1V3QE

Structure of human pnp complexed with ddi
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
288
structure length
288
Chain Sequence
ENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of human purine nucleoside phosphorylase complexed with inosine and ddI
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
total genus 81
structure length 288
sequence length 288
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1v3qE00
5IU6A 4M7WA 5IFKA 1Y6RA 1PR2A 5F73A 3FOWA 4TXNA 1PR5A 1PK9A 3NM6B 1Z33A 1TCVA 1ODLA 1PR6A 3C74A 1JE0A 1PBNA 1YQQA 1RYZA 1ZOSA 4D8YA 1U1DA 3UAXA 3E0QA 1SQ6A 1SD2A 5F7XA 4EB8A 4YNBA 1QE5A 2A0YA 4MCHA 2PGAA 3GB9A 4QATA 3TL6A 2H8GA 4I2VA 1U1EA 1OUMA 4TXHA 3UAWA 5EFOA 4TYMA 2OXFA 5F76A 4OF4A 1PW7A 1OTYA 4TXJA 2GUWA 3OCCA 2A0XA 1RXUA 3ONVA 4KN5A 5CCEA 4D8VA 2I4TA 1I80A 1Z36A 2P4SA 1M73E 1SJ9A 5ETJA 4K6OA 3KHSA 4BN0A 4WKCA 3E9ZA 3EMVA 3D1VA 4YO8A 1PR0A 1RXYA 3DJFA 3OZDA 4EARA 1Y1SA 2OECA 1K3FA 1NC1A 3ENZA 1VHWA 3KVYA 1V3QE 1Z37A 4WKBA 3FWPA 1T8SA 4M3NA 4F3CA 1N3IA 3E9RA 1ODIA 3P0EA 5CCDA 2IQ5A 4JWTA 1TD1A 1U1GA 4LNHA 3ODGA 2BSXA 2XRFA 5B7QA 4NY1A 1YR3A 1V45E 5F77A 3BGSA 1Z35A 3KVVA 4PR3A 4BMYA 1OU4A 1TGYA 1OV6A 4TTJA 4G89A 4ECEA 2QSUA 1XE3A 1WTAA 4QARA 3DF9A 5CXSA 1VMKA 1V48A 5EUBA 5EPUA 2AI1A 3O4VA 3UAZA 3MMSA 3NM5A 1JYSA 1JDSA 1YBFA 2OC4A 1Z5PA 1Q1GA 5F7OA 5F7ZA 1YRYE 2I8AA 1RFGE 3KUKA 1A69A 3EUEA 3QPBA 4DA0A 2OC9A 1TCUA 4E1VA 3OZCA 5B7GA 4R2XA 1K27A 1ECPA 1C3XA 2AI2A 3NM4A 2HWUA 1JE1A 4G41A 4X24A 4MCIA 1NC3A 3OZEA 1Y1QA 3DP9A 4TXLA 4GLJA 3OOEA 4DANA 3OOHA 3BJEA 4U2KA 4WKPA 4LKRA 4NS1A 3KU4A 1U1CA 1NW4A 2QTTA 4GKAA 3INYA 2QTGA 2AI3A 4DAEA 4QAQA 4D8XA 2A8YA 1G2OA 4DARA 1LV8A 2QDKA 4YMLA 3DPSA 4DA6A 4L0MA 1T0UA 3PNPA 1SD1A 4L5AA 1Y1TA 4NSNA 3UT6A 1CG6A 1YQUA 1ODJA 3K8OE 4P54A 5CYFA 2ON6A 1JPVA 3K8QA 1Z34A 2HN9A 3IEXA 5B7NA 1V41E 3FAZA 1FXUA 1OTXA 2ISCA 4GLFA 3EUFA 4R31A 4GMHA 4TTIA 3LBAA 3SCZA 1JDUA 5FAKA 3EEIA 2A0WA 4R2WA 5B7PA 1Y6QA 1PR4A 4BMZA 1CB0A 3FB1A 1ODKA 4TXMA 2HSWA 2B94A 4D98A 1T8WA 1RSZA 1A9QA 3PHBE 4G8JA 4OJTA 4DABA 1B8NA 4QASA 4UC0A 1Z5NA 3T94A 3PNSA 4FFSA 1U1FA 3O6VA 1A9SA 1VFNA 5CXQA 4MARA 3OF3A 4L5CA 1VHJA 4LNAA 1RT9A 5KB3A 5F78A 4TS9A 5C80A 2RJ3A 1PK7A 1A9TA 5JPCA 1LVUA 1RR6A 1A9RA 4F3KA 1T8RA 1ZL2A 3DDOA 1Y1RA 2Q7OE 1A9PA 1Z39A 1Z38A 4IP0A 4OGKA 4PNPA 3BL6A 3GGSA 1Z5OA 5K1ZA 1ULBA 4OY3A 4L6IA 4L5YA 2QPLA 3UAYA 2AC7A 4F2PA 4RJ2A 4LDNA 4DA7A 4QEZA 4TTAA 1PF7E 3P0FA 3PHCA 5CYGA 1V2HE 4D9HA 3FUCA 5I3CA 3OPVA 5DK6A 3F8WA 4H1TA 2HRDA 4QFBA 1JDZA 4F2WA 4M1EA 3LGSA 4WKNA 1RCTE 1PWYE 4OEHA 1PR1A 3KVRA 4DAOA 1B8OA 4F1WA 4TS3A 3BSFA 1PKEA 1ULAA 3LA8A 1TGVA 1RXSA 1K9SA 4LZWA 1T8YA 1V4NA 1LX7A 4JOSA 3MB8A 1JDTA 1A9OA 5F7JA 1JP7A 1RXCA 3FNQA 3U40A 4OGLA 4JP5A 1OVGA 4BMXA 3IOMA 3UAVA 4WKOA 3NBQA 4DA8A 1JDVA 4YJKA 3OZBA
chains in the Genus database with same CATH superfamily
3ILYA 3B5JA 3KEFA 1KFJB 3SZRA 5AI6A 4B80A 4CM9D 1CS4C 2Q1XA 1EK0A 2IYVA 1YDGA 2J9ZB 5JSKA 3U7IA 1R8XA 3FROA 1ONNA 2VJQA 4FFLA 1OBVA 4DCVA 5K7SA 1E8DA 1MQ8B 5DSZA 3I9V6 4Q4DA 2FMHA 2PNFA 2DLNA 2X6QA 3D9QX 5TF0A 1UBNA 1VLQA 1W5TA 2OOKA 1I5RA 2K4MA 3PUYA 4RD6A 1M7HA 2OMEA 4LMPA 4PYOA 2PGLA 3A1CA 1ODLA 1EG2A 2W6PA 4TLDA 3BOSA 1QH8B 3ZUGA 3D3KA 2RKWA 2VHXA 2ZBUA 1EGQA 2QUBA 4KWEA 4MQFB 2B1IA 5AKKA 4YJ3A 2EJVA 3ANTA 4NOKA 4R9RA 5LZ5A 3HB9A 1N2XA 1TEHA 2O2DA 2DFLA 3LF1A 2E1PA 4Q3EA 5JEDA 3A2MA 4O4JF 2GRJA 2W8ZA 4GXNA 2VBIA 4H7EA 4ZJUA 1P2SA 1UOEA 4HXFB 4U6SA 4ZQIA 4M9QA 5C46F 2RAVA 3M1IA 2FRVA 4ZAZA 1RACA 1DKNA 1ZEJA 2QMEA 1JLMA 3ABIA 3IVRA 3I2JA 4HTFB 1C81A 4YGYA 3EBOA 1I6MA 4QRIA 3OLCX 5FKJA 2C9BA 3ANYB 2CW5A 2IY9A 2VEDA 3CCBA 3JRWA 4MDYA 4UXIA 4MCHA 4CETA 3CQ9A 2PGAA 3QUAA 2XOXA 4F8EA 1VBNA 5KNBD 1GTRA 1FA9A 4E6EA 1ODCA 2GKGA 1J2YA 4MITA 4KC0A 2EIXA 2X0JA 4OXRA 2ZBPA 3LHIA 1W5AA 4W82A 3AH8A 1N2GA 1W44A 2Y4OA 4BFXA 5JYDA 5DP1A 4BVKA 1G5RA 4L2IB 3EWNA 1OKKA 3MPOA 1I7PA 3I01M 4IRUB 1L7EA 1QJ4A 2VP5A 2X1LA 3RIMA 2WHPA 3USCS 2AIRA 4UOZA 4HBZA 3HL0A 1D5CA 1UBRS 2OXFA 1T9GR 2B1QA 4QODA 4Q21A 3SZGA 3IBCA 3OE1A 4PO1A 3DLBA 2VNIA 5CDGA 4G09A 4HAXA 1I2CA 1XNGA 4PAOA 4OUDA 2GM3A 3OE7D 3MCZA 4H6PA 4ENRA 3O8CA 1J24A 2AV6A 3FMFA 2PJRA 2JAHA 3OX1A 3JS5A 2W4MA 5TS3A 4UD6A 4QHSA 3EUWA 2ENWA 3HUEA 3ONVA 1Z6AA 2BMFA 2J4FA 3ME5A 2PLAA 5DTRA 2JJQA 2I4TA 4RYLA 1YFKA 1CY6A 2JBHA 3OLQA 3NUQA 2ZRGA 1G63A 1WA5A 3TE7A 4W8HA 1DUVG 3R7AA 2FSPA 3KSUA 4MVWA 3G2MA 2HX1A 1EAMA 4Y9RA 3CRVA 3GLHA 3L7LA 3QNWA 3I1YA 4NICA 3GDFA 2ADMA 3NXKA 4YN3A 1Z4QA 3S27A 1JPUA 3EZGA 2DY0A 2P3SA 5KQGA 5M7EA 3U61B 4B4VA 1K4KA 3I04M 4RY8A 1OLSA 5B30A 4RA9B 4JB0A 3D3EA 2WRZA 3HN2A 3JSAA 4K9QA 4P5DA 3STHA 2WJPA 1IAVA 3ESXA 2YZKA 3BPSA 5EGSA 1LSUA 3HFJA 5EJ4A 2ODWA 2WP8J 3BD7A 3K9HA 4A2PA 1DQNA 4DMRA 4MRMB 5CFPA 2O5VA 2L2QA 3TTWA 1VBMA 3O3OB 2ZBRA 1TC2A 4K9DA 2PBLA 5BN1A 2PLNA 4BMCA 3R5SA 5KYGA 3GEIA 4X1IA 3S2SA 4JXXA 2PXXA 1XELA 1NM5C 1BE0A 3T7RA 4DLBA 1E5LA 1M54A 1FYXA 1Z6QA 4H6WA 1Z0KA 1HFEL 4OHMA 1IB0A 2DBQA 1KFCB 2DY1A 2JANA 3OKPA 4TVKA 2HU2A 2BKXA 3DTNA 3GEPA 4KGVA 4D6XA 