA 4KN4X 4CO8A 2ZO4A 4ZYEA 4Y52J 2NAZA 1WGXA 2CH0A 3OOPA 2DBBA 1ZGJA 1S29A 3HZJA 3U1KA 3KX2A 2KZGA 2XUBA 4QPQA 2WY7Q 1TQMA 4RGUA 5HS9A 1D8JA 4AWXB 2V7FA 2YU3A 3IKVA 3KYLA 2FQ4A 3BP8A 3QQAA 5HLTA 2STTA 3NAUA 1OYWA 3ZPLA 2E5NA 3L2QA 2EWNA 3BWGA 1B1BA 4UV8A 3GLLA 3HHHA 3FXRA 3HOVJ 4RBOA 4G6QA 2MYSA 1T8IA 1YJWI 3GTGJ 2R92J 1Z05A 3GUDA 5DV5A 1W7PB 2VXZA 3DFGA 1N75A 3JRBA 2J5PA 5JFRA 1K79A 5CVUA 1TP4A 3E7LA 1N77A 3F8BA 2BV6A 3TMOA 3KZIC 5GAGJ 4ZC3A 2DLLA 4JK1X 4RGXA 3GZNB 3PL8A 1G2HA 3FMQA 5HVQC 5FRMA 4B3AA 3FDYA 4M3EA 2ELJA 3L9FA 2LG4A 1QO0D 5KK1A 2VQGA 3TOAA 2Y69H 3L2RA 3S17J 2Y2ZA 5K1YA 2VOOA 5D6FA 1DGRM 5H6RA 3FM5A 3KFWX 3O8GA 2COBA 4I76A 4YIFA 5E79C 2GAUA 3Q0WA 5B66C 2E7XA 5DD8A 1R1UA 1FOYA 1W1WE 2RGVA 1SEUA 4AYBA 4L0ZB 3DKWA 1WJAA 1ITYA 1CGPA 1ETOA 4BJ6C 2RNJA 3ZP5A 1U5TA 2A69F 4JBAA 5EEHA 1FNNA 2LY2A 3X2QH 1XX5A 4PJ0C 1R9TJ 5HOOA 3T5XA 2NNNA 2Q2EB 2GA1A 2W00A 2QGUA 2ZXHA 1QPMA 3J81K 3CCVI 1X1DA 3BR5A 3KYCB 1DU6A 5GTIC 3K0LA 4DYCA 5EGOB 1YS6A 1G3YA 3HUGA 3Q0UA 2ME0A 2NVTJ 1SAUA 4CDGA 1P4WA 3PUBA 2R7DA 2NXNB 3OSGA 5L3GA 3CMYA 1WI3A 2FMLA 4O5VA 4BL0B 1ZN2A 2AHQA 5H2FC 5BS6A 5JR3A 4EJOA 3CCMI 3SZTA 2DTZA 5KCMA 1HA8A 1JUSA 1TW2A 3CJNA 1R4NB 2QSFX 3I56I 3CESA 1FPQA 2R3SA 1J75A 3ZCOA 2PX9A 5BPDA 3GTJJ 2WWYA 4BBSJ 4RLQA 3GFJA 1Y1VJ 1P4XA 4HA8A 1SC7A 3LL7A 4V19K 2BZTA 2A61A 1W0TA 2L4MA 4YFNF 2JA6J 5DYMA 5AIQA 3OS2A 4U7BA 2P5VA 2XF7A 1OKRA 3GO5A 4ZYAA 2VKEA 4J19A 1OPCA 2VC0A 4M72A 1TL8A 2NVXJ 3RQ4A 2K86A 4PFOA 2HPIA 3FM3A 3SFIA 2X4HA 3EUHA 2MG4A 1T2KA 2VBZA 1HC8A 3IH3A 1WH7A 2KDZA 2A07F 2HDWA 4MIMA 3WGGA 2CFOA 1XS9A 3S3MA 2L01A 4CSWA 4E7ZA 2DA1A 2W7NA 1MZBA 4C2UA 2CUZA 2M4KA 3W2WA 1JUMA 5HDGA 2KRHA 3MQ0A 5IYDJ 3DBRB 3PNTA 2OZUA 2DU9A 2WAQN 1Y0NA 1BR1A 2LREA 2MD0A 5E1WA 2P81A 3U21A 2ZC2A 1S8NA 2NOGA 3L7WA 2V9KA 3U1DA 1B72B 1TQPA 3CJRB 4HLYA 3BG3A 3K2AA 2Y9ZA 5K7FA 3CF5F 4IKFA 3GEZA 2O5RA 5FFZA 5AONA 2CW8A 1UELB 3CMEI 4HSTA 1P2FA 4Q48A 3DV8A 1SD5A 2H1KA 2M7AA 5IT9Z 1EH7A 1W7PA 2M34A 4A5NA 3ULQB 2DFIA 2Q1ZB 5K7ZA 1P4AA 3ABTA 2OC6A 4L5EA 2ZXWH 2HVRA 1W7PD 4B8XA 2OQGA 4I2OA 1VQ4I 1WFXA 5KHDA 2K7LA 3OSFA 5EZGA 3CUQC 2PJRB 1POGA 1EV7A 3F9KA 4F92B 5ICEA 1HOMA 4IF4A 2EA4A 2M4GA 1FYKA 3IAS2 3ZXSA 3CMMA 4EJWA 1F4KA 4A3BJ 4RAYA 1FMWA 1R6RA 5D5VB 1TLHB 4KMFA 4F93B 2PMZA 4I09A 4IOAF 3RYRA 4CCMA 1A5JA 3H5RA 4HLXA 1WJ5A 3TEDA 1F5TA 3FK6A 1FX7A 1R5HA 2XAGA 3LFKA 1UAAA 1OCZH 1TWHJ 5IYCJ 4AIHA 4HF1A 4D9JA 1MNDA 2KKOA 2HU9A 1LVKA 1TWAJ 2LMDA 2Q2EA 2RDPA 3ZMTA 4XLPF 2IXSA 4ZZDA 5EGOA 3GTPJ 2EZIA 1IN6A 2X51A 2LTPA 3JCUC 1F43A 2VJ5A 5AIPA 3SFZA 3AL0C 5ILVA 3FXMA 3OL4A 3E5XA 5M5YJ 1T98A 1JTXA 3GMEA 3CCSI 2EILH 2P7CB 2R7QA 2DA7A 2QENA 2Y75A 5K5OA 1X19A 1O7FA 3IRRA 3JSPA 1TTYA 5J8FA 2IT0A 4EEFG 2E60A 4U0WA 3CLOA 3JRAA 1I50J 3ZQGA 1YW9A 2L7FP 4OU0A 5EEAA 4DW6A 3DBLB 2F6CA 4RAZA 2CWEA 1IV6A 1SVOA 3H35A 2ELHA 2E35A 1AOYA 5M5XJ 2X6YA 1U0JA 5GP9A 1P6RA 3C1DA 3FHNA 4UVBA 1FYMA 2D1VA 2LYCA 5FB2A 5LD2C 5LRRA 5FKMA 4BXXJ 5CJ9A 5J6XA 1RR7A 2OV7A 3SEZA 2XC7A 4OWRB 4IO9F 3G1MA 5LLQA 2CO5A 2BY3A 4Q47A 2K3FA 4P55A 5J4VA 2TCTA 1IN4A 3F8FA 5L3EA 1KQ8A 2MC4A 2JRMA 4N9HA 1RKTA 4AUXA 1MBFA 3D5LA 2EQRA 2K5CA 3CP8A 2ETHA 4BQOA 2VE9A 4HX7A 5F0FA 3ZMVA 5J8CA 1XGOA 1S6LA 4HDVA 2Y9YA 3BTJA 3EPZA 4KFCA 2FBIA 1OYIA 2CUEA 3V7SA 2DAOA 4BS9A 4A6EA 2LY9A 4CYDA 3CCUI 3FXQA 2HKXA 2KISA 2R7XA 1XTAA 3WTXC 3CC2I 3PQJA 5J4YA 4ZH4F 1IRGA 2VASA 5K5RA 2ISZA 1PYVA 4V2GA 3OYKA 3MZ8A 3RCOA 2ZKZA 2XGXA 4ZYDA 4ON0A 3RKQA 1B72A 4GYIA 3DTKA 1N78A 1RKWA 1GV5A 4XORA 1HW1A 1YIOA 4LK0F 3O6BB 3A03A 2M3AA 4UV9A 3RKWA 1KYZA 4M74A 1Y8QB 2GOMA 2IVMA 4A3MJ 2GA2A 2XB5A 4YFXF 3S1NJ 1D1AA 3HRSA 3R60A 1PP8F 3ISPA 5GTHC 2FXAA 2XGEA 4DNCA 1ULYA 3QPLA 1FLIA 3WTTC 3K4NA 1G8XA 2JN6A 2XKOA 4AD9A 3RSNA 2DYSH 2CW0F 1ERDA 4P96A 2GBYA 1STZA 4FCYA 2PJRA 3M1EA 4DBQA 4QLCU 5DTDA 4PGHA 2NS8A 3H3VK 2O7OA 4OINF 1TZLA 2WTEA 5E8IA 3KZZA 1A36A 2WB1N 3CCLI 4BJ5C 4HX8A 2XROA 1XN7A 2M9HA 2TRTA 1JHHA 1ZGWA 1BBYA 1W0UA 3AG2H 5D5UB 3OIQA 2STWA 1Z7UA 1BR4A 2ZBKA 1NG7A 2MABA 2OZ6A 2E5ZA 3ERMA 3RYPA 3OS1A 1X3UA 1GT0C 1W36C 3BQZA 1NH3A 2V1NA 4G6DA 4RAGA 2HDDA 1QZYA 1OMIA 4BACA 3QYEA 1MNMC 2PI0A 2VI6A 1CQTA 1R00A 3C2HA 3WGIA 2DPUA 1X2MA 3TQNA 3BQYA 4Y33A 5K7HA 3KEYA 3BG7A 4L5IA 5IP9J 2K4BA 1LEAA 2R7WA 5LGTA 4XICA 2BGCA 3HTUA 5IYBJ 1NK2P 2VE8A 2NS0A 3FBNB 3DU5A 1IV8A 3DEUA 2IGNA 2P0WA 2RC4A 2Z3YA 2EA2A 4G7OF 1RETA 3H92A 2M8EA 2HI3A 1X1AA 2KRCA 5KAIC 2DQRA 3MEXA 3E0JB 3BJ6A 2WAQA 3S32A 1ETVA 5EDNA 2HYJA 4D7NA 3HOXJ 1G4DA 4A5MA 3HJEA 2HYGD 3AG1H 2J5OA 2CQXA 4IHVA 3LSPA 2KZVA 3QOEA 1R4MB 4WXDA 3CO6C 2VKVA 3LOCA 1J9IA 3TP0A 2BY0A 5E3MA 4RB1A 3GZ5A 4MTEA 3MKZA 1X58A 5FKKA 5F27A 3FKIJ 2IS4A 5EZHA 1GV2A 4HF2A 1MMSA 3DTEA 2DMPA 3AKZA 4HF0A 5DEQA 5H6QA 4ZTFA 3G1LA 4KT5C 4XKCA 1WJDA 3SHFA 3BG6A 1LJ9A 2F5DA 4E4HA 2EB7A 2FNAA 1QQIA 2M1BA 4HZFA 2EJRA 5TGTA 1MSFC 4ENKA 1F1ZA 4OOIA 1J09A 3ABUA 2CV2A 5KNLA 1UHWA 3WHBA 3VYRB 3WTZA 2DODA 2IA0A 3K7AJ 2OAZA 1IO2A 4XSZF 2BXZA 4DBRA 1OCOH 1ETXA 4N4OB 4XLFA 4FQGA 3VB2A 5FJ8J 2HQRA 2W24A 3COAC 1Z0XA 1UCRA 4LG3A 3WGHA 2W4SA 3ZQLA 1M1EB 1ZHFA 4JQFA 1DDNA 1UMQA 3CF2A 3P5JA 3A2KA 3HOUJ 3I58A 4CH7A 1FBQA 3HKZN 4XM3A 3I59B 1G3WA 1S5LC 3CCYA 5M5WJ 4BGDA 4NQWB 2MFZA 2P8TA 4L9NA 4C2TA 4M9ZA 1BI1A 3REOA 2K02A 2XF6A 4C9YA 4PJJA 3ZMSA 2E34A 4HV6A 4A3GJ 2DT5A 2ME6A 3DPTA 4ZYHA 3EUKL 1O7LA 3PNVA 4M9XA 2I8DA 3M9AA 3R4KA 4W1UA 2HQNA 5FKLA 2M87A 2B7EA 3V8JA 4IHSA 1MGTA 1YI2I 4LOCA 2E19A 1I1GA 3I0TA 3T8TA 4A3LJ 1I6HJ 3FXJA 3L2VA 4CUGA 1U3EM 3BR6A 3F23A 2FA5A 4HG2A 2AQFA 4OMZA 2COMA 4RAFA 4QTRA 4CCNA 1ENHA 2HOSA 2VUMJ 3Q0VA 4CICA 3H9GA 3OR2C 2QM3A 4UB8C 4A3DJ 3HOTA 4CZZA 2VL8A 1W5SA 4Y7NJ 3LSHA 3CC7I 4AM3A 2D2WA 3QP5A 1A04A 3CTAA 1KGSA 1ON2A 3VYTB 3KP3A 2H6BA 2VKDA 2VBWA 5J40A 2CW7A 3L09A 1EJ9A 2CS3A 2N8GA 3V42A 1GXQA 2X9DA 4MO7A 2M30A 3RPQA 3DPUA 2DOEA 1Y56A 3Q9VA 3C3WA 3LA3A 5FLVA 4E7SA 3I71A 1YIJI 1P7JA 3WTUC 2DW4A 3S1RJ 5E1ZB 1IC8A 4X1EA 2L54A 2QKMB 1K78B 2FNPA 4MHGA 4Z2YA 4MQVA 1FOKA 1IGNA 1FTZA 3H0DA 5LGUA 3UKGA 2LSOA 2YPRA 2JQ7A 3LWFA 2V26A 1XGNA 4DGWB 1VQMI 2A6TA 1V5GA 3K4JA 4KUMA 5ICGA 2HPMA 4U88A 2M8GX 5E3LA 4ZDOA 3GF2A 4P9UA 1IUYA 4YIIA 1QNTA 4L9TA 4PCQA 5BNGA 1BC8C 3LA7A 2L7MP 4OIPF 1Y0UA 3IHUA 2KP6A 3GTMJ 3K4BA 2I5UA 2W1OA 4WXCA 1T95A 2FMYA 1HDPA 1IRZA 2VJ4A 1MDMB 1B4AA 1FMVA 3I64A 3PO2J 5FD5A 4GYGA 2Z2SB 1K83J 2HVSA 4LG0B 5JHUA 2NOJB 2O03A 2YX7A 3BROA 1VI0A 2CYYA 3QP6A 3S3OA 5F1RA 2V6CA 3OYMA 3A0BC 1DQUA 4LD5A 2JPCA 2H09A 3AG4H 2R7TA 4P5OA 1BI2A 2XSDC 2QQBA 2OBPA 2WBMA 3HPGA 3MWMA 2FEZA 4I98B 1OR7C 1P9QC 5C4XJ 1USTA 1K6YA 1V55H 1IRFA 2MH9A 3M1CA 2QKLB 1XMXA 5D5XB 5DM7F 2E1MB 4HQMA 4HPQA 4YEJA 2QYOA 2QEXI 3D5RC 1FYLA 3GFIA 4FX0A 3V4GA 1VZ0A 2OF7A 3BTCA 3I4PA 4P1WA 3M3YJ 2WB1A 1Z6RA 4FE4A 1ETKA 2XHKA 2D5VA 5CVJA 1I1SA 1BN5A 3I59A 1YX5A 2LD5A 1MIJA 2O8KA 3OYFA 4NQWA 3IUOA 2NVQJ 4J01A 2O8XA 1SD4A 2RVCA 3KEQA 2JT1A 4GFBA 4WWCA 3K4MA 4UXNA 4PUSA 3WU2C 5C3EJ 1D5YA 4GO1A 1BJAA 3L2UA 2DMNA 4E7KA 3GFLA 3W6JB 3CJTB 1MJBA 3S2DJ 1E17A 2DA5A 2HFHA 2IPQX 3FZVA 5JVGF 1R5ID 3GWZA 1PP7U 4P9FA 2P6TA 1K61A 4XSXF 2LH9A 3O2PE 5EF6A 2DMQA 3RTRA 2QWWA 3MKYB 3MD2A 1VQ9I 5DCMB 1ACIA 2VQLA 5JI6A 1YX3A 2DI3A 4JX4A 5IT9K 2ZMEB 1T38A 2O9LA 3FF5A 3GCMA 5TISC 1JKPC 3QWLA 2LVSA 2BXYA 3K70C 1CF7B 1AA7A 3F72A 4EJUA 4KICA 2EZLA 4N9IA 4BHPA 5FLXK 3BJAA 4EM1A 2F4MB 2IA2A 3HC7A 3LAJA 1GHCA 2VBYA 3DKXA 3R0JA 2CQKA 2Z99A 3OOUA 2OD5A 3IH4A 4KITB 3WG9A 2ZJ2A 2K9MA 1KQ9A 3U2RA 2EZKA 1F36A 2LP0A 4XK4A 2DDBA 4FT8A 3IL2A 3GW2A 2WAFA 2F4IA 4A0XA 3KZYA 2ZB9A 4LFUA 3HIFA 1IZ1A 5D4SA 9ANTA 2XRLA 1K78A 2JWTA 3QU3A 1UHSA 3MCZA 2BY1A 3NARA 3R6SA 4EM0B 2BYVE 4FASD 1HKQA 2GM4A 1WH5A 3DQVC 1HDDC 1UB9A 2X6XA 4BY7J 5FKNA 1HQCA 4F52A 2I10A 1MBGA 4AIKA 3S93A 1EKEA 2G9WA 3RIRA 2F5EA 2MBFA 2KDOA 5CLSA 2DPDA 3HKZA 1JTYA 1MBHA 5HS7A 3BZ6A 3CDHA 1EH6A 1SD7A 2DMUA 2G7UA 2FBHA 2MLKA 3CCJI 4CZCA 3HOWJ 2HVQA 4U0VA 4NBQA 5FROA 1SD6A 2QSGX 3OS0A 2V9VA 3JRGA 1MDMA 2H8WA 3C7JA 3CDLA 3DKYA 3VOEA 3ZMZA 5KAFC 3O8HA 3ZMDA 1RC9A 5B5EC 1SVMA 1YTYA 2CFXA 2CMPA 4FISA 3R61A 4B44A 1PUEE 4M6VA 4LG0A 1MMDA 2WV1A 3C2GA 1D0XA 1U2WA 3NWTA 2YR2A 4U7DA 5L3FA 3CJQB 1FOXA 3F0CA 1I6XA 4BY1J 2L9SA 3PUFA 3DXJF 2RREA 2K9NA 3AFHA 3ZRGA 2DOFA 4HAMA 3SYTA 3SXYA 4D7MA 1RR8C 2DOAA 3RI4A 4HEA2 2F5CA 2M2EA 5HNFA 4BE2A 3IC7A 3CCRI 3B73A 2VPLA 1ZAOA 3CQZJ 2CQ7A 2CV0A 1U8BA 1Y1WJ 1ZLJA 4Y15A 4YIRX 2XB0X 3LNQA 2E1OA 2VJJA 2NVYJ 4HOBA 2BOLA 2IAIA 2ZJRF 3SJMA 2AS5F 4ZDLA 2XVCA 4XLCA 1LNWA 2O0YA 4I02A 1T56A 4RDUA 1R71A 1T6SA 2FOKA 2YUSA 3BC8A 3DWLE 4G12A 4NB5A 3M07A 3BDDA 3B6CA 1TC3C 5FLXZ 2ISYA 2NYXA 1DPUA 3OIPA 5JVTA 4B43A 3DEEA 3KIOA 2NS7A 3ERED 4I0BA 3KP7A 2EFOA 3P7NA 2X6OA 2DXIA 4IHWA 5F1JA 4CHUA 3G3ZA 3TO9A 2VN2A 1TWGJ 2HZTA 4C2MJ 3BCAA 3MFKA 2ACJA 4JX5A 2DFFA 4M6XA 3TBIA 2AXLA 4QPOA 3WODF 2E2IJ 2DN0A 1LVAA 4OIOF 3UNGC 3ECHA 2H1LA 2WA0A 3FXOA 1VQ6I 3PO3J 5C4JJ 1SFOJ 1HLVA 2IS6A 1T0FA 5DCMA 2IJLA 2JSCA 2KFDA 2R7OA 3PIPF 4HRIA 1RUNA 2VBXA 2ZMEA 3LSMA 2QBYB 2AO9A 3AAFA 4DJAA 3HSEA 2KT0A 3M8FA 1D8KA 4U87A 2XAUA 2YX4A 1CF7A 4BHCA 2L7KA 4LB6B 5E3NA 3LSTA 2E36A 3SZPA 5LEKA 1R7JA 2JZYA 2OU2A 3QYFA 2ZJQF 1X3ZB 4LLGF 4BQQA 3K1NA 2OJED 1RIOH 4HX4A 2VIXA 4BDZA 2ZNZA 5F04A 5IPAA 2V4JC 1U5TC 4RMNA 2HTJA 3TGNA 1FSEA 3MAJA 3OWTA 1LDDA 2UXXA 3MZHA 4RGRA 1FTTA 1RUOA 4GCVA 2VT3A 4UVAA 3IV5A 3HYIA 3OYCA 2QVOA 2L9NA 5J1YA 2IEKA 3OMYA 3HSRA 4AC0A 3S2WA 3WTYC 3ABMH 4A69C 1TWFJ 2XDVA 4LIUA 3OYNA 4Y3OA 4S0HB 1VQLI 4LIVA 4O6JA 4ABZA 1K6OA 3HG9A 3ZQQA 1KU9A 2BW3B 1UG2A 1R49A 2Y0SN 3A01B 2ID3A 4NC6A 3V8KA 2IRFG 1VTNC 4CCKA 1C0WA 3J7ZI 2EV6A 3K6GA 