1V40A

First inhibitor complex structure of human hematopoietic prostaglandin d synthase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGMSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione-requiring prostaglandin D synthase
publication title First determination of the inhibitor complex structure of human hematopoietic prostaglandin D synthase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 73
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2003-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1v40A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1v40A01
4I8BA 2X8CA 20GSA 3C1RA 1ERTA 4K9ZA 2IMFA 4OWYA 1SL1B 3FZAA 4XS4B 3LFLA 3LYPA 2AYTA 2B7JA 3TUEA 3RPPA 5KN3A 5G1KA 4IJIA 4OFMA 1UC7A 2GQMA 3BJ5A 2LSTA 4NMUA 1SENA 2CVBA 13GSA 1T4ZA 2HSMB 2LNTA 1THOA 5CRGA 5HR1A 4OD7A 1NHOA 4AJ8A 5G2ZA 1W4VA 2GSTA 1SKRB 5ENUA 3GNJA 2I1UA 1OAZA 2YZUA 1A24A 2QC7A 4TR1A 5GSTA 2QGVA 2FLSA 5DVBA 4HU7A 1S3CA 1OE8A 3VPQA 2C0GA 5DDLA 4WBRD 1YEPA 4IGJA 1PN9A 5FT3A 2HZFA 3EYTA 1F3AA 2JACA 1M2AA 4OCEA 3M9KA 5CRDA 5ABRA 1XW5A 3DVXA 3IAM2 4G9HA 1BYEA 2KLXA 4BL7B 1OVNA 4K7IA 2AJQB 1BEDA 2MMZA 4F0CA 2V1MA 4HS1A 4OO5A 2N5BA 2FCHA 2PPTA 2CZ2A 3EC3A 2X8HA 4BPYA 3KH9A 2PWJA 5G5FA 3F9UA 1XW6A 1WP0A 3O76A 1TRVA 4HU9A 2YOIA 3D4TA 1OC8A 3IC4A 1VF3A 4PGTA 5ECNB 3UVHA 3IK7A 5B7CA 2YCDA 4MJBA 4QQ7A 1B9XC 4GLTA 4KDYA 5ECOB 4OMVA 5DJMA 5IMCA 2TIRA 4IELA 2P0GA 1XWKA 1TP9A 3CSIA 1U3AA 4EC0A 3RBTA 2FA4A 2HRAA 4E8EA 3ERWA 2GGTA 3WT1A 3HA9A 4CDOA 3SWLA 4ECBA 2Z9SA 2L6CA 1H4OA 5F06A 3KMOA 3WT2A 6GSTA 2HRKB 4TN8A 2CV4A 2EIOA 3CRTA 4FO5A 3U6VA 1JFUA 5CREA 4RI6A 1M9AA 2DBCA 1ERWA 2V6OA 4I2UA 2EIQA 1HQOA 2YN1A 4HUAA 1B9YC 5IO0A 1DSBA 2GDRA 1FO5A 4OFTA 5C04A 4MF6A 4ECIA 2WFCA 3TJFA 2DJ2A 2OA7A 4KH7A 5H5QA 4K1FA 4IBPA 3FZ5A 3KIJA 4KSMA 5D9VA 1DUGA 1EGOA 1U87A 2MMNA 2WGRA 1ML6A 1T1VA 1TKDB 2KOKA 3Q18A 5F8BA 2H73A 4KDXA 1XFLA 3VPTA 2H6YA 3GN3A 3MDKA 1QGVA 1XWCA 3F8UA 1SJ6A 4BWSA 5JWOB 5AIXA 1Z3EA 2R5GA 4O32A 3A5WA 1S3DA 1EOHA 3TJGA 3DMLA 5A4WA 3IXRA 4AJ6A 4L5LA 1YDKA 4JZQA 1M99A 4MPGA 3HD5A 3HVVA 5E59A 3TJBA 1UN2A 4BA7A 2LJRA 4IKHA 3UEMA 1K3OA 5D8IA 3BOAA 2IL3A 5DQSA 3RDWA 2EC4A 2MMAA 2R37A 4MLYA 3H79A 2C80A 5B6NA 3PINA 1FAAA 3MNGA 2VM1A 4KE3A 5IMDA 4QL9A 1LBKA 2E0QA 3NOFA 4HZ4A 3H1NA 3G7IA 5ELGA 2HSHA 1MEKA 2ON7A 4DSSA 1T00A 4NPBA 3D22A 2F9SA 3TRQA 3IPZA 4PUFC 4EO3A 2H1AA 2H19A 2RM6A 3E3EA 3UL3A 4O7HA 1PKZA 4ULXA 3FKFA 5LD0A 3ME8A 3Q6OA 3GKMA 4ML1A 4HQZA 4GQFA 4TR4A 2JZSA 3TJJA 3U5RE 4L5OA 3Q19A 3RHCA 2XBQA 1GWCA 1MD3A 4MJAA 5ID2A 4D73A 5HR2A 2HXKA 1OKTA 3EMXA 4X0XA 1YZXA 3BCKA 3IC8A 3LXTA 1IYHA 4N30A 2GTUA 1KTEA 2F3MA 4GWRA 2VCZA 1GSFA 3LYKA 5KEJA 4PURA 2EIRA 1PX6A 3M3MA 4ZIJA 3VWWA 3UJ1A 3D6IA 2O89A 4PXOA 3DYRA 2K9FA 3FHKA 3GUSA 2MMOA 4XS4A 3HY2A 3GYKA 5F0GA 4DVCA 5JWQB 5KN1A 4BVXB 1MTCA 5IPGA 4NWYA 1M2BA 1FW1A 4N10A 2C4JA 1DE2A 2VUPA 2HSMA 3GMFA 1X9SB 2XC2A 2HZEB 2RLIA 4TKYA 1IYIA 1U3IA 4F82A 5GAND 3I9V2 5BMUA 2QSIA 1M0UA 5JCWA 4EE0A 5A5KA 4RUVA 5G30A 2YWNA 3QOUA 2HI7A 4RQRA 2B6MA 2TRXA 2H6XA 3M8NA 4TW5A 2V2GA 1HNAA 5ELAA 2A4VA 2JZTA 2GS3A 2C3QA 3F63A 2IPAA 3TRPA 3CMIA 1G7EA 2LEGA 1K3YA 3VWUA 1TTZA 4AF2A 4EDYA 4YQUA 4MP4A 2XHFA 2OACA 3FY7A 5ECPB 2H6ZA 2GZZA 1J9BA 2FWEA 4BL7A 3NIVA 4HZ2A 1PL1A 2OJLA 3LGCA 4XS6A 2YPMA 3ZREA 2RUEA 3L9VA 3KD0A 5DAKB 3ZVJD 3ED3A 1XVQA 1HD2A 1ST9A 4LLRA 1HNCA 1JLWA 1TK5B 2R4VA 5HFGA 5DALB 1A0FA 1Y25A 3D21A 1X5DA 2IMDA 2X8GA 4NV5A 3LORA 2D2ZA 2VLVA 4GSSA 3KEBA 3LXZA 3GX8A 4XHMA 3VK9A 2ZUPA 5B8AA 3BD2A 4G10A 2CT6A 3QPMA 3IV4A 1SK1A 4EVMA 3ZMLA 3HJMA 4X43A 3GH9A 2GSRA 4MF5A 4EF0A 1VF4A 2OADA 5ECQB 2H1GA 2DJ0A 4POMA 3GL3A 2VM2A 4IP1A 11GSA 1LJRA 2H74A 2HRKA 1SD9A 3HZ4A 3QAGA 4K7OA 4MPFA 2CVKA 2XPEA 5IOWA 4GRFA 10GSA 4PNFA 1ZYQB 6GSXA 3UVTA 2GSQA 1FG4A 3R3EA 2L6DA 2ES7A 2LQQA 3FR6A 4ISDA 1I9DA 2H8LA 1XCCA 3UBKA 2HSYA 1THXA 4ILFA 4N11A 4K2DA 3HCZA 3CSJA 5KN2A 2DC5A 1GL8A 4MMMA 1KEBA 3I69A 4JRRA 1G6YA 1ACVA 1QFNA 3I43A 1K0DA 2NTOA 1XW9A 1SJIA 3C1SA 4N0ZA 3TDGA 2RM5A 2B3SA 2P31A 2IN3A 2RIIA 1T7PB 4POKA 1G7OA 4L0UA 3GURA 5J4UA 1GH2A 2PGTA 1T3BA 1XIYA 1FB6A 1XWAA 2H30A 1EOGA 3HVSA 4I97A 2GLRA 1WRYA 1XWBA 3TOTA 2CVDA 4TXVA 4NAXA 1RQMA 2HLSA 3GIXA 4POBA 1ZOFA 4WF4A 3TCOA 5D96A 1GSSA 1ZGNA 1YF1A 5G5EA 2LRTA 3GL5A 1F3BA 2AAWA 2YJHA 2B7KA 4X1UA 4MA9A 4GF0A 2IJYA 2LUSA 1BQ7A 2E7PA 2TRCP 1YKAA 1NM3A 1TDIA 2L59A 1JLVA 5G1LA 5INYA 4MJEA 5CP1A 3VI5A 2C0FA 1GNEA 2JSZA 1K0BA 12GSA 4KAEA 1O8XA 1MDJA 1B4PA 4ZBAA 2C1YA 5H5RA 4TVEA 4CHSA 2B5EA 4TXOA 5KN0A 5HFKA 1ABAA 5F05A 3BCIA 4DSQA 4KDUA 4I6XA 2C0DA 3UARA 3KXOA 1R7HA 4RI7A 2FUG2 3EURA 4Z7XA 1USBA 3ZIVA 2JSYA 3TKSC 2CA8A 3UAPA 3WD6A 1N2AA 2LKUA 2X99A 5H5SA 2NVLA 1V57A 3QMXA 2R3XA 1U6TA 3J7Yk 1EWXA 1A2JA 3A3TA 2P5QA 4IQAA 1GSUA 1JHBA 5A4UA 4V1Ag 3ZZXA 4G0IA 3LG6A 2H0HA 1SYRA 1T8EB 3IA1A 3US3A 1AQXA 1K0MA 1LU4A 4BVXA 4PNGA 1BAYA 4LMVA 1AUCA 4JR4A 1TXXA 4G0LA 2PUKC 4MDCA 2HZEA 4TR0A 4OO4A 2DLXA 1QUWA 1OE7A 3TKSA 3FR3A 2L4CA 2WJUA 3SBCA 1EV4A 2LJAA 2GZPA 1DE1A 1Z6MA 4O92A 3TKRA 4HJ2A 4V1Ap 4MJCA 3TKQA 1F37A 5IMVA 3ZFLA 1J0FA 1GSEA 2O85A 4J57E 2A2SA 5HQPA 3W6GA 3QAWA 3FYGA 4WEYA 4XS1A 2OE1A 4LA1A 3HHVA 3WGEA 4PQIA 6GSSA 2YWMA 3IE3A 5B8BA 1PGTA 3L9SA 2C3TA 1Z5YE 4MH2A 5DAKA 2YV7A 1X9WB 1Z9HA 2CQ9A 4PX1A 1J08A 3HDCA 1BX9A 1K0AA 1GTBA 3KCMA 4ZL9A 3IOSA 2YWIA 4WR4A 14GSA 4PQ1A 1XZOA 5DALA 4AGSA 3GA4A 1GUKA 3VURA 3Q74A 4EDZA 3KGKA 1GSQA 3C8EA 5J9BA 1ZMAA 1BG5A 3E0UA 3ME7A 1SJZA 3HVXA 3W8JA 3QDNA 3HXSA 3P90A 3WYWA 4MABA 5FWGA 3KH7A 1G6WA 2VCQA 4BVYB 2VD0A 3DXBA 4USSA 3D5JA 3L4NA 1V9WA 22GSA 2N5FA 3G7YA 2L4QA 2PU9C 4IVFA 3QAVA 3O6TA 3PPUA 4HDEA 3M0FA 4YAVA 1YQ1A 2DIZA 2O7KA 4HJMA 5J41A 2VL9A 3GX0A 2H70A 4TR3A 4ZBBA 5D9WA 2BMXA 4TXOB 1RK4A 5GSSA 3F4SA 5J5NA 2RUFA 2YJ7A 4TRXA 2JADA 1R4WA 3TKSE 1Z6NA 3G7JA 1FVKA 4FH8A 4TOPA 4KA0A 2L5OA 4Q5RA 4FYUA 2ON5A 2DJ1A 4F0BA 4JE1A 1G0TA 2C3NA 1EP8A 2MYGA 1EZKA 2GVPA 4F2IA 5ECSA 3UIWA 1A8LA 4NHZA 1NHYA 1R5AA 1QQ2A 4KGIA 2K6VA 4ZL7A 2VIMA 4MH3A 16GSA 1A0RP 3S9FA 2VCTA 1OC3A 4ECJA 3PR8A 4ZBDA 4IHUA 4XIHA 1AAZA 1FVJA 5D93A 3L9UA 2H1DA 1YEXA 5D9XA 2H66A 1YKCA 2IMKA 2IMIA 1WMJA 3VLNA 2VCWA 3ERGA 2H01A 3V1WA 3IR4A 1R26A 1AIUA 1X0RA 1B48A 3GKNA 2MBTA 4NXIA 2WS2A 2B5XA 2AHEA 3WGXA 5AGYA 2I81A 3CRUA 2HSNB 1TU8A 3GH6A 2OBIA 3HJOA 2I4AA 3MAKA 5IQYA 3EWLA 4K7NA 3O3TA 4YAPA 5LNKe 2M72A 3P2AA 2YV9A 1VF2A 1YJ6A 2CZ3A 5AIVA 1TRWA 3F6FA 3D0ZA 1OKDA 3DRNA 2E2GA 2F8FA 1QMVA 1OYJA 2DSAA 2J23A 5L71A 3ZMKA 1C72A 3GV1A 2AB6A 1XOAA 3H93A 1V58A 4MZCA 2FWHA 2OE0A 2I3YA 4OCFA 4ID0A 1Q4JA 2VLUA 2AUVA 2HE3A 3A2XA 4J56E 3ZLPA 3IHQA 3I6AA 3IRAA 1O6JA 3EU3A 4G19A 3WGDA 3IBHA 5IMAA 1O81A 3EU4A 3P8WA 2NBSA 2YP6A 2LNSA 3NZNA 4G0KA 5EPFA 4YH2A 2F8AA 4KW6A 1HYUA 1BJXA 2PBJA 1H75A 3FK8A 4EXJA 1XWGA 3DIEA 4WF5A 5E4WA 3C73A 5IM9A 3AY8A 4HEA2 1A8YA 3RAZA 5D73A 3ZVJA 1JZRA 4IN0A 3VWVA 4FYCA 3EVIA 1AQWA 5EY6A 5HFIA 1GULA 2O87A 2PVOC 2JU5A 4FQUA 19GSA 2JL4A 2GT6A 2WCIA 1PA3A 1T4YA 4I5QA 4BWQA 3APOA 2H76A 3UOMA 1AC1A 2H1BA 3L78A 1F6MC 1Z7PA 4Q5FA 1SKSB 4E8HA 4EKZA 2HYXA 1EEMA 2FA8A 1X5CA 2M46A 1JZDA 1XPVA 3IK9A 