1K1EA 2B25A 3GEBA 3T38A 1JIKA 3WLLA 4FC6A 3SMVA 2PUBA 2N3ZA 4HUQB 5HK8A 3WSWA 3NEPX 4KGXA 4IDBA 4CEHA 1N3IA 2ZP1A 3IX7A 3P0EA 2FSFA 3KO8A 2ZYAA 1DGQA 5AXBA 3ZDCA 3NGMA 4CWAA 5LQRA 2V54A 3FVVA 3I0ZA 4W5NA 1N25A 1FRNA 2VHVA 2ZSUA 2JW5A 3OCUA 3QHPA 3QG1A 4IFEA 1ZVJA 1GZSA 1XTPA 4EY6A 1NNLA 1E1YA 4MLPA 5B55A 1EFKA 4K8RB 1NYRA 2B4QA 2UVPB 1H9BA 1NPTO 2OAEA 2VVTA 2H08A 4A8JA 3TJZA 3TSYA 5FPKA 4LF7B 1WEHA 3HCRA 3GX1A 2XITA 3FLEA 4YCMA 3KSBC 1GVNB 3OX4A 1VL0A 1ZK0A 4ETIA 3VKFA 1OVMA 1JEYA 3PTZA 2MSNA 1DINA 3E9DA 5F4BA 4MMXB 4DUYB 2HQRA 4Q9HA 1FTSA 4G89A 5KYYB 2A5GA 4EYOA 1GZ5A 1N1DA 2ZZKA 3G68A 4MV9A 4WFQA 3HUFA 4BU1A 4F86A 3OZTA 4E21A 4F2DA 4RX1A 1Z7WA 4IKEA 4I6JA 2ID7A 1NI4B 2C2MA 3MLAA 3VHQA 4C9BA 5F2NA 4NK4A 5FBRB 3O93A 3DD5A 4ZVRA 2ZIFA 3IAM6 2P2SA 1GADO 4H1VA 4KR3A 1JYFA 5C7LO 1PLKA 3K9LA 4BQEA 3BWCA 4RENA 1PL7A 3OZIA 4IHJF 4OMCA 5DI9A 4OSOA 1UMCA 1XPUA 1U7UA 2XKJE 3G17A 4DMUB 1VE5A 4J4TA 5G53C 3W4JA 1CZNA 4QWWA 2A1UA 3WWZA 1DCFA 1HURA 4NU0A 1XD9A 3W3AH 2ZKLA 2XMPA 4LV8B 3C5WP 1OYOA 3WLKX 2H65A 1ZJYA 3AVQA 3Q9SA 1LFAA 4RDHA 1OLSB 5FR2A 1HTWA 2VXCA 4DR4B 1PTJC 2DFVA 2FAXA 1MPTA 2Q9BA 3LPAA 1AU9A 3ID6C 2FPGB 4YAJA 4ENSA 5CD9A 3UQZA 3V80A 3ZDEA 1CUZA 3NKLA 4GOXA 1JE1A 2Y0PA 1I4WA 4RH3A 2QRUA 4BVJA 1GUDA 3HR4A 1YNSA 4S1VA 3HL4A 2HIAA 1DAEA 2H5LA 3HWWA 4OFWA 1MLDA 3Q6MA 2AS0A 3GVPA 1APBA 2QUAA 3K9NA 4N3CA 3SDSA 3ZDFA 3HVHA 3IIKA 4MCIA 3ZZTA 3TXAA 3U3ZA 4AZ0B 3ENNA 4Z9YA 4L8FA 4GRAA 3TQOA 2AZ4A 3CNEA 3LKBA 4BO3A 1EFPA 4BVEA 3OOEA 1Y9DA 3R7DA 1T9BA 1QHNA 4KWHA 4BO4A 2O8DA 3W1VA 1XRJA 3NIFB 3BRSA 1W0KA 3IOEA 4IAOA 3JRXA 4ZU3A 5IUJC 1Z5ZA 3TAUA 4ALIA 4U2KA 1U2QA 4L4UA 1QGAA 4X00A 1RZVA 3ZIDA 1HL3A 2A4MA 2UYOA 2J0UB 3KQTA 4KR9A 4BEBA 5K6TA 5ILQA 1OBFO 1NW4A 3AEZA 2DQSA 3VNRA 3ICVA 2O2EA 1VKZA 4DAEA 3BQ9A 1CPYA 1ZK1A 4K3VA 4U00A 1ECBA 4RL6A 5IH7A 1OWOA 2VTBB 1DX6A 3N2NA 4Q24A 2J0EA 4MS1A 1IOLA 4PXYA 3VAZA 3ANSA 3UWDA 3TM4A 4EB6B 1ICIA 3RSOA 1ABEA 1ECLA 2HDWA 5LOVB 1GAJA 4UCFA 3GLSA 1V1RA 3DMNA 4CM4A 4XVUA 1X1AA 2VSOA 1UFQA 2HBZA 2R5NA 2R62A 4GLBA 3MTGA 3EBLA 1HE2A 2HWWA 1QX3A 5HYVA 1KMMA 3AHCA 2JBWA 1E1CB 3F9CA 2O6LA 4EELA 3U26A 3A4YA 2GK3A 5EOVA 3OSUA 3SQWA 1F1BA 1C30B 3GFVA 2A30A 4KFUA 3VO8A 2WMDA 3A36A 3K0SA 1NNUA 2BFEB 3LKZA 4AT1A 2H4JA 4DCGA 2P3QA 2X2EA 2HN9A 3EBPA 4FBMA 1PUXA 2WD7B 3B2QA 3KQVA 3F9IA 1RRFA 2NYAA 5KMGA 1B15A 2BSQA 5ERYA 1JAIA 2OCXA 3R3HA 3A3PA 4J2HA 1GZ3A 4J0QA 1USVA 4NBNA 4DV1B 1KIFA 3AZOA 3QKWA 3UYLA 2Q5EA 2GYVA 1AUVA 4W9NC 3AM5A 3ZKWA 1R6AA 3GRYA 5BSGA 1UWVA 5AP9A 3W9BA 4KQWA 2W11A 3AGPA 1PL6A 1Q7EA 3PITA 3O8BA 1U7TA 4DNQA 2DPHA 2XE8A 3FR7A 4EEKA 2B7LA 1JDUA 3HYTA 3IULA 4H7DA 4EGQA 9LDTA 2Z8YM 1AY0A 3ENQA 2A67A 4HX5A 3BTSA 3E2PA 3V4FA 1Q7BA 1UEJA 4QTTB 4RL4A 2BONA 3BKWA 5H80A 4AJ1A 1CE8A 2WG2A 3FBGA 3ONFA 2BTQA 4MQ4A 3LTNC 4WNIA 1IY1A 3CZ5A 3HR8A 4P4SB 3QFTA 4PFQA 2XOKD 3WK8A 3CZ9A 3B70A 2QV7A 2J1LA 4CUJA 4Z9AA 1ITZA 3P9SA 3PUIA 3PLNA 5A1JA 1GO2A 4EJSC 2DWUA 1W5EA 3A3NA 4YLEA 4N0DA 2AZTA 4FCCA 2C95A 1ODSA 1VJRA 2ORVA 3CONA 4XOUA 4IFBA 3KETA 4PPNA 4JUDX 3F6CA 1YGYA 3ZUPA 1SBQA 2Q27A 4Z3OA 1TMGE 3MQ2A 4Q4HA 4WLNA 4CV0A 1JHMA 5DHTA 1Y63A 2PO7A 5JMWA 1QX4A 5KX5B 4F0JA 4FFRA 2ABWA 1XMOB 4QFDA 1WCV1 3EYWA 3PNSA 4II7A 4RF3A 5G4KA 3W9UA 3SX2A 1V8OA 3V8EA 3TLEA 1QYVA 1D6NA 1U1FA 3O6VA 4K3UA 4R1MA 5ALMA 2OTCA 1FFXA 1XN1A 5IC6A 4MUNA 3V2IA 2ORED 5FOWA 2VP9A 5P21A 2PY6A 4IQ4A 4C43A 1NXOA 3NHRA 4BGEA 1FF9A 3BWBA 2A14A 1HDGO 1YS7A 1PGJA 3Q7PA 3AB3A 2GJKA 3L92A 5JG7A 1OTHA 4MV3A 4ITUA 4CMIA 4ZVLA 1M34B 2HHCA 2JFQA 1AZWA 4JJ7A 3NLLA 5J1TB 1ANKA 5KI6A 4CN8A 3CRW1 5EZ6B 5C7YA 3K2QA 1BDIA 3RWOA 3HJAA 3OTQA 1H4SA 2ZJ4A 4C7XA 2QD5A 3KTAB 2AW3A 3CF2A 1S3GA 3VPAA 5JJ5A 1H5QA 2GZSA 4AO6A 2IZ5A 2F6RA 2W8BA 3RIXA 5A5FA 3U19A 1N57A 4BGVA 3QITA 1FW6A 1WM1A 4EITA 2P65A 3WNCA 1G64A 1MDFA 2FOIA 4KAFA 1U8UA 2WYVA 1L1QA 3OFND 4IIEA 1YULA 1UF9A 4W8OA 1ZL2A 2I2DA 4QQ8A 2NU7B 3G02A 2FW6A 3WHLA 2C00A 1BKSB 1DTWB 1EAYA 1EU1A 1OIWA 1P6UA 3PU6A 4H18A 4RSHA 5IN5A 3I05A 3UAGA 3NONA 1EUDA 1E3JA 2QLJA 5LOVF 3WHPA 2RGBA 3EY9A 1E2FA 1WDTA 3PNMA 2W00A 1X8KA 2JI7A 3G7SA 5CHYA 3THOA 4GKBA 4JLDA 3ZD7A 2PO5A 3B6KA 1OXSC 2G8NA 1ACJA 3HEBA 4CF5A 1HX7A 4E2XA 2G28A 1QAMA 4X7MA 3EXEA 5E3JA 3WKDA 2XUAA 2I9PA 3O4GA 2VHTA 3VNQA 3RARA 2F8TA 1XXHE 2V5VA 1MGPA 2NXJA 2WMNB 3C5VA 5CJJA 2EWVA 4RJ2A 5BNFA 4CF7A 3DDCA 5ENDA 1KETA 3DBLB 4RGVA 3AR2A 4M1MA 3FZGA 2XGSA 2J87A 3WAKA 3FFTA 4QOSA 1SR8A 3GP5A 2IQIA 3L6DA 5I7HA 3EMBA 3R24A 3WE7A 5A4MS 5DGTA 2LTAA 1JLLA 2O8VA 3JPYA 3VAYA 1IONA 4A8HA 1TRHA 1P5RA 4FOTA 4NLLA 2NZYA 5GQSA 4DC1A 3IC5A 5DK6A 3RSFA 2OFOA 3IDSA 1VDZA 2XEXA 3M2PA 4E5KA 3KZMA 1XD2B 5K0LA 1O6CA 1WQ3A 1R8SA 2JCYA 3OURA 3QLVC 4Q37A 3L9XA 3LGSA 3SS7X 3EA4A 4LX8A 3BFXA 5L3QB 4M9UA 3KKLA 5IKXA 3GRPA 2GAAA 2FEXA 3I3OA 3N0RA 2XA1A 4XIIA 4CIDA 1B8OA 3NKVA 4JGBA 3ABQB 3IVCA 5IJ9B 1C8LA 1CQWA 5JJLA 3BSFA 4JR0A 5FAXA 2G5TA 2RB4A 5IUNC 3ZLBA 2PSHA 4IIJA 3RJMA 1K9SA 5K8LA 3RADC 4DA4A 3LYUA 1IC6A 3R1IA 3TAHA 1JR2A 3N8IA 3AHIA 4HEJA 2A92A 2X9NA 3BUSA 3GFSA 3L6OO 4HLDA 3UY4A 