4D0PA 2LLKA 4V2FA 2L02A 4E6KG 4BDYA 2VPRA 3LAPA 2XASA 2E1CA 4A3KJ 1UFMA 3I9V2 3PSIA 4KMUX 4A0YA 1ZELA 3E6CC 2DTRA 1HKSA 3HEFA 3TDUC 2LDUA 3UR3C 2K9QA 3CP2A 2HOEA 1R1VA 2L5QA 5A2QK 3FMRA 4C3HJ 1OYYA 3EDPA 1QRYA 1YS7A 3P9CA 1H9GA 4MQ9F 3EUHC 3CC4I 4LMYA 3J7YJ 2B9SA 1WPKA 4GDFA 4PDKA 4DYRA 2KPMA 2ELKA 2IA1A 4PZJA 2RNGA 3CZ6A 3N97A 1B8IB 3BZCA 3O3KA 4S04A 4QWQA 1J7KA 1LKXA 3T8RA 2EINH 2DA3A 1BOBA 3GFMA 3T0YA 1Z9CA 4LGWA 3GX4X 1REPC 2RV8A 2HEOA 2BVMA 1G3SA 4A3JJ 3K10A 1VQ7I 1ODDA 4WX9A 3BZKA 4EVIA 1JUPA 2WV0A 3EETA 4QSHA 2RQPA 3F8MA 3A4CA 4RLFA 1LDKB 2PFBA 1VQ5I 1K4SA 3LQRA 2EFQA 3OYAA 1Z91A 5ERIA 4CCOA 1JT0A 1QHHD 2DFEA 4E7LA 3LQQA 5HODA 2FBKA 1QZZA 5DUKA 1A35A 1HKTA 3KYDB 1VQKI 3TO6A 3BCBA 5HLHA 2MSYA 5FGMA 5FD6A 1IXRC 2VC1A 2A5WA 4N0BA 2OUMA 4KN7X 4DZJA 2W57A 3S14J 1R5GA 5L3CA 1O3RA 3JRHA 1IUFA 3RPUA 2V6EA 4H4KC 2Q8KA 1Z6TA 4NC7A 2XPWA 4MEYF 5TJJA 4L18B 3KP5A 3RPUD 3WE2A 1YW7A 3NEUA 3C2BA 2GWRA 1L3LA 3VWBA 2DDAA 4WXHA 3I4MJ 2ESHA 1A6QA 1DPRA 4B4CA 1LB2A 1GXPA 1ZRCA 4IRIA 3LMMA 2LR8A 3F8NA 1PDNC 2GXBA 1UG0A 3JRCA 4PGGA 3LSRA 1OCCH 4XLEA 2QBYA 1YLFA 2CQNA 1DU0A 2OA4A 5GAEJ 2PG4A 5F6FA 4AU7A 2A5YB 4ENNA 3K4KA 2OTLI 3KE2A 4LK1F 3FIWA 1AU7A 5ILSA 5D5WB 3ONQA 1TQIA 5FO5A 1I27A 4KYWA 4R79A 1RRJA 2RKHA 1O4XA 4YRVA 2XRNA 1XB4A 4KJZA 1KONA 3PSFA 5DCFA 3CCEI 4MLOA 5DDGA 1AKHB 1HBXG 5BMZA 1S7AA 4ZYGA 1Z1DA 5A2QZ 4BE1A 1G3TA 4EQQA 2MA3A 5IT3A 2H94A 4IPAA 1P92A 1MD0A 1G6NA 3I4NJ 1I39A 4HQEA 4IRHA 1YJNI 3TW7A 2R7RA 3ASOH 3PNYA 2L7ZA 3RZOJ 2BW3A 2G7HA 3FK7A 3HRMA 3IRQA 1MKMA 1PVEA 1YITI 2KHMA 2VXDA 3A01A 2H8RA 1FP1D 3ELKA 4XLHA 3H3ZA 2MC3A 5ILUA 5EEGA 2W84A 1BJZA 1KYWA 1YG2A 1HXDA 1IG7A 1OCTC 3CUQB 4M6YA 1KZHA 1FY7A 2VONA 1R23A 2RAEA 1ZREA 2FJ1A 3BR0A 1GVJA 1KU7A 4PJMA 2IGKA 1FP2A 1B6AA 4CYCB 1FZPB 3OYDA 3E6BA 1ZG5A 1APLC 2Q0OA 4O3MA 1XCBA 1ETYA 4C30A 3ZGKA 4EGYA 5M3FJ 2LK2A 4XLAA 1BR2A 1HW5A 2DT7B 1RI7A 3VODA 3DLLF 1WSUA 2CJJA 5EG0B 3PIOF 1HSJA 1E3OC 1IAWA 3H3UA 1B8IA 3LSKA 4IL6C 4IX7A 2P7VB 3MVPA 2FD5A 3TW6A 1ZRDA 4CGZA 1WI9A 2LOOA 1VQOI 4UHTA 3D0SA 2KIUA 3HOSA 3KP2A 5E3OA 1XDSA 1XSVA 2D1HA 3A1YA 4XQFA 2PLYA 2ID6A 3CCQI 3RZDJ 3K1PA 3HOYJ 3AL0B 3S15J 5IY5H 4IRGA 2R4GA 3BJOA 1WQ2A 3IP4B 5J47A 1D3YA 2MH2A 3N05A 4BHBA 1MNEA 3ASNH 3WTSC 2LFBA 2QQ8A 5L3BA 2ADUA 5DD4A 3PFYA 3TO7A 3H9JA 2XAHA 3MKWB 4B09A 2PEXA 3H5NA 1GUUA 4G9YA 1ZR4A 4M3BA 2PMHA 1SFEA 4PJNA 1X2NA 2PMUA 3JAMZ 3HDDA 4UUVA 2QCOA 2TDXA 3S3NA 5FRNA 4RA2A 3OIOA 1NTCA 1MJAA 2JUCA 4Y17A 5FLMJ 1XSXA 3RKXA 3SEQA 5HNHA 4B47A 2IGMA 1ORKA 3ECOA 4II3A 2EPFA 4XONA 1D1CA 1S9HA 1V5FA 3DU6A 3SZGA 3H5AA 2HTSA 2ZXIA 2GXGA 3MN2A 3V7RA 3Q5FA 1S7OA 2WADA 2Y0SA 3FXUA 1BIAA 4ZDPA 4K2EA 5IOYA 4LLNA 2X1EA 1IRXA 3MMYB 4PSWA 4EJVA 3BR3A 2HOTA 2X1CA 3BG5A 2P5KA 1BOAA 3C18A 4OIQF 2LKXA 2GIZA 1MMAA
chains in the Genus database with same CATH topology
1R22A 1XMAA 2RN7A 1YYVA 2PN6A 3F3XA 1J2XA 3GLXA 3R0AA 5HS8A 1KU2A 4WF2A 5LGNA 2E1NA 2O6GE 3E97A 4RB3C 4ESBA 2Y0MA 4A6DA 3HSFA 4M73A 2R7FA 1XGSA 2KRFA 2GQQA 2IP2A 1BI0A 3IWZA 2HKOA 4XRFA 3KP6A 3DF8A 2HGCA 5ICFA 1HW2A 1B9NA 2KIFA 4RS8A 5ICCA 4HV5A 1FSHA 3E6MA 1K7AA 4GGGA 1R1TA 4MGRA 4E70A 2EK5A 5KVRA 3CUQA 3N4MA 1IF1A 4HDUA 2QQ9A 5CVVA 3FHZA 2HYFA 1O3SA 2A6EF 3W6KB 4Q4ZF 1U6GA 4EV0A 4A2UA 3J7AO 4F7ZA 4AIJA 2LKPA 4IXAA 2WC2A 2C6YA 5E18F 1R36A 5D8LB 4XLNF 3E6DA 5D6EA 5BPIA 5D4RA 2LF7A 3HHGA 4NHJA 3B02A 1IN5A 1EH8A 2OQRA 2PBIA 3ZQ7A 1D5VA 2PJPA 4IHTA 1ZH5A 5TRDA 2EV0A 3GXOA 1UHMA 4ASNA 2B0LA 4ENJA 2XKPA 2QLZA 5E17F 1R58A 2IW5A 4Q5SF 5CVRA 3NRVA 1JE8A 4HYEA 2QZ8A 4TV7A 3GZ6A 1NHAA 4KNYA 4ETSA 3PQKA 3F21A 4EGZA 3HRTA 1HSTA 1TNSA 4ENMA 1B9MA 3KLOA 3IKTA 2EFNA 1B59A 5L3DA 3WTWC 4IVNA 5F64A 2HS5A 4M9SA 4MEXF 2MD5A 2H27A 3TDZC 2H6CA 2F5FA 2LNBA 3F8CA 1L0OC 3WTVC 5LHHA 2EV5A 1W5TA 6PAXA 2M45A 1KU3A 2M5WA 4ESFA 4WK8F 3HRUA 3KETA 3ML6A 2BBYA 2XAJA 3WU1B 3P9IA 2K27A 1QBJA 3QPTA 1LQ1A 3F6VA 5K5QA 2QUFA 5LBQA 3EYIA 3LA2A 2HDCA 3M8EA 4GXOA 4UVCA 4LB5A 4S05A 3VFZA 2ESNA 2GIVA 1T39A 3MZYA 1H9TA 2JPBA 2W25A 4OMYA 4FHTA 1ZG1A 3J81Z 4G8XA 2FSWA 1YFHA 5FFXA 1ZARA 4A0ZA 3FX3A 3RKYA 2KJBA 3K1MA 5HLIA 2UWMA 3FMSA 2V1UA 3PFIA 3GVAA 3RJPA 3E5QA 4KIFA 1SFUA 1AWCA 3IWFA 1YO5C 4G7HF 4RB2C 1TBXA 1XMKA 1XD7A 3KP4A 1QGPA 4YFKF 2EFWA 3J80K 2FQ3A 2Z9OA 2VOPA 4Y13A 2DK5A 1IN7A 1SMTA 2O3FA 2Z5UA 5E20A 4I01A 3WE3A 1JHFA 2UXNA 3K2ZA 1J0RA 4A12A 2DQLA 2P4WA 2HWVA 1KQ0A 2NNYA 2X0LA 3ROUA 4BH9A 2E7WA 1WRJA 2A6HF 4RB0A 3KCCA 1XSDA 4M71A 1O3TA 1YW8A 4BYYA 1IW7F 3JSOA 2L4AA 4R1HA 4G7ZF 1TW3A 1FWZA 2CG4A 3BPVA 2VODA 2A68F 2P5LC 2F2EA 2DK8A 2L3DA 1FT9A 3U9GA 3BY6A 2Z33A 1IXSB 4ZZLA 1I5ZA 1JXSA 1RZ4A 2ZXJA 1SAXA 2D45A 3ZN0A 2QQAA 4KIGA 1ZRFA 5CVIA 1FC3A 1MJ9A 2P6SA 4KA4A 5CYVA 3V7CA 2NRAC 1ON1A 1YQAA 3G73A 1ZYRF 3EQLF 1LDJA 4WCGA 2K4JA 3J80Z 3HTSB 2GZWA 2FRHA 4LJZF 2KJCA 4LLLA 2EFPA 3WU0A 2ZCWA 3E5UA 1V4RA 1ONVA 1KA8A 1ZGAA 2O61A 3QAHA 1O57A 3TKYA 4KIBA 4XBFA 1U78A 2XV4S 3L00A 4BAYA 1BC7C 1Q1HA 1FBUA 2CSOA 2UZKA 4H0EA 2BEOA 3NQOA 4I7HA 1DP7P 3JAMK 3K69A 1XDUA 3SQNA 2FF4A 4BXUA 3KEOA 2KIMA 3CO7C 1W4MA 2V1XA 3QRFF 4L5JA 3BOQA 1ZLKA 3T1BA 1SMYF 3TOBA 3CUOA 4G94A 5HDNA 4EMSA 3DPLC 1O3QA 2FE3A 2PQ8A 2FU4A 1OR7A 3JTHA 2Y48A 4L0YB 1ZG3A 2YSRA 4AVPA 4YG2F 1RNLA 3E3VA 5HDKA 1JGSA 2LF8A 2ZFWA 4FX4A 4DQ2A 1BM9A 5BQTA 3EYYA 1BI3A 1U8RA 2XIGA 5LRSA 5D8KB 1XCVA 2V1DA 4ESJA 4HW0A 5BOXA 4L9VA 1BIBA 5DUIA 3JW4A 3P9KA 1S3JA 3VEPA 3I54A 1IN8A 3ZMUA 1DUXC 1USSA 4MTDA 4EM2A 3I53A 2XAQA 5LHIA 2HR3A 5LHGA 3QOPA 1U5TB 2MLGA 4HBLA 4CXFA 3Q9SA 3QU6A 2V79A 5H20A 1LEBA 1FBSA 3F6OA 3I5UA 4BNCA 3GYHX 3OV8A 3F22A 3K9TA 3DP7A 4OIRF 4IJAA 1E2XA 1TNTA 4UNOA 3ZN1A 1WKMA 2JRTA 1XGMA 3QPHA 4KDPA 1WWXA 4RGSA 2A3SA 4L9JA 3L2CA 1V3FA 5E1XA 3BPXA 1SFXA 4U0YA 2VT2A 3V8LA 1IXCA 2DO7A 3JTGA 2W85A 2JTVA 3FWEA 2BE5F 1H0MA 3RDIA 5E8GA 1J59A 4I0AA 5HLGA 5LEJA 1J5YA 4MNUA 4EJTA 3M7GA 5ED4A 2CGPA 4R8HA 4BQAA 1F9NA 3KLNA 2XAFA 2ZNYA 4KN4X 4CO8A 2ZO4A 4ZYEA 2NAZA 3OOPA 2DBBA 1ZGJA 1S29A 2XUBA 1TQMA 4RGUA 5HS9A 1D8JA 4AWXB 2YU3A 3IKVA 3BP8A 2STTA 1OYWA 3ZPLA 2EWNA 3BWGA 1B1BA 4UV8A 3HHHA 3FXRA 4G6QA 1Z05A 3GUDA 5DV5A 1W7PB 2VXZA 3DFGA 2J5PA 5JFRA 1K79A 5CVUA 3F8BA 2BV6A 2DLLA 4JK1X 4RGXA 3FMQA 5HVQC 3L9FA 1QO0D 5KK1A 3TOAA 5K1YA 2VOOA 5D6FA 5H6RA 3FM5A 3KFWX 4YIFA 2GAUA 2E7XA 5DD8A 1R1UA 2RGVA 4L0ZB 3DKWA 1CGPA 2RNJA 3ZP5A 1U5TA 2A69F 4JBAA 5EEHA 1FNNA 5HOOA 3T5XA 2NNNA 2GA1A 1QPMA 3J81K 3K0LA 1YS6A 1G3YA 3HUGA 4CDGA 1P4WA 2R7DA 5L3GA 2FMLA 4O5VA 1ZN2A 5BS6A 5JR3A 4EJOA 3SZTA 1TW2A 3CJNA 1FPQA 2R3SA 1J75A 5BPDA 2WWYA 3GFJA 1P4XA 4HA8A 2A61A 2L4MA 4YFNF 5DYMA 5AIQA 4U7BA 2P5VA 1OKRA 3GO5A 1OPCA 2VC0A 4M72A 2K86A 3FM3A 2X4HA 3EUHA 1T2KA 2VBZA 2A07F 3WGGA 2L01A 1MZBA 5HDGA 3MQ0A 2OZUA 2DU9A 5E1WA 1S8NA 3L7WA 3U1DA 1TQPA 4HLYA 3GEZA 5FFZA 5AONA 1P2FA 4Q48A 3DV8A 1SD5A 5IT9Z 1EH7A 1W7PA 4A5NA 3ULQB 2DFIA 1P4AA 3ABTA 1W7PD 4B8XA 2OQGA 4I2OA 2K7LA 3CUQC 1EV7A 5ICEA 4IF4A 2EA4A 1FYKA 4EJWA 1F4KA 4RAYA 5D5VB 1TLHB 4KMFA 4I09A 3RYRA 4HLXA 1F5TA 1FX7A 1R5HA 2XAGA 3LFKA 4AIHA 4HF1A 2KKOA 2Q2EA 2RDPA 3ZMTA 4XLPF 4ZZDA 1IN6A 5AIPA 3SFZA 5ILVA 3E5XA 1T98A 2P7CB 2QENA 2Y75A 5K5OA 1O7FA 3IRRA 3JSPA 1TTYA 5J8FA 2IT0A 4U0WA 3CLOA 1YW9A 4OU0A 4RAZA 2CWEA 2ELHA 1AOYA 1P6RA 3C1DA 4UVBA 1FYMA 2D1VA 5FB2A 5LRRA 5CJ9A 5J6XA 5LLQA 2CO5A 4Q47A 4P55A 1IN4A 3F8FA 5L3EA 1KQ8A 4N9HA 3D5LA 2ETHA 2VE9A 4HX7A 3ZMVA 5J8CA 1XGOA 1S6LA 4HDVA 4KFCA 2FBIA 1OYIA 3V7SA 2DAOA 4A6EA 4CYDA 3FXQA 2HKXA 3WTXC 3PQJA 1IRGA 4ZH4F 5K5RA 2ISZA 2ZKZA 2XGXA 4ZYDA 4ON0A 4GYIA 1HW1A 1YIOA 4LK0F 3O6BB 4UV9A 3RKWA 1KYZA 4M74A 2IVMA 2GA2A 4YFXF 3HRSA 3R60A 1PP8F 3ISPA 2FXAA 4DNCA 1ULYA 1FLIA 3WTTC 2XKOA 4AD9A 2CW0F 4P96A 1STZA 3M1EA 4QLCU 4PGHA 4OINF 5E8IA 2WTEA 3KZZA 4HX8A 2XROA 1XN7A 1JHHA 1BBYA 5D5UB 2STWA 1Z7UA 2ZBKA 2OZ6A 3RYPA 1X3UA 4G6DA 1QZYA 1OMIA 2PI0A 1R00A 3WGIA 2DPUA 3TQNA 4L5IA 2K4BA 1LEAA 5LGTA 2BGCA 3HTUA 2VE8A 2NS0A 3DEUA 2RC4A 2Z3YA 2EA2A 4G7OF 3H92A 2M8EA 2DQRA 3MEXA 3BJ6A 1G4DA 4A5MA 2HYGD 2J5OA 4WXDA 3CO6C 1J9IA 4RB1A 3GZ5A 4MTEA 4HF2A 4HF0A 5DEQA 5H6QA 4KT5C 3SHFA 1LJ9A 2F5DA 2EB7A 2FNAA 1QQIA 2M1BA 4HZFA 2EJRA 4ENKA 1F1ZA 4OOIA 3ABUA 1UHWA 3WTZA 2IA0A 2OAZA 4XSZF 3VB2A 2HQRA 2W24A 3COAC 1UCRA 3WGHA 1ZHFA 4JQFA 1DDNA 3I58A 1FBQA 3I59B 1G3WA 2P8TA 4L9NA 4M9ZA 1BI1A 3REOA 2K02A 3ZMSA 4HV6A 2DT5A 3DPTA 4ZYHA 1O7LA 4M9XA 3M9AA 3R4KA 2HQNA 2M87A 3V8JA 4IHSA 1MGTA 1I1GA 3I0TA 3T8TA 1U3EM 3F23A 2FA5A 4OMZA 2COMA 4CICA 2QM3A 3HOTA 4CZZA 1W5SA 2D2WA 3QP5A 1A04A 3CTAA 1KGSA 1ON2A 3KP3A 2H6BA 2VBWA 3L09A 1GXQA 2M30A 3RPQA 3Q9VA 3C3WA 3LA3A 3I71A 3WTUC 2DW4A 5E1ZB 2L54A 1K78B 2FNPA 4MHGA 4Z2YA 4MQVA 1FOKA 5LGUA 2LSOA 2YPRA 3LWFA 1XGNA 4KUMA 5ICGA 4U88A 3GF2A 4P9UA 1IUYA 4YIIA 1QNTA 4L9TA 4PCQA 1BC8C 3LA7A 4OIPF 1Y0UA 3IHUA 4WXCA 2FMYA 1MDMB 1B4AA 3I64A 5FD5A 4GYGA 4LG0B 5JHUA 2O03A 2YX7A 3BROA 2CYYA 3QP6A 5F1RA 2V6CA 4LD5A 2JPCA 2H09A 4P5OA 1BI2A 2QQBA 2OBPA 3MWMA 2FEZA 4I98B 1USTA 1IRFA 2MH9A 5D5XB 4HQMA 2QYOA 1FYLA 3GFIA 4FX0A 3V4GA 3I4PA 1Z6RA 2XHKA 5CVJA 1I1SA 1BN5A 3I59A 4NQWA 3KEQA 1SD4A 2O8XA 2RVCA 2JT1A 4WWCA 4UXNA 4GO1A 1BJAA 3GFLA 3W6JB 1MJBA 1E17A 1PP7U 2HFHA 2IPQX 3FZVA 3GWZA 4P9FA 2P6TA 4XSXF 3O2PE 3RTRA 2QWWA 5DCMB 5JI6A 2DI3A 5IT9K 2ZMEB 1T38A 3FF5A 1CF7B 3F72A 4EJUA 4KICA 4N9IA 4BHPA 5FLXK 3BJAA 4EM1A 2IA2A 3LAJA 1GHCA 2VBYA 3R0JA 2CQKA 2Z99A 2OD5A 3WG9A 2ZJ2A 1KQ9A 3U2RA 3IL2A 4FT8A 3GW2A 4A0XA 3KZYA 4LFUA 3HIFA 1IZ1A 5D4SA 1K78A 3QU3A 3MCZA 3R6SA 4EM0B 2BYVE 1HKQA 3DQVC 1UB9A 1HQCA 4AIKA 2G9WA 3RIRA 2F5EA 2MBFA 5CLSA 2DPDA 5HS7A 3BZ6A 3CDHA 1EH6A 1SD7A 2G7UA 2FBHA 2MLKA 4U0VA 1SD6A 