2I9HA 2P5RA 4N0VA 2YNXA 4NHWA 2NPBA 5D9TA 2UZ8A 2LS5A 5DQYA 1E6BA 1MD4A 5G31A 4GXZA 1TOFA 4V2NA 1SKWB 4BVYA 4O5RA 3KM6A 3TRXA 2YANA 2DMLA 4GSTA 1GUMA 3LSZA 5IOXA 4F9ZA 3M1GA 5FHIA 2V6KA 1B8XA 2L5LA 4IQ1A 4ZL8A 5CYYA 3MSZA 4WXTA 3EMPA 4L0WA 1HNBA 2WDUA 1AW9A 2PMTA 3F6DA 2LRCA 2WZ9A 1O7UA 4EL1A 3DVWA 5COHA 5ECRB 2VLTA 5LCZA 5EL8A 2O8VB 2FHEA 2WB9A 2VO4A 4IW9A 3DGQA 2LJKA 1GSYA 2AV4A 17GSA 5CRWA 2PVQA 1OC9B 4Q5NA 2H0IA 3DD3A 2ALBA 4CW9A 3IAS2 3KP9A 4F03A 4XRDA 1XBSA 3N5OA 1V98A 3TOUA 1PQNA 1SU9A 2G2QA 2IMEA 3DWVA 1SD8A 3TB2A 2K18A 4GQCA 1GP1A 1O8WA 4MCUA 3GSTA 3ZL5A 3CBUA 3L0HA 1ILOA 4XTSA 1SL0B 1V40A 1PX7A 1CQGA 2B5YA 1X5EA 1O85A 4ZXGA 3BBYA 3TGZA 5ECKB 4WBJA 1Z7RA 1W89A 1FHEA 2G0FA 2A2RA 2KP1A 3C71A 3F3RA 1GNWA 3ZITA 1V2AA 4MK3A 1Q98A 5HR0A 1XVWA 3K8NA 1KNGA 2H75A 3JCML 1QXHA 2WRTA 4DEJA 3LQ7A 3LWAA 1DBYA 2LV3A 3H8QA 5B6MA 3GFKA 4K0NA 3ERFA 3VFIA 3UMAA 1PRXA 2H71A 4HOJA 2GSSA 1U88A 3DEXA 6GSWA 2DMMA 2C8UA 3G9BA 2IIYA 5DJLA 4JR6A 4WR5A 2R6KA 1A2LA 1SK0A 4IP6A 4FIWA 2VOCA 4KSOA 2LRNA 2KHPA 4POLA 3APSA 4WKWA 5F07A 4KX4A 4H86A 4MZBA 4PQHA 4JEDA 2GQLA 5DCGA 3F4RA 4DSRA 3KTLA 3ZFBA 5DCHA 5A4VA 2K8VA 2H0GA 3CYNA 2J9HA 3CTFA 4IJ3A 4JBBA 1X9MB 3OR5A 4KCAA 1JZWA 1ZL9A 2FD3A 4QL7A 4PTSA 7GSSA 3ZRDA 3C7MA 1TI3A 2REMA 3FZ4A 1NSWA 4V2MA 3HKRA 5IIZA 3HJPA 2VCVA 1F9MA 1FB0A 1UVZA 2YWOA 3A2VA 1GTIA 2DJKA 1YY7A 1O73A 2V32A 1A2MA 3HYPA 4TR1B 3D4MA 2HRNA 3ISOA 5ECIB 1NW2A 2VAFA 2ZNMA 2GZYA 4KCEA 4G2EA 3GTUA 4ZB6A 2R2JA 2BJXA 1PL2A 4KNDA 2B1KA 2PERA 5IPHA 1TK0B 3R2QA 4ECCA 4ML6A 1I5GA 1N8JA 4WETA 2HQTA 5CAXA 3A2WA 3GKKA 3CSHA 3GHAA 2IFQA 2LQOA 4K6XA 1SYXA 4JU5A 1TRUA 5ECLB 1VF1A 1K3LA 1K0NA 1UA5A 2WULA 3QFAC 3QCPA 4Q5QA 4IS0A 3QR6A 1ERUA 4EUYA 3E9JB 1QK8A 2MZCA 1ZCPA 4KUNA 5JWRB 2XBIA 3CXGA 3M9JA 2JZRA 3H4KA 3FZ9A 5CO3A 1GRXA 2V41A 1TRSA 2CAQA 2DJJA 5EVOA 5ECMB 2HRFA 1B4QA 2PN8A 4LMWA 3FR9A 3RHBA 1TU7A 2NDOA 1GSDA 2CAIA 5GZZB 1R5PA 3VI7A 1WPIA 2HT9A 3MWHA 4XCSA 2FNOA 2XPDA 2VL3A 4MZWA 2KP2A 1TK8B 1EEJA 3EE2A 4ZB8A 2B1LA 4XRAA 1GTAA 3VWXA 2HNLA 3IDVA 1GUHA 5JCUA 1M2DA 2IWTA 2L57A 1VRSD 5C00A 5DBQA 3FRCA 2CX3A 3LEFA 3PGTA 1M9BA 3GSSA 2F51A 4OFNA 3N9JA 1WE0A 4YQVA 3FEUA 1CQHA 2FWFA 3TJKA 3TKPA 1S3AA 3KP8A 3J7Yb 2H72A 1SL2B 2BTOT 1WWJA 3QD9A 4ZILA 5J3RA 1RW1A 1EV9A 5IMFA 6GSUA 3FW2A 1ZYEA 2DIYA 1KBNA 1M7TA 4HQSA 1OC9A 3F4TA 1MDIA 1PD21 1PSQA 4V2LA 3CTGA 2FGXA 5JCGA 5IMZA 2VL2C 4K8MA 3UBLA 4LL4B 9GSSA 3KTBA 3RPNA 4RQXA 2HFDA 2ZCTA 4KB3A 3F3QA 2MBSA 2FY6A 1EGRA 1PKWA 2CX4A 4HI7A 1ERVA 5CNWA 1GLPA 1GLQA 5CRHA 3LJRA 2FWGA 4J2FA 1WIKA 4GSNA 1Y6EA 4ACSA 1WJKA 3QFBC 4GTUA 4I2TA 4ZB9A 1VGLA 5HR3A 2VCXA 1XOBA 1YF0A 3PH9A 1WOUA 4P3YB 2LTKA 2OBKA 6GSVA 2X64A 4L8EA 1XXUA 1URMA 4GCIA 1AXDA 3P7XA 2YZHA 6GSYA 2K8SA 3F0IA 4K0GA 1K0CA 1JZOA 3KMNA 1F2EA 2E2MA 3GTUB 4DSSB 3KJYA 1ZZYA 8GSSA 3W8SA 2N5AA 2DJ3A 1ON4A 2OE3A 1FOVA 3EINA 5AISA 1AQVA 1EP7A 4PUAA 1PMTA 1A23A 2M80A 2VL2A 3ZYWA 2QKEA 2IFQB 5ECHB 3APQA 3GRXA 5J9CA 3ZTLA 1TJDA 2GQKA 1GTUA 1E2YA 3HZ8A 18GSA 2GT5A 3KZQA 5ID2B 4NV2A 5AN1A 3ZIJA 4D73B 2C0EA 4YQMA 1TI1A 2OKAA 2KUCA 5IO2A 4FYBA 5GAPD 3GKXA 3DKSA 1SK2A 1K0OA 4AJ7A 4KF9A 1TW9A 4LL1B 1MDKA 2VD1A 4MF7A
chains in the Genus database with same CATH superfamily
4I8BA 2X8CA 20GSA 3C1RA 1YEWC 1ERTA 2X49A 1ZYPA 4K9ZA 2IMFA 1I1IP 4OWYA 1SL1B 3FZAA 4XS4B 3LFLA 3LYPA 2AYTA 2B7JA 3TUEA 3RPPA 5KN3A 5G1KA 4IJIA 4OFMA 1UC7A 2GQMA 3BJ5A 2LSTA 4NMUA 1SENA 2CVBA 13GSA 2WZSA 1T4ZA 2HSMB 2LNTA 1THOA 5CRGA 5HR1A 4OD7A 1NHOA 4AJ8A 5G2ZA 1W4VA 2GSTA 1SKRB 5ENUA 3GNJA 2I1UA 5BMUB 1OAZA 2YZUA 1A24A 2QC7A 4TR1A 5GSTA 2QGVA 2FLSA 4AKIA 5DVBA 4HU7A 1S3CA 1OE8A 3VPQA 2C0GA 5DDLA 4WBRD 1YEPA 4IGJA 1PN9A 5FT3A 2HZFA 3EYTA 1F3AA 2JACA 1M2AA 4PI2C 4OCEA 3M9KA 5CRDA 5ABRA 1XW5A 3DVXA 3IAM2 4G9HA 1BYEA 2KLXA 4BL7B 1OVNA 4K7IA 2AJQB 4FXYP 1BEDA 2MMZA 3MYDA 4F0CA 2V1MA 4HS1A 5J47A 4OO5A 2O36A 1ZYNA 2N5BA 2FCHA 2PPTA 2CZ2A 3EC3A 2X8HA 4BPYA 3KH9A 2PWJA 5G5FA 3F9UA 1XW6A 1WP0A 3O76A 1TRVA 4YKGA 4HU9A 2YOIA 5J4YA 3D4TA 1OC8A 3IC4A 1VF3A 4K5SA 4PGTA 5ECNB 3UVHA 3IK7A 5B7CA 2YCDA 4MJBA 4QQ7A 1B9XC 4GLTA 4KDYA 5ECOB 1PFOA 4OMVA 5DJMA 5IMCA 2TIRA 4IELA 2P0GA 3MIXA 1XWKA 1TP9A 3CSIA 1U3AA 4EC0A 3RBTA 2FA4A 2HRAA 4E8EA 3ERWA 2GGTA 2WW2A 3WT1A 3HA9A 3RFRC 4CDOA 2H1LA 3SWLA 4ECBA 2Z9SA 2L6CA 1H4OA 5F06A 3KMOA 3WT2A 6GSTA 2HRKB 4TN8A 2CV4A 2EIOA 3CRTA 4FO5A 3U6VA 1JFUA 5CREA 4RI6A 1M9AA 2DBCA 1ERWA 2V6OA 4I2UA 2EIQA 1HQOA 2YN1A 4HUAA 1B9YC 1BG1A 5IO0A 1DSBA 2GDRA 1FO5A 4OFTA 5C04A 4MF6A 4ECIA 2WFCA 3TJFA 2DJ2A 2OA7A 4KH7A 4AKHA 5H5QA 4K1FA 4IBPA 3FZ5A 3KIJA 4KSMA 5D9VA 1DUGA 1EGOA 1U87A 2MMNA 2WGRA 1ML6A 1T1VA 1TKDB 2KOKA 3Q18A 5F8BA 2H73A 4KDXA 1XFLA 3VPTA 2H6YA 3GN3A 3MDKA 1QGVA 1XWCA 3F8UA 1SJ6A 4BWSA 5JWOB 5AIXA 1Z3EA 2R5GA 4O32A 3A5WA 1S3DA 1EOHA 3TJGA 3DMLA 5A4WA 3IXRA 4AJ6A 4L5LA 1YDKA 4JZQA 1M99A 4MPGA 3HD5A 3HVVA 5E59A 3TJBA 1UN2A 4BA7A 2LJRA 3HMJG 4IKHA 3UEMA 1K3OA 5D8IA 3BOAA 2IL3A 5DQSA 3RDWA 2EC4A 2MMAA 2R37A 4MLYA 3H79A 2C80A 5B6NA 3PINA 1FAAA 3MNGA 2VM1A 4KE3A 3HVNA 5IMDA 4QL9A 1LBKA 2E0QA 3NOFA 4HZ4A 3H1NA 5J4VA 3G7IA 5ELGA 2HSHA 1MEKA 2ON7A 4DSSA 1T00A 4NPBA 3D22A 2F9SA 4A5PA 3TRQA 3IPZA 4PUFC 4EO3A 2H1AA 2H19A 2RM6A 3E3EA 3UL3A 4O7HA 1PKZA 4ULXA 3FKFA 5LD0A 3ME8A 3Q6OA 3GKMA 4ML1A 4HQZA 4GQFA 4TR4A 2JZSA 3TJJA 3U5RE 4L5OA 3Q19A 3RHCA 2XBQA 1GWCA 1MD3A 4MJAA 5ID2A 4D73A 5HR2A 2HXKA 1OKTA 3EMXA 4X0XA 1YZXA 3BCKA 3IC8A 3LXTA 1IYHA 4N30A 2GTUA 1KTEA 2F3MA 4GWRA 2VCZA 1GSFA 4K2XA 3LYKA 5KEJA 4PURA 2EIRA 1PX6A 2QA2A 3M3MA 4ZIJA 3VWWA 3UJ1A 3D6IA 2O89A 4PXOA 3DYRA 2K9FA 3FHKA 3GUSA 2MMOA 4XS4A 3HY2A 3GYKA 5F0GA 4DVCA 5JWQB 5KN1A 4BVXB 1MTCA 5IPGA 4NWYA 1M2BA 1FW1A 4N10A 2C4JA 1DE2A 2VUPA 2HSMA 3GMFA 1X9SB 2XC2A 2HZEB 2DKIA 2RLIA 4TKYA 1IYIA 1U3IA 4F82A 5GAND 3I9V2 5BMUA 2QSIA 1M0UA 5JCWA 4EE0A 5A5KA 5A1NB 4RUVA 5G30A 2YWNA 3QOUA 2HI7A 4RQRA 2B6MA 2TRXA 2H6XA 3M8NA 4TW5A 2V2GA 1HNAA 5ELAA 2A4VA 2JZTA 2GS3A 2C3QA 3F63A 2IPAA 3TRPA 3CMIA 1G7EA 2LEGA 1K3YA 3VWUA 1TTZA 4AF2A 4PI0C 4EDYA 4YQUA 4MP4A 2XHFA 2OACA 3FY7A 5ECPB 2H6ZA 2GZZA 1J9BA 2FWEA 4BL7A 3NIVA 4HZ2A 1PL1A 2OJLA 1FOHA 3LGCA 4XS6A 2YPMA 3ZREA 2RUEA 3L9VA 3KD0A 5DAKB 3ZVJD 3ED3A 1XVQA 4ZB7A 1HD2A 1ST9A 4LLRA 1HNCA 1JLWA 1TK5B 2R4VA 5HFGA 5DALB 1A0FA 1Y25A 2DKHA 3D21A 1X5DA 2IMDA 2X8GA 4NV5A 3LORA 2D2ZA 2VLVA 4GSSA 3KEBA 3LXZA 3GX8A 4XHMA 3VK9A 4Z2RA 2ZUPA 2O5VA 5B8AA 3BD2A 4G10A 2CT6A 3QPMA 3IV4A 1SK1A 4EVMA 3ZMLA 3HJMA 4X43A 3GH9A 2GSRA 4MF5A 4EF0A 1VF4A 2OADA 5ECQB 2H1GA 2DJ0A 4POMA 3GL3A 2VM2A 4IP1A 11GSA 1LJRA 2H74A 2HRKA 1SD9A 3HZ4A 3QAGA 4HSCX 4K7OA 4MPFA 2CVKA 2XPEA 5IOWA 4GRFA 10GSA 4PNFA 1ZYQB 6GSXA 3UVTA 3EPTA 2GSQA 4X4JA 1FG4A 3R3EA 2L6DA 2ES7A 3FMWA 2LQQA 3FR6A 4ISDA 1I9DA 2H8LA 1XCCA 3UBKA 2HSYA 2WVXB 1THXA 4ILFA 4N11A 4K2DA 3HCZA 3CSJA 5KN2A 2DC5A 1GL8A 4MMMA 1SVLA 1KEBA 3I69A 4JRRA 1G6YA 1ACVA 1QFNA 3I43A 1K0DA 2NTOA 1XW9A 1SJIA 3C1SA 4N0ZA 3TDGA 2RM5A 2B3SA 4AKXB 2P31A 2IN3A 2RIIA 1T7PB 4POKA 2EFEA 1G7OA 4L0UA 3GURA 5J4UA 1GH2A 2PGTA 1T3BA 1XIYA 1FB6A 1XWAA 2H30A 1EOGA 3HVSA 4I97A 2GLRA 1WRYA 3TU3B 1XWBA 3TOTA 2CVDA 4TXVA 