2H59A 4LAFA 2YW9A 3FPCA 4BRZA 5FB3A 3ZK7A 5IULC 4W8GA 1EFDN 3C3AA 5ALUA 4CM9A 5AUNB 3A6DA 2OYCA 3WZMA 1S7GA 3QLUA 2JRLA 4ZMBA 4UCQA 2E37A 1T4CA 3OQHA 1ADJA 2RHLA 4F5WA 1SXQA 1YU6A 1EDEA 2OPHA 2CEKA 2I87A 4QTUB 2N46A 1NRIA 4G86A 3TLMA 3UXEA 2CUKA 2GF9A 2GJ9A 5F9HA 5TLSA 5J58A 2OZKA 1XDBA 4AF6A 3MTIA 2JCSA 3RM3A 4JBXA 2OBXA 2FNAA 1YUBA 1D7AA 1VYHA 2F17A 3LCVB 3NPAA 4ZD6A 1R9MA 1IHDA 2VJMA 4NBSA 5G41A 4HNHA 1YJ5A 4CE6A 5L45A 1PR2A 4OQPA 5AIBA 5JVDB 2CLDX 4Y2VA 3TQCA 4XDGA 5LYJF 4ROSA 4XUGB 3Q7QA 4COOA 1X2EA 1WPRA 4CG3A 2FSVC 1TCVA 1E5TA 3F3MA 3C7KA 3H11A 2ESRA 4IIBA 5EC8A 1FTYA 1SBCA 2J32A 4JI3B 1KR2A 1G7TA 1M75A 1TLLA 4FNAA 4RFVA 4W5WA 5E6SA 3UKJA 2I8CA 5IEBA 3ZXIA 4MR8B 2X0NA 2ZSEA 3PUWA 1GYQA 4V2IA 3WHIA 4KYTA 5AKLA 3WKAA 1T6YA 1P0MA 5JROA 1W25A 2DWQA 2J9GA 1PBNA 5EYPB 1FPQA 1RYEA 2NO5A 4HWSA 2VQFB 1KO4A 4R8VA 3IP6A 3RABA 1PCXA 2VH1A 3DKVA 3GNQA 1JTVA 3HYCA 5CDYA 1N2BA 1SQ6A 3K1JA 3NTUA 3EWIA 4PWZA 3BIJA 1XGKA 3N5KA 5LP6C 5JDCA 4CEIB 1LBEA 4R3UC 5CVDA 1S0UA 1N36B 1T8PA 1COWD 4JR2A 3RVDA 2EKLA 4JDPA 5EJ5A 5BYBA 1BXGA 4AM8A 4E70A 3TL6A 4D43A 3L8EA 1WPGA 2JGLA 1D5WA 1IM8A 3EVTA 3GQVA 4WAUA 1FSZA 2QU8A 3WLTA 4DCNA 2A1TR 2JCBA 5HQ3B 1L0BA 1KY5A 1TW3A 2C4MA 1VHDA 5CNKA 4DG9A 5KREA 3MYYA 5KIAA 4C4RA 2BPOA 5HHTA 2EZ8A 1WZNA 4WDRA 1EZ1A 1KFBB 5AKHA 4EHNA 5HNKA 4G5QA 5EE1A 1I7LA 2PZLA 2XYGA 1JG6A 3LI2A 3L05A 1RKBA 3L5KA 4NWIA 1WZ2A 4YRTA 5JCJA 3Q8LA 2A9FA 1TD9A 1B23P 4IUYA 4TXJA 1KI2A 3T0IA 2GUWA 4GVXA 1BHO1 2KW5A 3QMMA 5EJGA 5G40A 4AF7A 3P0RA 1JHRA 3F6BX 4ZI3A 1IY9A 1USKA 1FMCA 1KO8A 5ALRA 3OQVA 1KDZA 4FUQA 1XKQA 2XYVA 3RSCA 5AD1A 3E3MA 4D74A 5KYUB 4JYAB 1DXOA 2A84A 4HH1A 4O8CA 1NJGA 1KS9A 2BGNA 3PDWA 3TCXB 2FN7A 1NW3A 1YUMA 2D1SA 4HB4A 1SUSA 4WASA 2PV0A 1SHLA 3JQ7B 2ZI7A 2P78A 1U8ZA 3NEJA 1M73E 2R00C 3KOWA 3NFYA 4KDRA 2WAOA 2XTMA 4UM7A 2QDXA 4LF5B 1ZCBA 2R8EA 1A50B 3PJGA 2ZBQA 4G9EA 3CE9A 1RXWA 1A4RA 3F7OA 3U6BA 1K3TA 2FEOA 2Y1GA 4QPJC 2UZ4A 5DTMA 1FRFS 1VA5A 2JLAA 1NGSA 2ODPA 2V7PA 3RHSA 1KH2A 2EFGA 4NBKA 4OP2A 4TL8A 5HKKD 4XM0A 1JG2A 3ITKA 3D7KA 4X6UA 5DM70 5HDBB 2I4LA 3AV3A 3PA8A 4NYIR 4ZPXA 4CKXA 3HMKA 2IWRA 3B85A 3VVBA 4KQXA 2GN8A 5EJEA 4HXYA 4TVSA 3WA7A 3AOEC 3IAXA 3OOWA 3FUTA 4TWJA 5B64A 1DWOA 3ND9A 1T10A 2NVUB 2CYBA 1Q6ZA 1N92A 3WIDA 4J7XA 3R6DA 4A8JC 2OGUA 1SUDA 4KX5A 1JKJB 4IQ0A 4EHJA 1RFLA 1A27A 2LCQA 4IGEA 3EJWA 3RWBA 1LQUA 3TZQA 2GBFA 4XX0B 4NG5A 2XRZA 1PD0A 4AWAA 4J7AA 3Q2OA 4EPRA 4MSUA 4GI1A 2UU9B 3E2IA 3VV3A 1CZLA 2YJ3A 2ZUWA 3FJ1A 3ITNA 4MULA 5DU2A 2NVUA 2VKTA 1JXMA 1WVMA 3GP8A 1NX9A 4YMSA 3GLVA 3MBIA 1DWQA 2ZDQA 1NV8A 3GUHA 10MHA 3K2BA 4PLFA 1YR3A 3BXEA 3SN6A 2QW8A 2W93A 3R41A 3L7BA 4JELA 4OHBA 3ADDA 3Q7IA 4P5PA 2OSBA 3WYCA 4II2A 1MORA 4GDMA 1G55A 2Q21A 5AJUA 3SZ3A 1BXRB 3GOQA 2BR3A 3QUSA 4PRYA 2G76A 2QM3A 2XNHA 1AIPA 1RPAA 2QJWA 2ZREA 2CHVA 1EGHA 1XK6A 4LTDA 1W2HA 2REXB 4H1HA 4L9SA 5EINA 1PE0A 3ANMA 3MHTA 1L7BA 1LLQA 4ZT2A 3K0BA 3OZAA 3U13A 2HW8A 2EKBA 4P0PB 4LQDA 3L0OA 3IPLA 3HGQA 4G1FA 4P3NA 1BXKA 5CXSA 1M2VB 1ZHHA 3WYBA 1OZHA 1BRTA 2QTFA 5FFMA 4MUMA 4L0QA 1XAJA 4KPEC 4KFCA 1GUAA 1Z47A 2IT1A 2PX4A 3K5HA 2ZYHA 4J8PA 1BHQ1 1QRAA 3HP1A 4JVMA 4E07A 5HJEA 4J7CA 5ESDA 4HAZA 1HY3A 5HA5A 1F2TB 1E1QD 3AZQA 3C70A 3IPXA 4NENA 1L7QA 1BFUA 4ZU6X 5DCLA 2A9VA 4M0MA 3KVNA 3PUJA 1RWWA 4Q34A 3W77A 4F8YA 1Q1GA 3TBKA 4XDZA 1ULUA 1AN0A 1LF0A 5SV2A 1Z4PX 1ZJ5A 1HL7A 3IRVA 4P22A 4NR0A 3VDQA 5CK4A 1NHGA 2LZ0A 3QFSA 3ZDQA 2WYUA 3ORQA 4Q1EA 1K4YA 4LDAA 4ER0A 1E79D 3DB2A 4MV7A 4PZ9A 4RLSA 4AUNA 4B71A 1YDWA 1T5IA 1QFYA 1E2PA 1R5OA 2AQIA 3PWKA 4H77A 5HQ3A 2X23A 1HFWA 2C3PA 2HQBA 3AOEA 4R7TA 3DMFA 1TIBA 2QTVA 4MJ3A 3RV4A 4TZKA 4Z4FA 4ZHQF 1VSVA 1ECPA 1TCAA 2P9ZA 2RGNA 2XQFA 7ABPA 4O4LA 5HWSA 3ZZUA 1NUPA 3QEOA 1PWXA 2AFVA 2V6JA 2HWUA 3RB8A 1NI3A 2B0CA 2VT2A 3RTDA 1I0LA 1KIAA 1Q19A 1KSFX 1QDEA 4J0IA 2EP8A 3SZOA 1JILA 2QD3A 4NESA 3VTFA 3L01A 3OM1A 3NC1C 5DXAA 2Q46A 5K5EA 3K15A 1Q22A 1NUAA 2BKUA 4D1YA 1E3EA 1J2TA 2HJHA 4BQNA 1PYGA 3UC9A 1X1EA 3C3DA 3AJAA 3LL4A 4UHJA 3MIIA 4BVHA 1ZISA 3NWPA 2ZDHA 4JBIA 1PYOA 2BFPA 3GFBA 4LKRA 1BYUA 4CT0A 3TLYA 3VA7A 4MZDA 1KTIA 2GX6A 4HQ0A 4G01B 5HE8A 1I3NA 2J07A 4PAWA 5TGTA 3L6UA 4MJLA 1A7UA 1K06A 1TYCA 2BE9A 2BZ0A 2Y2VA 3ADPA 3R3YA 4MWCA 2D1YA 3AY6A 4UHHA 1G1MA 1AUXA 1OBHA 1EYZA 2Q5LA 5DBFA 3WIUA 1LV8A 3R3UA 3PQ4A 4BO9A 4C0AC 3GK3A 2GBPA 4M0FA 4Y7CA 2C7PA 2Q6TA 2IA5A 1ZM9A 4ILEA 2QE7A 3FGPA 1E77A 1KOGA 3KR2A 1JAHA 3QFRA 1MOSA 1T0UA 3K8YA 2AK3A 4LHZA 4IRMA 5H1YA 4UZEA 3MILA 5AI5A 3MLBA 1VLZA 1NDUA 1KQNA 5A5VA 2A4KA 4MMYB 4XB6B 4E30A 1AF7A 1JSXA 1XZKA 1BS9A 3HFSA 4CKYA 5JXJA 3T3PB 1EDZA 1MO6A 3U48A 4BECA 1CUEA 5CYFA 3DLIA 4MGZR 2VRCA 4HFRA 1KAQA 2ON6A 4Q9IA 1TAQA 1XMXA 1H1DA 2G67A 2LP4Y 3QEKA 4B44A 2BF4A 3PWZA 3KWMA 5JH7F 1WJGA 4LI0A 1NVFA 1V4BA 2AE1A 1Y4ZA 4R1LA 1JBEA 2CVPA 2GYUA 4RMNA 5LDHA 2OKCA 2VF4X 3BD8A 3V6LA 1LI4A 2CVZA 3WICA 4YV1A 3DFKA 2HU5A 4S12A 5IMSA 1BN7A 5LP6A 4QWMA 4PGFA 1RVDA 1E5XA 3DBRA 3TLCA 5JC8A 5AM1A 1L5MA 1U2SA 1EGMB 4GMHA 5LKRA 3C16C 4HT3B 2RIPA 4LDQA 4KQEA 2EWWA 1Y8QB 3BA6A 1JXOA 