2V9VA 1MDMA 3C7JA 3ZMZA 3VOEA 3ZMDA 1YTYA 2CFXA 3R61A 1PUEE 4LG0A 1U2WA 2YR2A 4U7DA 5L3FA 1I6XA 3DXJF 4HAMA 3SXYA 3RI4A 2F5CA 3IC7A 3B73A 1ZAOA 1ZLJA 4Y15A 4HOBA 2AS5F 2XVCA 1LNWA 2O0YA 4I02A 1T6SA 2FOKA 4NB5A 3BDDA 5FLXZ 2ISYA 2NYXA 1DPUA 5JVTA 3ERED 4I0BA 3KP7A 2EFOA 3P7NA 4CHUA 3G3ZA 3TO9A 2VN2A 2HZTA 2ACJA 3MFKA 4M6XA 2AXLA 3WODF 1LVAA 4OIOF 3ECHA 1T0FA 5DCMA 2IJLA 2JSCA 1RUNA 2VBXA 2ZMEA 2QBYB 3AAFA 3HSEA 3M8FA 1D8KA 2YX4A 1CF7A 4BHCA 4LB6B 3LSTA 3SZPA 5LEKA 1R7JA 2JZYA 2OU2A 4LLGF 3K1NA 1RIOH 4HX4A 2ZNZA 1U5TC 2HTJA 3TGNA 1FSEA 3MAJA 1LDDA 2UXXA 3MZHA 4RGRA 1RUOA 4GCVA 2VT3A 4UVAA 3HYIA 2QVOA 3HSRA 3S2WA 3WTYC 4O6JA 1K6OA 1KU9A 3V8KA 2IRFG 1VTNC 1C0WA 2EV6A 4D0PA 2L02A 3LAPA 2XASA 2E1CA 1UFMA 4KMUX 4A0YA 3E6CC 2DTRA 1HKSA 3TDUC 2LDUA 2HOEA 1R1VA 5A2QK 3FMRA 1OYYA 3EDPA 1YS7A 3P9CA 1H9GA 4MQ9F 4LMYA 4PDKA 2IA1A 4PZJA 3N97A 3O3KA 4S04A 4QWQA 1J7KA 3T8RA 3GFMA 1Z9CA 3T0YA 4LGWA 3GX4X 1REPC 2RV8A 2HEOA 1G3SA 1ODDA 4WX9A 4EVIA 2WV0A 3EETA 2RQPA 3F8MA 1LDKB 2PFBA 3LQRA 2EFQA 1Z91A 5ERIA 3LQQA 2FBKA 1QZZA 5DUKA 1HKTA 3TO6A 5HLHA 5FGMA 5FD6A 1IXRC 2VC1A 4N0BA 4KN7X 2W57A 1R5GA 5L3CA 1O3RA 3RPUA 2Q8KA 1Z6TA 4MEYF 5TJJA 4L18B 3KP5A 3WE2A 1YW7A 3NEUA 2GWRA 1L3LA 4WXHA 2ESHA 1LB2A 1DPRA 1GXPA 4IRIA 1ZRCA 1PDNC 3F8NA 2GXBA 4PGGA 2QBYA 1YLFA 2OA4A 2PG4A 5F6FA 2A5YB 4ENNA 3KE2A 4LK1F 5ILSA 5D5WB 1TQIA 5FO5A 1I27A 4KYWA 4R79A 2RKHA 2XRNA 1XB4A 5DCFA 5DDGA 1HBXG 5BMZA 1S7AA 5A2QZ 1Z1DA 4ZYGA 1G3TA 4EQQA 2MA3A 5IT3A 2H94A 4IPAA 1P92A 1MD0A 1G6NA 4HQEA 4IRHA 2G7HA 3HRMA 3IRQA 1MKMA 1FP1D 3ELKA 3H3ZA 2MC3A 5ILUA 5EEGA 2W84A 1KYWA 1YG2A 1HXDA 3CUQB 4M6YA 1FY7A 2VONA 1R23A 1ZREA 1GVJA 1KU7A 1FP2A 1B6AA 1FZPB 3E6BA 1ZG5A 4O3MA 2Q0OA 1XCBA 4EGYA 1HW5A 1RI7A 3VODA 1WSUA 1HSJA 1IAWA 3H3UA 2P7VB 1ZRDA 4CGZA 1WI9A 4UHTA 3D0SA 2KIUA 3HOSA 3KP2A 1XDSA 1XSVA 2D1HA 2PLYA 3K1PA 4IRGA 3BJOA 1WQ2A 1D3YA 2MH2A 4BHBA 3WTSC 5L3BA 2ADUA 5DD4A 3TO7A 2XAHA 4B09A 2PEXA 4G9YA 2PMHA 1SFEA 2PMUA 3JAMZ 4UUVA 2TDXA 1MJAA 4Y17A 1XSXA 3RKXA 3ECOA 2HTSA 2GXGA 3V7RA 3Q5FA 1S7OA 3FXUA 1BIAA 4K2EA 4LLNA 4EJVA 2P5KA 1BOAA 3C18A 4OIQF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R22 A;  1XMA A;  2RN7 A;  1YYV A;  2PN6 A;  3F3X A;  1J2X A;  3GLX A;  3R0A A;  5HS8 A;  1KU2 A;  4WF2 A;  5LGN A;  2E1N A;  2O6G E;  3E97 A;  4RB3 C;  4ESB A;  2Y0M A;  4A6D A;  3HSF A;  4M73 A;  2R7F A;  1XGS A;  2KRF A;  2GQQ A;  2IP2 A;  1BI0 A;  3IWZ A;  2HKO A;  4XRF A;  3KP6 A;  3DF8 A;  2HGC A;  5ICF A;  1HW2 A;  1B9N A;  2KIF A;  4RS8 A;  5ICC A;  4HV5 A;  1FSH A;  3E6M A;  1K7A A;  4GGG A;  1R1T A;  4MGR A;  4E70 A;  2EK5 A;  5KVR A;  3CUQ A;  3N4M A;  1IF1 A;  4HDU A;  2QQ9 A;  5CVV A;  3FHZ A;  2HYF A;  1O3S A;  2A6E F;  3W6K B;  4Q4Z F;  1U6G A;  4EV0 A;  4A2U A;  3J7A O;  4F7Z A;  4AIJ A;  2LKP A;  4IXA A;  2WC2 A;  2C6Y A;  5E18 F;  1R36 A;  5D8L B;  4XLN F;  3E6D A;  5D6E A;  5BPI A;  5D4R A;  2LF7 A;  3HHG A;  4NHJ A;  3B02 A;  1IN5 A;  1EH8 A;  2OQR A;  2PBI A;  3ZQ7 A;  1D5V A;  2PJP A;  4IHT A;  1ZH5 A;  5TRD A;  2EV0 A;  3GXO A;  1UHM A;  4ASN A;  2B0L A;  4ENJ A;  2XKP A;  2QLZ A;  5E17 F;  1R58 A;  2IW5 A;  4Q5S F;  5CVR A;  3NRV A;  1JE8 A;  4HYE A;  2QZ8 A;  4TV7 A;  3GZ6 A;  1NHA A;  4KNY A;  4ETS A;  3PQK A;  3F21 A;  4EGZ A;  3HRT A;  1HST A;  1TNS A;  4ENM A;  1B9M A;  3KLO A;  3IKT A;  2EFN A;  1B59 A;  5L3D A;  3WTW C;  4IVN A;  5F64 A;  2HS5 A;  4M9S A;  4MEX F;  2MD5 A;  2H27 A;  3TDZ C;  2H6C A;  2F5F A;  2LNB A;  3F8C A;  1L0O C;  3WTV C;  5LHH A;  2EV5 A;  1W5T A;  6PAX A;  2M45 A;  1KU3 A;  2M5W A;  4ESF A;  4WK8 F;  3HRU A;  3KET A;  3ML6 A;  2BBY A;  2XAJ A;  3WU1 B;  3P9I A;  2K27 A;  1QBJ A;  3QPT A;  1LQ1 A;  3F6V A;  5K5Q A;  2QUF A;  5LBQ A;  3EYI A;  3LA2 A;  2HDC A;  3M8E A;  4GXO A;  4UVC A;  4LB5 A;  4S05 A;  3VFZ A;  2ESN A;  2GIV A;  1T39 A;  3MZY A;  1H9T A;  2JPB A;  2W25 A;  4OMY A;  4FHT A;  1ZG1 A;  3J81 Z;  4G8X A;  2FSW A;  1YFH A;  5FFX A;  1ZAR A;  4A0Z A;  3FX3 A;  3RKY A;  2KJB A;  3K1M A;  5HLI A;  2UWM A;  3FMS A;  2V1U A;  3PFI A;  3GVA A;  3RJP A;  3E5Q A;  4KIF A;  1SFU A;  1AWC A;  3IWF A;  1YO5 C;  4G7H F;  4RB2 C;  1TBX A;  1XMK A;  1XD7 A;  3KP4 A;  1QGP A;  4YFK F;  2EFW A;  3J80 K;  2FQ3 A;  2Z9O A;  2VOP A;  4Y13 A;  2DK5 A;  1IN7 A;  1SMT A;  2O3F A;  2Z5U A;  5E20 A;  4I01 A;  3WE3 A;  1JHF A;  2UXN A;  3K2Z A;  1J0R A;  4A12 A;  2DQL A;  2P4W A;  2HWV A;  1KQ0 A;  2NNY A;  2X0L A;  3ROU A;  4BH9 A;  2E7W A;  1WRJ A;  2A6H F;  4RB0 A;  3KCC A;  1XSD A;  4M71 A;  1O3T A;  1YW8 A;  4BYY A;  1IW7 F;  3JSO A;  2L4A A;  4R1H A;  4G7Z F;  1TW3 A;  1FWZ A;  2CG4 A;  3BPV A;  2VOD A;  2A68 F;  2P5L C;  2F2E A;  2DK8 A;  2L3D A;  1FT9 A;  3U9G A;  3BY6 A;  2Z33 A;  1IXS B;  4ZZL A;  1I5Z A;  1JXS A;  1RZ4 A;  2ZXJ A;  1SAX A;  2D45 A;  3ZN0 A;  2QQA A;  4KIG A;  1ZRF A;  5CVI A;  1FC3 A;  1MJ9 A;  2P6S A;  4KA4 A;  5CYV A;  3V7C A;  2NRA C;  1ON1 A;  1YQA A;  3G73 A;  1ZYR F;  3EQL F;  1LDJ A;  4WCG A;  2K4J A;  3J80 Z;  3HTS B;  2GZW A;  2FRH A;  4LJZ F;  2KJC A;  4LLL A;  2EFP A;  3WU0 A;  2ZCW A;  3E5U A;  1V4R A;  1ONV A;  1KA8 A;  1ZGA A;  2O61 A;  3QAH A;  1O57 A;  3TKY A;  4KIB A;  4XBF A;  1U78 A;  2XV4 S;  3L00 A;  4BAY A;  1BC7 C;  1Q1H A;  1FBU A;  2CSO A;  2UZK A;  4H0E A;  2BEO A;  3NQO A;  4I7H A;  1DP7 P;  3JAM K;  3K69 A;  1XDU A;  3SQN A;  2FF4 A;  4BXU A;  3KEO A;  2KIM A;  3CO7 C;  1W4M A;  2V1X A;  3QRF F;  4L5J A;  3BOQ A;  1ZLK A;  3T1B A;  1SMY F;  3TOB A;  3CUO A;  4G94 A;  5HDN A;  4EMS A;  3DPL C;  1O3Q A;  2FE3 A;  2PQ8 A;  2FU4 A;  1OR7 A;  3JTH A;  2Y48 A;  4L0Y B;  1ZG3 A;  2YSR A;  4AVP A;  4YG2 F;  1RNL A;  3E3V A;  5HDK A;  1JGS A;  2LF8 A;  2ZFW A;  4FX4 A;  4DQ2 A;  1BM9 A;  5BQT A;  3EYY A;  1BI3 A;  1U8R A;  2XIG A;  5LRS A;  5D8K B;  1XCV A;  2V1D A;  4ESJ A;  4HW0 A;  5BOX A;  4L9V A;  1BIB A;  5DUI A;  3JW4 A;  3P9K A;  1S3J A;  3VEP A;  3I54 A;  1IN8 A;  3ZMU A;  1DUX C;  1USS A;  4MTD A;  4EM2 A;  3I53 A;  2XAQ A;  5LHI A;  2HR3 A;  5LHG A;  3QOP A;  1U5T B;  2MLG A;  4HBL A;  4CXF A;  3Q9S A;  3QU6 A;  2V79 A;  5H20 A;  1LEB A;  1FBS A;  3F6O A;  3I5U A;  4BNC A;  3GYH X;  3OV8 A;  3F22 A;  3K9T A;  3DP7 A;  4OIR F;  4IJA A;  1E2X A;  1TNT A;  4UNO A;  3ZN1 A;  1WKM A;  2JRT A;  1XGM A;  3QPH A;  4KDP A;  1WWX A;  4RGS A;  2A3S A;  4L9J A;  3L2C A;  1V3F A;  5E1X A;  3BPX A;  1SFX A;  4U0Y A;  2VT2 A;  3V8L A;  1IXC A;  2DO7 A;  3JTG A;  2W85 A;  2JTV A;  3FWE A;  2BE5 F;  1H0M A;  3RDI A;  5E8G A;  1J59 A;  4I0A A;  5HLG A;  5LEJ A;  1J5Y A;  4MNU A;  4EJT A;  3M7G A;  5ED4 A;  2CGP A;  4R8H A;  4BQA A;  1F9N A;  3KLN A;  2XAF A;  2ZNY A;  4KN4 X;  4CO8 A;  2ZO4 A;  4ZYE A;  2NAZ A;  3OOP A;  2DBB A;  1ZGJ A;  1S29 A;  2XUB A;  1TQM A;  4RGU A;  5HS9 A;  1D8J A;  4AWX B;  2YU3 A;  3IKV A;  3BP8 A;  2STT A;  1OYW A;  3ZPL A;  2EWN A;  3BWG A;  1B1B A;  4UV8 A;  3HHH A;  3FXR A;  4G6Q A;  1Z05 A;  3GUD A;  5DV5 A;  1W7P B;  2VXZ A;  3DFG A;  2J5P A;  5JFR A;  1K79 A;  5CVU A;  3F8B A;  2BV6 A;  2DLL A;  4JK1 X;  4RGX A;  3FMQ A;  5HVQ C;  3L9F A;  1QO0 D;  5KK1 A;  3TOA A;  5K1Y A;  2VOO A;  5D6F A;  5H6R A;  3FM5 A;  3KFW X;  4YIF A;  2GAU A;  2E7X A;  5DD8 A;  1R1U A;  2RGV A;  4L0Z B;  3DKW A;  1CGP A;  2RNJ A;  3ZP5 A;  1U5T A;  2A69 F;  4JBA A;  5EEH A;  1FNN A;  5HOO A;  3T5X A;  2NNN A;  2GA1 A;  1QPM A;  3J81 K;  3K0L A;  1YS6 A;  1G3Y A;  3HUG A;  4CDG A;  1P4W A;  2R7D A;  5L3G A;  2FML A;  4O5V A;  1ZN2 A;  5BS6 A;  5JR3 A;  4EJO A;  3SZT A;  1TW2 A;  3CJN A;  1FPQ A;  2R3S A;  1J75 A;  5BPD A;  2WWY A;  3GFJ A;  1P4X A;  4HA8 A;  2A61 A;  2L4M A;  4YFN F;  5DYM A;  5AIQ A;  4U7B A;  2P5V A;  1OKR A;  3GO5 A;  1OPC A;  2VC0 A;  4M72 A;  2K86 A;  3FM3 A;  2X4H A;  3EUH A;  1T2K A;  2VBZ A;  2A07 F;  3WGG A;  2L01 A;  1MZB A;  5HDG A;  3MQ0 A;  2OZU A;  2DU9 A;  5E1W A;  1S8N A;  3L7W A;  3U1D A;  1TQP A;  4HLY A;  3GEZ A;  5FFZ A;  5AON A;  1P2F A;  4Q48 A;  3DV8 A;  1SD5 A;  5IT9 Z;  1EH7 A;  1W7P A;  4A5N A;  3ULQ B;  2DFI A;  1P4A A;  3ABT A;  1W7P D;  4B8X A;  2OQG A;  4I2O A;  2K7L A;  3CUQ C;  1EV7 A;  5ICE A;  4IF4 A;  2EA4 A;  1FYK A;  4EJW A;  1F4K A;  4RAY A;  5D5V B;  1TLH B;  4KMF A;  4I09 A;  3RYR A;  4HLX A;  1F5T A;  1FX7 A;  1R5H A;  2XAG A;  3LFK A;  4AIH A;  4HF1 A;  2KKO A;  2Q2E A;  2RDP A;  3ZMT A;  4XLP F;  4ZZD A;  1IN6 A;  5AIP A;  3SFZ A;  5ILV A;  3E5X A;  1T98 A;  2P7C B;  2QEN A;  2Y75 A;  5K5O A;  1O7F A;  3IRR A;  3JSP A;  1TTY A;  5J8F A;  2IT0 A;  4U0W A;  3CLO A;  1YW9 A;  4OU0 A;  4RAZ A;  2CWE A;  2ELH A;  1AOY A;  1P6R A;  3C1D A;  4UVB A;  1FYM A;  2D1V A;  5FB2 A;  5LRR A;  5CJ9 A;  5J6X A;  5LLQ A;  2CO5 A;  4Q47 A;  4P55 A;  1IN4 A;  3F8F A;  5L3E A;  1KQ8 A;  4N9H A;  3D5L A;  2ETH A;  2VE9 A;  4HX7 A;  3ZMV A;  5J8C A;  1XGO A;  1S6L A;  4HDV A;  4KFC A;  2FBI A;  1OYI A;  3V7S A;  2DAO A;  4A6E A;  4CYD A;  3FXQ A;  2HKX A;  3WTX C;  3PQJ A;  1IRG A;  4ZH4 F;  5K5R A;  2ISZ A;  2ZKZ A;  2XGX A;  4ZYD A;  4ON0 A;  4GYI A;  1HW1 A;  1YIO A;  4LK0 F;  3O6B B;  4UV9 A;  3RKW A;  1KYZ A;  4M74 A;  2IVM A;  2GA2 A;  4YFX F;  3HRS A;  3R60 A;  1PP8 F;  3ISP A;  2FXA A;  4DNC A;  1ULY A;  1FLI A;  3WTT C;  2XKO A;  4AD9 A;  2CW0 F;  4P96 A;  1STZ A;  3M1E A;  4QLC U;  4PGH A;  4OIN F;  5E8I A;  2WTE A;  3KZZ A;  4HX8 A;  2XRO A;  1XN7 A;  1JHH A;  1BBY A;  5D5U B;  2STW A;  1Z7U A;  2ZBK A;  2OZ6 A;  3RYP A;  1X3U A;  4G6D