4NAXA 1RQMA 2HLSA 3GIXA 4POBA 1ZOFA 4WF4A 3TCOA 5D96A 1GSSA 1ZGNA 1YF1A 5G5EA 2LRTA 3GL5A 1F3BA 2AAWA 2YJHA 2B7KA 4X1UA 4MA9A 4GF0A 2IJYA 2LUSA 1BQ7A 2E7PA 2TRCP 1YKAA 1NM3A 1TDIA 2L59A 1JLVA 5G1LA 5INYA 4MJEA 5CP1A 3VI5A 2C0FA 1GNEA 2JSZA 1K0BA 12GSA 4KAEA 1O8XA 1MDJA 1B4PA 4ZBAA 1M3JA 2C1YA 5H5RA 4TVEA 4CHSA 2B5EA 4TXOA 5KN0A 5HFKA 1ABAA 5F05A 3BCIA 4DSQA 4KDUA 4I6XA 2C0DA 3UARA 3KXOA 1R7HA 4RI7A 2FUG2 3EURA 4Z7XA 1USBA 3ZIVA 4K5RA 2JSYA 3TKSC 4EIPA 4CY6A 2CA8A 3UAPA 3WD6A 1N2AA 2LKUA 2X99A 5H5SA 2NVLA 1V57A 3QMXA 2R3XA 1U6TA 3J7Yk 1EWXA 3RGBC 1A2JA 1SVOA 3A3TA 1SVMA 2P5QA 4IQAA 1GSUA 1JHBA 5A4UA 4V1Ag 5J40A 3ZZXA 4G0IA 3LG6A 2H0HA 1SYRA 1T8EB 3IA1A 3US3A 1AQXA 1K0MA 1LU4A 4BVXA 4PNGA 1BAYA 4LMVA 1AUCA 4JR4A 1TXXA 4G0LA 2PUKC 4MDCA 2HZEA 4TR0A 1Y1UA 4OO4A 2DLXA 1QUWA 1OE7A 3TKSA 3FR3A 2L4CA 2WJUA 3SBCA 1EV4A 2LJAA 5A1NA 2GZPA 2WVYA 1DE1A 1Z6MA 4O92A 3TKRA 4HJ2A 4V1Ap 4MJCA 3TKQA 1F37A 5IMVA 3ZFLA 1J0FA 1GSEA 2O85A 4QMKA 4J57E 2A2SA 5HQPA 3W6GA 3QAWA 3FYGA 4WEYA 4XS1A 2OE1A 4LA1A 3HHVA 3WGEA 4PQIA 6GSSA 1BF5A 2YWMA 3IE3A 5B8BA 1PGTA 3L9SA 2C3TA 1Z5YE 4MH2A 5DAKA 2YV7A 1X9WB 1Z9HA 2CQ9A 4PX1A 1J08A 3HDCA 1S3RA 1BX9A 1K0AA 1GTBA 3KCMA 4ZL9A 3IOSA 2YWIA 4WR4A 14GSA 4PQ1A 1XZOA 5DALA 4AGSA 3GA4A 1GUKA 3VURA 3Q74A 4EDZA 3KGKA 3LW9A 1GSQA 3C8EA 5J9BA 1ZMAA 1BG5A 3E0UA 3ME7A 5KOWA 1SJZA 3HVXA 3W8JA 3QDNA 3HXSA 3P90A 3WYWA 4MABA 5FWGA 3KH7A 1G6WA 2VCQA 4BVYB 2VD0A 3DXBA 4USSA 3D5JA 3L4NA 1V9WA 22GSA 2N5FA 3G7YA 2L4QA 2PU9C 4IVFA 3QAVA 3O6TA 3PPUA 4HDEA 3M0FA 4YAVA 1YQ1A 2DIZA 2O7KA 4HJMA 5J41A 2VL9A 3GX0A 2H70A 4TR3A 4ZBBA 5D9WA 2BMXA 4TXOB 1RK4A 5GSSA 3F4SA 5J5NA 2RUFA 2YJ7A 4TRXA 2JADA 1R4WA 2UV8G 3TKSE 1Z6NA 3G7JA 1FVKA 2WVXA 4FH8A 4TOPA 4KA0A 2L5OA 4Q5RA 4FYUA 2ON5A 2DJ1A 4F0BA 4BIKA 4JE1A 1G0TA 2C3NA 1EP8A 2MYGA 1EZKA 2GVPA 4F2IA 5ECSA 3UIWA 1A8LA 4NHZA 1NHYA 1R5AA 1QQ2A 1N25A 4KGIA 2K6VA 4ZL7A 2VIMA 4MH3A 16GSA 1A0RP 3S9FA 2VCTA 1OC3A 4ECJA 3PR8A 4E68A 4ZBDA 4IHUA 4XIHA 1AAZA 1FVJA 5D93A 3L9UA 2H1DA 1YEXA 5D9XA 1TXUA 2H66A 1YKCA 2IMKA 2IMIA 1WMJA 3VLNA 2VCWA 3ERGA 2H01A 3V1WA 3IR4A 1R26A 1AIUA 1X0RA 1B48A 4ICYA 1PN0A 3GKNA 2MBTA 4NXIA 2EFCA 2WS2A 2B5XA 2AHEA 3WGXA 5AGYA 2I81A 3CRUA 2HSNB 1TU8A 3IHGA 3GH6A 2OBIA 3HJOA 2I4AA 3MAKA 5IQYA 3EWLA 4K7NA 3O3TA 4YAPA 5LNKe 2M72A 2EFDA 3P2AA 2YV9A 1VF2A 1YJ6A 2CZ3A 5AIVA 1TRWA 3F6FA 2R0PA 3D0ZA 1OKDA 3DRNA 2E2GA 2F8FA 1QMVA 1OYJA 2DSAA 2J23A 5L71A 3ZMKA 1C72A 3GV1A 2AB6A 1XOAA 3H93A 1V58A 4MZCA 2FWHA 2OE0A 2I3YA 4OCFA 4ID0A 1Q4JA 2VLUA 2AUVA 2HE3A 3CWGA 3A2XA 4J56E 3ZLPA 3IHQA 3I6AA 3IRAA 1O6JA 3EU3A 4G19A 3WGDA 3IBHA 5IMAA 1XG8A 1O81A 3EU4A 3P8WA 2NBSA 2X4AA 2YP6A 2LNSA 3NZNA 4G0KA 5EPFA 4YH2A 2F8AA 4KW6A 1HYUA 1BJXA 2PBJA 1H75A 3FK8A 4EXJA 1XWGA 2O3EA 4N3ZA 2EFHA 3DIEA 4WF5A 5E4WA 3C73A 5IM9A 3AY8A 4HEA2 1A8YA 3RAZA 5D73A 3ZVJA 1JZRA 4IN0A 3VWVA 5A34B 4FYCA 3EVIA 1AQWA 5EY6A 5HFIA 1GULA 2O87A 2PVOC 2JU5A 4FQUA 19GSA 2JL4A 2GT6A 2WCIA 1PA3A 1T4YA 4I5QA 4BWQA 3APOA 2H76A 3UOMA 1AC1A 2H1BA 2WW3A 3L78A 1F6MC 1Z7PA 4Q5FA 1SKSB 4E8HA 4EKZA 4EIQA 2HYXA 1EEMA 2FA8A 1X5CA 2M46A 1JZDA 1XPVA 3IK9A 2I9HA 2P5RA 4N0VA 2QA1A 2YNXA 4NHWA 2NPBA 5D9TA 2UZ8A 2LS5A 5DQYA 1E6BA 1MD4A 5G31A 4GXZA 1TOFA 4V2NA 1SKWB 4BVYA 4O5RA 5BRTA 3KM6A 3TRXA 2YANA 2DMLA 4GSTA 1GUMA 3LSZA 5IOXA 4F9ZA 3M1GA 5FHIA 2V6KA 1B8XA 2L5LA 3CQFA 4IQ1A 4ZL8A 5CYYA 3MSZA 4WXTA 3EMPA 4L0WA 1HNBA 2WDUA 1AW9A 2PMTA 3F6DA 2LRCA 2WZ9A 1O7UA 4EL1A 3DVWA 5COHA 5ECRB 2VLTA 5LCZA 5EL8A 2O8VB 2FHEA 2WB9A 2VO4A 1YVLA 5A5HB 4IW9A 3DGQA 2LJKA 1GSYA 2AV4A 17GSA 5CRWA 2PVQA 1OC9B 4Q5NA 2H0IA 3DD3A 2ALBA 4CW9A 3IAS2 3KP9A 4F03A 4XRDA 1XBSA 3N5OA 1V98A 3TOUA 1PQNA 1SU9A 2G2QA 2A2PA 2IMEA 3DWVA 1SD8A 3TB2A 2K18A 4GQCA 1GP1A 2R0GA 1O8WA 4MCUA 3GSTA 3ZL5A 3CBUA 3L0HA 1ILOA 4XTSA 1SL0B 1V40A 1PX7A 1CQGA 2B5YA 1X5EA 1O85A 4ZXGA 3BBYA 3TGZA 5ECKB 4WBJA 1Z7RA 1W89A 1FHEA 2G0FA 2A2RA 2KP1A 3C71A 3F3RA 1GNWA 3ZITA 1V2AA 4MK3A 1Q98A 5HR0A 1XVWA 3K8NA 1KNGA 2H75A 3JCML 1QXHA 2WRTA 4DEJA 3LQ7A 3LWAA 1DBYA 2LV3A 3H8QA 5B6MA 3GFKA 4K0NA 3ERFA 3VFIA 3UMAA 1PRXA 2H71A 4HOJA 2GSSA 1U88A 3DEXA 6GSWA 2DMMA 2C8UA 3G9BA 2HSNA 2IIYA 5DJLA 4JR6A 4WR5A 2R6KA 1A2LA 1SK0A 4IP6A 4FIWA 2VOCA 4KSOA 2LRNA 2KHPA 4POLA 3APSA 4WKWA 4Z2UA 5F07A 4KX4A 4H86A 4MZBA 4PQHA 4JEDA 2GQLA 5DCGA 3F4RA 4DSRA 3KTLA 3ZFBA 5DCHA 5A4VA 2K8VA 2H0GA 3CYNA 2J9HA 3CTFA 4IJ3A 4JBBA 1X9MB 3OR5A 2WVZA 4KCAA 1JZWA 1ZL9A 2FD3A 4QL7A 4PTSA 7GSSA 3ZRDA 3C7MA 1TI3A 2REMA 3FZ4A 1NSWA 4V2MA 3HKRA 5IIZA 3HJPA 2VCVA 1F9MA 1FB0A 1UVZA 2YWOA 3A2VA 1GTIA 2DJKA 1YY7A 1O73A 2V32A 1A2MA 3HYPA 4TR1B 3D4MA 2HRNA 3ISOA 5ECIB 1NW2A 2VAFA 2ZNMA 2GZYA 4KCEA 4G2EA 3GTUA 4ZB6A 2R2JA 2BJXA 1PL2A 4KNDA 2B1KA 2PERA 5IPHA 1TK0B 3R2QA 4ECCA 4ML6A 3CHXC 1I5GA 1N8JA 4WETA 2HQTA 5CAXA 3A2WA 3GKKA 3CSHA 5A34A 3GHAA 2IFQA 2LQOA 4K6XA 1SYXA 4JU5A 1TRUA 5ECLB 1VF1A 1K3LA 1K0NA 1UA5A 2WULA 3QFAC 3QCPA 4Q5QA 4IS0A 1S4BP 3QR6A 4O5UA 4GDFA 1ERUA 4EUYA 3E9JB 1QK8A 2MZCA 1ZCPA 4KUNA 5JWRB 2XBIA 3CXGA 3M9JA 2JZRA 3H4KA 3FZ9A 5CO3A 1GRXA 2V41A 1TRSA 2CAQA 2DJJA 5EVOA 5ECMB 2HRFA 2R0CA 2WW0A 1B4QA 2PN8A 4LMWA 3FR9A 3RHBA 1TU7A 2NDOA 1GSDA 2CAIA 5GZZB 4MNNA 1R5PA 3VI7A 1WPIA 2HT9A 3MWHA 4XCSA 2FNOA 2XPDA 2VL3A 4MZWA 2KP2A 1TK8B 1EEJA 3EE2A 4ZB8A 2B1LA 4XRAA 1GTAA 2VKZG 3VWXA 2HNLA 3IDVA 4YKFA 1GUHA 5JCUA 1M2DA 2IWTA 2L57A 1VRSD 5C00A 2A4HA 5DBQA 3FRCA 2CX3A 3LEFA 3PGTA 2OT3A 1M9BA 3GSSA 2F51A 4OFNA 3N9JA 1WE0A 4YQVA 4CY8A 3FEUA 1CQHA 2FWFA 4O5QA 3TJKA 3TKPA 1S3AA 3KP8A 3J7Yb 2H72A 1SL2B 2BTOT 1WWJA 3QD9A 4ZILA 5J3RA 1RW1A 1EV9A 5IMFA 6GSUA 5A5HA 3FW2A 1ZYEA 2DIYA 1KBNA 1M7TA 4HQSA 1OC9A 3F4TA 1MDIA 5KOXA 1PD21 1PSQA 4V2LA 3CTGA 2FGXA 5JCGA 5IMZA 2VL2C 4K8MA 3UBLA 4LL4B 9GSSA 4AI6A 3KTBA 3RPNA 4RQXA 2HFDA 2ZCTA 4KB3A 3F3QA 2MBSA 2FY6A 1EGRA 1PKWA 2CX4A 4HI7A 1ERVA 5CNWA 1GLPA 1GLQA 4PHZC 5CRHA 3LJRA 2FWGA 4J2FA 1WIKA 4GSNA 1Y6EA 4ACSA 1WJKA 3QFBC 4GTUA 4I2TA 4ZB9A 1VGLA 5HR3A 2VCXA 1XOBA 1YF0A 3PH9A 1WOUA 4P3YB 1M3IA 2LTKA 2OBKA 4Z2TA 6GSVA 2X64A 4L8EA 1XXUA 1URMA 4GCIA 1AXDA 3P7XA 2YZHA 6GSYA 2K8SA 3F0IA 4W66A 4K0GA 1K0CA 1JZOA 3KMNA 1F2EA 2E2MA 3GTUB 4DSSB 3KJYA 3A5IA 1ZZYA 2WW1A 8GSSA 3W8SA 2N5AA 2DJ3A 1ON4A 2OE3A 1FOVA 3EINA 5AISA 1AQVA 1EP7A 4PUAA 1PMTA 1A23A 2M80A 2VL2A 3ZYWA 2QKEA 2IFQB 5ECHB 3APQA 3GRXA 5J9CA 3ZTLA 1TJDA 2GQKA 1GTUA 1E2YA 3HZ8A 18GSA 2GT5A 3KZQA 5ID2B 4NV2A 5AN1A 3ZIJA 4D73B 2C0EA 4YQMA 1TI1A 2OKAA 2KUCA 5IO2A 4FYBA 5GAPD 3GKXA 3DKSA 1SK2A 1K0OA 4AKGA 4AJ7A 4KF9A 1TW9A 4LL1B 4G01A 1MDKA 2VD1A 4MF7A
chains in the Genus database with same CATH topology