2FXIA 2RFLA 5CVJA 5FJJA 3QELA 1NKTA 2NV2B 4A8TA 4JMLA 4BNKA 2EL9A 5TIIA 1Q7GA 4H1UA 4UBLA 2HC9A 4CM4B 1N1GA 1RYHA 1JLKA 2GYYA 3OCVA 2R1VA 4JI2B 5ILGA 1LGYA 1ORTA 3HUDA 1F06A 3P96A 2I4RA 1RRCA 2P40A 1L8AA 2P9FA 2G5PA 4ZIRA 2BCGY 4Q4LA 4BJ3A 2WD9A 1QQTA 2HA4A 3QTTA 1OAAA 4AP9A 2VUHB 2F1RA 3JWJA 3VYRB 1U6KA 2V59A 3G1TA 2GD2A 3QVXA 4KIGA 1QS0A 5ALEA 1VE7A 3GG9A 5FO1A 2QWXA 3IMCA 1G98A 4GE3A 2YQZA 2YHSA 2WU1A 4UNRA 1HXHA 2O1XA 3HDHA 3LTEA 5BMVA 2C1EA 4JQOA 1QU3A 1YCDA 1JDJA 3OICA 4WJZA 3CF6R 4A7PA 4TWZA 1U04A 2A6PA 2HTFA 3U1VA 1EE9A 2QPAA 2NQ2C 3HO8A 1H1LB 3AI2A 5EWJA 2VHQA 1HQKA 4D9JA 1AK9A 2IHYA 3GFQA 2YNMA 4G65A 3UGQA 5CDUA 5EERA 1E3WA 4M86A 2EG9A 1A9SA 1TT5A 4S3MA 5FBVB 5I9SA 3DTVA 4WW0A 1NMSA 1WRBA 4JX8A 2FEMA 3QLUC 2A5JA 1DO0A 4P4GA 4LRSB 5ALSA 4BKQA 1UINA 4EF6A 3B1XA 2CLCX 4K6KA 4PSDA 4YMIA 1BX0A 2OV1A 1BDHA 3QVGB 3BXXA 4BX8A 5EE5B 3CWZA 3ZDXB 4MW9A 1MD9A 3CS3A 3BHJA 2IS4A 4F21A 4LNUA 2PH1A 3EEOA 2JIRA 3RVRA 5E6SB 4I1SA 4EJFA 2R4UA 4OQNA 5I9TA 2H4FA 2QRVB 1GGMA 2R11A 1BXRA 3QFCA 5BSVA 2CHUA 1V5WA 4RD0A 1ZZEA 2DH6A 1NE2A 2VAPA 1LVUA 3EXHA 4PLTA 4CL2A 4ARIA 2X5XA 4GMFA 3MJSA 4P7BA 5BN4B 4A9AA 3ZNPA 2IL1A 5CA0F 3U60B 1TCCA 3OTIA 4NEQA 4NULA 1FFBA 1MO5A 1T8RA 2E6UX 5DCWA 3NOOA 3QA9A 2E5WA 5NULA 5JJKA 4KN9S 3TFQA 3JATB 4MP6A 4XIJA 3IB3A 4EI9A 1MJFA 3BICA 3QLVA 5ITVA 5I9BA 5I7WA 3FIUA 5CDSA 4O3FA 2HWYA 2ZRBA 1JHYA 3NEAA 5PNTA 3ROKA 1YKFA 1Z38A 4K5QA 5BN5B 3UO8B 5EHGA 1TYDE 4CFYA 4TYNA 4GQIA 4RXMA 1V7ZA 2NUTB 3FVRA 1WDLA 4S2EA 2RB5A 3AR3A 3WNQA 4EYGA 4B2LA 1L7RA 1BGWA 1OU0A 1P9RA 2AC7A 4L76A 3ZIAD 1NA5A 2VAVA 5AJHA 3HHPA 2TMKA 2ONZA 4EDFA 1NL3A 3IPCA 4RIFA 4QM7A 1OC2A 2OO7A 5IBPA 2ZVDA 2Q62A 3ZI7A 5AK3A 3U9LA 4IX9A 4ZGGA 2ROQA 2CNNA 2H0RA 1CUVA 4QRDA 1UEIA 4WUTA 4ZO4A 3PJDA 5DIZA 3DDWA 4MRVA 3AUKA 3H0CA 4YI3A 5ITZA 2HK6A 3R5XA 5E6RB 3VYTB 2D1QA 3AUUA 4N7RA 3AKCA 2QZPA 4Q47A 3N2KB 1UKVY 3GCGA 3LC2O 1X92A 3M6VA 1FX1A 4WZAE 2B98A 3ZKAA 3OEWA 1J42A 2FN4A 1JDZA 1O8BA 3DZDA 1GD1O 2AMFA 2ZJ8A 2AD1A 2O1WA 3PXEA 1CY1A 4BYGA 2MCFA 2E1RA 3BJZA 2G70A 2J09A 4JN6B 3EB9A 4CQMD 1J99A 4GYYA 5IJ9A 1FJ2A 4RKWA 1N0HA 4RHEA 3ZGYA 1IEXA 3COYA 3PPVA 1RXSA 1E98A 2PZMA 4EAQA 1GGHA 4UFNA 5K03A 2GDZA 1CT9A 1LBIA 3QIAA 4MI6A 2ZFUA 1IULA 3O84A 4UTXA 4HBGA 5L3ZA 4JOSA 3CFYA 2WF7A 3KZKA 3MWLA 2VHCA 1JDTA 4R05A 1R6XA 4YP0A 1TZJA 3FVQA 3K1YA 1A9OA 1QZXA 2WWTA 4R2MA 3M8KA 1Y9JA 3GGPA 1X1CA 1DFHA 2P91A 3EY4A 2XBUA 4OI1A 3RQSA 4KPFC 1HG0A 3KHUA 2IGBA 3FKQA 2J5BA 4Z7OB 1KQPA 2HHAA 1DC7A 2R8PA 3DMHA 4MS4B 1C3JA 3GT7A 5EHZA 3STYA 1MB4A 3PG5A 3AB7A 2NUPA 2VAMA 2W98A 4H7FA 4D9BA 1TK9A 4QXOA 2XOEA 4H6VA 5E7JA 3NHLA 5EMJA 4ZN6A 5K45A 1IFXA 1I4OA 1QDLB 2WSIA 5A05A 1Q74A 3RC2A 2VTKA 1HNWB 3KC2A 4GL2A 5DWDA 3WNBA 1P73A 3AF6A 2XXAA 2VJYA 3VR4D 1JAYA 3GVHA 1MKYA 2VKQA 3OPQA 4BXOB 1FPMA 4NVRA 3VNAA 3WGKA 2A5DA 4ZKEA 5HR5A 3EODA 4H6XA 3AONB 1OGJA 3ABRB 4M7WA 1E94E 4LCEA 3J81A 4HDQB 4PZEA 4I8DA 4MVJE 4NOLA 3R20A 1LS1A 2E21A 3OP1A 1H4VB 1B14A 1UKEA 2FZLA 1SU4A 4NMHA 4UXJA 5AI4A 1O0CA 4Y1FA 3PFFA 2RAUA 4X1KA 2X3FA 5D01A 1L2TA 5BRNA 2H52A 3FDZA 5FUVA 3FOBA 5HE9A 4F46A 1KQFA 3NS7A 3K72B 2E4YA 2GARA 1XJ0A 4MR8A 1O5TA 4QBIA 2VP0A 4JXKA 4AQ7A 4TLLB 4GE0A 4DY4A 1JQ5A 4JC8A 4UATA 4AWXA 3L1HA 2I33A 3OG9A 5FEMA 1KK3A 4IR7A 3AK4A 4LDZA 2MHCA 1MW8X 3EIUA 4BNLA 1OXKB 4I50B 3SBEA 1GQOA 4GMDA 4JYBA 4F1KA 1GAQA 4J91A 2LWIA 1E7QA 2CZQA 3WLIA 1MJHA 1U2GC 5CYOA 4XRRA 4UBKA 3WGHA 4J1SA 3QXJA 3WO1A 1E2UA 5JSFA 1XMSA 2NGRA 1QE5A 3OSZA 4PGMA 4Y6PA 5IH3A 4HYYA 1SHKA 4HDSB 1ZSYA 3HN7A 4JZYA 2IJGX 2XGOA 3F97A 3JQAA 1YC5A 4K9RA 4OREX 5ARCA 4ZAXA 2RBKA 4DWWA 4Q9NA 2IHTA 4MQFA 4ZYUA 3W6OA 5C9ZA 4LYJA 4I2VA 1U1EA 5KJ6A 1ZJZA 2IYFA 2N47A 1ZU5A 2BEKA 5D87A 3JARB 1WMEA 4O2AA 4FU0A 5A71A 1YQXA 4MAMA 4F1JA 3CLVA 4ZQEA 3TRDA 3OU7A 3ZHSA 4XYBA 4QPNA 3EQ6A 1MA3A 2J4CA 3M9XA 4RZ2A 3EXG1 3N86A 4YLGA 1PW7A 4B3CA 1V4VA 1D1QA 4GD3Q 1QTQA 4L1KA 3NIDB 5KBYA 1G6KA 1W87A 1T2NA 3O8DA 3VTZA 1Y3HA 4UVIA 1IG0A 3WL6A 2B5VA 2V98A 3T7DA 4BKRA 1LLFA 1Y4SA 2YVUA 4MVJD 3BILA 5DXFA 5EZYA 4BRUA 1HT2E 1LBTA 3E84A 2EFCB 4PFJA 2B8EA 4ZEVA 1ORDA 1I3KA 2ZS7A 3E61A 1QYXA 4IIYA 5AJTA 2D0DA 4E5UA 4B45A 1TJ5A 3AP1A 5AKJA 2CFSA 3BD6A 4RVFA 3UMBA 1X2BA 3PJFA 4YDSA 3RJZA 2H11A 3DL0A 4RK7A 1LTQA 2H6EA 1PFYA 2CD9A 2IXDA 3O91A 4URHA 5IC4A 2GF2A 1JEYB 1SOAA 4P81A 2GOYA 4DLVA 1Q0RA 4ZCRA 1RPTA 4N0EA 1P4SA 3DVQX 4A8JB 2IP4A 1ONBA 4MW2A 1RXYA 3LXRA 1NBEA 4DIEA 2I4NA 4YT4A 1JA9A 1LV7A 4LXGA 1DO2A 5A3SA 4EPTA 2RHCA 4DSOA 4XLZA 1Q1NA 1RMYA 1WKBA 3TKAA 2J30A 5JVDF 2WJVA 1RC1A 4N01A 3DVAA 1AGRA 1N9GB 4XGRA 1XZDA 2JAXA 3P9NA 1JDNA 2ZROA 2FF5A 4FNMA 4BNVA 3ND6A 2HF8A 3D0KA 1UFVA 2G77B 2QN6A 2N9UA 2Y1CA 3BXHA 3TECE 3NJRA 4WKBA 4NRDA 3LP6A 4A0QA 2GZDA 2I1LA 2WWRA 3PTLA 4ABYA 3N2IA 4J0DA 4LJAA 2HPHA 3W3AD 1Q7RA 2JIZD 4IDDA 4OU5A 1ODIA 2I34A 4KH1A 2ZTLA 3SQLA 7MDHA 1M10A 3TW8B 4Q4JB 3VR3A 2C57A 3HABA 3HU5A 4B2PA 3PSHA 1XL0A 1CXZA 2FUG1 4B3XA 4RACA 2GYWA 2EQAA 1XN4A 3PR2B 4JK3A 5E6UB 3PEWA 2X13A 4TOIA 4G1UC 4O0LA 2ZANA 2X42A 2GM9A 3GLUA 3VHRA 2WPNA 1HDOA 4GR9A 