A;  1QZY A;  1OMI A;  2PI0 A;  1R00 A;  3WGI A;  2DPU A;  3TQN A;  4L5I A;  2K4B A;  1LEA A;  5LGT A;  2BGC A;  3HTU A;  2VE8 A;  2NS0 A;  3DEU A;  2RC4 A;  2Z3Y A;  2EA2 A;  4G7O F;  3H92 A;  2M8E A;  2DQR A;  3MEX A;  3BJ6 A;  1G4D A;  4A5M A;  2HYG D;  2J5O A;  4WXD A;  3CO6 C;  1J9I A;  4RB1 A;  3GZ5 A;  4MTE A;  4HF2 A;  4HF0 A;  5DEQ A;  5H6Q A;  4KT5 C;  3SHF A;  1LJ9 A;  2F5D A;  2EB7 A;  2FNA A;  1QQI A;  2M1B A;  4HZF A;  2EJR A;  4ENK A;  1F1Z A;  4OOI A;  3ABU A;  1UHW A;  3WTZ A;  2IA0 A;  2OAZ A;  4XSZ F;  3VB2 A;  2HQR A;  2W24 A;  3COA C;  1UCR A;  3WGH A;  1ZHF A;  4JQF A;  1DDN A;  3I58 A;  1FBQ A;  3I59 B;  1G3W A;  2P8T A;  4L9N A;  4M9Z A;  1BI1 A;  3REO A;  2K02 A;  3ZMS A;  4HV6 A;  2DT5 A;  3DPT A;  4ZYH A;  1O7L A;  4M9X A;  3M9A A;  3R4K A;  2HQN A;  2M87 A;  3V8J A;  4IHS A;  1MGT A;  1I1G A;  3I0T A;  3T8T A;  1U3E M;  3F23 A;  2FA5 A;  4OMZ A;  2COM A;  4CIC A;  2QM3 A;  3HOT A;  4CZZ A;  1W5S A;  2D2W A;  3QP5 A;  1A04 A;  3CTA A;  1KGS A;  1ON2 A;  3KP3 A;  2H6B A;  2VBW A;  3L09 A;  1GXQ A;  2M30 A;  3RPQ A;  3Q9V A;  3C3W A;  3LA3 A;  3I71 A;  3WTU C;  2DW4 A;  5E1Z B;  2L54 A;  1K78 B;  2FNP A;  4MHG A;  4Z2Y A;  4MQV A;  1FOK A;  5LGU A;  2LSO A;  2YPR A;  3LWF A;  1XGN A;  4KUM A;  5ICG A;  4U88 A;  3GF2 A;  4P9U A;  1IUY A;  4YII A;  1QNT A;  4L9T A;  4PCQ A;  1BC8 C;  3LA7 A;  4OIP F;  1Y0U A;  3IHU A;  4WXC A;  2FMY A;  1MDM B;  1B4A A;  3I64 A;  5FD5 A;  4GYG A;  4LG0 B;  5JHU A;  2O03 A;  2YX7 A;  3BRO A;  2CYY A;  3QP6 A;  5F1R A;  2V6C A;  4LD5 A;  2JPC A;  2H09 A;  4P5O A;  1BI2 A;  2QQB A;  2OBP A;  3MWM A;  2FEZ A;  4I98 B;  1UST A;  1IRF A;  2MH9 A;  5D5X B;  4HQM A;  2QYO A;  1FYL A;  3GFI A;  4FX0 A;  3V4G A;  3I4P A;  1Z6R A;  2XHK A;  5CVJ A;  1I1S A;  1BN5 A;  3I59 A;  4NQW A;  3KEQ A;  1SD4 A;  2O8X A;  2RVC A;  2JT1 A;  4WWC A;  4UXN A;  4GO1 A;  1BJA A;  3GFL A;  3W6J B;  1MJB A;  1E17 A;  1PP7 U;  2HFH A;  2IPQ X;  3FZV A;  3GWZ A;  4P9F A;  2P6T A;  4XSX F;  3O2P E;  3RTR A;  2QWW A;  5DCM B;  5JI6 A;  2DI3 A;  5IT9 K;  2ZME B;  1T38 A;  3FF5 A;  1CF7 B;  3F72 A;  4EJU A;  4KIC A;  4N9I A;  4BHP A;  5FLX K;  3BJA A;  4EM1 A;  2IA2 A;  3LAJ A;  1GHC A;  2VBY A;  3R0J A;  2CQK A;  2Z99 A;  2OD5 A;  3WG9 A;  2ZJ2 A;  1KQ9 A;  3U2R A;  3IL2 A;  4FT8 A;  3GW2 A;  4A0X A;  3KZY A;  4LFU A;  3HIF A;  1IZ1 A;  5D4S A;  1K78 A;  3QU3 A;  3MCZ A;  3R6S A;  4EM0 B;  2BYV E;  1HKQ A;  3DQV C;  1UB9 A;  1HQC A;  4AIK A;  2G9W A;  3RIR A;  2F5E A;  2MBF A;  5CLS A;  2DPD A;  5HS7 A;  3BZ6 A;  3CDH A;  1EH6 A;  1SD7 A;  2G7U A;  2FBH A;  2MLK A;  4U0V A;  1SD6 A;  2V9V A;  1MDM A;  3C7J A;  3ZMZ A;  3VOE A;  3ZMD A;  1YTY A;  2CFX A;  3R61 A;  1PUE E;  4LG0 A;  1U2W A;  2YR2 A;  4U7D A;  5L3F A;  1I6X A;  3DXJ F;  4HAM A;  3SXY A;  3RI4 A;  2F5C A;  3IC7 A;  3B73 A;  1ZAO A;  1ZLJ A;  4Y15 A;  4HOB A;  2AS5 F;  2XVC A;  1LNW A;  2O0Y A;  4I02 A;  1T6S A;  2FOK A;  4NB5 A;  3BDD A;  5FLX Z;  2ISY A;  2NYX A;  1DPU A;  5JVT A;  3ERE D;  4I0B A;  3KP7 A;  2EFO A;  3P7N A;  4CHU A;  3G3Z A;  3TO9 A;  2VN2 A;  2HZT A;  2ACJ A;  3MFK A;  4M6X A;  2AXL A;  3WOD F;  1LVA A;  4OIO F;  3ECH A;  1T0F A;  5DCM A;  2IJL A;  2JSC A;  1RUN A;  2VBX A;  2ZME A;  2QBY B;  3AAF A;  3HSE A;  3M8F A;  1D8K A;  2YX4 A;  1CF7 A;  4BHC A;  4LB6 B;  3LST A;  3SZP A;  5LEK A;  1R7J A;  2JZY A;  2OU2 A;  4LLG F;  3K1N A;  1RIO H;  4HX4 A;  2ZNZ A;  1U5T C;  2HTJ A;  3TGN A;  1FSE A;  3MAJ A;  1LDD A;  2UXX A;  3MZH A;  4RGR A;  1RUO A;  4GCV A;  2VT3 A;  4UVA A;  3HYI A;  2QVO A;  3HSR A;  3S2W A;  3WTY C;  4O6J A;  1K6O A;  1KU9 A;  3V8K A;  2IRF G;  1VTN C;  1C0W A;  2EV6 A;  4D0P A;  2L02 A;  3LAP A;  2XAS A;  2E1C A;  1UFM A;  4KMU X;  4A0Y A;  3E6C C;  2DTR A;  1HKS A;  3TDU C;  2LDU A;  2HOE A;  1R1V A;  5A2Q K;  3FMR A;  1OYY A;  3EDP A;  1YS7 A;  3P9C A;  1H9G A;  4MQ9 F;  4LMY A;  4PDK A;  2IA1 A;  4PZJ A;  3N97 A;  3O3K A;  4S04 A;  4QWQ A;  1J7K A;  3T8R A;  3GFM A;  1Z9C A;  3T0Y A;  4LGW A;  3GX4 X;  1REP C;  2RV8 A;  2HEO A;  1G3S A;  1ODD A;  4WX9 A;  4EVI A;  2WV0 A;  3EET A;  2RQP A;  3F8M A;  1LDK B;  2PFB A;  3LQR A;  2EFQ A;  1Z91 A;  5ERI A;  3LQQ A;  2FBK A;  1QZZ A;  5DUK A;  1HKT A;  3TO6 A;  5HLH A;  5FGM A;  5FD6 A;  1IXR C;  2VC1 A;  4N0B A;  4KN7 X;  2W57 A;  1R5G A;  5L3C A;  1O3R A;  3RPU A;  2Q8K A;  1Z6T A;  4MEY F;  5TJJ A;  4L18 B;  3KP5 A;  3WE2 A;  1YW7 A;  3NEU A;  2GWR A;  1L3L A;  4WXH A;  2ESH A;  1LB2 A;  1DPR A;  1GXP A;  4IRI A;  1ZRC A;  1PDN C;  3F8N A;  2GXB A;  4PGG A;  2QBY A;  1YLF A;  2OA4 A;  2PG4 A;  5F6F A;  2A5Y B;  4ENN A;  3KE2 A;  4LK1 F;  5ILS A;  5D5W B;  1TQI A;  5FO5 A;  1I27 A;  4KYW A;  4R79 A;  2RKH A;  2XRN A;  1XB4 A;  5DCF A;  5DDG A;  1HBX G;  5BMZ A;  1S7A A;  5A2Q Z;  1Z1D A;  4ZYG A;  1G3T A;  4EQQ A;  2MA3 A;  5IT3 A;  2H94 A;  4IPA A;  1P92 A;  1MD0 A;  1G6N A;  4HQE A;  4IRH A;  2G7H A;  3HRM A;  3IRQ A;  1MKM A;  1FP1 D;  3ELK A;  3H3Z A;  2MC3 A;  5ILU A;  5EEG A;  2W84 A;  1KYW A;  1YG2 A;  1HXD A;  3CUQ B;  4M6Y A;  1FY7 A;  2VON A;  1R23 A;  1ZRE A;  1GVJ A;  1KU7 A;  1FP2 A;  1B6A A;  1FZP B;  3E6B A;  1ZG5 A;  4O3M A;  2Q0O A;  1XCB A;  4EGY A;  1HW5 A;  1RI7 A;  3VOD A;  1WSU A;  1HSJ A;  1IAW A;  3H3U A;  2P7V B;  1ZRD A;  4CGZ A;  1WI9 A;  4UHT A;  3D0S A;  2KIU A;  3HOS A;  3KP2 A;  1XDS A;  1XSV A;  2D1H A;  2PLY A;  3K1P A;  4IRG A;  3BJO A;  1WQ2 A;  1D3Y A;  2MH2 A;  4BHB A;  3WTS C;  5L3B A;  2ADU A;  5DD4 A;  3TO7 A;  2XAH A;  4B09 A;  2PEX A;  4G9Y A;  2PMH A;  1SFE A;  2PMU A;  3JAM Z;  4UUV A;  2TDX A;  1MJA A;  4Y17 A;  1XSX A;  3RKX A;  3ECO A;  2HTS A;  2GXG A;  3V7R A;  3Q5F A;  1S7O A;  3FXU A;  1BIA A;  4K2E A;  4LLN A;  4EJV A;  2P5K A;  1BOA A;  3C18 A;  4OIQ F; 
#chains in the Genus database with same CATH topology
 4BUP A;  3W2A A;  1R22 A;  3WHC A;  4HNU A;  1XMA A;  1SFK A;  1VQP I;  2RN7 A;  4M3D A;  2R93 J;  1YYV A;  4KT6 A;  2PN6 A;  2R7V A;  3F3X A;  3JRD A;  1DGW Y;  1J2X A;  3GLX A;  3R0A A;  5HS8 A;  2DA6 A;  3VYU B;  2JA7 J;  1KU2 A;  2EIK H;  3QPS A;  1OQY A;  1VQ8 I;  5JHF A;  3S1Q J;  4WF2 A;  1PUF B;  4C3I J;  5LGN A;  2E1N A;  2O6G E;  4DYQ A;  5IP6 A;  2LBF B;  3E97 A;  4RB3 C;  2R5Y B;  4A3I J;  4ESB A;  2JUG A;  2Y0M A;  4A6D A;  1AKH A;  3HSF A;  4M73 A;  2R7F A;  3ZOB A;  4B48 A;  2L9R A;  4XKW A;  2GLO A;  1XGS A;  5GPC A;  2R7U A;  2KRF A;  4M3G A;  2GQQ A;  2IP2 A;  1BI0 A;  4KIS A;  3IWZ A;  2HKO A;  4XRF A;  3KP6 A;  1E3P A;  1T33 A;  3DF8 A;  2HGC A;  5ICF A;  1HW2 A;  1B9N A;  2KIF A;  3OR1 C;  4IHY A;  3OYH A;  4RS8 A;  2F4O B;  4A93 J;  5ICC A;  4HV5 A;  1FSH A;  1YE9 A;  3E6M A;  1K7A A;  3E1S A;  4GGG A;  2OTJ I;  1JKR C;  1R1T A;  1SAN A;  1H89 C;  4MGR A;  3GTK J;  4E70 A;  2EK5 A;  3KPH A;  4XL9 A;  4YEL A;  5KVR A;  5EJC A;  3CUQ A;  3N4M A;  1IF1 A;  2XGC A;  3OYL A;  4HDU A;  2QQ9 A;  5CVV A;  5FKO A;  2ZJP F;  1D0Z A;  4FTH A;  3FHZ A;  2HYF A;  1O3S A;  2A6E F;  3W6K B;  1Z3X A;  4CYC A;  3I3L A;  2LKS A;  4NNJ A;  4Q4Z F;  1U9N A;  1Z7L A;  3HOZ J;  4PFP A;  3OYB A;  1QHG A;  1U6G A;  4EV0 A;  2WY8 Q;  4A2U A;  4Y4R A;  3J7A O;  3FXK A;  4F7Z A;  4BU2 A;  4AIJ A;  5EG0 A;  4N4N B;  2V9P A;  2IBD A;  2VQC A;  3LSJ A;  5B1B H;  5F0H A;  1YOV B;  4XOT A;  2LKP A;  4NDL A;  4IXA A;  2K85 A;  1FOW A;  2ECB A;  2JSP A;  2WC2 A;  2UV1 A;  2C6Y A;  2IS1 A;  2JVH A;  2EIJ H;  5E18 F;  1R36 A;  2FUG 2;  2HXI A;  4ITV A;  5D8L B;  1X1B A;  1PJR A;  4UY8 I;  2F5V A;  4XLN F;  3E6D A;  5D6E A;  5B3S H;  5BPI A;  1YJ9 I;  3CD6 I;  5CQG A;  3JRE A;  5D4R A;  2LF7 A;  3HHG A;  1QPI A;  4NHJ A;  2W82 A;  3QYB A;  3B02 A;  1IN5 A;  1D0Y A;  1EH8 A;  2OQR A;  4E7J A;  2PBI A;  3ZQ7 A;  4F55 A;  1VND A;  1A6I A;  2JA8 J;  2PJP A;  1D5V A;  4IHT A;  3HBL A;  1Z21 A;  2ZSH B;  1ZH5 A;  3OL3 A;  5TRD A;  1JI8 A;  2MW8 A;  2EV0 A;  3GXO A;  2HXO A;  1UHM A;  4ASN A;  2B0L A;  2QSH X;  4ENJ A;  2XKP A;  4UUT A;  2QLZ A;  5E17 F;  1R58 A;  1U9O A;  1ZTR A;  2IW5 A;  4Q5S F;  3LFU A;  1WJC A;  5CVR A;  2DA4 A;  3G2B A;  3HGY A;  3NRV A;  4HYE A;  4BEH B;  4E7H A;  1JE8 A;  2IGO A;  2QZ8 A;  2KL4 A;  3G71 I;  4A3C J;  5J3L A;  4TV7 A;  3GBG A;  3GZ6 A;  3S16 J;  4OAY A;  1NHA A;  2W48 A;  4KNY A;  2E71 A;  2B63 J;  1I3A A;  2XSJ C;  1XG1 A;  4M3F A;  4ETS A;  2DJI A;  3PQK A;  3W2V A;  1IDZ A;  3F21 A;  4E7I A;  5C44 J;  1WVR A;  2KIQ A;  4EGZ A;  3WG7 H;  2JA2 A;  3HRT A;  4I6Z A;  1HST A;  1TNS A;  4ENM A;  1MSE C;  1B9M A;  2FX0 A;  3KLO A;  4G6T B;  1MH3 A;  4ZJZ A;  3IKT A;  4IOC F;  2EFN A;  1B59 A;  5L3D A;  3WTW C;  4IVN A;  4XID A;  2LY1 A;  5F64 A;  2FOW A;  2HS5 A;  4M9S A;  1VFC A;  1PUF A;  4MEX F;  1V5E A;  2LBF A;  1X4P A;  1LUJ B;  2MD5 A;  2R5Y A;  2H27 A;  3TDZ C;  1HF0 A;  3HB9 A;  1YRN B;  2H6C A;  3GTL J;  2F5F A;  2LNB A;  3F8C A;  3NWS A;  5J1U A;  1L0O C;  3HPH A;  3WTV C;  5LHH A;  1G59 A;  1BL0 A;  3CMA I;  2EV5 A;  3K4C A;  1FJL A;  1EF4 A;  1W5T A;  6PAX A;  5JLW A;  2M45 A;  1WZ2 A;  1E0E A;  1KU3 A;  2M5W A;  2R0Q C;  4ESF A;  4WK8 F;  1ETW A;  3ZQC A;  5M3M J;  3DTI A;  3HRU A;  2K9S A;  3QOD A;  3B6A A;  3KET A;  3ML6 A;  5CPR B;  4MFE A;  2ECC A;  2BBY A;  2BY2 A;  3HGG A;  1Q1V A;  2XAJ A;  3WU1 B;  1K4T A;  4PSX A;  3ESW B;  3P9I A;  2K27 A;  1QBJ A;  1LFB A;  3QPT A;  1LQ1 A;  2Z16 A;  3F6V A;  2YS9 A;  1LE8 B;  5K5Q A;  2QUF A;  5LBQ A;  1BW6 