4I8BA 2X8CA 20GSA 3C1RA 1ERTA 2X49A 1ZYPA 4K9ZA 2IMFA 4OWYA 1SL1B 3FZAA 4XS4B 3LFLA 3LYPA 2AYTA 2B7JA 3TUEA 3RPPA 5KN3A 5G1KA 4IJIA 4OFMA 1UC7A 2GQMA 3BJ5A 2LSTA 4NMUA 1SENA 2CVBA 13GSA 1T4ZA 2HSMB 2LNTA 1THOA 5CRGA 5HR1A 4OD7A 1NHOA 4AJ8A 5G2ZA 1W4VA 2GSTA 1SKRB 5ENUA 3GNJA 2I1UA 5BMUB 1OAZA 2YZUA 1A24A 2QC7A 4TR1A 5GSTA 2QGVA 2FLSA 4AKIA 5DVBA 4HU7A 1S3CA 1OE8A 3VPQA 2C0GA 5DDLA 4WBRD 1YEPA 4IGJA 1PN9A 5FT3A 2HZFA 3EYTA 1F3AA 2JACA 1M2AA 4OCEA 3M9KA 5CRDA 5ABRA 1XW5A 3DVXA 3IAM2 4G9HA 1BYEA 2KLXA 4BL7B 1OVNA 4K7IA 2AJQB 1BEDA 3MYDA 2MMZA 4F0CA 2V1MA 4HS1A 5J47A 4OO5A 1ZYNA 2N5BA 2FCHA 2PPTA 2CZ2A 3EC3A 2X8HA 4BPYA 3KH9A 2PWJA 5G5FA 3F9UA 1XW6A 1WP0A 3O76A 1TRVA 4YKGA 4HU9A 2YOIA 5J4YA 3D4TA 1OC8A 3IC4A 1VF3A 4K5SA 4PGTA 5ECNB 3UVHA 3IK7A 5B7CA 2YCDA 4MJBA 4QQ7A 1B9XC 4GLTA 4KDYA 5ECOB 4OMVA 5DJMA 5IMCA 2TIRA 4IELA 2P0GA 3MIXA 1XWKA 1TP9A 3CSIA 1U3AA 4EC0A 3RBTA 2FA4A 2HRAA 4E8EA 3ERWA 2GGTA 3WT1A 3HA9A 4CDOA 2H1LA 3SWLA 4ECBA 2Z9SA 2L6CA 1H4OA 5F06A 3KMOA 3WT2A 6GSTA 2HRKB 4TN8A 2CV4A 2EIOA 3CRTA 4FO5A 3U6VA 1JFUA 5CREA 4RI6A 1M9AA 2DBCA 1ERWA 2V6OA 4I2UA 2EIQA 1HQOA 2YN1A 4HUAA 1B9YC 1BG1A 5IO0A 1DSBA 2GDRA 1FO5A 4OFTA 5C04A 4MF6A 4ECIA 2WFCA 3TJFA 2DJ2A 2OA7A 4KH7A 4AKHA 5H5QA 4K1FA 4IBPA 3FZ5A 3KIJA 4KSMA 5D9VA 1DUGA 1EGOA 1U87A 2MMNA 2WGRA 1ML6A 1T1VA 1TKDB 2KOKA 3Q18A 5F8BA 2H73A 4KDXA 1XFLA 3VPTA 2H6YA 3GN3A 3MDKA 1QGVA 1XWCA 3F8UA 1SJ6A 4BWSA 5JWOB 5AIXA 1Z3EA 2R5GA 4O32A 3A5WA 1S3DA 1EOHA 3TJGA 3DMLA 5A4WA 3IXRA 4AJ6A 4L5LA 1YDKA 4JZQA 1M99A 4MPGA 3HD5A 3HVVA 5E59A 3TJBA 1UN2A 4BA7A 2LJRA 3HMJG 4IKHA 3UEMA 1K3OA 5D8IA 3BOAA 2IL3A 5DQSA 3RDWA 2EC4A 2MMAA 2R37A 4MLYA 3H79A 2C80A 5B6NA 3PINA 1FAAA 3MNGA 2VM1A 4KE3A 5IMDA 4QL9A 1LBKA 2E0QA 3NOFA 4HZ4A 3H1NA 5J4VA 3G7IA 5ELGA 2HSHA 1MEKA 2ON7A 4DSSA 1T00A 4NPBA 3D22A 2F9SA 4A5PA 3TRQA 3IPZA 4PUFC 4EO3A 2H1AA 2H19A 2RM6A 3E3EA 3UL3A 4O7HA 1PKZA 4ULXA 3FKFA 5LD0A 3ME8A 3Q6OA 3GKMA 4ML1A 4HQZA 4GQFA 4TR4A 2JZSA 3TJJA 3U5RE 4L5OA 3Q19A 3RHCA 2XBQA 1GWCA 1MD3A 4MJAA 5ID2A 4D73A 5HR2A 2HXKA 1OKTA 3EMXA 4X0XA 1YZXA 3BCKA 3IC8A 3LXTA 1IYHA 4N30A 2GTUA 1KTEA 2F3MA 4GWRA 2VCZA 1GSFA 4K2XA 3LYKA 5KEJA 4PURA 2EIRA 1PX6A 2QA2A 3M3MA 4ZIJA 3VWWA 3UJ1A 3D6IA 2O89A 4PXOA 3DYRA 2K9FA 3FHKA 3GUSA 2MMOA 4XS4A 3HY2A 3GYKA 5F0GA 4DVCA 5JWQB 5KN1A 4BVXB 1MTCA 5IPGA 4NWYA 1M2BA 1FW1A 4N10A 2C4JA 1DE2A 2VUPA 2HSMA 3GMFA 1X9SB 2XC2A 2HZEB 2DKIA 2RLIA 4TKYA 1IYIA 1U3IA 4F82A 5GAND 3I9V2 5BMUA 2QSIA 1M0UA 5JCWA 4EE0A 5A5KA 5A1NB 4RUVA 5G30A 2YWNA 3QOUA 2HI7A 4RQRA 2B6MA 2TRXA 2H6XA 3M8NA 4TW5A 2V2GA 1HNAA 5ELAA 2A4VA 2JZTA 2GS3A 2C3QA 3F63A 2IPAA 3TRPA 3CMIA 1G7EA 2LEGA 1K3YA 3VWUA 1TTZA 4AF2A 4EDYA 4YQUA 4MP4A 2XHFA 2OACA 3FY7A 5ECPB 2H6ZA 2GZZA 1J9BA 2FWEA 4BL7A 3NIVA 4HZ2A 1PL1A 2OJLA 1FOHA 3LGCA 4XS6A 2YPMA 3ZREA 2RUEA 3L9VA 3KD0A 5DAKB 3ZVJD 3ED3A 1XVQA 4ZB7A 1HD2A 1ST9A 4LLRA 1HNCA 1JLWA 1TK5B 2R4VA 5HFGA 5DALB 1A0FA 1Y25A 2DKHA 3D21A 1X5DA 2IMDA 2X8GA 4NV5A 3LORA 2D2ZA 2VLVA 4GSSA 3KEBA 3LXZA 3GX8A 4XHMA 3VK9A 4Z2RA 2ZUPA 2O5VA 5B8AA 3BD2A 4G10A 2CT6A 3QPMA 3IV4A 1SK1A 4EVMA 3ZMLA 3HJMA 4X43A 3GH9A 2GSRA 4MF5A 4EF0A 1VF4A 2OADA 5ECQB 2H1GA 2DJ0A 4POMA 3GL3A 2VM2A 4IP1A 11GSA 1LJRA 2H74A 2HRKA 1SD9A 3HZ4A 3QAGA 4K7OA 4MPFA 2CVKA 2XPEA 5IOWA 4GRFA 10GSA 4PNFA 1ZYQB 6GSXA 3UVTA 3EPTA 2GSQA 4X4JA 1FG4A 3R3EA 2L6DA 2ES7A 3FMWA 2LQQA 3FR6A 4ISDA 1I9DA 2H8LA 1XCCA 3UBKA 2HSYA 1THXA 4ILFA 4N11A 4K2DA 3HCZA 3CSJA 5KN2A 2DC5A 1GL8A 4MMMA 1SVLA 1KEBA 3I69A 4JRRA 1G6YA 1ACVA 1QFNA 3I43A 1K0DA 2NTOA 1XW9A 1SJIA 3C1SA 4N0ZA 3TDGA 2RM5A 2B3SA 4AKXB 2P31A 2IN3A 2RIIA 1T7PB 4POKA 2EFEA 1G7OA 4L0UA 3GURA 5J4UA 1GH2A 2PGTA 1T3BA 1XIYA 1FB6A 1XWAA 2H30A 1EOGA 3HVSA 4I97A 2GLRA 1WRYA 3TU3B 1XWBA 3TOTA 2CVDA 4TXVA 4NAXA 1RQMA 2HLSA 3GIXA 4POBA 1ZOFA 4WF4A 3TCOA 5D96A 1GSSA 1ZGNA 1YF1A 5G5EA 2LRTA 3GL5A 1F3BA 2AAWA 2YJHA 2B7KA 4X1UA 4MA9A 4GF0A 2IJYA 2LUSA 1BQ7A 2E7PA 2TRCP 1YKAA 1NM3A 1TDIA 2L59A 1JLVA 5G1LA 5INYA 4MJEA 5CP1A 3VI5A 2C0FA 1GNEA 2JSZA 1K0BA 12GSA 4KAEA 1O8XA 1MDJA 1B4PA 4ZBAA 2C1YA 5H5RA 4TVEA 4CHSA 2B5EA 4TXOA 5KN0A 5HFKA 1ABAA 5F05A 3BCIA 4DSQA 4KDUA 4I6XA 2C0DA 3UARA 3KXOA 1R7HA 4RI7A 2FUG2 3EURA 4Z7XA 1USBA 3ZIVA 4K5RA 2JSYA 3TKSC 4EIPA 4CY6A 2CA8A 3UAPA 3WD6A 1N2AA 2LKUA 2X99A 5H5SA 2NVLA 1V57A 3QMXA 2R3XA 1U6TA 3J7Yk 1EWXA 1A2JA 1SVOA 3A3TA 1SVMA 2P5QA 4IQAA 1GSUA 1JHBA 5A4UA 4V1Ag 5J40A 3ZZXA 4G0IA 3LG6A 2H0HA 1SYRA 1T8EB 3IA1A 3US3A 1AQXA 1K0MA 1LU4A 4BVXA 4PNGA 1BAYA 4LMVA 1AUCA 4JR4A 1TXXA 4G0LA 2PUKC 4MDCA 2HZEA 4TR0A 1Y1UA 4OO4A 2DLXA 1QUWA 1OE7A 3TKSA 3FR3A 2L4CA 2WJUA 3SBCA 1EV4A 2LJAA 5A1NA 2GZPA 1DE1A 1Z6MA 4O92A 3TKRA 4HJ2A 4V1Ap 4MJCA 3TKQA 1F37A 5IMVA 3ZFLA 1J0FA 1GSEA 2O85A 4QMKA 4J57E 2A2SA 5HQPA 3W6GA 3QAWA 3FYGA 4WEYA 4XS1A 2OE1A 4LA1A 3HHVA 3WGEA 4PQIA 6GSSA 1BF5A 2YWMA 3IE3A 5B8BA 1PGTA 3L9SA 2C3TA 1Z5YE 4MH2A 5DAKA 2YV7A 1X9WB 1Z9HA 2CQ9A 4PX1A 1J08A 3HDCA 1BX9A 1K0AA 1GTBA 3KCMA 4ZL9A 3IOSA 2YWIA 4WR4A 14GSA 4PQ1A 1XZOA 5DALA 4AGSA 3GA4A 1GUKA 3VURA 3Q74A 4EDZA 3KGKA 3LW9A 1GSQA 3C8EA 5J9BA 1ZMAA 1BG5A 3E0UA 3ME7A 5KOWA 1SJZA 3HVXA 3W8JA 3QDNA 3HXSA 3P90A 3WYWA 4MABA 5FWGA 3KH7A 1G6WA 2VCQA 4BVYB 2VD0A 3DXBA 4USSA 3D5JA 3L4NA 1V9WA 22GSA 2N5FA 3G7YA 2L4QA 2PU9C 4IVFA 3QAVA 3O6TA 3PPUA 4HDEA 3M0FA 4YAVA 1YQ1A 2DIZA 2O7KA 4HJMA 5J41A 2VL9A 3GX0A 2H70A 4TR3A 4ZBBA 5D9WA 2BMXA 4TXOB 1RK4A 5GSSA 3F4SA 5J5NA 2RUFA 2YJ7A 4TRXA 2JADA 1R4WA 2UV8G 3TKSE 1Z6NA 3G7JA 1FVKA 4FH8A 4TOPA 4KA0A 2L5OA 4Q5RA 4FYUA 2ON5A 2DJ1A 4F0BA 4JE1A 1G0TA 2C3NA 1EP8A 2MYGA 1EZKA 2GVPA 4F2IA 5ECSA 3UIWA 1A8LA 4NHZA 1NHYA 1R5AA 1QQ2A 1N25A 4KGIA 2K6VA 4ZL7A 2VIMA 4MH3A 16GSA 1A0RP 3S9FA 2VCTA 1OC3A 4ECJA 3PR8A 4E68A 4ZBDA 4IHUA 4XIHA 1AAZA 1FVJA 5D93A 3L9UA 2H1DA 1YEXA 5D9XA 1TXUA 2H66A 1YKCA 2IMKA 2IMIA 1WMJA 3VLNA 2VCWA 3ERGA 2H01A 3V1WA 3IR4A 1R26A 1AIUA 1X0RA 1B48A 4ICYA 1PN0A 3GKNA 2MBTA 4NXIA 2EFCA 2WS2A 2B5XA 2AHEA 3WGXA 5AGYA 2I81A 3CRUA 2HSNB 1TU8A 3IHGA 3GH6A 2OBIA 3HJOA 2I4AA 3MAKA 5IQYA 3EWLA 4K7NA 3O3TA 4YAPA 5LNKe 2M72A 2EFDA 3P2AA 2YV9A 1VF2A 1YJ6A 2CZ3A 5AIVA 1TRWA 3F6FA 2R0PA 3D0ZA 1OKDA 3DRNA 2E2GA 2F8FA 1QMVA 1OYJA 2DSAA 2J23A 5L71A 3ZMKA 1C72A 3GV1A 2AB6A 1XOAA 3H93A 1V58A 4MZCA 2FWHA 2OE0A 2I3YA 4OCFA 4ID0A 1Q4JA 2VLUA 2AUVA 2HE3A 3CWGA 3A2XA 4J56E 3ZLPA 3IHQA 3I6AA 3IRAA 1O6JA 3EU3A 4G19A 3WGDA 3IBHA 5IMAA 1O81A 3EU4A 3P8WA 2NBSA 2X4AA 2YP6A 2LNSA 3NZNA 4G0KA 5EPFA 4YH2A 2F8AA 4KW6A 1HYUA 1BJXA 2PBJA 1H75A 3FK8A 4EXJA 1XWGA 4N3ZA 2EFHA 3DIEA 4WF5A 5E4WA 3C73A 5IM9A 3AY8A 4HEA2 1A8YA 3RAZA 5D73A 3ZVJA 1JZRA 4IN0A 3VWVA 5A34B 4FYCA 3EVIA 1AQWA 5EY6A 5HFIA 1GULA 2O87A 2PVOC 2JU5A 4FQUA 19GSA 2JL4A 2GT6A 2WCIA 1PA3A 1T4YA 4I5QA 4BWQA 3APOA 2H76A 3UOMA 1AC1A 2H1BA 3L78A 1F6MC 1Z7PA 4Q5FA 1SKSB 4E8HA 4EKZA 4EIQA 2HYXA 1EEMA 2FA8A 1X5CA 2M46A 1JZDA 1XPVA 3IK9A 2I9HA 2P5RA 4N0VA 2QA1A 2YNXA 4NHWA 2NPBA 5D9TA 2UZ8A 2LS5A 5DQYA 1E6BA 1MD4A 5G31A 4GXZA 1TOFA 4V2NA 1SKWB 4BVYA 4O5RA 5BRTA 3KM6A 3TRXA 2YANA 2DMLA 4GSTA 1GUMA 3LSZA 5IOXA 4F9ZA 3M1GA 5FHIA 2V6KA 1B8XA 2L5LA 4IQ1A 4ZL8A 5CYYA 3MSZA 4WXTA 3EMPA 4L0WA 1HNBA 2WDUA 1AW9A 2PMTA 3F6DA 2LRCA 2WZ9A 1O7UA 4EL1A 3DVWA 5COHA 5ECRB 2VLTA 5LCZA 5EL8A 2O8VB 2FHEA 2WB9A 2VO4A 1YVLA 5A5HB 4IW9A 3DGQA 2LJKA 1GSYA 2AV4A 17GSA 5CRWA 2PVQA 1OC9B 4Q5NA 2H0IA 3DD3A 2ALBA 4CW9A 3IAS2 3KP9A 4F03A 4XRDA 1XBSA 3N5OA 1V98A 3TOUA 1PQNA 1SU9A 2G2QA 2A2PA 2IMEA 3DWVA 1SD8A 3TB2A 2K18A 4GQCA 1GP1A 2R0GA 1O8WA 4MCUA 3GSTA 3ZL5A 3CBUA 3L0HA 1ILOA 4XTSA 1SL0B 1V40A 1PX7A 1CQGA 2B5YA 1X5EA 1O85A 4ZXGA 3BBYA 3TGZA 5ECKB 4WBJA 1Z7RA 