2C0PA 5CNMA 1ZYUA 3OTHA 5BQXA 1RI2A 4M9CA 1EJ6A 1RXEA 1XA4A 2Z9BA 1X1TA 3SS8A 3M6MD 5CX4A 4NYMQ 2ZTVA 1DWPA 1ZD9A 2O2XA 4XJTA 3FTQA 4E2WA 4CEJA 1T4BA 3LK7A 3EPRA 1MEOA 4MVYA 2OV4A 3FZNA 1SUCA 3KYCB 5L95A 1DEHA 3QUTA 1GLVA 4BV2A 2R8YA 3VPSA 4DS3A 1OZ0A 4QT0A 1OD6A 4TTJA 4Y6OA 4Z2AA 3CZ4A 1RLMA 5K3AA 3HBAA 3K35A 3I37X 1ATIA 1L4KA 3CBGA 4OB7A 4B3TB 5KOYA 3G5UA 4BIMA 2QRHA 2VT6A 3AFGA 5JDCC 1KYWA 1EB9A 3LCMA 4NFHA 3WJ2A 4CMCA 3JD3A 1E9FA 3GYBA 3V1NA 4BNDA 5EUBA 1ZN8A 4F7DA 1FFXB 5TJ9A 1YKGA 3M81A 4KXLA 1W19A 5TX7A 2C9MA 4C7VA 2P69A 3QEMB 3S2UA 3IMGA 1HV8A 1Q84A 3MIZA 3NM5A 3OPMA 2REOA 2JJ1D 1JYSA 3L06A 4CYMA 1JQLB 1CYEA 3Q3IA 3RK1A 3TSOA 4HI0E 3HLTA 1A5ZA 2GGSA 2QVYX 3DMDA 3QKRA 4RHTA 3H9EO 4IX1A 4RPCA 4A16A 3KP1A 1GRQA 4UEOA 2JLBA 1T9HA 2IX9A 2XB8A 3ICWA 2XR1A 2X0DA 1EGVB 4B7ZA 5IVHA 4PG7A 1U6IA 3QPBA 4HJXA 3UKOA 5AW3A 3H7IA 3K2IA 4AY2A 3VSCA 3H2IA 1O54A 5DLDA 2XWJI 4JENA 3GFRA 4B5KA 4UBNA 4UREA 1S01A 4YXFA 2D2IA 2ID4A 5E9QA 3WV4A 2DECA 5E1BA 3FZYA 2DOKA 2P11A 3OPYI 1K7SN 5ALLA 5ESXA 3W4IA 2P6PA 4NYIQ 1SOUA 2O7NA 1RHRA 3T15A 5HOEA 5JXGA 1JKIA 3LQYA 1X7XB 5F1PA 1VLLA 1P18A 2P2GA 5GJCA 1MVOA 4K1LA 4TT8A 2YOGA 3BE6A 1W8DA 3PX3A 3BMCB 7ADHA 2AN1A 4RVHA 1LZKA 3DNMA 4IJWA 1G6OA 3FOAA 4Q1BA 1E6UA 3PGVA 1M8PA 2NXNA 1QHYA 1P1IA 4B43A 1DV2A 1OA0A 1VE3A 4N7BA 2O05A 5ALTA 4ZTBA 5NLLA 1WCWA 3Q0EA 2KB0A 1GPLA 3A6EA 1EJ0A 2NV0A 2ZIXA 3CTMA 2GEJA 2FWMX 4JYPA 4OQXA 4Y98A 1JG7A 1USGA 1RLUA 1ZBDA 4LUCA 3SQNA 4CM3A 1FRQA 2JFBA 2HQSA 3BB1A 2IUSA 4FSHA 4IBOA 4MRPA 4TMWA 3EGOA 4XVCA 4FZJA 4Q4AA 3N8DA 1RAFA 4E08A 2G9ZA 1V8ZA 5DEIA 3WO0A 3DYBA 2C7VA 1FMLA 1MOZA 2WWVD 5EXEA 2PVSA 3OWHA 1YF3A 2RGCA 4PO9A 1PG0A 1GNSA 3BD9A 5A2GA 3GVIA 3HKBB 2CKMA 2FQYA 4RD1A 5EIAA 4YRMA 4JI0B 3FTCA 2FA9A 4B0PA 1M2OB 4N6OA 2BTQB 1JV2B 2AR0A 2V6FA 4MDEA 4GYJA 1PJZA 1KPGA 5LWQA 3ZN2A 3EEQA 4WK6A 4B6SA 1IJBA 5C5IA 1B0AA 1K2WA 3DUFA 3EGCA 5EJFA 1SQ0A 3MAGA 2WSYB 4QOFA 2VYND 4D26A 1G38A 5C8DA 2D4HA 3AV0B 1ZN2A 1JNYA 3KZOA 4I66A 5GM2A 1BEUB 4D9FA 1M1UA 3SJ7A 2IIPA 4MS1B 4V0KA 1RLTA 2BR5A 4CEIA 1R16A 4FDTA 2BRUC 3OAAD 3IGFA 4BLUA 4BVLA 4B17A 2JH9A 5HBRA 1NQOA 3WGNA 4UVDA 2PRKA 2BKEA 3GUZA 4Q3KA 4AP6A 4X5OA 3G8BA 1BEZA 1NW6A 5CLQA 5LXTB 1E1DA 1FDUA 1SEPA 2CVQA 2QZZA 2G1KA 3LECA 3W8FA 5AW5A 1JR4A 3WFIA 4BFVA 4U6QA 2O8DB 1BJTA 2OGWA 2O0HA 3K0FB 3DV0A 2B21A 3EW9A 1Z5GA 1NMQA 3G7NA 1G18A 1IZ8A 2OBLA 3BMOB 3O26A 4UHCA 2ZSFA 3M33A 4GXQA 4MQEB 3T9BA 4P0QB 3AI3A 1BDBA 3C7TA 2OAP1 4XWYA 1KPIA 1N8SA 2WABA 3OMXA 4HN4B 1ILEA 3VJRA 2RONA 2OLKA 1IZ0A 3P9ZA 3H1PA 4GQBA 2JVKA 1RPJA 3B2NA 3IDAA 3P2IA 2YNMD 1J0DA 3G0CA 1XWWA 1QP8A 1FP4B 2OHJA 3H6HA 1YAHA 3OA2A 4WZZA 2O52A 3N8NA 5C52B 1YA6A 2INGX 2NZVG 1RSZA 3SHOA 3P5SA 4CLRB 2WM9B 1WUYA 4MA5A 3QLJA 4AJKA 4CG0A 3B6JA 3ESYA 4J76A 2XZLA 1GA4A 4X1KB 3OCYA 2V3CC 1FU4A 3WGTA 2BSAA 1JIJA 2FPPA 4ZJPA 4BFWA 1B8NA 3FUVA 1R0ZA 3CX3A 3I9LA 2P1ZA 3KAPA 1O8CA 4WLFA 1O6GA 2DHRA 3LGAA 4GZ5A 2Q0SA 2NQTA 3PXBA 1W5FA 4WNYA 2K2QB 3NORA 3UMRA 4YJ2A 2QKYA 2XHEA 5HIKA 1RKVA 3DE5X 4HTFA 2A94A 1T1IA 3LG2A 1XLTA 1U7PA 3Q9NA 4U5XA 4D44A 1KO7A 2APJA 1RJWA 3AJDA 5P8WA 2PWBA 3PD7A 4B81A 1GPDG 1OWNA 2GLXA 1J1UA 3GUUA 1LY1A 4CQLA 1NY6A 4FFPA 2HO5A 4BBPA 1RW4A 2AEEA 3HKDA 4PE5B 3FCEA 3OE5A 4FDAA 4IIJF 4KDCA 5DNYB 1KKUA 4N3NA 2P9EA 2AMYA 3U4CA 4CNBA 3KJIA 121PA 3WYEA 4YUWA 2FE4A 4FFWA 5K99A 3WWEA 2Q5IA 4C3ZA 1CRLA 4FMDF 1B74A 4J1QA 1CNEA 4F60A 3T3OA 3Q85A 1SUFA 2IPMA 3D2CA 2WM3A 4AJIA 3NDBB 2AUNA 2GEUA 3BMQA 4FP9A 5BT8A 5KTRA 4U7FA 3A27A 3EARA 2UUBB 4E5VA 3MEQA 1G8GA 1ABFA 1E20A 9MHTA 1T2CA 4ME6A 5K05A 4ER6A 3HJGA 1ZD1A 2H7YA 3GN1A 4ZAWA 4OYLA 5CVTA 1XV5A 4HDMA 1EWYA 1CJVC 4QGAA 4TV8F 1P75A 5H3LA 1KMCA 3DVRX 3N75A 5E9WA 4YR7A 4BTLA 1ZN9A 2ZAIA 3DAOA 1Z3IX 3ZHRA 4G2NA 4B3IA 2NO4A 3VJKA 5T67A 5CW1A 5ENZA 2H06A 3OZ7A 5H70A 1I2DA 2BGKA 621PA 4RZQA 3AF2A 4HDMB 1H2ZA 1PFUA 3SX0A 1E2BA 4NMWA 5I45A 3LPMA 4Y9DA 1PGOA 1O95D 2JJ2D 2MMGA 5K3EA 3TZ6A 3QKRB 3TRHA 1AM4D 1DBIA 3UHPA 3IE1A 3ND5A 4ALLA 2F1HA 4M0KA 1PNOA 3BWVA 5C4IA 3U4GA 1ZA1A 3H8SA 3HWX1 3K3PA 2I4MA 3OCZA 4N18A 2HDOA 1ZINA 4GVPA 4YLYA 4MUAA 5CYGA 5FHQA 1V26A 3AG6A 3TCKA 2WAAA 1E6WA 2RHWA 2G08A 4CLRA 5TGZA 3DQQA 5EIHA 4EAAA 2W70A 3HKEA 3VX3A 1TEZA 4HK4A 1RLOA 1STOA 1IBSA 4UMDA 3B1VA 4OIFA 1AXEA 3TLGB 2ZRDA 2QMUA 3U7JA 4BKUA 4CN9A 4URWR 3PSAA 5CEEA 1Y3FE 2VXYA 2Z4SA 3HRIA 4NDNE 1AKEA 5K8JB 1TUBB 4DSZA 1GIAA 1MC5A 1ULAA 3CXUA 2BD0A 2P2DA 4HAOA 5E3IA 1BVHA 5JO9A 4YMVA 1HOXA 2Q2OA 2RC6A 1T8YA 3KBOA 1QRTA 4EEXA 1X39A 3DDSA 1OR8A 3URKA 4HNAA 1PHPA 2NU8A 1U0TA 4G5FA 2V97A 1T0IA 2PGNA 4A6XA 4IF6A 1TA9A 3WL5A 2P9BA 3BWDD 3KJFA 4N54A 4BLQA 4DLNA 4U3JB 2QRVA 3CLTC 3SC4A 4LISA 2QQ5A 1DJNA 2K6GA 2BFCA 3DXXA 2Z1NA 3O47A 3WWOA 3BE8A 4JOBA 5F5NA 4RZSA 1SBYA 3M4XA 2I1VB 5F21A 1AQIA 2G80A 2PFKA 3G1WA 3ZV7A 2I3ZA 2Q4OA 4TT3D 5KDDA 4JFRA 1Z0AA 1M8KA 4PYLA 4RAOA 1HE1C 1UXIA 2JZOA 3LXUX 4EG1A 3E81A 4M0CA 4UQPA 3V1MA 2IF0A 4DCUA 4KRFA 5LQUA 1YJ8A 2GN2A 1W85B 2PS3A 1J2EA 1NQTA 2QTMA 3GUCA 2LPMA 3H97A 3RT9A 4PANA 5TB5A 2BZ1A 1NVBA 5AW6A 3BCRA 2FLVA 