A;  3EYI A;  4XRS A;  3LA2 A;  5JLX A;  2HDC A;  3M8E A;  3S1M J;  4GXO A;  1JKO C;  4CCJ A;  2JJ7 A;  4UVC A;  4LB5 A;  4S05 A;  2R7S A;  3VFZ A;  2OCE A;  3M8J A;  2ESN A;  2GIV A;  1T39 A;  1TT5 B;  3MZY A;  4X0G A;  1H9T A;  2JPB A;  2W25 A;  3BTL A;  3K4L A;  4OMY A;  4FHT A;  3IH2 A;  1ZG1 A;  3J81 Z;  4G8X A;  2FSW A;  4FE7 A;  1YFH A;  4QIW N;  5FFX A;  1ZAR A;  3M4O J;  4ANJ A;  2X1D A;  3A0H C;  4DIQ A;  2R7Z J;  4A0Z A;  1W36 D;  2X6W A;  3W3C A;  2R5Z B;  3FX3 A;  3RKY A;  2KJB A;  1ZR2 A;  1T08 B;  1NK3 P;  3K1M A;  1GLN A;  4II2 A;  5HLI A;  2UWM A;  3H36 A;  1OLT A;  3FMS A;  2V1U A;  1Z67 A;  3PFI A;  1MH4 A;  3S8P A;  1EA3 A;  2XPU A;  3GVA A;  4B1R A;  3RJP A;  3E5Q A;  4KIF A;  3PM1 A;  1SFU A;  3EUA A;  1AWC A;  3IWF A;  1N25 A;  3TP3 A;  1YO5 C;  3PJR A;  4G7H F;  4W97 A;  1BW5 A;  4RB2 C;  1TBX A;  1XMK A;  4UUS B;  3I55 I;  1XD7 A;  3ABL H;  3KP4 A;  1QGP A;  4YFK F;  1LFP A;  2HNH A;  1S7E A;  2EFW A;  2UUZ A;  3J80 K;  3BTI A;  2YU9 J;  2FQ3 A;  4BBR J;  2BHY A;  4J00 A;  2Z9O A;  2OPT A;  3LSG A;  2VOP A;  2XF5 A;  4JP0 A;  4Y13 A;  5DM6 F;  3OYI A;  2KQR A;  2BHZ A;  2DK5 A;  4BXF A;  4XMY A;  3OYE A;  4HSR A;  4XN3 A;  1IN7 A;  1SMT A;  4BEH A;  4IQJ A;  2O3F A;  2Z5U A;  5E20 A;  4I01 A;  5GAH J;  5IOZ A;  2EH3 A;  3MKL A;  1JHF A;  3WE3 A;  2UXN A;  3K2Z A;  3ZR8 X;  1J0R A;  4A12 A;  3FXL A;  2IS2 A;  1S72 I;  2DQL A;  2P4W A;  2HWV A;  1RES A;  1KQ0 A;  2NNY A;  2X0L A;  3ROU A;  1QA6 A;  4IEJ A;  4BH9 A;  1VF9 A;  1LFU P;  2E7W A;  1OCP A;  1WRJ A;  2A6H F;  3ZQI A;  4RB0 A;  1JJ8 C;  2ZSI B;  3KCC A;  5DS9 A;  3H0G J;  4JOM A;  1MW7 A;  1MBK A;  4JX6 A;  1XSD A;  4M71 A;  1O3T A;  1YW8 A;  5B1A H;  1QU3 A;  3GTQ J;  4BYY A;  1IW7 F;  2ZFU A;  3JSO A;  1OCR H;  1Y8R B;  2L4A A;  4R1H A;  4G7Z F;  1TW3 A;  3JRI A;  1FWZ A;  1YRN A;  2Y31 A;  2CG4 A;  3BPV A;  2VOD A;  4NUB A;  1IJW C;  2A68 F;  4ZTJ A;  2CV1 A;  2P5L C;  3BR1 A;  2F2E A;  2JA5 J;  2DT6 A;  2JVG A;  2EIM H;  2DK8 A;  1Y6I A;  2EBI A;  2L3D A;  4XRM A;  5CKT A;  1WJE A;  1FT9 A;  3U9G A;  4BJT A;  3BY6 A;  2Z33 A;  1IXS B;  2M0M A;  4ZZL A;  1I5Z A;  1JXS A;  1RZ4 A;  2ZXJ A;  1SAX A;  2D45 A;  3ZN0 A;  2QQA A;  4XR6 A;  4KIG A;  1ZRF A;  2VJI A;  5CVI A;  1I3Q J;  4BQN A;  3OYG A;  1FC3 A;  2WAE A;  1MJ9 A;  3BR2 A;  2P6S A;  4KA4 A;  1YHQ I;  5CYV A;  3V7C A;  2NRA C;  1ON1 A;  2DMT A;  1YQA A;  3G73 A;  2X48 A;  3H1C A;  1LE8 A;  2VQH A;  4XN0 A;  1ZYR F;  3CDI A;  4Z6Y A;  2DYR H;  3EQL F;  1LDJ A;  4UB6 C;  1IDY A;  3IAM 2;  4AID A;  4WCG A;  2CUF A;  2K4J A;  3J80 Z;  3HTS B;  4D1Q A;  2VB6 A;  2GZW A;  4C3J J;  3BG9 A;  1HCR A;  2FRH A;  1ZK8 A;  4LJZ F;  4IZZ A;  2KJC A;  4LLL A;  1JJ6 C;  1NG6 A;  4XKB A;  1OIS A;  2EFP A;  3WU0 A;  4NC8 A;  2NVU B;  2ZCW A;  3E5U A;  4PK4 A;  1V4R A;  2EZH A;  1ONV A;  1MMG A;  1ZKG A;  1KA8 A;  1ZGA A;  2O61 A;  2XGD A;  3QAH A;  4F3Q A;  1H88 C;  5J1R A;  1WCM J;  4XRS G;  1W5C C;  4GRI A;  1O57 A;  2R5Z A;  3DLA A;  3AG3 H;  1V54 H;  3TKY A;  4KIB A;  4XBF A;  1U78 A;  4XKV A;  1BA5 A;  2E1M C;  1MBJ A;  2XV4 S;  3L00 A;  4BAY A;  1DP3 A;  2A05 A;  4CCL A;  4D5C A;  1UZC A;  3J7A Y;  1BC7 C;  4DZP A;  4A3E J;  4MFD A;  1GVD A;  3Q3S A;  1Q1H A;  3S2H J;  5GAD J;  1FBU A;  2CRG A;  2CSO A;  2UZK A;  4H0E A;  4UUS A;  2BEO A;  2ICW G;  3NQO A;  4XOP A;  1ETQ A;  4X6A J;  1XC5 A;  2CUJ A;  4I7H A;  3BLY A;  1DP7 P;  2JK3 A;  1Z3Y A;  3JAM K;  3K69 A;  1XDU A;  4AYB N;  3SQN A;  2FF4 A;  1WJB A;  3L2W A;  3HXL A;  3DBH B;  1WJF A;  1FIA A;  1T0F C;  4BXU A;  3G4S I;  3ABK H;  2QF7 A;  3KEO A;  5F0C A;  1VQN I;  2KIM A;  4FET A;  3CO7 C;  2ZME C;  1W4M A;  2V1X A;  1X1P A;  1QVU A;  3QRF F;  1P7I A;  3FKJ A;  1RPW A;  4L5J A;  3BOQ A;  1ZLK A;  3T1B A;  2MGQ A;  1SMY F;  5EYR A;  2Y30 A;  3CUO A;  4IQ4 A;  3TOB A;  4G94 A;  5HDN A;  1OJL A;  3RQI A;  3W6V A;  4EMS A;  2M7B A;  2Z1D A;  3DPL C;  1O3Q A;  2FE3 A;  2PQ8 A;  2FU4 A;  1MBE A;  1OR7 A;  3JTH A;  2Y48 A;  4LIT A;  1QZE A;  4L0Y B;  4PJL A;  3HL2 A;  2E2H J;  1ZG3 A;  2K40 A;  2YSR A;  4AVP A;  4YG2 F;  3FIS A;  1RNL A;  1ZQ3 P;  2L9V A;  3H9Q A;  2CU7 A;  3A02 A;  3E3V A;  2L2O A;  1X3W B;  1JGS A;  5HDK A;  1X1C A;  2X85 A;  1TWC J;  2LF8 A;  2ZFW A;  3VDX A;  2JMW A;  2VLA A;  2DA2 A;  4FX4 A;  2OCC H;  2HQA A;  4DQ2 A;  1BM9 A;  5BQT A;  3EYY A;  1BI3 A;  1U8R A;  2XIG A;  1JGG A;  5LRS A;  3TL4 X;  5D8K B;  1XCV A;  4HNV A;  2V1D A;  4ESJ A;  3ZQF A;  3D5S C;  4HW0 A;  2K3P A;  5BOX A;  3DCF A;  1FEX A;  2HQ5 A;  4L9V A;  4JYK A;  1BIB A;  5DUI A;  1FIP A;  4AVZ A;  3JW4 A;  2GOX B;  4DOZ A;  1AHD P;  2M0C A;  1GDT A;  3P9K A;  1S3J A;  3BT9 A;  3VEP A;  3I54 A;  4EAT A;  2XPV A;  1IN8 A;  1QVT A;  5LFA A;  3ZMU A;  4BE0 A;  1WHU A;  5CQE A;  1DUX C;  1USS A;  2KLO A;  4EM2 A;  3VSL A;  4MTD A;  4F91 B;  3DEW A;  2CQQ A;  3I53 A;  3L1P A;  1H8A C;  2XAQ A;  5LHI A;  3SDG A;  3K70 D;  2HR3 A;  1X4O A;  5LHG A;  4BKX A;  2RQQ A;  3QOP A;  2E2J J;  1U5T B;  5GPA A;  2MLG A;  1OFC X;  1Y39 A;  4OAZ A;  4HBL A;  4CXF A;  2VKH A;  3OYJ A;  3Q9S A;  3QU6 A;  2V79 A;  4IHX A;  5H20 A;  1LEB A;  4RM3 A;  4D5F A;  2DCE A;  3JR9 A;  3JRF A;  1A31 A;  1FBS A;  1JT6 A;  4HNT A;  3F6O A;  3I5U A;  1JKQ C;  4XNF A;  4I99 C;  4BNC A;  3GYH X;  3OV8 A;  3HUG B;  3F22 A;  3K9T A;  3GTO J;  3DP7 A;  2DJN A;  4OIR F;  4IJA A;  1MMN A;  4A3F J;  3ZQH A;  1E2X A;  4RM2 A;  2QA4 I;  1TNT A;  4UNO A;  3ZN1 A;  3CLQ A;  2DFH A;  2AXT C;  1WKM A;  2JRT A;  1XGM A;  3QPH A;  4KDP A;  1WWX A;  4RGS A;  3SDB A;  2LC2 A;  2F48 A;  2A3S A;  4L9J A;  2G0E A;  2HZD A;  3L2C A;  1V3F A;  2BVL A;  5E1X A;  3BPX A;  1SFX A;  1LPQ A;  4U0Y A;  2VT2 A;  3G1O A;  3V8L A;  1UJ8 A;  2PMZ N;  3VPR A;  1IXC A;  3VSK A;  2DO7 A;  3JTG A;  2W85 A;  2AQE A;  2JTV A;  1Z77 A;  2L0K A;  3FWE A;  5F08 A;  3D1N I;  2HOA A;  2BE5 F;  1H0M A;  3RDI A;  2GXA A;  2K9L A;  4B3X A;  3G6E I;  3FBI B;  5E8G A;  2KMU A;  5IP7 J;  1XPX A;  3HM5 A;  1J59 A;  4I0A A;  1D1B A;  1SVL A;  5HLG A;  5LEJ A;  1J5Y A;  4MNU A;  2LRD A;  3LSI A;  4EJT A;  3M7G A;  1E3H A;  1TT0 A;  3OY9 A;  5ED4 A;  3VYS B;  2CGP A;  4R8H A;  4CA0 A;  4BQA A;  1F9N A;  3KLN A;  2XAF A;  2ZNY A;  4KN4 X;  4CO8 A;  2ZO4 A;  4ZYE A;  4Y52 J;  2NAZ A;  1WGX A;  2CH0 A;  3OOP A;  2DBB A;  1ZGJ A;  1S29 A;  3HZJ A;  3U1K A;  3KX2 A;  2KZG A;  2XUB A;  4QPQ A;  2WY7 Q;  1TQM A;  4RGU A;  5HS9 A;  1D8J A;  4AWX B;  2V7F A;  2YU3 A;  3IKV A;  3KYL A;  2FQ4 A;  3BP8 A;  3QQA A;  5HLT A;  2STT A;  3NAU A;  1OYW A;  3ZPL A;  2E5N A;  3L2Q A;  2EWN A;  3BWG A;  1B1B A;  4UV8 A;  3GLL A;  3HHH A;  3FXR A;  3HOV J;  4RBO A;  4G6Q A;  2MYS A;  1T8I A;  1YJW I;  3GTG J;  2R92 J;  1Z05 A;  3GUD A;  5DV5 A;  1W7P B;  2VXZ A;  3DFG A;  1N75 A;  3JRB A;  2J5P A;  5JFR A;  1K79 A;  5CVU A;  1TP4 A;  3E7L A;  1N77 A;  3F8B A;  2BV6 A;  3TMO A;  3KZI C;  5GAG J;  4ZC3 A;  2DLL A;  4JK1 X;  4RGX A;  3GZN B;  3PL8 A;  1G2H A;  3FMQ A;  5HVQ C;  5FRM A;  4B3A A;  3FDY A;  4M3E A;  2ELJ A;  3L9F A;  2LG4 A;  1QO0 D;  5KK1 A;  2VQG A;  3TOA A;  2Y69 H;  3L2R A;  3S17 J;  2Y2Z A;  5K1Y A;  2VOO A;  5D6F A;  1DGR M;  5H6R A;  3FM5 A;  3KFW X;  3O8G A;  2COB A;  4I76 A;  4YIF A;  5E79 C;  2GAU A;  3Q0W A;  5B66 C;  2E7X A;  5DD8 A;  1R1U A;  1FOY A;  1W1W E;  2RGV A;  1SEU A;  4AYB A;  4L0Z B;  3DKW A;  1WJA A;  1ITY A;  1CGP A;  1ETO A;  4BJ6 C;  2RNJ A;  3ZP5 A;  1U5T A;  2A69 F;  4JBA A;  5EEH A;  1FNN A;  2LY2 A;  3X2Q H;  1XX5 A;  4PJ0 C;  1R9T J;  5HOO A;  3T5X A;  2NNN A;  2Q2E B;  2GA1 A;  2W00 A;  2QGU A;  2ZXH A;  1QPM A;  3J81 K;  3CCV I;  1X1D A;  3BR5 A;  3KYC B;  1DU6 A;  5GTI C;  3K0L A;  4DYC A;  5EGO B;  1YS6 A;  1G3Y A;  3HUG A;  3Q0U A;  2ME0 A;  2NVT J;  1SAU A;  4CDG A;  1P4W A;  3PUB A;  2R7D A;  2NXN B;  3OSG A;  5L3G A;  3CMY A;  1WI3 A;  2FML A;  4O5V A;  4BL0 B;  1ZN2 A;  2AHQ A;  5H2F C;  5BS6 A;  5JR3 A;  4EJO A;  3CCM I;  3SZT A;  2DTZ A;  5KCM A;  1HA8 A;  1JUS A;  1TW2 A;  3CJN A;  1R4N B;  2QSF X;  3I56 I;  3CES A;  1FPQ A;  2R3S A;  1J75 A;  3ZCO A;  2PX9 A;  5BPD A;  3GTJ J;  2WWY A;  4BBS J;  4RLQ A;  3GFJ A;  1Y1V J;  1P4X A;  4HA8 A;  1SC7 A;  3LL7 A;  4V19 K;  2BZT A;  2A61 A;  1W0T A;  2L4M A;  4YFN F;  2JA6 J;  5DYM A;  5AIQ A;  3OS2 A;  4U7B A;  2P5V A;  2XF7 A;  1OKR A;  3GO5 A;  4ZYA A;  2VKE A;  4J19 A;  1OPC A;  2VC0 A;  4M72 A;  1TL8 A;  2NVX J;  3RQ4 A;  2K86 A;  4PFO A;  2HPI A;  3FM3 A;  3SFI A;  2X4H A;  3EUH A;  2MG4 A;  1T2K A;  2VBZ A;  1HC8 A;  3IH3 A;  1WH7 A;  2KDZ A;  2A07 F;  2HDW A;  4MIM A;  3WGG A;  2CFO A;  1XS9 A;  3S3M A;  2L01 A;  4CSW A;  4E7Z A;  2DA1 A;  2W7N A;  1MZB A;  4C2U A;  2CUZ A;  2M4K A;  3W2W A;  1JUM A;  5HDG A;  2KRH A;  3MQ0 A;  5IYD J;  3DBR B;  3PNT A;  2OZU A;  2DU9 A;  2WAQ N;  1Y0N A;  1BR1 A;  2LRE A;  2MD0 A;  5E1W A;  2P81 A;  3U21 A;  2ZC2 A;  1S8N A;  2NOG A;  3L7W A;  2V9K A;  3U1D A;  1B72 B;  1TQP A;  3CJR B;  4HLY A;  3BG3 A;  3K2A A;  2Y9Z A;  5K7F A;  3CF5 F;  4IKF A;  3GEZ A;  2O5R A;  5FFZ A;  5AON A;  2CW8 A;  1UEL B;  3CME I;  4HST A;  1P2F A;  4Q48 A;  3DV8 A;  1SD5 A;  2H1K A;  2M7A A;  5IT9 Z;  1EH7 A;  1W7P A;  2M34 A;  4A5N A;  3ULQ B;  2DFI A;  2Q1Z B;  5K7Z A;  1P4A A;  3ABT A;  2OC6 A;  4L5E A;  2ZXW H;  2HVR A;  1W7P D;  4B8X A;  2OQG A;  4I2O A;  1VQ4 I;  1WFX A;  5KHD A;  2K7L A;  3OSF A;  5EZG A;  3CUQ C;  2PJR B;  