1W89A 1FHEA 2G0FA 2A2RA 2KP1A 3C71A 3F3RA 1GNWA 3ZITA 1V2AA 4MK3A 1Q98A 5HR0A 1XVWA 3K8NA 1KNGA 2H75A 3JCML 1QXHA 2WRTA 4DEJA 3LQ7A 3LWAA 1DBYA 2LV3A 3H8QA 5B6MA 3GFKA 4K0NA 3ERFA 3VFIA 3UMAA 1PRXA 2H71A 4HOJA 2GSSA 1U88A 3DEXA 6GSWA 2DMMA 2C8UA 3G9BA 2HSNA 2IIYA 5DJLA 4JR6A 4WR5A 2R6KA 1A2LA 1SK0A 4IP6A 4FIWA 2VOCA 4KSOA 2LRNA 2KHPA 4POLA 3APSA 4WKWA 4Z2UA 5F07A 4KX4A 4H86A 4MZBA 4PQHA 4JEDA 2GQLA 5DCGA 3F4RA 4DSRA 3KTLA 3ZFBA 5DCHA 5A4VA 2K8VA 2H0GA 3CYNA 2J9HA 3CTFA 4IJ3A 4JBBA 1X9MB 3OR5A 4KCAA 1JZWA 1ZL9A 2FD3A 4QL7A 4PTSA 7GSSA 3ZRDA 3C7MA 1TI3A 2REMA 3FZ4A 1NSWA 4V2MA 3HKRA 5IIZA 3HJPA 2VCVA 1F9MA 1FB0A 1UVZA 2YWOA 3A2VA 1GTIA 2DJKA 1YY7A 1O73A 2V32A 1A2MA 3HYPA 4TR1B 3D4MA 2HRNA 3ISOA 5ECIB 1NW2A 2VAFA 2ZNMA 2GZYA 4KCEA 4G2EA 3GTUA 4ZB6A 2R2JA 2BJXA 1PL2A 4KNDA 2B1KA 2PERA 5IPHA 1TK0B 3R2QA 4ECCA 4ML6A 1I5GA 1N8JA 4WETA 2HQTA 5CAXA 3A2WA 3GKKA 3CSHA 5A34A 3GHAA 2IFQA 2LQOA 4K6XA 1SYXA 4JU5A 1TRUA 5ECLB 1VF1A 1K3LA 1K0NA 1UA5A 2WULA 3QFAC 3QCPA 4Q5QA 4IS0A 3QR6A 4O5UA 4GDFA 1ERUA 4EUYA 3E9JB 1QK8A 2MZCA 1ZCPA 4KUNA 5JWRB 2XBIA 3CXGA 3M9JA 2JZRA 3H4KA 3FZ9A 5CO3A 1GRXA 2V41A 1TRSA 2CAQA 2DJJA 5EVOA 5ECMB 2HRFA 2R0CA 1B4QA 2PN8A 4LMWA 3FR9A 3RHBA 1TU7A 2NDOA 1GSDA 2CAIA 5GZZB 4MNNA 1R5PA 3VI7A 1WPIA 2HT9A 3MWHA 4XCSA 2FNOA 2XPDA 2VL3A 4MZWA 2KP2A 1TK8B 1EEJA 3EE2A 4ZB8A 2B1LA 4XRAA 1GTAA 2VKZG 3VWXA 2HNLA 3IDVA 4YKFA 1GUHA 5JCUA 1M2DA 2IWTA 2L57A 1VRSD 5C00A 2A4HA 5DBQA 3FRCA 2CX3A 3LEFA 3PGTA 2OT3A 1M9BA 3GSSA 2F51A 4OFNA 3N9JA 1WE0A 4YQVA 4CY8A 3FEUA 1CQHA 2FWFA 4O5QA 3TJKA 3TKPA 1S3AA 3KP8A 3J7Yb 2H72A 1SL2B 2BTOT 1WWJA 3QD9A 4ZILA 5J3RA 1RW1A 1EV9A 5IMFA 6GSUA 5A5HA 3FW2A 1ZYEA 2DIYA 1KBNA 1M7TA 4HQSA 1OC9A 3F4TA 1MDIA 5KOXA 1PD21 1PSQA 4V2LA 3CTGA 2FGXA 5JCGA 5IMZA 2VL2C 4K8MA 3UBLA 4LL4B 9GSSA 4AI6A 3KTBA 3RPNA 4RQXA 2HFDA 2ZCTA 4KB3A 3F3QA 2MBSA 2FY6A 1EGRA 1PKWA 2CX4A 4HI7A 1ERVA 5CNWA 1GLPA 1GLQA 5CRHA 3LJRA 2FWGA 4J2FA 1WIKA 4GSNA 1Y6EA 4ACSA 1WJKA 3QFBC 4GTUA 4I2TA 4ZB9A 1VGLA 5HR3A 2VCXA 1XOBA 1YF0A 3PH9A 1WOUA 4P3YB 2LTKA 2OBKA 4Z2TA 6GSVA 2X64A 4L8EA 1XXUA 1URMA 4GCIA 1AXDA 3P7XA 2YZHA 6GSYA 2K8SA 3F0IA 4W66A 4K0GA 1K0CA 1JZOA 3KMNA 1F2EA 2E2MA 3GTUB 4DSSB 3KJYA 3A5IA 1ZZYA 8GSSA 3W8SA 2N5AA 2DJ3A 1ON4A 2OE3A 1FOVA 3EINA 5AISA 1AQVA 1EP7A 4PUAA 1PMTA 1A23A 2M80A 2VL2A 3ZYWA 2QKEA 2IFQB 5ECHB 3APQA 3GRXA 5J9CA 3ZTLA 1TJDA 2GQKA 1GTUA 1E2YA 3HZ8A 18GSA 2GT5A 3KZQA 5ID2B 4NV2A 5AN1A 3ZIJA 4D73B 2C0EA 4YQMA 1TI1A 2OKAA 2KUCA 5IO2A 4FYBA 5GAPD 3GKXA 3DKSA 1SK2A 1K0OA 4AKGA 4AJ7A 4KF9A 1TW9A 4LL1B 4G01A 1MDKA 2VD1A 4MF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I8B A;  2X8C A;  20GS A;  3C1R A;  1ERT A;  4K9Z A;  2IMF A;  4OWY A;  1SL1 B;  3FZA A;  4XS4 B;  3LFL A;  3LYP A;  2AYT A;  2B7J A;  3TUE A;  3RPP A;  5KN3 A;  5G1K A;  4IJI A;  4OFM A;  1UC7 A;  2GQM A;  3BJ5 A;  2LST A;  4NMU A;  1SEN A;  2CVB A;  13GS A;  1T4Z A;  2HSM B;  2LNT A;  1THO A;  5CRG A;  5HR1 A;  4OD7 A;  1NHO A;  4AJ8 A;  5G2Z A;  1W4V A;  2GST A;  1SKR B;  5ENU A;  3GNJ A;  2I1U A;  1OAZ A;  2YZU A;  1A24 A;  2QC7 A;  4TR1 A;  5GST A;  2QGV A;  2FLS A;  5DVB A;  4HU7 A;  1S3C A;  1OE8 A;  3VPQ A;  2C0G A;  5DDL A;  4WBR D;  1YEP A;  4IGJ A;  1PN9 A;  5FT3 A;  2HZF A;  3EYT A;  1F3A A;  2JAC A;  1M2A A;  4OCE A;  3M9K A;  5CRD A;  5ABR A;  1XW5 A;  3DVX A;  3IAM 2;  4G9H A;  1BYE A;  2KLX A;  4BL7 B;  1OVN A;  4K7I A;  2AJQ B;  1BED A;  2MMZ A;  4F0C A;  2V1M A;  4HS1 A;  4OO5 A;  2N5B A;  2FCH A;  2PPT A;  2CZ2 A;  3EC3 A;  2X8H A;  4BPY A;  3KH9 A;  2PWJ A;  5G5F A;  3F9U A;  1XW6 A;  1WP0 A;  3O76 A;  1TRV A;  4HU9 A;  2YOI A;  3D4T A;  1OC8 A;  3IC4 A;  1VF3 A;  4PGT A;  5ECN B;  3UVH A;  3IK7 A;  5B7C A;  2YCD A;  4MJB A;  4QQ7 A;  1B9X C;  4GLT A;  4KDY A;  5ECO B;  4OMV A;  5DJM A;  5IMC A;  2TIR A;  4IEL A;  2P0G A;  1XWK A;  1TP9 A;  3CSI A;  1U3A A;  4EC0 A;  3RBT A;  2FA4 A;  2HRA A;  4E8E A;  3ERW A;  2GGT A;  3WT1 A;  3HA9 A;  4CDO A;  3SWL A;  4ECB A;  2Z9S A;  2L6C A;  1H4O A;  5F06 A;  3KMO A;  3WT2 A;  6GST A;  2HRK B;  4TN8 A;  2CV4 A;  2EIO A;  3CRT A;  4FO5 A;  3U6V A;  1JFU A;  5CRE A;  4RI6 A;  1M9A A;  2DBC A;  1ERW A;  2V6O A;  4I2U A;  2EIQ A;  1HQO A;  2YN1 A;  4HUA A;  1B9Y C;  5IO0 A;  1DSB A;  2GDR A;  1FO5 A;  4OFT A;  5C04 A;  4MF6 A;  4ECI A;  2WFC A;  3TJF A;  2DJ2 A;  2OA7 A;  4KH7 A;  5H5Q A;  4K1F A;  4IBP A;  3FZ5 A;  3KIJ A;  4KSM A;  5D9V A;  1DUG A;  1EGO A;  1U87 A;  2MMN A;  2WGR A;  1ML6 A;  1T1V A;  1TKD B;  2KOK A;  3Q18 A;  5F8B A;  2H73 A;  4KDX A;  1XFL A;  3VPT A;  2H6Y A;  3GN3 A;  3MDK A;  1QGV A;  1XWC A;  3F8U A;  1SJ6 A;  4BWS A;  5JWO B;  5AIX A;  1Z3E A;  2R5G A;  4O32 A;  3A5W A;  1S3D A;  1EOH A;  3TJG A;  3DML A;  5A4W A;  3IXR A;  4AJ6 A;  4L5L A;  1YDK A;  4JZQ A;  1M99 A;  4MPG A;  3HD5 A;  3HVV A;  5E59 A;  3TJB A;  1UN2 A;  4BA7 A;  2LJR A;  4IKH A;  3UEM A;  1K3O A;  5D8I A;  3BOA A;  2IL3 A;  5DQS A;  3RDW A;  2EC4 A;  2MMA A;  2R37 A;  4MLY A;  3H79 A;  2C80 A;  5B6N A;  3PIN A;  1FAA A;  3MNG A;  2VM1 A;  4KE3 A;  5IMD A;  4QL9 A;  1LBK A;  2E0Q A;  3NOF A;  4HZ4 A;  3H1N A;  3G7I A;  5ELG A;  2HSH A;  1MEK A;  2ON7 A;  4DSS A;  1T00 A;  4NPB A;  3D22 A;  2F9S A;  3TRQ A;  3IPZ A;  4PUF C;  4EO3 A;  2H1A A;  2H19 A;  2RM6 A;  3E3E A;  3UL3 A;  4O7H A;  1PKZ A;  4ULX A;  3FKF A;  5LD0 A;  3ME8 A;  3Q6O A;  3GKM A;  4ML1 A;  4HQZ A;  4GQF A;  4TR4 A;  2JZS A;  3TJJ A;  3U5R E;  4L5O A;  3Q19 A;  3RHC A;  2XBQ A;  1GWC A;  1MD3 A;  4MJA A;  5ID2 A;  4D73 A;  5HR2 A;  2HXK A;  1OKT A;  3EMX A;  4X0X A;  1YZX A;  3BCK A;  3IC8 A;  3LXT A;  1IYH A;  4N30 A;  2GTU A;  1KTE A;  2F3M A;  4GWR A;  2VCZ A;  1GSF A;  3LYK A;  5KEJ A;  4PUR A;  2EIR A;  1PX6 A;  3M3M A;  4ZIJ A;  3VWW A;  3UJ1 A;  3D6I A;  2O89 A;  4PXO A;  3DYR A;  2K9F A;  3FHK A;  3GUS A;  2MMO A;  4XS4 A;  3HY2 A;  3GYK A;  5F0G A;  4DVC A;  5JWQ B;  5KN1 A;  4BVX B;  1MTC A;  5IPG A;  4NWY A;  1M2B A;  1FW1 A;  4N10 A;  2C4J A;  1DE2 A;  2VUP A;  2HSM A;  3GMF A;  1X9S B;  2XC2 A;  2HZE B;  2RLI A;  4TKY A;  1IYI A;  1U3I A;  4F82 A;  5GAN D;  3I9V 2;  5BMU A;  2QSI A;  1M0U A;  5JCW A;  4EE0 A;  5A5K A;  4RUV A;  5G30 A;  2YWN A;  3QOU A;  2HI7 A;  4RQR A;  2B6M A;  2TRX A;  2H6X A;  3M8N A;  4TW5 A;  2V2G A;  1HNA A;  5ELA A;  2A4V A;  2JZT A;  2GS3 A;  2C3Q A;  3F63 A;  2IPA A;  3TRP A;  3CMI A;  1G7E A;  2LEG A;  1K3Y A;  3VWU A;  1TTZ A;  4AF2 A;  4EDY A;  4YQU A;  4MP4 A;  2XHF A;  2OAC A;  3FY7 A;  5ECP B;  2H6Z A;  2GZZ A;  1J9B A;  2FWE A;  4BL7 A;  3NIV A;  4HZ2 A;  1PL1 A;  2OJL A;  3LGC A;  4XS6 A;  2YPM A;  3ZRE A;  2RUE A;  3L9V A;  3KD0 A;  5DAK B;  3ZVJ D;  3ED3 A;  1XVQ A;  1HD2 A;  1ST9 A;  4LLR A;  1HNC A;  1JLW A;  1TK5 B;  2R4V A;  5HFG A;  5DAL B;  1A0F A;  1Y25 A;  3D21 A;  1X5D A;  2IMD A;  2X8G A;  4NV5 A;  3LOR A;  2D2Z A;  2VLV A;  4GSS A;  3KEB A;  3LXZ A;  3GX8 A;  4XHM A;  3VK9 A;  2ZUP A;  5B8A A;  3BD2 A;  4G10 A;  2CT6 A;  3QPM A;  3IV4 A;  1SK1 A;  4EVM A;  3ZML A;  