2CNWD 2ODEA 5KAPA 1TM2A 1TK3A 2FV8A 2G17A 1G4HA 2OQ2A 3OY7A 2FFQA 1C5KA 4JMPA 1V5EA 5KZMB 1KC1A 3ZXXA 1PTJA 5L4NA 2Z30A 1W1IA 1NBAA 3G2JA 3KOOA 4YRPA 3RIGA 3LQ2A 1RDFA 3U80A 1W4LA 3QXCA 4AZTA 5I9LA 2SICE 4GOKA 1K0FA 2CCKA 4BPRA 4YRSA 4OXYA 1Z5UA 4LHEA 2P5UA 4BUCA 4CKCA 4F04A 3CWCA 4JDUA 8ABPA 4WOKA 4BLPA 5IBCA 1WHTB 2DTXA 1ZN7A 2CE7A 4MKGA 5FTKA 1KZGB 2QNBA 1EFVA 3T35A 3F2IA 2L18A 3OC0A 4RTRA 2QAGC 1QOPB 1AO3A 4YAFA 5AICA 3EPPA 3V4SA 3U7QB 3R3SA 1EEXB 2OAQ1 3C74A 3QY9A 1DIGA 1WXHA 2PGOA 3ITDA 5DLQC 5B3KA 2LVBA 3GBSA 4AKSA 1DJLA 4Q15A 4KSYA 4E14A 1GGJA 1QGUA 1CR4A 2HBRA 4AK9A 3HPQA 4MUYA 4D8YA 3OY2A 2OGZA 3EDOA 2Q07A 3E0QA 5FEUA 2B69A 3MLEA 3E15A 4MPPA 1OXXK 4U5QA 2JLUA 1B2LA 2HREA 4PGAA 1K7FB 1TU4A 4U2GA 3D6FA 1V39A 5D2CA 3CW8X 3UJ9A 3I3SR 4ZOAA 3Q0TA 4ZYVA 1Y8QA 2QD2A 1ZUHA 2HA5A 2G9RA 4BMPB 2GWHA 4AX4A 5HPYB 2VHWA 3EVBA 4OX9Y 4CCYA 3RC1A 3MJDA 2ZI4A 1JXQA 4HLQB 5ITWA 2QVZX 4Z2YA 4IVQA 3TMAA 1DCTA 3WNZA 4H59A 4DJ5X 1HG1A 1VE9A 5IHPA 4R2JA 4WTOA 4EI8A 2GTHA 1YFZA 3KYJB 3PIRA 1N6LA 3F8TA 4PQRA 3E18A 4FHZA 4YP5A 1G4UR 1GNTA 1GQRA 2BUAA 3DOUA 3IEPA 4R2IA 4WFJA 3S2IA 5IRCD 2HT1A 4QPDA 4BLRA 5HTOA 1BCSB 2BJHA 4L4SA 1PL8A 1VRVA 3I28A 4IIFA 1VSQA 3DT9A 4KGZA 4TUYB 3ZBTA 3UMMA 4EH1A 1ESDA 1SU6A 3WLHA 2ZK7A 3V7WA 2VDWB 5DPMA 3UN1A 5AXCA 1N5IA 2YV1A 4DC0A 4NIMA 4N76A 1KAEA 1T1JA 2ZTUA 4MWOA 4WFIA 1EWTA 3OZFA 4DBVO 4WXRA 3HU3A 5AW1A 1H2HA 2FG7C 2FEWB 1UWKA 1SPBS 1P61B 2VK4A 5TR9A 4YXWD 5LNK6 1D7OA 3K30A 3ZWDA 3GLGB 1G17A 5FPTA 4OPMA 4EFDA 3COSA 3UT0A 2QM0A 3AESB 1CJSA 3IKMB 1D8AA 3DFIA 3CNBA 1B42A 2XAAA 2VT3A 1N2EA 2H1HA 5CDTA 3MAJA 4A03A 1M6WA 3MT0A 1AT1A 4PHFA 3M6LA 4I08A 3WRVA 1UZAA 3D02A 1QH9A 4KNYA 2P9CA 5EHQA 2CXSA 4NFYA 3LHSA 1CJUC 1KK0A 2OO3A 3B9BA 1N4DA 4JITA 1EM6A 2GJAA 1E0KA 4FQ5A 5FPYA 4EVQA 4YUZA 5FLEX 4LF9B 1A4XA 1IJEA 2CL0X 3H9GA 4UAVA 3A05A 3JPWA 5C8XA 4EKEA 1PD1A 4TT3A 4J0JA 1F9EA 3ZLTA 3RAEC 3FPGA 1A9XA 1S2GA 3EF0A 1JVNA 4N5NA 1T25A 3GT0A 4ZI7F 1SPXA 2H17A 3G9UA 2B8TA 3IAS6 4OLFA 1I1QB 1YVRA 2V6MA 3KS9A 1OFIA 4OOEA 4N3AA 1RBMA 3D8TA 2A35A 4ESVA 3JAWA 4Q6WA 1LFDB 1VIMA 4RY9A 4D96A 2PTGA 1UBUS 2V55B 4EKIA 1JPNA 4RCYA 1LK7A 2NSDA 4ZT6A 1WDWB 3R8CA 3GYGA 3EULA 3KL2A 5EP1A 1Q2UA 3SIPA 1PP4A 4CXMA 1ECJA 1Z6GA 2GN6A 3HKEB 2I80A 5FV4A 4R2LA 4R4JA 1D0IA 4BVFA 2NAPA 2IDJA 4WN3A 1U0BB 4OA5A 5CURA 5JWOA 1RVV1 2A5FA 3FPKA 1CUJA 3KLOA 5KOHA 2ASEA 3R7WA 1VGQA 3TDNA 1YB5A 1TQ6A 2IYAA 5F77A 4B3JA 2VSNA 3MTEA 2W2LD 1ST2A 1C1YA 1PI3A 1Y98A 1X1RA 2MR6A 2O07A 3UFXB 1E60A 1QG6A 3FTPA 2RBEA 2AFRA 1E7WA 3H2JA 3NTQA 4B6OA 4LC9A 5CR9A 3UK2A 3IUPA 3HXPA 1XEAA 4D4IA 1OV6A 3MUOA 3UG7A 1H2BA 1O97C 2AMVA 2A78A 3MCAA 3AHDA 1C1HA 2XVZA 4O2RA 4XUDA 1XZAA 3TW8A 5K0EA 4O3MA 2RBGA 1U81A 1HMYA 5KCMA 2O2GA 2BGUA 1Z68A 3FBTA 1DV1A 1L3IA 4G56A 3P9RA 1XPRA 4NABA 2JC3A 1FFEA 2JI6A 2YJZA 1J33A 3FSGD 1PUIA 1ORHA 1TRKA 4H0CA 2QL5A 2YINC 1J56A 2WVAA 4MVJA 3VU9B 2BI7A 1FSGA 2ONKA 4CL3A 4EX7A 1G1AA 2J6BA 3A4TA 1O6BA 3EEYA 4IOJA 4TTSA 5I7AA 2DTDA 3DNPA 4PC3A 2H1SA 4A6PA 1NX6A 3LSTA 1EVYA 3L8GA 4OKNA 1CY0A 2PSJA 4LRYA 3G23A 5I7VA 3P0JA 2C4HA 2JKVA 1Q0HA 1YE5A 1EVIA 2JD2A 3AIMA 2VDQB 3BAFA 4MB2A 4H3HB 3GA5A 5FD8A 1ZXXA 4RVDA 4UM9D 5G1OA 3M1YA 2BMVA 1M2GA 2R48A 4TQGA 1SK9A 4NBUA 5IVKA 2H7XA 5MGBA 4E1VA 1N8KA 4GYKA 3GCZA 2O3TA 3JYQA 3LU1A 3ZIAA 4OX9B 5LJIA 2D7DA 2OV6A 4BMDA 2HUNA 2Z3ZA 4KR2A 1JMVA 2JFFA 3E23A 4EWLA 2JAWA 3DFZA 4GWKA 4J3JA 4DDVA 3GBVA 4K46A 2BEVB 1US8A 5EE9A 1BMTA 5H3HA 1JLRA 3CUVA 4XCXA 5D00A 4US1R 3GJ6A 2I6XA 3B8EA 5FPQA 2E89A 2I62A 3OZEA 1WMBA 2RGWA 1XALA 3QI2A 3H5AA 1FLVA 1Q3HA 3FN4A 3ZE1B 2JIQA 5A4AA 3IAM1 1J7KA 5EQFA 2V58A 3NHSA 3Q2IA 3CZCA 3TZHA 4IXWA 4QPCA 2Z5LA 2YICA 2VHJA 4QBFA 1UJBA 4D0NA 2WB2A 1EVKA 1YK0A 4DGQA 1J00A 3R0XA 5B3LA 4A0SA 1X3LA 1Q12A 1UC9A 5BOVA 3B36A 1T0HB 3IQIX 3EIQA 1VGVA 3H2HA 4TLBA 4XVQA 4MB0A 5MN6A 3C5EA 2O2SA 5BQOA 1IXRC 4L8LA 4PPGA 3IIEA 1KGSA 1TJ4A 2CJFA 1BO6A 4NZNA 4JI5B 1R6DA 5H81A 1FP6A 4HRYA 4ND6A 3DPSA 1I3CA 5DBEX 3B9RA 3R3VA 4GP6A 3RKSA 3T5GA 4P3KA 2QUHA 1HEIA 2Z6AA 4JC4A 4OK5A 5F1YA 4U1RA 3RSSA 1O87A 1ZK2A 4JUAA 4PGHA 1H1LA 4CTKA 4U2DA 1GTJ1 1QR2A 4WRRA 4P82A 4Y2YA 2DETA 3HEAA 1WCIA 3FUUA 1V5IA 3SLGA 2H0QA 3I34X 4JUCA 2QLBA 4CLOB 5AH0A 3B2EA 3AVOA 4O4IA 4QDKA 3TINA 3SIXA 4Z49A 5M3BA 4DMKA 4Q7LA 4BY9E 1HNXB 5B7NA 2DJ5A 3QNMA 1REQB 3O4RA 1Q1QA 1Y5MA 4N8DA 2ISCA 4L0DA 2GASA 1W0KD 3ETHA 2X8JB 2FETA 1KRWA 1GXSA 2YIVX 3DQPA 3H1GA 5DGDA 4BQFA 4E4TA 5A06A 4LJRA 4B85A 2C5HA 1BXGB 1IUOA 3TXXA 3QOYA 4JIMA 4L6CA 4N3GA 1QFZA 1QYIA 1RBZA 4XYMA 4RLFA 5B4TA 1RAGA 3CINA 1BOFA 3OX2A 4TSRA 1L1FA 1DZIA 2CMFA 2GRAA 2MWMA 3V2HA 5FYDA 3DVLA 5TY0A 2GNPA 5TQJA 1ICEA 2DKOA 1UJ4A 3KRTA 1L6RA 4LYGA 4PHHA 5SZJA 5A0TA 1WB5A 5GJWC 5CVUA 4YI5A 4M1TA 5FFFA 1U0HC 3ESBA 3GR6A 3LUDA 4PZLA 3U56A 3H5NA 2R6FA 3VUEA 4BE4A 5A2QA 1Z2AA 5JECA 1RYDA 4GKVA 1C7IA 4ZVMA 3WBJA 2HPVA 4W5HA 1PR4A 2R2GA 4HFJA 4BKPA 3AKEA 4CIVA 5EJ8A 2GWRA 2XY4A 1EFHA 1ESZA 1WP9A 2WHXA 2ZTHA 3B52X 3HKBA 5EIBC 3TIFA 3V33A 5LP6B 2QROA 1XZNA 3PUHA 1VA4A 5C35A 1N2SA 1G3RA 3KT3A 