1POG A;  1EV7 A;  3F9K A;  4F92 B;  5ICE A;  1HOM A;  4IF4 A;  2EA4 A;  2M4G A;  1FYK A;  3IAS 2;  3ZXS A;  3CMM A;  4EJW A;  1F4K A;  4A3B J;  4RAY A;  1FMW A;  1R6R A;  5D5V B;  1TLH B;  4KMF A;  4F93 B;  2PMZ A;  4I09 A;  4IOA F;  3RYR A;  4CCM A;  1A5J A;  3H5R A;  4HLX A;  1WJ5 A;  3TED A;  1F5T A;  3FK6 A;  1FX7 A;  1R5H A;  2XAG A;  3LFK A;  1UAA A;  1OCZ H;  1TWH J;  5IYC J;  4AIH A;  4HF1 A;  4D9J A;  1MND A;  2KKO A;  2HU9 A;  1LVK A;  1TWA J;  2LMD A;  2Q2E A;  2RDP A;  3ZMT A;  4XLP F;  2IXS A;  4ZZD A;  5EGO A;  3GTP J;  2EZI A;  1IN6 A;  2X51 A;  2LTP A;  3JCU C;  1F43 A;  2VJ5 A;  5AIP A;  3SFZ A;  3AL0 C;  5ILV A;  3FXM A;  3OL4 A;  3E5X A;  5M5Y J;  1T98 A;  1JTX A;  3GME A;  3CCS I;  2EIL H;  2P7C B;  2R7Q A;  2DA7 A;  2QEN A;  2Y75 A;  5K5O A;  1X19 A;  1O7F A;  3IRR A;  3JSP A;  1TTY A;  5J8F A;  2IT0 A;  4EEF G;  2E60 A;  4U0W A;  3CLO A;  3JRA A;  1I50 J;  3ZQG A;  1YW9 A;  2L7F P;  4OU0 A;  5EEA A;  4DW6 A;  3DBL B;  2F6C A;  4RAZ A;  2CWE A;  1IV6 A;  1SVO A;  3H35 A;  2ELH A;  2E35 A;  1AOY A;  5M5X J;  2X6Y A;  1U0J A;  5GP9 A;  1P6R A;  3C1D A;  3FHN A;  4UVB A;  1FYM A;  2D1V A;  2LYC A;  5FB2 A;  5LD2 C;  5LRR A;  5FKM A;  4BXX J;  5CJ9 A;  5J6X A;  1RR7 A;  2OV7 A;  3SEZ A;  2XC7 A;  4OWR B;  4IO9 F;  3G1M A;  5LLQ A;  2CO5 A;  2BY3 A;  4Q47 A;  2K3F A;  4P55 A;  5J4V A;  2TCT A;  1IN4 A;  3F8F A;  5L3E A;  1KQ8 A;  2MC4 A;  2JRM A;  4N9H A;  1RKT A;  4AUX A;  1MBF A;  3D5L A;  2EQR A;  2K5C A;  3CP8 A;  2ETH A;  4BQO A;  2VE9 A;  4HX7 A;  5F0F A;  3ZMV A;  5J8C A;  1XGO A;  1S6L A;  4HDV A;  2Y9Y A;  3BTJ A;  3EPZ A;  4KFC A;  2FBI A;  1OYI A;  2CUE A;  3V7S A;  2DAO A;  4BS9 A;  4A6E A;  2LY9 A;  4CYD A;  3CCU I;  3FXQ A;  2HKX A;  2KIS A;  2R7X A;  1XTA A;  3WTX C;  3CC2 I;  3PQJ A;  5J4Y A;  4ZH4 F;  1IRG A;  2VAS A;  5K5R A;  2ISZ A;  1PYV A;  4V2G A;  3OYK A;  3MZ8 A;  3RCO A;  2ZKZ A;  2XGX A;  4ZYD A;  4ON0 A;  3RKQ A;  1B72 A;  4GYI A;  3DTK A;  1N78 A;  1RKW A;  1GV5 A;  4XOR A;  1HW1 A;  1YIO A;  4LK0 F;  3O6B B;  3A03 A;  2M3A A;  4UV9 A;  3RKW A;  1KYZ A;  4M74 A;  1Y8Q B;  2GOM A;  2IVM A;  4A3M J;  2GA2 A;  2XB5 A;  4YFX F;  3S1N J;  1D1A A;  3HRS A;  3R60 A;  1PP8 F;  3ISP A;  5GTH C;  2FXA A;  2XGE A;  4DNC A;  1ULY A;  3QPL A;  1FLI A;  3WTT C;  3K4N A;  1G8X A;  2JN6 A;  2XKO A;  4AD9 A;  3RSN A;  2DYS H;  2CW0 F;  1ERD A;  4P96 A;  2GBY A;  1STZ A;  4FCY A;  2PJR A;  3M1E A;  4DBQ A;  4QLC U;  5DTD A;  4PGH A;  2NS8 A;  3H3V K;  2O7O A;  4OIN F;  1TZL A;  2WTE A;  5E8I A;  3KZZ A;  1A36 A;  2WB1 N;  3CCL I;  4BJ5 C;  4HX8 A;  2XRO A;  1XN7 A;  2M9H A;  2TRT A;  1JHH A;  1ZGW A;  1BBY A;  1W0U A;  3AG2 H;  5D5U B;  3OIQ A;  2STW A;  1Z7U A;  1BR4 A;  2ZBK A;  1NG7 A;  2MAB A;  2OZ6 A;  2E5Z A;  3ERM A;  3RYP A;  3OS1 A;  1X3U A;  1GT0 C;  1W36 C;  3BQZ A;  1NH3 A;  2V1N A;  4G6D A;  4RAG A;  2HDD A;  1QZY A;  1OMI A;  4BAC A;  3QYE A;  1MNM C;  2PI0 A;  2VI6 A;  1CQT A;  1R00 A;  3C2H A;  3WGI A;  2DPU A;  1X2M A;  3TQN A;  3BQY A;  4Y33 A;  5K7H A;  3KEY A;  3BG7 A;  4L5I A;  5IP9 J;  2K4B A;  1LEA A;  2R7W A;  5LGT A;  4XIC A;  2BGC A;  3HTU A;  5IYB J;  1NK2 P;  2VE8 A;  2NS0 A;  3FBN B;  3DU5 A;  1IV8 A;  3DEU A;  2IGN A;  2P0W A;  2RC4 A;  2Z3Y A;  2EA2 A;  4G7O F;  1RET A;  3H92 A;  2M8E A;  2HI3 A;  1X1A A;  2KRC A;  5KAI C;  2DQR A;  3MEX A;  3E0J B;  3BJ6 A;  2WAQ A;  3S32 A;  1ETV A;  5EDN A;  2HYJ A;  4D7N A;  3HOX J;  1G4D A;  4A5M A;  3HJE A;  2HYG D;  3AG1 H;  2J5O A;  2CQX A;  4IHV A;  3LSP A;  2KZV A;  3QOE A;  1R4M B;  4WXD A;  3CO6 C;  2VKV A;  3LOC A;  1J9I A;  3TP0 A;  2BY0 A;  5E3M A;  4RB1 A;  3GZ5 A;  4MTE A;  3MKZ A;  1X58 A;  5FKK A;  5F27 A;  3FKI J;  2IS4 A;  5EZH A;  1GV2 A;  4HF2 A;  1MMS A;  3DTE A;  2DMP A;  3AKZ A;  4HF0 A;  5DEQ A;  5H6Q A;  4ZTF A;  3G1L A;  4KT5 C;  4XKC A;  1WJD A;  3SHF A;  3BG6 A;  1LJ9 A;  2F5D A;  4E4H A;  2EB7 A;  2FNA A;  1QQI A;  2M1B A;  4HZF A;  2EJR A;  5TGT A;  1MSF C;  4ENK A;  1F1Z A;  4OOI A;  1J09 A;  3ABU A;  2CV2 A;  5KNL A;  1UHW A;  3WHB A;  3VYR B;  3WTZ A;  2DOD A;  2IA0 A;  3K7A J;  2OAZ A;  1IO2 A;  4XSZ F;  2BXZ A;  4DBR A;  1OCO H;  1ETX A;  4N4O B;  4XLF A;  4FQG A;  3VB2 A;  5FJ8 J;  2HQR A;  2W24 A;  3COA C;  1Z0X A;  1UCR A;  4LG3 A;  3WGH A;  2W4S A;  3ZQL A;  1M1E B;  1ZHF A;  4JQF A;  1DDN A;  1UMQ A;  3CF2 A;  3P5J A;  3A2K A;  3HOU J;  3I58 A;  4CH7 A;  1FBQ A;  3HKZ N;  4XM3 A;  3I59 B;  1G3W A;  1S5L C;  3CCY A;  5M5W J;  4BGD A;  4NQW B;  2MFZ A;  2P8T A;  4L9N A;  4C2T A;  4M9Z A;  1BI1 A;  3REO A;  2K02 A;  2XF6 A;  4C9Y A;  4PJJ A;  3ZMS A;  2E34 A;  4HV6 A;  4A3G J;  2DT5 A;  2ME6 A;  3DPT A;  4ZYH A;  3EUK L;  1O7L A;  3PNV A;  4M9X A;  2I8D A;  3M9A A;  3R4K A;  4W1U A;  2HQN A;  5FKL A;  2M87 A;  2B7E A;  3V8J A;  4IHS A;  1MGT A;  1YI2 I;  4LOC A;  2E19 A;  1I1G A;  3I0T A;  3T8T A;  4A3L J;  1I6H J;  3FXJ A;  3L2V A;  4CUG A;  1U3E M;  3BR6 A;  3F23 A;  2FA5 A;  4HG2 A;  2AQF A;  4OMZ A;  2COM A;  4RAF A;  4QTR A;  4CCN A;  1ENH A;  2HOS A;  2VUM J;  3Q0V A;  4CIC A;  3H9G A;  3OR2 C;  2QM3 A;  4UB8 C;  4A3D J;  3HOT A;  4CZZ A;  2VL8 A;  1W5S A;  4Y7N J;  3LSH A;  3CC7 I;  4AM3 A;  2D2W A;  3QP5 A;  1A04 A;  3CTA A;  1KGS A;  1ON2 A;  3VYT B;  3KP3 A;  2H6B A;  2VKD A;  2VBW A;  5J40 A;  2CW7 A;  3L09 A;  1EJ9 A;  2CS3 A;  2N8G A;  3V42 A;  1GXQ A;  2X9D A;  4MO7 A;  2M30 A;  3RPQ A;  3DPU A;  2DOE A;  1Y56 A;  3Q9V A;  3C3W A;  3LA3 A;  5FLV A;  4E7S A;  3I71 A;  1YIJ I;  1P7J A;  3WTU C;  2DW4 A;  3S1R J;  5E1Z B;  1IC8 A;  4X1E A;  2L54 A;  2QKM B;  1K78 B;  2FNP A;  4MHG A;  4Z2Y A;  4MQV A;  1FOK A;  1IGN A;  1FTZ A;  3H0D A;  5LGU A;  3UKG A;  2LSO A;  2YPR A;  2JQ7 A;  3LWF A;  2V26 A;  1XGN A;  4DGW B;  1VQM I;  2A6T A;  1V5G A;  3K4J A;  4KUM A;  5ICG A;  2HPM A;  4U88 A;  2M8G X;  5E3L A;  4ZDO A;  3GF2 A;  4P9U A;  1IUY A;  4YII A;  1QNT A;  4L9T A;  4PCQ A;  5BNG A;  1BC8 C;  3LA7 A;  2L7M P;  4OIP F;  1Y0U A;  3IHU A;  2KP6 A;  3GTM J;  3K4B A;  2I5U A;  2W1O A;  4WXC A;  1T95 A;  2FMY A;  1HDP A;  1IRZ A;  2VJ4 A;  1MDM B;  1B4A A;  1FMV A;  3I64 A;  3PO2 J;  5FD5 A;  4GYG A;  2Z2S B;  1K83 J;  2HVS A;  4LG0 B;  5JHU A;  2NOJ B;  2O03 A;  2YX7 A;  3BRO A;  1VI0 A;  2CYY A;  3QP6 A;  3S3O A;  5F1R A;  2V6C A;  3OYM A;  3A0B C;  1DQU A;  4LD5 A;  2JPC A;  2H09 A;  3AG4 H;  2R7T A;  4P5O A;  1BI2 A;  2XSD C;  2QQB A;  2OBP A;  2WBM A;  3HPG A;  3MWM A;  2FEZ A;  4I98 B;  1OR7 C;  1P9Q C;  5C4X J;  1UST A;  1K6Y A;  1V55 H;  1IRF A;  2MH9 A;  3M1C A;  2QKL B;  1XMX A;  5D5X B;  5DM7 F;  2E1M B;  4HQM A;  4HPQ A;  4YEJ A;  2QYO A;  2QEX I;  3D5R C;  1FYL A;  3GFI A;  4FX0 A;  3V4G A;  1VZ0 A;  2OF7 A;  3BTC A;  3I4P A;  4P1W A;  3M3Y J;  2WB1 A;  1Z6R A;  4FE4 A;  1ETK A;  2XHK A;  2D5V A;  5CVJ A;  1I1S A;  1BN5 A;  3I59 A;  1YX5 A;  2LD5 A;  1MIJ A;  2O8K A;  3OYF A;  4NQW A;  3IUO A;  2NVQ J;  4J01 A;  2O8X A;  1SD4 A;  2RVC A;  3KEQ A;  2JT1 A;  4GFB A;  4WWC A;  3K4M A;  4UXN A;  4PUS A;  3WU2 C;  5C3E J;  1D5Y A;  4GO1 A;  1BJA A;  3L2U A;  2DMN A;  4E7K A;  3GFL A;  3W6J B;  3CJT B;  1MJB A;  3S2D J;  1E17 A;  2DA5 A;  2HFH A;  2IPQ X;  3FZV A;  5JVG F;  1R5I D;  3GWZ A;  1PP7 U;  4P9F A;  2P6T A;  1K61 A;  4XSX F;  2LH9 A;  3O2P E;  5EF6 A;  2DMQ A;  3RTR A;  2QWW A;  3MKY B;  3MD2 A;  1VQ9 I;  5DCM B;  1ACI A;  2VQL A;  5JI6 A;  1YX3 A;  2DI3 A;  4JX4 A;  5IT9 K;  2ZME B;  1T38 A;  2O9L A;  3FF5 A;  3GCM A;  5TIS C;  1JKP C;  3QWL A;  2LVS A;  2BXY A;  3K70 C;  1CF7 B;  1AA7 A;  3F72 A;  4EJU A;  4KIC A;  2EZL A;  4N9I A;  4BHP A;  5FLX K;  3BJA A;  4EM1 A;  2F4M B;  2IA2 A;  3HC7 A;  3LAJ A;  1GHC A;  2VBY A;  3DKX A;  3R0J A;  2CQK A;  2Z99 A;  3OOU A;  2OD5 A;  3IH4 A;  4KIT B;  3WG9 A;  2ZJ2 A;  2K9M A;  1KQ9 A;  3U2R A;  2EZK A;  1F36 A;  2LP0 A;  4XK4 A;  2DDB A;  4FT8 A;  3IL2 A;  3GW2 A;  2WAF A;  2F4I A;  4A0X A;  3KZY A;  2ZB9 A;  4LFU A;  3HIF A;  1IZ1 A;  5D4S A;  9ANT A;  2XRL A;  1K78 A;  2JWT A;  3QU3 A;  1UHS A;  3MCZ A;  2BY1 A;  3NAR A;  3R6S A;  4EM0 B;  2BYV E;  4FAS D;  1HKQ A;  2GM4 A;  1WH5 A;  3DQV C;  1HDD C;  1UB9 A;  2X6X A;  4BY7 J;  5FKN A;  1HQC A;  4F52 A;  2I10 A;  1MBG A;  4AIK A;  3S93 A;  1EKE A;  2G9W A;  3RIR A;  2F5E A;  2MBF A;  2KDO A;  5CLS A;  2DPD A;  3HKZ A;  1JTY A;  1MBH A;  5HS7 A;  3BZ6 A;  3CDH A;  1EH6 A;  1SD7 A;  2DMU A;  2G7U A;  2FBH A;  2MLK A;  3CCJ I;  4CZC A;  3HOW J;  2HVQ A;  4U0V A;  4NBQ A;  5FRO A;  1SD6 A;  2QSG X;  3OS0 A;  2V9V A;  3JRG A;  1MDM A;  2H8W A;  3C7J A;  3CDL A;  3DKY A;  3VOE A;  3ZMZ A;  5KAF C;  3O8H A;  3ZMD A;  1RC9 A;  5B5E C;  1SVM A;  1YTY A;  2CFX A;  2CMP A;  4FIS A;  3R61 A;  4B44 A;  1PUE E;  4M6V A;  4LG0 A;  1MMD A;  2WV1 A;  3C2G A;  1D0X A;  1U2W A;  3NWT A;  2YR2 A;  4U7D A;  5L3F A;  3CJQ B;  1FOX A;  3F0C A;  1I6X A;  4BY1 J;  2L9S A;  3PUF A;  3DXJ F;  2RRE A;  2K9N A;  3AFH A;  3ZRG A;  2DOF A;  4HAM A;  3SYT A;  3SXY A;  4D7M A;  1RR8 C;  2DOA A;  3RI4 A;  4HEA 2;  2F5C A;  2M2E A;  5HNF A;  4BE2 A;  3IC7 A;  3CCR I;  3B73 A;  2VPL A;  1ZAO A;  3CQZ J;  2CQ7 A;  2CV0 A;  1U8B A;  1Y1W J;  1ZLJ A;  4Y15 A;  4YIR X;  2XB0 X;  3LNQ A;  2E1O A;  2VJJ A;  2NVY J;  4HOB A;  2BOL A;  2IAI A;  2ZJR F;  3SJM A;  2AS5 F;  4ZDL A;  2XVC A;  4XLC A;  1LNW A;  2O0Y A;  4I02 A;  1T56 A;  4RDU A;  1R71 A;  1T6S A;  2FOK A;  2YUS A;  3BC8 A;  3DWL E;  4G12 A;  