3HJM A;  4X43 A;  3GH9 A;  2GSR A;  4MF5 A;  4EF0 A;  1VF4 A;  2OAD A;  5ECQ B;  2H1G A;  2DJ0 A;  4POM A;  3GL3 A;  2VM2 A;  4IP1 A;  11GS A;  1LJR A;  2H74 A;  2HRK A;  1SD9 A;  3HZ4 A;  3QAG A;  4K7O A;  4MPF A;  2CVK A;  2XPE A;  5IOW A;  4GRF A;  10GS A;  4PNF A;  1ZYQ B;  6GSX A;  3UVT A;  2GSQ A;  1FG4 A;  3R3E A;  2L6D A;  2ES7 A;  2LQQ A;  3FR6 A;  4ISD A;  1I9D A;  2H8L A;  1XCC A;  3UBK A;  2HSY A;  1THX A;  4ILF A;  4N11 A;  4K2D A;  3HCZ A;  3CSJ A;  5KN2 A;  2DC5 A;  1GL8 A;  4MMM A;  1KEB A;  3I69 A;  4JRR A;  1G6Y A;  1ACV A;  1QFN A;  3I43 A;  1K0D A;  2NTO A;  1XW9 A;  1SJI A;  3C1S A;  4N0Z A;  3TDG A;  2RM5 A;  2B3S A;  2P31 A;  2IN3 A;  2RII A;  1T7P B;  4POK A;  1G7O A;  4L0U A;  3GUR A;  5J4U A;  1GH2 A;  2PGT A;  1T3B A;  1XIY A;  1FB6 A;  1XWA A;  2H30 A;  1EOG A;  3HVS A;  4I97 A;  2GLR A;  1WRY A;  1XWB A;  3TOT A;  2CVD A;  4TXV A;  4NAX A;  1RQM A;  2HLS A;  3GIX A;  4POB A;  1ZOF A;  4WF4 A;  3TCO A;  5D96 A;  1GSS A;  1ZGN A;  1YF1 A;  5G5E A;  2LRT A;  3GL5 A;  1F3B A;  2AAW A;  2YJH A;  2B7K A;  4X1U A;  4MA9 A;  4GF0 A;  2IJY A;  2LUS A;  1BQ7 A;  2E7P A;  2TRC P;  1YKA A;  1NM3 A;  1TDI A;  2L59 A;  1JLV A;  5G1L A;  5INY A;  4MJE A;  5CP1 A;  3VI5 A;  2C0F A;  1GNE A;  2JSZ A;  1K0B A;  12GS A;  4KAE A;  1O8X A;  1MDJ A;  1B4P A;  4ZBA A;  2C1Y A;  5H5R A;  4TVE A;  4CHS A;  2B5E A;  4TXO A;  5KN0 A;  5HFK A;  1ABA A;  5F05 A;  3BCI A;  4DSQ A;  4KDU A;  4I6X A;  2C0D A;  3UAR A;  3KXO A;  1R7H A;  4RI7 A;  2FUG 2;  3EUR A;  4Z7X A;  1USB A;  3ZIV A;  2JSY A;  3TKS C;  2CA8 A;  3UAP A;  3WD6 A;  1N2A A;  2LKU A;  2X99 A;  5H5S A;  2NVL A;  1V57 A;  3QMX A;  2R3X A;  1U6T A;  3J7Y k;  1EWX A;  1A2J A;  3A3T A;  2P5Q A;  4IQA A;  1GSU A;  1JHB A;  5A4U A;  4V1A g;  3ZZX A;  4G0I A;  3LG6 A;  2H0H A;  1SYR A;  1T8E B;  3IA1 A;  3US3 A;  1AQX A;  1K0M A;  1LU4 A;  4BVX A;  4PNG A;  1BAY A;  4LMV A;  1AUC A;  4JR4 A;  1TXX A;  4G0L A;  2PUK C;  4MDC A;  2HZE A;  4TR0 A;  4OO4 A;  2DLX A;  1QUW A;  1OE7 A;  3TKS A;  3FR3 A;  2L4C A;  2WJU A;  3SBC A;  1EV4 A;  2LJA A;  2GZP A;  1DE1 A;  1Z6M A;  4O92 A;  3TKR A;  4HJ2 A;  4V1A p;  4MJC A;  3TKQ A;  1F37 A;  5IMV A;  3ZFL A;  1J0F A;  1GSE A;  2O85 A;  4J57 E;  2A2S A;  5HQP A;  3W6G A;  3QAW A;  3FYG A;  4WEY A;  4XS1 A;  2OE1 A;  4LA1 A;  3HHV A;  3WGE A;  4PQI A;  6GSS A;  2YWM A;  3IE3 A;  5B8B A;  1PGT A;  3L9S A;  2C3T A;  1Z5Y E;  4MH2 A;  5DAK A;  2YV7 A;  1X9W B;  1Z9H A;  2CQ9 A;  4PX1 A;  1J08 A;  3HDC A;  1BX9 A;  1K0A A;  1GTB A;  3KCM A;  4ZL9 A;  3IOS A;  2YWI A;  4WR4 A;  14GS A;  4PQ1 A;  1XZO A;  5DAL A;  4AGS A;  3GA4 A;  1GUK A;  3VUR A;  3Q74 A;  4EDZ A;  3KGK A;  1GSQ A;  3C8E A;  5J9B A;  1ZMA A;  1BG5 A;  3E0U A;  3ME7 A;  1SJZ A;  3HVX A;  3W8J A;  3QDN A;  3HXS A;  3P90 A;  3WYW A;  4MAB A;  5FWG A;  3KH7 A;  1G6W A;  2VCQ A;  4BVY B;  2VD0 A;  3DXB A;  4USS A;  3D5J A;  3L4N A;  1V9W A;  22GS A;  2N5F A;  3G7Y A;  2L4Q A;  2PU9 C;  4IVF A;  3QAV A;  3O6T A;  3PPU A;  4HDE A;  3M0F A;  4YAV A;  1YQ1 A;  2DIZ A;  2O7K A;  4HJM A;  5J41 A;  2VL9 A;  3GX0 A;  2H70 A;  4TR3 A;  4ZBB A;  5D9W A;  2BMX A;  4TXO B;  1RK4 A;  5GSS A;  3F4S A;  5J5N A;  2RUF A;  2YJ7 A;  4TRX A;  2JAD A;  1R4W A;  3TKS E;  1Z6N A;  3G7J A;  1FVK A;  4FH8 A;  4TOP A;  4KA0 A;  2L5O A;  4Q5R A;  4FYU A;  2ON5 A;  2DJ1 A;  4F0B A;  4JE1 A;  1G0T A;  2C3N A;  1EP8 A;  2MYG A;  1EZK A;  2GVP A;  4F2I A;  5ECS A;  3UIW A;  1A8L A;  4NHZ A;  1NHY A;  1R5A A;  1QQ2 A;  4KGI A;  2K6V A;  4ZL7 A;  2VIM A;  4MH3 A;  16GS A;  1A0R P;  3S9F A;  2VCT A;  1OC3 A;  4ECJ A;  3PR8 A;  4ZBD A;  4IHU A;  4XIH A;  1AAZ A;  1FVJ A;  5D93 A;  3L9U A;  2H1D A;  1YEX A;  5D9X A;  2H66 A;  1YKC A;  2IMK A;  2IMI A;  1WMJ A;  3VLN A;  2VCW A;  3ERG A;  2H01 A;  3V1W A;  3IR4 A;  1R26 A;  1AIU A;  1X0R A;  1B48 A;  3GKN A;  2MBT A;  4NXI A;  2WS2 A;  2B5X A;  2AHE A;  3WGX A;  5AGY A;  2I81 A;  3CRU A;  2HSN B;  1TU8 A;  3GH6 A;  2OBI A;  3HJO A;  2I4A A;  3MAK A;  5IQY A;  3EWL A;  4K7N A;  3O3T A;  4YAP A;  5LNK e;  2M72 A;  3P2A A;  2YV9 A;  1VF2 A;  1YJ6 A;  2CZ3 A;  5AIV A;  1TRW A;  3F6F A;  3D0Z A;  1OKD A;  3DRN A;  2E2G A;  2F8F A;  1QMV A;  1OYJ A;  2DSA A;  2J23 A;  5L71 A;  3ZMK A;  1C72 A;  3GV1 A;  2AB6 A;  1XOA A;  3H93 A;  1V58 A;  4MZC A;  2FWH A;  2OE0 A;  2I3Y A;  4OCF A;  4ID0 A;  1Q4J A;  2VLU A;  2AUV A;  2HE3 A;  3A2X A;  4J56 E;  3ZLP A;  3IHQ A;  3I6A A;  3IRA A;  1O6J A;  3EU3 A;  4G19 A;  3WGD A;  3IBH A;  5IMA A;  1O81 A;  3EU4 A;  3P8W A;  2NBS A;  2YP6 A;  2LNS A;  3NZN A;  4G0K A;  5EPF A;  4YH2 A;  2F8A A;  4KW6 A;  1HYU A;  1BJX A;  2PBJ A;  1H75 A;  3FK8 A;  4EXJ A;  1XWG A;  3DIE A;  4WF5 A;  5E4W A;  3C73 A;  5IM9 A;  3AY8 A;  4HEA 2;  1A8Y A;  3RAZ A;  5D73 A;  3ZVJ A;  1JZR A;  4IN0 A;  3VWV A;  4FYC A;  3EVI A;  1AQW A;  5EY6 A;  5HFI A;  1GUL A;  2O87 A;  2PVO C;  2JU5 A;  4FQU A;  19GS A;  2JL4 A;  2GT6 A;  2WCI A;  1PA3 A;  1T4Y A;  4I5Q A;  4BWQ A;  3APO A;  2H76 A;  3UOM A;  1AC1 A;  2H1B A;  3L78 A;  1F6M C;  1Z7P A;  4Q5F A;  1SKS B;  4E8H A;  4EKZ A;  2HYX A;  1EEM A;  2FA8 A;  1X5C A;  2M46 A;  1JZD A;  1XPV A;  3IK9 A;  2I9H A;  2P5R A;  4N0V A;  2YNX A;  4NHW A;  2NPB A;  5D9T A;  2UZ8 A;  2LS5 A;  5DQY A;  1E6B A;  1MD4 A;  5G31 A;  4GXZ A;  1TOF A;  4V2N A;  1SKW B;  4BVY A;  4O5R A;  3KM6 A;  3TRX A;  2YAN A;  2DML A;  4GST A;  1GUM A;  3LSZ A;  5IOX A;  4F9Z A;  3M1G A;  5FHI A;  2V6K A;  1B8X A;  2L5L A;  4IQ1 A;  4ZL8 A;  5CYY A;  3MSZ A;  4WXT A;  3EMP A;  4L0W A;  1HNB A;  2WDU A;  1AW9 A;  2PMT A;  3F6D A;  2LRC A;  2WZ9 A;  1O7U A;  4EL1 A;  3DVW A;  5COH A;  5ECR B;  2VLT A;  5LCZ A;  5EL8 A;  2O8V B;  2FHE A;  2WB9 A;  2VO4 A;  4IW9 A;  3DGQ A;  2LJK A;  1GSY A;  2AV4 A;  17GS A;  5CRW A;  2PVQ A;  1OC9 B;  4Q5N A;  2H0I A;  3DD3 A;  2ALB A;  4CW9 A;  3IAS 2;  3KP9 A;  4F03 A;  4XRD A;  1XBS A;  3N5O A;  1V98 A;  3TOU A;  1PQN A;  1SU9 A;  2G2Q A;  2IME A;  3DWV A;  1SD8 A;  3TB2 A;  2K18 A;  4GQC A;  1GP1 A;  1O8W A;  4MCU A;  3GST A;  3ZL5 A;  3CBU A;  3L0H A;  1ILO A;  4XTS A;  1SL0 B;  1V40 A;  1PX7 A;  1CQG A;  2B5Y A;  1X5E A;  1O85 A;  4ZXG A;  3BBY A;  3TGZ A;  5ECK B;  4WBJ A;  1Z7R A;  1W89 A;  1FHE A;  2G0F A;  2A2R A;  2KP1 A;  3C71 A;  3F3R A;  1GNW A;  3ZIT A;  1V2A A;  4MK3 A;  1Q98 A;  5HR0 A;  1XVW A;  3K8N A;  1KNG A;  2H75 A;  3JCM L;  1QXH A;  2WRT A;  4DEJ A;  3LQ7 A;  3LWA A;  1DBY A;  2LV3 A;  3H8Q A;  5B6M A;  3GFK A;  4K0N A;  3ERF A;  3VFI A;  3UMA A;  1PRX A;  2H71 A;  4HOJ A;  2GSS A;  1U88 A;  3DEX A;  6GSW A;  2DMM A;  2C8U A;  3G9B A;  2IIY A;  5DJL A;  4JR6 A;  4WR5 A;  2R6K A;  1A2L A;  1SK0 A;  4IP6 A;  4FIW A;  2VOC A;  4KSO A;  2LRN A;  2KHP A;  4POL A;  3APS A;  4WKW A;  5F07 A;  4KX4 A;  4H86 A;  4MZB A;  4PQH A;  4JED A;  2GQL A;  5DCG A;  3F4R A;  4DSR A;  3KTL A;  3ZFB A;  5DCH A;  5A4V A;  2K8V A;  2H0G A;  3CYN A;  2J9H A;  3CTF A;  4IJ3 A;  4JBB A;  1X9M B;  3OR5 