1QPBA 3IJRA 1RCUA 1QVWA 2N75A 5BSWA 1DX4A 2YHIA 2YIMA 1U7WA 2FW8A 4AUKA 2CXHA 2OZEA 4GG1A 3C45A 1I3OA 4Z4GA 4YMUA 1FOEB 2AW5A 3DBOB 3Q7SA 3T7EA 2H1OA 3BHNA 3DFUA 3CT4A 4GPD1 3X2SA 3A7DA 2VAXA 4JQYA 3NUZA 3ICPA 1BQ4A 1QK5A 3ZCUA 3RFFA 1E6KA 4R40A 5EQJB 4CLEA 3ZDAA 3O83A 4U7PB 3OC6A 1M6NA 1X42A 3AY7A 2G07A 3VZQA 1VG8A 3LUFA 3PRJA 3TX2A 2Y1LA 3HV2A 4M37A 3QF4B 1MO3A 3KFLA 3LY9A 2IXGA 1RM4A 4F45A 3NG1A 1RZ3A 1UBMS 5BW8A 2ZVQX 5C5DA 3BHMA 1L7PA 1ZBQA 1GFWA 1ZNYA 2G88A 2FZVA 2D3WA 3HY3A 3PKIA 4FFDA 3V1TC 1VHJA 3WHKA 3DXZA 5LJLA 2IBTA 3TNYA 1E59A 1SXHA 4ER3A 4KAJA 5C5CA 3I0NA 3U4IA 5U4XA 2FLKA 1TLTA 2B4AA 4G0OA 4PX5A 2BAGA 1ORRA 2VQ3A 1K92A 2BMAA 2BUCA 4QXPA 5C31A 1A9TA 3TLBA 1BS2A 5JPCA 3WLSA 4C4TA 2DH5A 2ECOA 2J3IA 5IYZB 1W7AA 4OJNA 2RHBA 1AQJA 2QTNA 2VWQA 4Y0AA 3SC3A 2QMHA 4Q12A 4UCXA 2TRSB 2Z9DA 5K51A 1J70A 4UPDA 1FY2A 2WYHA 3B3AA 3SYRA 1PU2A 2R86A 4PYMA 3S7TA 5EQTA 1YZKA 1FFYA 2ZB8A 1ZK3A 1KMNA 2EQBA 4RK6A 3CPSA 4RZIA 5DNAA 4WEOA 5AJVB 1NXSA 5HM6A 4IJMA 1R9NA 3VC1A 1K3UB 1P6XA 2D00A 5L3QA 2FQQA 2VNAA 4AJ4A 4C3VA 2BMEA 3FWZA 3VDNB 3EIHA 1OJLA 5AK6A 3T4UA 3T5BA 4MHOA 4DV7B 3PNQA 1YHNA 4XYLA 4MWEA 4YCDA 4CMEA 2GHRA 4LDNA 2YVQA 1CUAA 4MWTA 3F73A 1GKIA 3NGLA 5BYAA 3DW3X 2CYAA 3JATA 2QT1A 4GNRA 1F48A 4JAVC 4JJ4A 5C2JB 1U9YA 4JEMA 4PLPA 2FTKE 2JASA 2PXAA 3WRXA 4G8CA 3EPKA 3OCJA 1YS1X 5BXQC 1PJ3A 3DXFA 2V4ZA 1ND6A 2ZATA 3PHCA 4MO2A 3K1AA 2MYTA 3OPVA 3OZXA 3TAXA 4KE6A 4FEEA 1EXVA 1L7NA 2EFHB 2HRDA 2XEDA 1QS0B 2PAAA 3JYOA 3N9IA 2X7JA 1QQ7A 4HEA6 5BNTA 1G59A 5AOAA 3VU1A 1FU7A 3O1LA 2Q7DA 5AVQA 5I47A 3WAJA 1FS6A 3JASB 4OUKX 4GZLA 1O77A 2V7GA 3I2YX 1GA6A 1WO8A 2V7WA 3KVRA 3PF8A 4M4SA 4BFZA 2WYWA 4RTKA 3EQ8A 2CNLA 1Y81A 3LDHA 4NC9A 3KKQA 3FPFA 3I62A 3W5DA 2V7TA 3MQFA 4RE5A 4TLMB 1XSEA 2XUOA 3ZVRA 2WTUA 1YVDA 5DM2A 3GIWA 2QMYA 2GZAA 5DMHA 1GLGA 2GEFA 1JDPA 2CY0A 2XUHA 3N0WA 3CX4A 3JU3A 4JSYA 4RV9A 3W7AA 1UAAA 4B3RB 4XQEA 4B9EA 5YASA 3ROFA 3QY0A 1AKMA 4EYKA 1YB6A 1EMDA 3OJ0A 1IN7A 2UV8A 4P93A 4FWTA 1P1KA 3QOWA 5LP1A 4EGAA 1B8PA 3DBRB 2FFAA 5HRUA 1SU8A 1LTHR 2P4QA 1RCFA 3ADBA 5C0OE 4U6NA 3FYUB 5HXAA 3FMVA 4IINA 16PKA 3SAJA 4KE8A 5KNDH 1X6VA 4WN9A 4AYWA 3KE8A 1UQUA 4WL0A 1Y7LA 2ODBA 1WLSA 5EFZA 2V5UA 4PQYA 3R6TA 3DAFA 1TNDA 2LE0A 2UZ0A 1V43A 1OVGA 1QLHA 3BK2A 4FEAA 5G02A 3ULKA 4BU0A 2HLHA 4G1BA 4EHDA 2R0QC 1RXVA 1KO5A 1MJGA 3GLGA 2IHNA 1XDWA 1YJAA 3PFHA 4QSHA 1U4NA 2OWEA 4PRZA 1E7MA 1EQAA 3ZXYA 3IUQA 5I7UA 1QRRA 4YRLA 5JIBA 4YJKA 2Q6VA 3M3PA 3VI4B 5JYCA 5KKNB 5L6LB 3K0AB 5HUQA 3HB5X 5IU6A 1A77A 1Q1ZA 4WVLA 2FDXA 1K7YA 4TKMA 4X64B 3BFVA 4RD4A 3L7DA 3LOPA 1E1RD 2F3SA 5JJCA 3FJOA 3JWHA 2XCLA 2XUGA 4MVJM 2JLRA 3H05A 1KDRA 3K1TA 4WQMA 4W1PA 5FOVA 1Z33A 1JZQA 1M76A 1JIQA 2B4KA 2Q5FA 2JK0A 2NQ8A 4IQFA 1E69A 4GMXA 2BFFA 3OLWA 4IIVA 1W4CA 5IWCA 1TLFA 2Z2IA 2P7IA 5AXDA 5HCUA 3SDBA 4S1TA 4G1VA 4D3ZA 5KPJA 2Y66A 4EY3A 2JA2A 1X15A 2IU6A 3PVZA 2AJCA 3VV2A 3NP7A 3LZ6A 2J8ZA 1GZUA 1ZICA 2ANCA 4JD5A 3WL7A 2V8BA 2B34A 4LBWA 4P4LA 5T7BA 2JBAB 3QF4A 1JLSA 1E2NA 1BROA 1UJNA 2F4NA 2MT9A 3AUXA 4KNWA 2QW1A 4OXXA 1ESNA 1GAEO 1Q0TA 5CB4F 1FLNA 3ABOB 2JFZA 1DMRA 1H0KA 3FNBA 4BP1A 5CB8A 3PDHA 1EX1A 3FHLA 3I6MA 1VDMA 2A0YA 3H9QA 4HKTA 4R9NA 4C0XA 4EBBA 5LLTA 2B3DA 5H9WA 3TPZA 3VKHA 3NHUA 2XA9A 2A7XA 2F43A 2VUSA 2JGAA 1RYNA 1WTCA 2IHUA 5TV2A 2FDRA 1VZ2A 2DR3A 1TB4A 2BLLA 1VQ1A 1P3DA 3V4RA 3WYFA 4A0GA 2FZGA 1GHTA 4ASUA 1NSTA 3N39C 5JSYA 1LBQA 4FYWA 1DCKA 4UMEA 4CODB 4Z9XA 3WQBA 4D97A 4F9GA 4UEQA 2G83A 2QS9A 3H17A 4KQIA 1W4AA 4OQEA 2GHIA 3DZFA 3G8AA 3K9QO 3ZH2A 3VI3B 3RREA 2GVDC 3A04A 1XQ1A 3U7FB 3KX2A 4TMVA 1W8IA 5BSTA 4CKEA 1E9EA 1KOJA 2ODNA 2QQEA 5HKLA 721PA 3NAQA 1P5FA 2TYSB 2PCJA 2QTAA 2J9YB 4TMFA 3W8NA 1OAOC 5I7SA 2I29A 3MCUA 1DRUA 4D8VA 2XUDA 3PS9A 1VIDA 3OZUA 1N2CA 2FLWA 1GNPA 1A8SA 1XROA 3W3AA 5B1SA 4GC9A 3TEFA 4JCOA 3WY9A 2XECA 2QL6A 3HRKA 3GJ4A 3VH1A 3S8YA 3ZVKA 4MWGA 4UDOA 3OAAA 2IP1A 2V45A 1SHUX 4IH1A 2QRLA 3FCAA 3IUMA 4U63A 3HR7A 4ZVOA 5H5JA 3SF8B 1XF1A 3FTEA 2VXOA 5HQTA 1COWA 2PVPA 3H5IA 2W22A 4MR7B 4AL4A 3LYLA 1V1MB 3IUEA 1QG2A 1XFAA 3OKAA 3WX0A 1OI3A 1HF3A 1NNSA 1VLMA 3D4LA 5B37A 5SY6A 2PLFA 3EMVA 1GGNA 2QLMA 3VNVA 3KPYA 1U7ZA 2W7TA 2PU7A 3NASA 1OH6A 2B1JA 5KQSA 3JQEA 3PNYA 2AHRA 3IDZA 4F6RA 1DBWA 2QU7A 1T9ZA 2QM7A 4UQOA 5BSRA 4OI0A 3UCEA 3LRPA 4JU9A 1TO2E 3SXUA 1AQNA 1JWBB 1IK6A 2YMPA 3SBXA 1VI2A 1FIUA 3DE2X 1E4YA 4U7HA 3CR3C 1EFAA 1TEXA 3AT1A 1Y9AA 2G7MC 1NBWB 2C4VA 2M1XA 2I22A 3E0XA 3DMPA 5CB4A 1ZI9A 4RIGA 3CVUA 1D3AA 1M1XB 4QDTA 1E9AA 4OHWA 5FOUA 4LFAB 1QIKA 2OQIA 3QOFA 3DE1X 4KI0A 5DHUA 2AVNA 5A9SB 5AUOB 4N8SA 1GRCA 1SC6A 1Z2EA 2VN8A 2Z08A 5CXUA 5ADVA 5CFRA 1NYLA 4FFMA 4MCAA 2Q5HA 2EJBA 2Q8QA 1YIDA 2KHZA 2W6MA 4XI9A 3I83A 1I14A 5HIIA 4B6EA 3GPIA 3NBMA 1G8HA 4C5BA 1U1GA 3WA6A 1MQSA 4XH9B 3D5TA 2ZG6A 2AK2A 3VU8A 3G2IA 3TI9A 2C31A 2A5LA 3ANLA 2VIIA 3ILSA 3OESA 2IUFA 3HDVA 3Q88A 4M6WA 5BR7A 5E7QA 1UT5A 4XX1A 2Y92A 4I0WB 1KOFA 5HMLA 2I7TA 1H69A 2Z09A 3IBYA 1J2RA 2Q50A 3RVLA 1E18A 2RI6A 4RE6A 1SC9A 2BZSA 2CUZA 1A5AB 2OXCA 3M2TA 3WIBA 1JU3A 2YH2A 1G2PA 