4NB5 A;  3M07 A;  3BDD A;  3B6C A;  1TC3 C;  5FLX Z;  2ISY A;  2NYX A;  1DPU A;  3OIP A;  5JVT A;  4B43 A;  3DEE A;  3KIO A;  2NS7 A;  3ERE D;  4I0B A;  3KP7 A;  2EFO A;  3P7N A;  2X6O A;  2DXI A;  4IHW A;  5F1J A;  4CHU A;  3G3Z A;  3TO9 A;  2VN2 A;  1TWG J;  2HZT A;  4C2M J;  3BCA A;  3MFK A;  2ACJ A;  4JX5 A;  2DFF A;  4M6X A;  3TBI A;  2AXL A;  4QPO A;  3WOD F;  2E2I J;  2DN0 A;  1LVA A;  4OIO F;  3UNG C;  3ECH A;  2H1L A;  2WA0 A;  3FXO A;  1VQ6 I;  3PO3 J;  5C4J J;  1SFO J;  1HLV A;  2IS6 A;  1T0F A;  5DCM A;  2IJL A;  2JSC A;  2KFD A;  2R7O A;  3PIP F;  4HRI A;  1RUN A;  2VBX A;  2ZME A;  3LSM A;  2QBY B;  2AO9 A;  3AAF A;  4DJA A;  3HSE A;  2KT0 A;  3M8F A;  1D8K A;  4U87 A;  2XAU A;  2YX4 A;  1CF7 A;  4BHC A;  2L7K A;  4LB6 B;  5E3N A;  3LST A;  2E36 A;  3SZP A;  5LEK A;  1R7J A;  2JZY A;  2OU2 A;  3QYF A;  2ZJQ F;  1X3Z B;  4LLG F;  4BQQ A;  3K1N A;  2OJE D;  1RIO H;  4HX4 A;  2VIX A;  4BDZ A;  2ZNZ A;  5F04 A;  5IPA A;  2V4J C;  1U5T C;  4RMN A;  2HTJ A;  3TGN A;  1FSE A;  3MAJ A;  3OWT A;  1LDD A;  2UXX A;  3MZH A;  4RGR A;  1FTT A;  1RUO A;  4GCV A;  2VT3 A;  4UVA A;  3IV5 A;  3HYI A;  3OYC A;  2QVO A;  2L9N A;  5J1Y A;  2IEK A;  3OMY A;  3HSR A;  4AC0 A;  3S2W A;  3WTY C;  3ABM H;  4A69 C;  1TWF J;  2XDV A;  4LIU A;  3OYN A;  4Y3O A;  4S0H B;  1VQL I;  4LIV A;  4O6J A;  4ABZ A;  1K6O A;  3HG9 A;  3ZQQ A;  1KU9 A;  2BW3 B;  1UG2 A;  1R49 A;  2Y0S N;  3A01 B;  2ID3 A;  4NC6 A;  3V8K A;  2IRF G;  1VTN C;  4CCK A;  1C0W A;  3J7Z I;  2EV6 A;  3K6G A;  4D0P A;  2LLK A;  4V2F A;  2L02 A;  4E6K G;  4BDY A;  2VPR A;  3LAP A;  2XAS A;  2E1C A;  4A3K J;  1UFM A;  3I9V 2;  3PSI A;  4KMU X;  4A0Y A;  1ZEL A;  3E6C C;  2DTR A;  1HKS A;  3HEF A;  3TDU C;  2LDU A;  3UR3 C;  2K9Q A;  3CP2 A;  2HOE A;  1R1V A;  2L5Q A;  5A2Q K;  3FMR A;  4C3H J;  1OYY A;  3EDP A;  1QRY A;  1YS7 A;  3P9C A;  1H9G A;  4MQ9 F;  3EUH C;  3CC4 I;  4LMY A;  3J7Y J;  2B9S A;  1WPK A;  4GDF A;  4PDK A;  4DYR A;  2KPM A;  2ELK A;  2IA1 A;  4PZJ A;  2RNG A;  3CZ6 A;  3N97 A;  1B8I B;  3BZC A;  3O3K A;  4S04 A;  4QWQ A;  1J7K A;  1LKX A;  3T8R A;  2EIN H;  2DA3 A;  1BOB A;  3GFM A;  3T0Y A;  1Z9C A;  4LGW A;  3GX4 X;  1REP C;  2RV8 A;  2HEO A;  2BVM A;  1G3S A;  4A3J J;  3K10 A;  1VQ7 I;  1ODD A;  4WX9 A;  3BZK A;  4EVI A;  1JUP A;  2WV0 A;  3EET A;  4QSH A;  2RQP A;  3F8M A;  3A4C A;  4RLF A;  1LDK B;  2PFB A;  1VQ5 I;  1K4S A;  3LQR A;  2EFQ A;  3OYA A;  1Z91 A;  5ERI A;  4CCO A;  1JT0 A;  1QHH D;  2DFE A;  4E7L A;  3LQQ A;  5HOD A;  2FBK A;  1QZZ A;  5DUK A;  1A35 A;  1HKT A;  3KYD B;  1VQK I;  3TO6 A;  3BCB A;  5HLH A;  2MSY A;  5FGM A;  5FD6 A;  1IXR C;  2VC1 A;  2A5W A;  4N0B A;  2OUM A;  4KN7 X;  4DZJ A;  2W57 A;  3S14 J;  1R5G A;  5L3C A;  1O3R A;  3JRH A;  1IUF A;  3RPU A;  2V6E A;  4H4K C;  2Q8K A;  1Z6T A;  4NC7 A;  2XPW A;  4MEY F;  5TJJ A;  4L18 B;  3KP5 A;  3RPU D;  3WE2 A;  1YW7 A;  3NEU A;  3C2B A;  2GWR A;  1L3L A;  3VWB A;  2DDA A;  4WXH A;  3I4M J;  2ESH A;  1A6Q A;  1DPR A;  4B4C A;  1LB2 A;  1GXP A;  1ZRC A;  4IRI A;  3LMM A;  2LR8 A;  3F8N A;  1PDN C;  2GXB A;  1UG0 A;  3JRC A;  4PGG A;  3LSR A;  1OCC H;  4XLE A;  2QBY A;  1YLF A;  2CQN A;  1DU0 A;  2OA4 A;  5GAE J;  2PG4 A;  5F6F A;  4AU7 A;  2A5Y B;  4ENN A;  3K4K A;  2OTL I;  3KE2 A;  4LK1 F;  3FIW A;  1AU7 A;  5ILS A;  5D5W B;  3ONQ A;  1TQI A;  5FO5 A;  1I27 A;  4KYW A;  4R79 A;  1RRJ A;  2RKH A;  1O4X A;  4YRV A;  2XRN A;  1XB4 A;  4KJZ A;  1KON A;  3PSF A;  5DCF A;  3CCE I;  4MLO A;  5DDG A;  1AKH B;  1HBX G;  5BMZ A;  1S7A A;  4ZYG A;  1Z1D A;  5A2Q Z;  4BE1 A;  1G3T A;  4EQQ A;  2MA3 A;  5IT3 A;  2H94 A;  4IPA A;  1P92 A;  1MD0 A;  1G6N A;  3I4N J;  1I39 A;  4HQE A;  4IRH A;  1YJN I;  3TW7 A;  2R7R A;  3ASO H;  3PNY A;  2L7Z A;  3RZO J;  2BW3 A;  2G7H A;  3FK7 A;  3HRM A;  3IRQ A;  1MKM A;  1PVE A;  1YIT I;  2KHM A;  2VXD A;  3A01 A;  2H8R A;  1FP1 D;  3ELK A;  4XLH A;  3H3Z A;  2MC3 A;  5ILU A;  5EEG A;  2W84 A;  1BJZ A;  1KYW A;  1YG2 A;  1HXD A;  1IG7 A;  1OCT C;  3CUQ B;  4M6Y A;  1KZH A;  1FY7 A;  2VON A;  1R23 A;  2RAE A;  1ZRE A;  2FJ1 A;  3BR0 A;  1GVJ A;  1KU7 A;  4PJM A;  2IGK A;  1FP2 A;  1B6A A;  4CYC B;  1FZP B;  3OYD A;  3E6B A;  1ZG5 A;  1APL C;  2Q0O A;  4O3M A;  1XCB A;  1ETY A;  4C30 A;  3ZGK A;  4EGY A;  5M3F J;  2LK2 A;  4XLA A;  1BR2 A;  1HW5 A;  2DT7 B;  1RI7 A;  3VOD A;  3DLL F;  1WSU A;  2CJJ A;  5EG0 B;  3PIO F;  1HSJ A;  1E3O C;  1IAW A;  3H3U A;  1B8I A;  3LSK A;  4IL6 C;  4IX7 A;  2P7V B;  3MVP A;  2FD5 A;  3TW6 A;  1ZRD A;  4CGZ A;  1WI9 A;  2LOO A;  1VQO I;  4UHT A;  3D0S A;  2KIU A;  3HOS A;  3KP2 A;  5E3O A;  1XDS A;  1XSV A;  2D1H A;  3A1Y A;  4XQF A;  2PLY A;  2ID6 A;  3CCQ I;  3RZD J;  3K1P A;  3HOY J;  3AL0 B;  3S15 J;  5IY5 H;  4IRG A;  2R4G A;  3BJO A;  1WQ2 A;  3IP4 B;  5J47 A;  1D3Y A;  2MH2 A;  3N05 A;  4BHB A;  1MNE A;  3ASN H;  3WTS C;  2LFB A;  2QQ8 A;  5L3B A;  2ADU A;  5DD4 A;  3PFY A;  3TO7 A;  3H9J A;  2XAH A;  3MKW B;  4B09 A;  2PEX A;  3H5N A;  1GUU A;  4G9Y A;  1ZR4 A;  4M3B A;  2PMH A;  1SFE A;  4PJN A;  1X2N A;  2PMU A;  3JAM Z;  3HDD A;  4UUV A;  2QCO A;  2TDX A;  3S3N A;  5FRN A;  4RA2 A;  3OIO A;  1NTC A;  1MJA A;  2JUC A;  4Y17 A;  5FLM J;  1XSX A;  3RKX A;  3SEQ A;  5HNH A;  4B47 A;  2IGM A;  1ORK A;  3ECO A;  4II3 A;  2EPF A;  4XON A;  1D1C A;  1S9H A;  1V5F A;  3DU6 A;  3SZG A;  3H5A A;  2HTS A;  2ZXI A;  2GXG A;  3MN2 A;  3V7R A;  3Q5F A;  1S7O A;  2WAD A;  2Y0S A;  3FXU A;  1BIA A;  4ZDP A;  4K2E A;  5IOY A;  4LLN A;  2X1E A;  1IRX A;  3MMY B;  4PSW A;  4EJV A;  3BR3 A;  2HOT A;  2X1C A;  3BG5 A;  2P5K A;  1BOA A;  3C18 A;  4OIQ F;  2LKX A;  2GIZ A;  1MMA A; 
#chains in the Genus database with same CATH homology
 1R22 A;  1XMA A;  2RN7 A;  1YYV A;  2PN6 A;  3F3X A;  1J2X A;  3GLX A;  3R0A A;  5HS8 A;  1KU2 A;  4WF2 A;  5LGN A;  2E1N A;  2O6G E;  3E97 A;  4RB3 C;  4ESB A;  2Y0M A;  4A6D A;  3HSF A;  4M73 A;  2R7F A;  1XGS A;  2KRF A;  2GQQ A;  2IP2 A;  1BI0 A;  3IWZ A;  2HKO A;  4XRF A;  3KP6 A;  3DF8 A;  2HGC A;  5ICF A;  1HW2 A;  1B9N A;  2KIF A;  4RS8 A;  5ICC A;  4HV5 A;  1FSH A;  3E6M A;  1K7A A;  4GGG A;  1R1T A;  4MGR A;  4E70 A;  2EK5 A;  5KVR A;  3CUQ A;  3N4M A;  1IF1 A;  4HDU A;  2QQ9 A;  5CVV A;  3FHZ A;  2HYF A;  1O3S A;  2A6E F;  3W6K B;  4Q4Z F;  1U6G A;  4EV0 A;  4A2U A;  3J7A O;  4F7Z A;  4AIJ A;  2LKP A;  4IXA A;  2WC2 A;  2C6Y A;  5E18 F;  1R36 A;  5D8L B;  4XLN F;  3E6D A;  5D6E A;  5BPI A;  5D4R A;  2LF7 A;  3HHG A;  4NHJ A;  3B02 A;  1IN5 A;  1EH8 A;  2OQR A;  2PBI A;  3ZQ7 A;  1D5V A;  2PJP A;  4IHT A;  1ZH5 A;  5TRD A;  2EV0 A;  3GXO A;  1UHM A;  4ASN A;  2B0L A;  4ENJ A;  2XKP A;  2QLZ A;  5E17 F;  1R58 A;  2IW5 A;  4Q5S F;  5CVR A;  3NRV A;  1JE8 A;  4HYE A;  2QZ8 A;  4TV7 A;  3GZ6 A;  1NHA A;  4KNY A;  4ETS A;  3PQK A;  3F21 A;  4EGZ A;  3HRT A;  1HST A;  1TNS A;  4ENM A;  1B9M A;  3KLO A;  3IKT A;  2EFN A;  1B59 A;  5L3D A;  3WTW C;  4IVN A;  5F64 A;  2HS5 A;  4M9S A;  4MEX F;  2MD5 A;  2H27 A;  3TDZ C;  2H6C A;  2F5F A;  2LNB A;  3F8C A;  1L0O C;  3WTV C;  5LHH A;  2EV5 A;  1W5T A;  6PAX A;  2M45 A;  1KU3 A;  2M5W A;  4ESF A;  4WK8 F;  3HRU A;  3KET A;  3ML6 A;  2BBY A;  2XAJ A;  3WU1 B;  3P9I A;  2K27 A;  1QBJ A;  3QPT A;  1LQ1 A;  3F6V A;  5K5Q A;  2QUF A;  5LBQ A;  3EYI A;  3LA2 A;  2HDC A;  3M8E A;  4GXO A;  4UVC A;  4LB5 A;  4S05 A;  3VFZ A;  2ESN A;  2GIV A;  1T39 A;  3MZY A;  1H9T A;  2JPB A;  2W25 A;  4OMY A;  4FHT A;  1ZG1 A;  3J81 Z;  4G8X A;  2FSW A;  1YFH A;  5FFX A;  1ZAR A;  4A0Z A;  3FX3 A;  3RKY A;  2KJB A;  3K1M A;  5HLI A;  2UWM A;  3FMS A;  2V1U A;  3PFI A;  3GVA A;  3RJP A;  3E5Q A;  4KIF A;  1SFU A;  1AWC A;  3IWF A;  1YO5 C;  4G7H F;  4RB2 C;  1TBX A;  1XMK A;  1XD7 A;  3KP4 A;  1QGP A;  4YFK F;  2EFW A;  3J80 K;  2FQ3 A;  2Z9O A;  2VOP A;  4Y13 A;  2DK5 A;  1IN7 A;  1SMT A;  2O3F A;  2Z5U A;  5E20 A;  4I01 A;  3WE3 A;  1JHF A;  2UXN A;  3K2Z A;  1J0R A;  4A12 A;  2DQL A;  2P4W A;  2HWV A;  1KQ0 A;  2NNY A;  2X0L A;  3ROU A;  4BH9 A;  2E7W A;  1WRJ A;  2A6H F;  4RB0 A;  3KCC A;  1XSD A;  4M71 A;  1O3T A;  1YW8 A;  4BYY A;  1IW7 F;  3JSO A;  2L4A A;  4R1H A;  4G7Z F;  1TW3 A;  1FWZ A;  2CG4 A;  3BPV A;  2VOD A;  2A68 F;  2P5L C;  2F2E A;  2DK8 A;  2L3D A;  1FT9 A;  3U9G A;  3BY6 A;  2Z33 A;  1IXS B;  4ZZL A;  1I5Z A;  1JXS A;  1RZ4 A;  2ZXJ A;  1SAX A;  2D45 A;  3ZN0 A;  2QQA A;  4KIG A;  1ZRF A;  5CVI A;  1FC3 A;  1MJ9 A;  2P6S A;  4KA4 A;  5CYV A;  3V7C A;  2NRA C;  1ON1 A;  1YQA A;  3G73 A;  1ZYR F;  3EQL F;  1LDJ A;  4WCG A;  2K4J A;  3J80 Z;  3HTS B;  2GZW A;  2FRH A;  4LJZ F;  2KJC A;  4LLL A;  2EFP A;  3WU0 A;  2ZCW A;  3E5U A;  1V4R A;  1ONV A;  1KA8 A;  1ZGA A;  2O61 A;  3QAH A;  1O57 A;  3TKY A;  4KIB A;  4XBF A;  1U78 A;  2XV4 S;  3L00 A;  4BAY A;  1BC7 C;  1Q1H A;  1FBU A;  2CSO A;  2UZK A;  4H0E A;  2BEO A;  3NQO A;  4I7H A;  1DP7 P;  3JAM K;  3K69 A;  1XDU A;  3SQN A;  2FF4 A;  4BXU A;  3KEO A;  2KIM A;  3CO7 C;  1W4M A;  2V1X A;  3QRF F;  4L5J A;  3BOQ A;  1ZLK A;  3T1B A;  1SMY F;  3TOB A;  3CUO A;  4G94 A;  5HDN A;  4EMS A;  3DPL C;  1O3Q A;  2FE3 A;  2PQ8 A;  2FU4 A;  1OR7 A;  3JTH A;  2Y48 A;  4L0Y B;  1ZG3 A;  2YSR A;  4AVP A;  4YG2 F;  1RNL A;  3E3V A;  5HDK A;  1JGS A;  2LF8 A;  2ZFW A;  4FX4 A;  4DQ2 A;  1BM9 A;  5BQT A;  3EYY A;  1BI3 A;  1U8R A;  2XIG A;  5LRS A;  5D8K B;  1XCV A;  2V1D A;  4ESJ A;  4HW0 A;  5BOX A;  4L9V A;  1BIB