A;  4KCA A;  1JZW A;  1ZL9 A;  2FD3 A;  4QL7 A;  4PTS A;  7GSS A;  3ZRD A;  3C7M A;  1TI3 A;  2REM A;  3FZ4 A;  1NSW A;  4V2M A;  3HKR A;  5IIZ A;  3HJP A;  2VCV A;  1F9M A;  1FB0 A;  1UVZ A;  2YWO A;  3A2V A;  1GTI A;  2DJK A;  1YY7 A;  1O73 A;  2V32 A;  1A2M A;  3HYP A;  4TR1 B;  3D4M A;  2HRN A;  3ISO A;  5ECI B;  1NW2 A;  2VAF A;  2ZNM A;  2GZY A;  4KCE A;  4G2E A;  3GTU A;  4ZB6 A;  2R2J A;  2BJX A;  1PL2 A;  4KND A;  2B1K A;  2PER A;  5IPH A;  1TK0 B;  3R2Q A;  4ECC A;  4ML6 A;  1I5G A;  1N8J A;  4WET A;  2HQT A;  5CAX A;  3A2W A;  3GKK A;  3CSH A;  3GHA A;  2IFQ A;  2LQO A;  4K6X A;  1SYX A;  4JU5 A;  1TRU A;  5ECL B;  1VF1 A;  1K3L A;  1K0N A;  1UA5 A;  2WUL A;  3QFA C;  3QCP A;  4Q5Q A;  4IS0 A;  3QR6 A;  1ERU A;  4EUY A;  3E9J B;  1QK8 A;  2MZC A;  1ZCP A;  4KUN A;  5JWR B;  2XBI A;  3CXG A;  3M9J A;  2JZR A;  3H4K A;  3FZ9 A;  5CO3 A;  1GRX A;  2V41 A;  1TRS A;  2CAQ A;  2DJJ A;  5EVO A;  5ECM B;  2HRF A;  1B4Q A;  2PN8 A;  4LMW A;  3FR9 A;  3RHB A;  1TU7 A;  2NDO A;  1GSD A;  2CAI A;  5GZZ B;  1R5P A;  3VI7 A;  1WPI A;  2HT9 A;  3MWH A;  4XCS A;  2FNO A;  2XPD A;  2VL3 A;  4MZW A;  2KP2 A;  1TK8 B;  1EEJ A;  3EE2 A;  4ZB8 A;  2B1L A;  4XRA A;  1GTA A;  3VWX A;  2HNL A;  3IDV A;  1GUH A;  5JCU A;  1M2D A;  2IWT A;  2L57 A;  1VRS D;  5C00 A;  5DBQ A;  3FRC A;  2CX3 A;  3LEF A;  3PGT A;  1M9B A;  3GSS A;  2F51 A;  4OFN A;  3N9J A;  1WE0 A;  4YQV A;  3FEU A;  1CQH A;  2FWF A;  3TJK A;  3TKP A;  1S3A A;  3KP8 A;  3J7Y b;  2H72 A;  1SL2 B;  2BTO T;  1WWJ A;  3QD9 A;  4ZIL A;  5J3R A;  1RW1 A;  1EV9 A;  5IMF A;  6GSU A;  3FW2 A;  1ZYE A;  2DIY A;  1KBN A;  1M7T A;  4HQS A;  1OC9 A;  3F4T A;  1MDI A;  1PD2 1;  1PSQ A;  4V2L A;  3CTG A;  2FGX A;  5JCG A;  5IMZ A;  2VL2 C;  4K8M A;  3UBL A;  4LL4 B;  9GSS A;  3KTB A;  3RPN A;  4RQX A;  2HFD A;  2ZCT A;  4KB3 A;  3F3Q A;  2MBS A;  2FY6 A;  1EGR A;  1PKW A;  2CX4 A;  4HI7 A;  1ERV A;  5CNW A;  1GLP A;  1GLQ A;  5CRH A;  3LJR A;  2FWG A;  4J2F A;  1WIK A;  4GSN A;  1Y6E A;  4ACS A;  1WJK A;  3QFB C;  4GTU A;  4I2T A;  4ZB9 A;  1VGL A;  5HR3 A;  2VCX A;  1XOB A;  1YF0 A;  3PH9 A;  1WOU A;  4P3Y B;  2LTK A;  2OBK A;  6GSV A;  2X64 A;  4L8E A;  1XXU A;  1URM A;  4GCI A;  1AXD A;  3P7X A;  2YZH A;  6GSY A;  2K8S A;  3F0I A;  4K0G A;  1K0C A;  1JZO A;  3KMN A;  1F2E A;  2E2M A;  3GTU B;  4DSS B;  3KJY A;  1ZZY A;  8GSS A;  3W8S A;  2N5A A;  2DJ3 A;  1ON4 A;  2OE3 A;  1FOV A;  3EIN A;  5AIS A;  1AQV A;  1EP7 A;  4PUA A;  1PMT A;  1A23 A;  2M80 A;  2VL2 A;  3ZYW A;  2QKE A;  2IFQ B;  5ECH B;  3APQ A;  3GRX A;  5J9C A;  3ZTL A;  1TJD A;  2GQK A;  1GTU A;  1E2Y A;  3HZ8 A;  18GS A;  2GT5 A;  3KZQ A;  5ID2 B;  4NV2 A;  5AN1 A;  3ZIJ A;  4D73 B;  2C0E A;  4YQM A;  1TI1 A;  2OKA A;  2KUC A;  5IO2 A;  4FYB A;  5GAP D;  3GKX A;  3DKS A;  1SK2 A;  1K0O A;  4AJ7 A;  4KF9 A;  1TW9 A;  4LL1 B;  1MDK A;  2VD1 A;  4MF7 A; 
#chains in the Genus database with same CATH topology
 4I8B A;  2X8C A;  20GS A;  3C1R A;  1YEW C;  1ERT A;  2X49 A;  1ZYP A;  4K9Z A;  2IMF A;  1I1I P;  4OWY A;  1SL1 B;  3FZA A;  4XS4 B;  3LFL A;  3LYP A;  2AYT A;  2B7J A;  3TUE A;  3RPP A;  5KN3 A;  5G1K A;  4IJI A;  4OFM A;  1UC7 A;  2GQM A;  3BJ5 A;  2LST A;  4NMU A;  1SEN A;  2CVB A;  13GS A;  2WZS A;  1T4Z A;  2HSM B;  2LNT A;  1THO A;  5CRG A;  5HR1 A;  4OD7 A;  1NHO A;  4AJ8 A;  5G2Z A;  1W4V A;  2GST A;  1SKR B;  5ENU A;  3GNJ A;  2I1U A;  5BMU B;  1OAZ A;  2YZU A;  1A24 A;  2QC7 A;  4TR1 A;  5GST A;  2QGV A;  2FLS A;  4AKI A;  5DVB A;  4HU7 A;  1S3C A;  1OE8 A;  3VPQ A;  2C0G A;  5DDL A;  4WBR D;  1YEP A;  4IGJ A;  1PN9 A;  5FT3 A;  2HZF A;  3EYT A;  1F3A A;  2JAC A;  1M2A A;  4PI2 C;  4OCE A;  3M9K A;  5CRD A;  5ABR A;  1XW5 A;  3DVX A;  3IAM 2;  4G9H A;  1BYE A;  2KLX A;  4BL7 B;  1OVN A;  4K7I A;  2AJQ B;  4FXY P;  1BED A;  2MMZ A;  3MYD A;  4F0C A;  2V1M A;  4HS1 A;  5J47 A;  4OO5 A;  2O36 A;  1ZYN A;  2N5B A;  2FCH A;  2PPT A;  2CZ2 A;  3EC3 A;  2X8H A;  4BPY A;  3KH9 A;  2PWJ A;  5G5F A;  3F9U A;  1XW6 A;  1WP0 A;  3O76 A;  1TRV A;  4YKG A;  4HU9 A;  2YOI A;  5J4Y A;  3D4T A;  1OC8 A;  3IC4 A;  1VF3 A;  4K5S A;  4PGT A;  5ECN B;  3UVH A;  3IK7 A;  5B7C A;  2YCD A;  4MJB A;  4QQ7 A;  1B9X C;  4GLT A;  4KDY A;  5ECO B;  1PFO A;  4OMV A;  5DJM A;  5IMC A;  2TIR A;  4IEL A;  2P0G A;  3MIX A;  1XWK A;  1TP9 A;  3CSI A;  1U3A A;  4EC0 A;  3RBT A;  2FA4 A;  2HRA A;  4E8E A;  3ERW A;  2GGT A;  2WW2 A;  3WT1 A;  3HA9 A;  3RFR C;  4CDO A;  2H1L A;  3SWL A;  4ECB A;  2Z9S A;  2L6C A;  1H4O A;  5F06 A;  3KMO A;  3WT2 A;  6GST A;  2HRK B;  4TN8 A;  2CV4 A;  2EIO A;  3CRT A;  4FO5 A;  3U6V A;  1JFU A;  5CRE A;  4RI6 A;  1M9A A;  2DBC A;  1ERW A;  2V6O A;  4I2U A;  2EIQ A;  1HQO A;  2YN1 A;  4HUA A;  1B9Y C;  1BG1 A;  5IO0 A;  1DSB A;  2GDR A;  1FO5 A;  4OFT A;  5C04 A;  4MF6 A;  4ECI A;  2WFC A;  3TJF A;  2DJ2 A;  2OA7 A;  4KH7 A;  4AKH A;  5H5Q A;  4K1F A;  4IBP A;  3FZ5 A;  3KIJ A;  4KSM A;  5D9V A;  1DUG A;  1EGO A;  1U87 A;  2MMN A;  2WGR A;  1ML6 A;  1T1V A;  1TKD B;  2KOK A;  3Q18 A;  5F8B A;  2H73 A;  4KDX A;  1XFL A;  3VPT A;  2H6Y A;  3GN3 A;  3MDK A;  1QGV A;  1XWC A;  3F8U A;  1SJ6 A;  4BWS A;  5JWO B;  5AIX A;  1Z3E A;  2R5G A;  4O32 A;  3A5W A;  1S3D A;  1EOH A;  3TJG A;  3DML A;  5A4W A;  3IXR A;  4AJ6 A;  4L5L A;  1YDK A;  4JZQ A;  1M99 A;  4MPG A;  3HD5 A;  3HVV A;  5E59 A;  3TJB A;  1UN2 A;  4BA7 A;  2LJR A;  3HMJ G;  4IKH A;  3UEM A;  1K3O A;  5D8I A;  3BOA A;  2IL3 A;  5DQS A;  3RDW A;  2EC4 A;  2MMA A;  2R37 A;  4MLY A;  3H79 A;  2C80 A;  5B6N A;  3PIN A;  1FAA A;  3MNG A;  2VM1 A;  4KE3 A;  3HVN A;  5IMD A;  4QL9 A;  1LBK A;  2E0Q A;  3NOF A;  4HZ4 A;  3H1N A;  5J4V A;  3G7I A;  5ELG A;  2HSH A;  1MEK A;  2ON7 A;  4DSS A;  1T00 A;  4NPB A;  3D22 A;  2F9S A;  4A5P A;  3TRQ A;  3IPZ A;  4PUF C;  4EO3 A;  2H1A A;  2H19 A;  2RM6 A;  3E3E A;  3UL3 A;  4O7H A;  1PKZ A;  4ULX A;  3FKF A;  5LD0 A;  3ME8 A;  3Q6O A;  3GKM A;  4ML1 A;  4HQZ A;  4GQF A;  4TR4 A;  2JZS A;  3TJJ A;  3U5R E;  4L5O A;  3Q19 A;  3RHC A;  2XBQ A;  1GWC A;  1MD3 A;  4MJA A;  5ID2 A;  4D73 A;  5HR2 A;  2HXK A;  1OKT A;  3EMX A;  4X0X A;  1YZX A;  3BCK A;  3IC8 A;  3LXT A;  1IYH A;  4N30 A;  2GTU A;  1KTE A;  2F3M A;  4GWR A;  2VCZ A;  1GSF A;  4K2X A;  3LYK A;  5KEJ A;  4PUR A;  2EIR A;  1PX6 A;  2QA2 A;  3M3M A;  4ZIJ A;  3VWW A;  3UJ1 A;  3D6I A;  2O89 A;  4PXO A;  3DYR A;  2K9F A;  3FHK A;  3GUS A;  2MMO A;  4XS4 A;  3HY2 A;  3GYK A;  5F0G A;  4DVC A;  5JWQ B;  5KN1 A;  4BVX B;  1MTC A;  5IPG A;  4NWY A;  1M2B A;  1FW1 A;  4N10 A;  2C4J A;  1DE2 A;  2VUP A;  2HSM A;  3GMF A;  1X9S B;  2XC2 A;  2HZE B;  2DKI A;  2RLI A;  4TKY A;  1IYI A;  1U3I A;  4F82 A;  5GAN D;  3I9V 2;  5BMU A;  2QSI A;  1M0U A;  5JCW A;  4EE0 A;  5A5K A;  5A1N B;  4RUV A;  5G30 A;  2YWN A;  3QOU A;  2HI7 A;  4RQR A;  2B6M A;  2TRX A;  2H6X A;  3M8N A;  4TW5 A;  2V2G A;  1HNA A;  5ELA A;  2A4V A;  2JZT A;  2GS3 A;  2C3Q A;  3F63 A;  2IPA A;  3TRP A;  3CMI A;  1G7E