1P0IA 3MS4A 4HWPA 1I9GA 4NE2A 2F1OA 5FQOA 2I76A 4EI7A 2XT6A 1UAYA 5C81A 2AJDA 2O20A 5CDHA 4BMYA 4CCWA 5E1DA 1TTPB 1FFGA 3CVJA 1KFEB 2X19A 3KKEA 2ZOSA 3RBAA 4TRMA 4D0GA 3OH8A 1RM3A 2QSUA 3SP1A 1NJ6A 3CSSA 4HB2A 1UH5A 2YZ2A 1TE2A 5KQRA 1PSZA 3QVVA 4AS1A 3UW3A 1YL7A 2I6TA 4KLRA 1VMKA 3INTA 2ACVA 2DU8A 2WIKA 1XJQA 1E3IA 2DBVO 4EW6A 4C04A 2UUOA 2CNDA 3BJMA 4X90A 1NZFA 1YD7A 4KRGA 1LXCA 1PEAA 421PA 2GCEA 4FX5A 4M8LA 1TM7E 3TR5A 4ENVA 5JAMA 3NIGB 4MUXA 2ZM5A 3ST7A 3LXMA 4XIGS 1XCLA 1ONPA 3ONEA 1FNBA 5ALQA 1MB3A 3DL4A 1ESMA 3CRRA 2DUUA 3QX8A 1XMIA 3N07A 1K6MA 1WLYA 4Q0MA 2NZXA 5TEVA 5BN4A 1RWQA 4P53A 2CD7A 1VMIA 2FHPA 4K9MA 3ZQJA 1LJUA 2YY7A 3BEDA 4RV5A 1QAOA 5TPWA 4KZKA 2R9VA 1KJZA 1WD5A 1BD4A 3LC7O 4LVCA 2GDJA 4TN1A 5TMDA 3NB0A 1PDVA 3UJNA 2XDQB 4MPRA 4PYQA 1KP3A 4DNPA 3GDOA 1B16A 4P38A 1C3XA 4EW3A 1GL6A 3QM1A 3ZY5A 3S6JA 3FI9A 3OFNA 3R3JA 4M9RA 3WQSB 1ZGGA 3OJXA 4RJTA 4GOJA 2RHGB 3X1XA 5LQDA 2E4AA 4M1OA 4R69A 3DB1A 3RT7A 2XNCA 3JQFA 2GFQA 3W04A 2R3SA 5BSKA 5L3SA 2WF9A 3KTFA 4YMWA 1F4LA 2UVDA 1ZSVA 1Y1QA 3GGJA 5KYUA 4FB4A 3UCXA 1IG3A 3B6MA 2VNKA 2Q99A 3C97A 3D43A 2YV4A 3ZWAA 4AJ9A 4EIWA 1NKSA 3DDNA 5IAAA 1KRHA 2ZJ0A 1DAHA 2ZBEA 3GY0A 1PBTA 5LWHA 1DXHA 2REQA 4UEKA 2Z5VA 1T5TA 2C0QA 4A5OA 5HW0A 1W0JD 5MGNA 1XKLA 3UJHA 4JIGA 4LQLA 4DRYA 2IKQA 2X8JA 5D6OA 3VPFA 4G0YA 2FWIA 2ZXEA 2DBZA 3NKFA 4GR5A 5DTJA 5K3SA 3HUUA 3RNLA 3WNVA 2GPWA 3A1EA 1QFJA 1GPH1 5HZMA 3PTAA 3JVUA 4EGSA 1U0LA 3FHTA 1PT5A 4B31A 6Q21A 2BFWA 4YUVA 1GZVA 2YWGA 4WKGA 5G1PA 1ETUA 1NXPA 2RHHA 5FIUA 1S96A 3ZHOA 2OBNA 2X0EA 1PQ4A 2RGRA 1NW9B 2IX3A 4YDRA 1NP3A 1DADA 3GD5A 1PSWA 3PCXA 1Z29A 4ND8A 1TKRA 4X8MA 3S55A 2HPAA 3P5BA 4ZEMA 3WLJA 1Y5LA 3JZIA 4L3VA 1QTRA 4AICA 1WUJS 4I8IA 3LHKA 4Y2QA 5LD2B 2P90A 3OCXA 4S05A 3KZXA 4N03A 1TVCA 2ZS8A 3BE5A 3JQRA 1I1HA 1N5JA 4H4EA 5LQNA 3D2LA 4JLJA 2H2GA 4AMYA 4WY8A 2IGTA 3NBUA 1XQXA 4FT4A 1MIOB 1JHAA 1N0IA 4P3OA 3FFBA 2C07A 2PBRA 5COBA 3HKCB 3L1JA 1YR1A 3LQKA 4URZR 1E2LA 4E09A 2PWAA 4EPWA 2FP3A 2BFFB 3FNGA 1BMDA 2C7GA 1V8FA 5COAA 5KSWB 5LDDC 2R60A 2WJ4A 3LMKA 1G4AE 1BGVA 3CJTA 2UDPA 2DQYA 4C0LA 5AHXA 3QU7A 3SGLA 1R8QA 5KU7A 3AJ8A 1M2OA 1QMPA 1TM5E 1PG2A 2A0WA 1L4GA 1OHHD 1SH7A 3KNZA 2Q3DA 4WK0B 3PXXA 4K1XA 4BQIA 3CA8A 3E8XA 2VF7A 2BI4A 4G5OA 4FYYA 1ZIPA 2J31A 2EQ5A 5D3ZA 2PIDA 3AUAA 4RQAA 4ZYYA 1Z5VA 2WKSA 4U7JA 3CN9A 2YC4C 4TKVA 4TLCA 3FNEA 2V7VA 1QK3A 4YAEA 5GVRA 3FYCA 4RFLA 5JAUA 4LJLA 4TKUB 4D98A 4DXAA 5JJBA 4MUKA 1BC5A 3L1KA 1A9QA 5K2OA 4YV0A 5DLYA 1FUEA 1LLDA 3ZHVA 3I5UA 2PFSA 4RHXA 1IZ9A 3A1WA 3MZ0A 4R41A 3PWTA 2ZWIA 2WQZA 3WGQA 1X14A 3M3HA 1VPVA 1AGNA 4OBBA 3HSSA 2QV0A 4YAWA 3RG2A 3AEQB 1IVSA 2H1VA 2CGEA 5FUWA 4V0OA 1F8YA 3H5OA 3SR4A 1NVKA 3LCUA 5CA0A 4HJRA 3AEYA 4EGFA 3QTLA 2QGZA 2I7VA 4TMXA 2XOKA 3AFMA 4HQOA 3QHAA 4LSMA 2FWPA 4DSUA 1W36D 3AM3A 3INGA 1E0JA 4FYHA 1CC1S 1ISGA 2IIQA 4UW9A 4Z1MA 3T9FA 1YOBA 4HS9A 4BJ5A 2PX5A 2NO6A 4G26A 2F9FA 3GGOA 5GADl 3ORSA 2WJYA 4TYQA 1XXHB 4Q7MB 2OYSA 2ATIA 1KEUA 1HETA 4MGYR 3T7AA 3KQKA 1M0TA 1GOTA 2Y1EA 1ZH0A 3TVTA 1QGZA 1BWRA 1S3IA 5KB3A 1HT1E 1MEJA 2GNAA 3MD9A 1N7IA 1XDSA 1M0WA 3KM0A 3VSDA 3HBMA 4FI3F 2DLDA 3F2VA 4WI1A 1MA0A 2V7BA 2RSLA 5J2TF 3TQFA 4EG3A 5BMVF 5HRAA 3TZCA 5L9AA 2ZSIA 1BZYA 1EJBA 5BV8A 2QR3A 3EQZA 3M1LA 1GFZA 4AP5A 4D46A 4M60A 1KI6A 3PGA1 3UPDA 2DHDA 2YCLA 2ZI6A 1A2KC 3DP7A 2JGDB 1WXFA 2HHJA 2XVYA 5AHKA 4F3KA 4AKHA 4ITVA 4P2BA 2GMWA 1CK4A 4BGIA 1ZP6A 3TGLA 3MTBA 4ZCSA 2GM5A 2WAXA 5JAOA 1H6DA 1DDIA 2PQ6A 2OY0A 4G0QA 4W1SA 2QN9A 5KYXA 5LLSA 1Q44A 1NVUQ 1J1IA 2W6JA 4R71A 1DQSA 3LFHA 4LXXA 4YCSA 4UMFA 2QMOA 3HV0A 4KG7A 2ZXUA 1VHTA 3TUZC 3ONNA 4TV8B 3LQ1A 4LY3A 4NNOA 5K1ZA 3UV6A 4YIHA 5IT5A 4OY3A 5CLLA 3IEUA 4L5YA 1E2KA 3EQ7A 2HNAA 2O3UA 2W2MA 1T1GA 2GPBA 2BKAA 4LJ9A 5D3MB 4YWJA 1AA6A 1UDAA 1EUDB 3W2IA 4ENWA 1J0CA 3OEEA 1L5WA 1O4WA 1NJ8A 2CDCA 5LU9A 5IDQA 4AKGA 5C1OA 1GSOA 2P1DA 2AE2A 1R9GA 3RTEA 4LE2A 4TTAA 3FBWA 1PF7E 1PS9A 3G0OA 4E2ZA 3FUWA 4HMQA 2JJYA 4OM8A 4Z0HO 1MP0A 3SHVA 3TOZA 2I2BA 5L53A 1PZEA 1Q16A 3KHKA 2WTAA 1N7HA 2IK8A 4AS2A 4MVJG 1W9HA 2I67A 4M54A 5LA6F 2FPSA 4DVJA 3RR2A 4TTPA 3LC0A 4IVPA 2L17A 2VYFA 4KPUB 4NE9A 4GR4A 5BWOA 1U99A 2YWJA 4ZAVA 1AK1A 3UWOA 4D0LB 1SY7A 1UJ2A 2C1ZA 2ZJOA 1S8OA 3I64A 5EE3A 1P39A 2QXTA 4TS3A 4O4HB 4FDVA 1WY5A 2Q9CA 4YDHB 4ZO8A 4UVHA 4PLZA 3DEIA 4EOGA 4MQ5A 4HX9A 3UG6A 3I6YA 4I2NA 1FNCA 2AOTB 4D79A 3MJVA 3ZD6A 1KNXA 3IP7A 3KAKA 3UCFA 5IX8A 2ISSD 3G6KA 3S5UA 3BBLA 4PC7A 5BOSA 2ZKIA 1EVZA 1U3CA 1P9OA 3N3BC 2FX3A 4L15A 5AKYA 4D3YA 3ZE8A 5JZ9A 2OBYA 4CBVA 5C3UA 1I1OA 3WWYA 4QO8A 4YRIA 2XRMA 4URFA 3ED1A 4OLHA 4C0JA 3FPBA 4ZCTA 1EQUA 4CL8A 3U40A 2P41A 4OLBA 1XJ5A 3F5QA 3KYDA 5AVUA 2WOOA 1DB3A 2XYHA 2C3UA 2VXBA 1G8AA 5REQB 1QRDA 4HL6A 1KZ1A 5DISB 3CV3A 3BVPA 3ZWVA 3WKBA 1B73A 1TZBA 2HV8A 3NNNA 4WKOA 3WGJA 1I94B 4WDQA 4JNCA 2ZJ6A 2BEWB 4PAMA 1JDVA 3SM9A 3OE4A 1HFKA 4LOAA 4X8LA 1I0IA 5A5DA 1QG4A 1C2TA 3PDJA 2QE6A 3KB8A 1DUIA 1X86B 4FWIB 2FE1A 3F5DA 4X9XA 4DG8A 1XTQA 5KYKA 4RDIA 1B41A 3G89A 3U3OA 4ZC1A 1RXIA 1K08A 1MTOA 2X40A 3ZLJA 1GDHA 1A1SA