A;  5DUI A;  3JW4 A;  3P9K A;  1S3J A;  3VEP A;  3I54 A;  1IN8 A;  3ZMU A;  1DUX C;  1USS A;  4MTD A;  4EM2 A;  3I53 A;  2XAQ A;  5LHI A;  2HR3 A;  5LHG A;  3QOP A;  1U5T B;  2MLG A;  4HBL A;  4CXF A;  3Q9S A;  3QU6 A;  2V79 A;  5H20 A;  1LEB A;  1FBS A;  3F6O A;  3I5U A;  4BNC A;  3GYH X;  3OV8 A;  3F22 A;  3K9T A;  3DP7 A;  4OIR F;  4IJA A;  1E2X A;  1TNT A;  4UNO A;  3ZN1 A;  1WKM A;  2JRT A;  1XGM A;  3QPH A;  4KDP A;  1WWX A;  4RGS A;  2A3S A;  4L9J A;  3L2C A;  1V3F A;  5E1X A;  3BPX A;  1SFX A;  4U0Y A;  2VT2 A;  3V8L A;  1IXC A;  2DO7 A;  3JTG A;  2W85 A;  2JTV A;  3FWE A;  2BE5 F;  1H0M A;  3RDI A;  5E8G A;  1J59 A;  4I0A A;  5HLG A;  5LEJ A;  1J5Y A;  4MNU A;  4EJT A;  3M7G A;  5ED4 A;  2CGP A;  4R8H A;  4BQA A;  1F9N A;  3KLN A;  2XAF A;  2ZNY A;  4KN4 X;  4CO8 A;  2ZO4 A;  4ZYE A;  2NAZ A;  3OOP A;  2DBB A;  1ZGJ A;  1S29 A;  2XUB A;  1TQM A;  4RGU A;  5HS9 A;  1D8J A;  4AWX B;  2YU3 A;  3IKV A;  3BP8 A;  2STT A;  1OYW A;  3ZPL A;  2EWN A;  3BWG A;  1B1B A;  4UV8 A;  3HHH A;  3FXR A;  4G6Q A;  1Z05 A;  3GUD A;  5DV5 A;  1W7P B;  2VXZ A;  3DFG A;  2J5P A;  5JFR A;  1K79 A;  5CVU A;  3F8B A;  2BV6 A;  2DLL A;  4JK1 X;  4RGX A;  3FMQ A;  5HVQ C;  3L9F A;  1QO0 D;  5KK1 A;  3TOA A;  5K1Y A;  2VOO A;  5D6F A;  5H6R A;  3FM5 A;  3KFW X;  4YIF A;  2GAU A;  2E7X A;  5DD8 A;  1R1U A;  2RGV A;  4L0Z B;  3DKW A;  1CGP A;  2RNJ A;  3ZP5 A;  1U5T A;  2A69 F;  4JBA A;  5EEH A;  1FNN A;  5HOO A;  3T5X A;  2NNN A;  2GA1 A;  1QPM A;  3J81 K;  3K0L A;  1YS6 A;  1G3Y A;  3HUG A;  4CDG A;  1P4W A;  2R7D A;  5L3G A;  2FML A;  4O5V A;  1ZN2 A;  5BS6 A;  5JR3 A;  4EJO A;  3SZT A;  1TW2 A;  3CJN A;  1FPQ A;  2R3S A;  1J75 A;  5BPD A;  2WWY A;  3GFJ A;  1P4X A;  4HA8 A;  2A61 A;  2L4M A;  4YFN F;  5DYM A;  5AIQ A;  4U7B A;  2P5V A;  1OKR A;  3GO5 A;  1OPC A;  2VC0 A;  4M72 A;  2K86 A;  3FM3 A;  2X4H A;  3EUH A;  1T2K A;  2VBZ A;  2A07 F;  3WGG A;  2L01 A;  1MZB A;  5HDG A;  3MQ0 A;  2OZU A;  2DU9 A;  5E1W A;  1S8N A;  3L7W A;  3U1D A;  1TQP A;  4HLY A;  3GEZ A;  5FFZ A;  5AON A;  1P2F A;  4Q48 A;  3DV8 A;  1SD5 A;  5IT9 Z;  1EH7 A;  1W7P A;  4A5N A;  3ULQ B;  2DFI A;  1P4A A;  3ABT A;  1W7P D;  4B8X A;  2OQG A;  4I2O A;  2K7L A;  3CUQ C;  1EV7 A;  5ICE A;  4IF4 A;  2EA4 A;  1FYK A;  4EJW A;  1F4K A;  4RAY A;  5D5V B;  1TLH B;  4KMF A;  4I09 A;  3RYR A;  4HLX A;  1F5T A;  1FX7 A;  1R5H A;  2XAG A;  3LFK A;  4AIH A;  4HF1 A;  2KKO A;  2Q2E A;  2RDP A;  3ZMT A;  4XLP F;  4ZZD A;  1IN6 A;  5AIP A;  3SFZ A;  5ILV A;  3E5X A;  1T98 A;  2P7C B;  2QEN A;  2Y75 A;  5K5O A;  1O7F A;  3IRR A;  3JSP A;  1TTY A;  5J8F A;  2IT0 A;  4U0W A;  3CLO A;  1YW9 A;  4OU0 A;  4RAZ A;  2CWE A;  2ELH A;  1AOY A;  1P6R A;  3C1D A;  4UVB A;  1FYM A;  2D1V A;  5FB2 A;  5LRR A;  5CJ9 A;  5J6X A;  5LLQ A;  2CO5 A;  4Q47 A;  4P55 A;  1IN4 A;  3F8F A;  5L3E A;  1KQ8 A;  4N9H A;  3D5L A;  2ETH A;  2VE9 A;  4HX7 A;  3ZMV A;  5J8C A;  1XGO A;  1S6L A;  4HDV A;  4KFC A;  2FBI A;  1OYI A;  3V7S A;  2DAO A;  4A6E A;  4CYD A;  3FXQ A;  2HKX A;  3WTX C;  3PQJ A;  1IRG A;  4ZH4 F;  5K5R A;  2ISZ A;  2ZKZ A;  2XGX A;  4ZYD A;  4ON0 A;  4GYI A;  1HW1 A;  1YIO A;  4LK0 F;  3O6B B;  4UV9 A;  3RKW A;  1KYZ A;  4M74 A;  2IVM A;  2GA2 A;  4YFX F;  3HRS A;  3R60 A;  1PP8 F;  3ISP A;  2FXA A;  4DNC A;  1ULY A;  1FLI A;  3WTT C;  2XKO A;  4AD9 A;  2CW0 F;  4P96 A;  1STZ A;  3M1E A;  4QLC U;  4PGH A;  4OIN F;  5E8I A;  2WTE A;  3KZZ A;  4HX8 A;  2XRO A;  1XN7 A;  1JHH A;  1BBY A;  5D5U B;  2STW A;  1Z7U A;  2ZBK A;  2OZ6 A;  3RYP A;  1X3U A;  4G6D A;  1QZY A;  1OMI A;  2PI0 A;  1R00 A;  3WGI A;  2DPU A;  3TQN A;  4L5I A;  2K4B A;  1LEA A;  5LGT A;  2BGC A;  3HTU A;  2VE8 A;  2NS0 A;  3DEU A;  2RC4 A;  2Z3Y A;  2EA2 A;  4G7O F;  3H92 A;  2M8E A;  2DQR A;  3MEX A;  3BJ6 A;  1G4D A;  4A5M A;  2HYG D;  2J5O A;  4WXD A;  3CO6 C;  1J9I A;  4RB1 A;  3GZ5 A;  4MTE A;  4HF2 A;  4HF0 A;  5DEQ A;  5H6Q A;  4KT5 C;  3SHF A;  1LJ9 A;  2F5D A;  2EB7 A;  2FNA A;  1QQI A;  2M1B A;  4HZF A;  2EJR A;  4ENK A;  1F1Z A;  4OOI A;  3ABU A;  1UHW A;  3WTZ A;  2IA0 A;  2OAZ A;  4XSZ F;  3VB2 A;  2HQR A;  2W24 A;  3COA C;  1UCR A;  3WGH A;  1ZHF A;  4JQF A;  1DDN A;  3I58 A;  1FBQ A;  3I59 B;  1G3W A;  2P8T A;  4L9N A;  4M9Z A;  1BI1 A;  3REO A;  2K02 A;  3ZMS A;  4HV6 A;  2DT5 A;  3DPT A;  4ZYH A;  1O7L A;  4M9X A;  3M9A A;  3R4K A;  2HQN A;  2M87 A;  3V8J A;  4IHS A;  1MGT A;  1I1G A;  3I0T A;  3T8T A;  1U3E M;  3F23 A;  2FA5 A;  4OMZ A;  2COM A;  4CIC A;  2QM3 A;  3HOT A;  4CZZ A;  1W5S A;  2D2W A;  3QP5 A;  1A04 A;  3CTA A;  1KGS A;  1ON2 A;  3KP3 A;  2H6B A;  2VBW A;  3L09 A;  1GXQ A;  2M30 A;  3RPQ A;  3Q9V A;  3C3W A;  3LA3 A;  3I71 A;  3WTU C;  2DW4 A;  5E1Z B;  2L54 A;  1K78 B;  2FNP A;  4MHG A;  4Z2Y A;  4MQV A;  1FOK A;  5LGU A;  2LSO A;  2YPR A;  3LWF A;  1XGN A;  4KUM A;  5ICG A;  4U88 A;  3GF2 A;  4P9U A;  1IUY A;  4YII A;  1QNT A;  4L9T A;  4PCQ A;  1BC8 C;  3LA7 A;  4OIP F;  1Y0U A;  3IHU A;  4WXC A;  2FMY A;  1MDM B;  1B4A A;  3I64 A;  5FD5 A;  4GYG A;  4LG0 B;  5JHU A;  2O03 A;  2YX7 A;  3BRO A;  2CYY A;  3QP6 A;  5F1R A;  2V6C A;  4LD5 A;  2JPC A;  2H09 A;  4P5O A;  1BI2 A;  2QQB A;  2OBP A;  3MWM A;  2FEZ A;  4I98 B;  1UST A;  1IRF A;  2MH9 A;  5D5X B;  4HQM A;  2QYO A;  1FYL A;  3GFI A;  4FX0 A;  3V4G A;  3I4P A;  1Z6R A;  2XHK A;  5CVJ A;  1I1S A;  1BN5 A;  3I59 A;  4NQW A;  3KEQ A;  1SD4 A;  2O8X A;  2RVC A;  2JT1 A;  4WWC A;  4UXN A;  4GO1 A;  1BJA A;  3GFL A;  3W6J B;  1MJB A;  1E17 A;  1PP7 U;  2HFH A;  2IPQ X;  3FZV A;  3GWZ A;  4P9F A;  2P6T A;  4XSX F;  3O2P E;  3RTR A;  2QWW A;  5DCM B;  5JI6 A;  2DI3 A;  5IT9 K;  2ZME B;  1T38 A;  3FF5 A;  1CF7 B;  3F72 A;  4EJU A;  4KIC A;  4N9I A;  4BHP A;  5FLX K;  3BJA A;  4EM1 A;  2IA2 A;  3LAJ A;  1GHC A;  2VBY A;  3R0J A;  2CQK A;  2Z99 A;  2OD5 A;  3WG9 A;  2ZJ2 A;  1KQ9 A;  3U2R A;  3IL2 A;  4FT8 A;  3GW2 A;  4A0X A;  3KZY A;  4LFU A;  3HIF A;  1IZ1 A;  5D4S A;  1K78 A;  3QU3 A;  3MCZ A;  3R6S A;  4EM0 B;  2BYV E;  1HKQ A;  3DQV C;  1UB9 A;  1HQC A;  4AIK A;  2G9W A;  3RIR A;  2F5E A;  2MBF A;  5CLS A;  2DPD A;  5HS7 A;  3BZ6 A;  3CDH A;  1EH6 A;  1SD7 A;  2G7U A;  2FBH A;  2MLK A;  4U0V A;  1SD6 A;  2V9V A;  1MDM A;  3C7J A;  3ZMZ A;  3VOE A;  3ZMD A;  1YTY A;  2CFX A;  3R61 A;  1PUE E;  4LG0 A;  1U2W A;  2YR2 A;  4U7D A;  5L3F A;  1I6X A;  3DXJ F;  4HAM A;  3SXY A;  3RI4 A;  2F5C A;  3IC7 A;  3B73 A;  1ZAO A;  1ZLJ A;  4Y15 A;  4HOB A;  2AS5 F;  2XVC A;  1LNW A;  2O0Y A;  4I02 A;  1T6S A;  2FOK A;  4NB5 A;  3BDD A;  5FLX Z;  2ISY A;  2NYX A;  1DPU A;  5JVT A;  3ERE D;  4I0B A;  3KP7 A;  2EFO A;  3P7N A;  4CHU A;  3G3Z A;  3TO9 A;  2VN2 A;  2HZT A;  2ACJ A;  3MFK A;  4M6X A;  2AXL A;  3WOD F;  1LVA A;  4OIO F;  3ECH A;  1T0F A;  5DCM A;  2IJL A;  2JSC A;  1RUN A;  2VBX A;  2ZME A;  2QBY B;  3AAF A;  3HSE A;  3M8F A;  1D8K A;  2YX4 A;  1CF7 A;  4BHC A;  4LB6 B;  3LST A;  3SZP A;  5LEK A;  1R7J A;  2JZY A;  2OU2 A;  4LLG F;  3K1N A;  1RIO H;  4HX4 A;  2ZNZ A;  1U5T C;  2HTJ A;  3TGN A;  1FSE A;  3MAJ A;  1LDD A;  2UXX A;  3MZH A;  4RGR A;  1RUO A;  4GCV A;  2VT3 A;  4UVA A;  3HYI A;  2QVO A;  3HSR A;  3S2W A;  3WTY C;  4O6J A;  1K6O A;  1KU9 A;  3V8K A;  2IRF G;  1VTN C;  1C0W A;  2EV6 A;  4D0P A;  2L02 A;  3LAP A;  2XAS A;  2E1C A;  1UFM A;  4KMU X;  4A0Y A;  3E6C C;  2DTR A;  1HKS A;  3TDU C;  2LDU A;  2HOE A;  1R1V A;  5A2Q K;  3FMR A;  1OYY A;  3EDP A;  1YS7 A;  3P9C A;  1H9G A;  4MQ9 F;  4LMY A;  4PDK A;  2IA1 A;  4PZJ A;  3N97 A;  3O3K A;  4S04 A;  4QWQ A;  1J7K A;  3T8R A;  3GFM A;  1Z9C A;  3T0Y A;  4LGW A;  3GX4 X;  1REP C;  2RV8 A;  2HEO A;  1G3S A;  1ODD A;  4WX9 A;  4EVI A;  2WV0 A;  3EET A;  2RQP A;  3F8M A;  1LDK B;  2PFB A;  3LQR A;  2EFQ A;  1Z91 A;  5ERI A;  3LQQ A;  2FBK A;  1QZZ A;  5DUK A;  1HKT A;  3TO6 A;  5HLH A;  5FGM A;  5FD6 A;  1IXR C;  2VC1 A;  4N0B A;  4KN7 X;  2W57 A;  1R5G A;  5L3C A;  1O3R A;  3RPU A;  2Q8K A;  1Z6T A;  4MEY F;  5TJJ A;  4L18 B;  3KP5 A;  3WE2 A;  1YW7 A;  3NEU A;  2GWR A;  1L3L A;  4WXH A;  2ESH A;  1LB2 A;  1DPR A;  1GXP A;  4IRI A;  1ZRC A;  1PDN C;  3F8N A;  2GXB A;  4PGG A;  2QBY A;  1YLF A;  2OA4 A;  2PG4 A;  5F6F A;  2A5Y B;  4ENN A;  3KE2 A;  4LK1 F;  5ILS A;  5D5W B;  1TQI A;  5FO5 A;  1I27 A;  4KYW A;  4R79 A;  2RKH A;  2XRN A;  1XB4 A;  5DCF A;  5DDG A;  1HBX G;  5BMZ A;  1S7A A;  5A2Q Z;  1Z1D A;  4ZYG A;  1G3T A;  4EQQ A;  2MA3 A;  5IT3 A;  2H94 A;  4IPA A;  1P92 A;  1MD0 A;  1G6N A;  4HQE A;  4IRH A;  2G7H A;  3HRM A;  3IRQ A;  1MKM A;  1FP1 D;  3ELK A;  3H3Z A;  2MC3 A;  5ILU A;  5EEG A;  2W84 A;  1KYW A;  1YG2 A;  1HXD A;  3CUQ B;  4M6Y A;  1FY7 A;  2VON A;  1R23 A;  1ZRE A;  1GVJ A;  1KU7 A;  1FP2 A;  1B6A A;  1FZP B;  3E6B A;  1ZG5 A;  4O3M A;  2Q0O A;  1XCB A;  4EGY A;  1HW5 A;  1RI7 A;  3VOD A;  1WSU A;  1HSJ A;  1IAW A;  3H3U A;  2P7V B;  1ZRD A;  4CGZ A;  1WI9 A;  4UHT A;  3D0S A;  2KIU A;  3HOS A;  3KP2 A;  1XDS A;  1XSV A;  2D1H A;  2PLY A;  3K1P A;  4IRG A;  3BJO A;  1WQ2 A;  1D3Y A;  2MH2 A;  4BHB A;  3WTS C;  5L3B A;  2ADU A;  5DD4 A;  3TO7 A;  2XAH A;  4B09 A;  2PEX A;  4G9Y A;  2PMH A;  1SFE A;  2PMU A;  3JAM Z;  4UUV A;  2TDX A;  1MJA A;  4Y17 A;  1XSX A;  3RKX A;  3ECO A;  2HTS A;  2GXG A;  3V7R A;  3Q5F A;  1S7O A;  3FXU A;  1BIA A;  4K2E A;  4LLN A;  4EJV A;  2P5K A;  1BOA A;  3C18 A;  4OIQ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...