A;  2LEG A;  1K3Y A;  3VWU A;  1TTZ A;  4AF2 A;  4PI0 C;  4EDY A;  4YQU A;  4MP4 A;  2XHF A;  2OAC A;  3FY7 A;  5ECP B;  2H6Z A;  2GZZ A;  1J9B A;  2FWE A;  4BL7 A;  3NIV A;  4HZ2 A;  1PL1 A;  2OJL A;  1FOH A;  3LGC A;  4XS6 A;  2YPM A;  3ZRE A;  2RUE A;  3L9V A;  3KD0 A;  5DAK B;  3ZVJ D;  3ED3 A;  1XVQ A;  4ZB7 A;  1HD2 A;  1ST9 A;  4LLR A;  1HNC A;  1JLW A;  1TK5 B;  2R4V A;  5HFG A;  5DAL B;  1A0F A;  1Y25 A;  2DKH A;  3D21 A;  1X5D A;  2IMD A;  2X8G A;  4NV5 A;  3LOR A;  2D2Z A;  2VLV A;  4GSS A;  3KEB A;  3LXZ A;  3GX8 A;  4XHM A;  3VK9 A;  4Z2R A;  2ZUP A;  2O5V A;  5B8A A;  3BD2 A;  4G10 A;  2CT6 A;  3QPM A;  3IV4 A;  1SK1 A;  4EVM A;  3ZML A;  3HJM A;  4X43 A;  3GH9 A;  2GSR A;  4MF5 A;  4EF0 A;  1VF4 A;  2OAD A;  5ECQ B;  2H1G A;  2DJ0 A;  4POM A;  3GL3 A;  2VM2 A;  4IP1 A;  11GS A;  1LJR A;  2H74 A;  2HRK A;  1SD9 A;  3HZ4 A;  3QAG A;  4HSC X;  4K7O A;  4MPF A;  2CVK A;  2XPE A;  5IOW A;  4GRF A;  10GS A;  4PNF A;  1ZYQ B;  6GSX A;  3UVT A;  3EPT A;  2GSQ A;  4X4J A;  1FG4 A;  3R3E A;  2L6D A;  2ES7 A;  3FMW A;  2LQQ A;  3FR6 A;  4ISD A;  1I9D A;  2H8L A;  1XCC A;  3UBK A;  2HSY A;  2WVX B;  1THX A;  4ILF A;  4N11 A;  4K2D A;  3HCZ A;  3CSJ A;  5KN2 A;  2DC5 A;  1GL8 A;  4MMM A;  1SVL A;  1KEB A;  3I69 A;  4JRR A;  1G6Y A;  1ACV A;  1QFN A;  3I43 A;  1K0D A;  2NTO A;  1XW9 A;  1SJI A;  3C1S A;  4N0Z A;  3TDG A;  2RM5 A;  2B3S A;  4AKX B;  2P31 A;  2IN3 A;  2RII A;  1T7P B;  4POK A;  2EFE A;  1G7O A;  4L0U A;  3GUR A;  5J4U A;  1GH2 A;  2PGT A;  1T3B A;  1XIY A;  1FB6 A;  1XWA A;  2H30 A;  1EOG A;  3HVS A;  4I97 A;  2GLR A;  1WRY A;  3TU3 B;  1XWB A;  3TOT A;  2CVD A;  4TXV A;  4NAX A;  1RQM A;  2HLS A;  3GIX A;  4POB A;  1ZOF A;  4WF4 A;  3TCO A;  5D96 A;  1GSS A;  1ZGN A;  1YF1 A;  5G5E A;  2LRT A;  3GL5 A;  1F3B A;  2AAW A;  2YJH A;  2B7K A;  4X1U A;  4MA9 A;  4GF0 A;  2IJY A;  2LUS A;  1BQ7 A;  2E7P A;  2TRC P;  1YKA A;  1NM3 A;  1TDI A;  2L59 A;  1JLV A;  5G1L A;  5INY A;  4MJE A;  5CP1 A;  3VI5 A;  2C0F A;  1GNE A;  2JSZ A;  1K0B A;  12GS A;  4KAE A;  1O8X A;  1MDJ A;  1B4P A;  4ZBA A;  1M3J A;  2C1Y A;  5H5R A;  4TVE A;  4CHS A;  2B5E A;  4TXO A;  5KN0 A;  5HFK A;  1ABA A;  5F05 A;  3BCI A;  4DSQ A;  4KDU A;  4I6X A;  2C0D A;  3UAR A;  3KXO A;  1R7H A;  4RI7 A;  2FUG 2;  3EUR A;  4Z7X A;  1USB A;  3ZIV A;  4K5R A;  2JSY A;  3TKS C;  4EIP A;  4CY6 A;  2CA8 A;  3UAP A;  3WD6 A;  1N2A A;  2LKU A;  2X99 A;  5H5S A;  2NVL A;  1V57 A;  3QMX A;  2R3X A;  1U6T A;  3J7Y k;  1EWX A;  3RGB C;  1A2J A;  1SVO A;  3A3T A;  1SVM A;  2P5Q A;  4IQA A;  1GSU A;  1JHB A;  5A4U A;  4V1A g;  5J40 A;  3ZZX A;  4G0I A;  3LG6 A;  2H0H A;  1SYR A;  1T8E B;  3IA1 A;  3US3 A;  1AQX A;  1K0M A;  1LU4 A;  4BVX A;  4PNG A;  1BAY A;  4LMV A;  1AUC A;  4JR4 A;  1TXX A;  4G0L A;  2PUK C;  4MDC A;  2HZE A;  4TR0 A;  1Y1U A;  4OO4 A;  2DLX A;  1QUW A;  1OE7 A;  3TKS A;  3FR3 A;  2L4C A;  2WJU A;  3SBC A;  1EV4 A;  2LJA A;  5A1N A;  2GZP A;  2WVY A;  1DE1 A;  1Z6M A;  4O92 A;  3TKR A;  4HJ2 A;  4V1A p;  4MJC A;  3TKQ A;  1F37 A;  5IMV A;  3ZFL A;  1J0F A;  1GSE A;  2O85 A;  4QMK A;  4J57 E;  2A2S A;  5HQP A;  3W6G A;  3QAW A;  3FYG A;  4WEY A;  4XS1 A;  2OE1 A;  4LA1 A;  3HHV A;  3WGE A;  4PQI A;  6GSS A;  1BF5 A;  2YWM A;  3IE3 A;  5B8B A;  1PGT A;  3L9S A;  2C3T A;  1Z5Y E;  4MH2 A;  5DAK A;  2YV7 A;  1X9W B;  1Z9H A;  2CQ9 A;  4PX1 A;  1J08 A;  3HDC A;  1S3R A;  1BX9 A;  1K0A A;  1GTB A;  3KCM A;  4ZL9 A;  3IOS A;  2YWI A;  4WR4 A;  14GS A;  4PQ1 A;  1XZO A;  5DAL A;  4AGS A;  3GA4 A;  1GUK A;  3VUR A;  3Q74 A;  4EDZ A;  3KGK A;  3LW9 A;  1GSQ A;  3C8E A;  5J9B A;  1ZMA A;  1BG5 A;  3E0U A;  3ME7 A;  5KOW A;  1SJZ A;  3HVX A;  3W8J A;  3QDN A;  3HXS A;  3P90 A;  3WYW A;  4MAB A;  5FWG A;  3KH7 A;  1G6W A;  2VCQ A;  4BVY B;  2VD0 A;  3DXB A;  4USS A;  3D5J A;  3L4N A;  1V9W A;  22GS A;  2N5F A;  3G7Y A;  2L4Q A;  2PU9 C;  4IVF A;  3QAV A;  3O6T A;  3PPU A;  4HDE A;  3M0F A;  4YAV A;  1YQ1 A;  2DIZ A;  2O7K A;  4HJM A;  5J41 A;  2VL9 A;  3GX0 A;  2H70 A;  4TR3 A;  4ZBB A;  5D9W A;  2BMX A;  4TXO B;  1RK4 A;  5GSS A;  3F4S A;  5J5N A;  2RUF A;  2YJ7 A;  4TRX A;  2JAD A;  1R4W A;  2UV8 G;  3TKS E;  1Z6N A;  3G7J A;  1FVK A;  2WVX A;  4FH8 A;  4TOP A;  4KA0 A;  2L5O A;  4Q5R A;  4FYU A;  2ON5 A;  2DJ1 A;  4F0B A;  4BIK A;  4JE1 A;  1G0T A;  2C3N A;  1EP8 A;  2MYG A;  1EZK A;  2GVP A;  4F2I A;  5ECS A;  3UIW A;  1A8L A;  4NHZ A;  1NHY A;  1R5A A;  1QQ2 A;  1N25 A;  4KGI A;  2K6V A;  4ZL7 A;  2VIM A;  4MH3 A;  16GS A;  1A0R P;  3S9F A;  2VCT A;  1OC3 A;  4ECJ A;  3PR8 A;  4E68 A;  4ZBD A;  4IHU A;  4XIH A;  1AAZ A;  1FVJ A;  5D93 A;  3L9U A;  2H1D A;  1YEX A;  5D9X A;  1TXU A;  2H66 A;  1YKC A;  2IMK A;  2IMI A;  1WMJ A;  3VLN A;  2VCW A;  3ERG A;  2H01 A;  3V1W A;  3IR4 A;  1R26 A;  1AIU A;  1X0R A;  1B48 A;  4ICY A;  1PN0 A;  3GKN A;  2MBT A;  4NXI A;  2EFC A;  2WS2 A;  2B5X A;  2AHE A;  3WGX A;  5AGY A;  2I81 A;  3CRU A;  2HSN B;  1TU8 A;  3IHG A;  3GH6 A;  2OBI A;  3HJO A;  2I4A A;  3MAK A;  5IQY A;  3EWL A;  4K7N A;  3O3T A;  4YAP A;  5LNK e;  2M72 A;  2EFD A;  3P2A A;  2YV9 A;  1VF2 A;  1YJ6 A;  2CZ3 A;  5AIV A;  1TRW A;  3F6F A;  2R0P A;  3D0Z A;  1OKD A;  3DRN A;  2E2G A;  2F8F A;  1QMV A;  1OYJ A;  2DSA A;  2J23 A;  5L71 A;  3ZMK A;  1C72 A;  3GV1 A;  2AB6 A;  1XOA A;  3H93 A;  1V58 A;  4MZC A;  2FWH A;  2OE0 A;  2I3Y A;  4OCF A;  4ID0 A;  1Q4J A;  2VLU A;  2AUV A;  2HE3 A;  3CWG A;  3A2X A;  4J56 E;  3ZLP A;  3IHQ A;  3I6A A;  3IRA A;  1O6J A;  3EU3 A;  4G19 A;  3WGD A;  3IBH A;  5IMA A;  1XG8 A;  1O81 A;  3EU4 A;  3P8W A;  2NBS A;  2X4A A;  2YP6 A;  2LNS A;  3NZN A;  4G0K A;  5EPF A;  4YH2 A;  2F8A A;  4KW6 A;  1HYU A;  1BJX A;  2PBJ A;  1H75 A;  3FK8 A;  4EXJ A;  1XWG A;  2O3E A;  4N3Z A;  2EFH A;  3DIE A;  4WF5 A;  5E4W A;  3C73 A;  5IM9 A;  3AY8 A;  4HEA 2;  1A8Y A;  3RAZ A;  5D73 A;  3ZVJ A;  1JZR A;  4IN0 A;  3VWV A;  5A34 B;  4FYC A;  3EVI A;  1AQW A;  5EY6 A;  5HFI A;  1GUL A;  2O87 A;  2PVO C;  2JU5 A;  4FQU A;  19GS A;  2JL4 A;  2GT6 A;  2WCI A;  1PA3 A;  1T4Y A;  4I5Q A;  4BWQ A;  3APO A;  2H76 A;  3UOM A;  1AC1 A;  2H1B A;  2WW3 A;  3L78 A;  1F6M C;  1Z7P A;  4Q5F A;  1SKS B;  4E8H A;  4EKZ A;  4EIQ A;  2HYX A;  1EEM A;  2FA8 A;  1X5C A;  2M46 A;  1JZD A;  1XPV A;  3IK9 A;  2I9H A;  2P5R A;  4N0V A;  2QA1 A;  2YNX A;  4NHW A;  2NPB A;  5D9T A;  2UZ8 A;  2LS5 A;  5DQY A;  1E6B A;  1MD4 A;  5G31 A;  4GXZ A;  1TOF A;  4V2N A;  1SKW B;  4BVY A;  4O5R A;  5BRT A;  3KM6 A;  3TRX A;  2YAN A;  2DML A;  4GST A;  1GUM A;  3LSZ A;  5IOX A;  4F9Z A;  3M1G A;  5FHI A;  2V6K A;  1B8X A;  2L5L A;  3CQF A;  4IQ1 A;  4ZL8 A;  5CYY A;  3MSZ A;  4WXT A;  3EMP A;  4L0W A;  1HNB A;  2WDU A;  1AW9 A;  2PMT A;  3F6D A;  2LRC A;  2WZ9 A;  1O7U A;  4EL1 A;  3DVW A;  5COH A;  5ECR B;  2VLT A;  5LCZ A;  5EL8 A;  2O8V B;  2FHE A;  2WB9 A;  2VO4 A;  1YVL A;  5A5H B;  4IW9 A;  3DGQ A;  2LJK A;  1GSY A;  2AV4 A;  17GS A;  5CRW A;  2PVQ A;  1OC9 B;  4Q5N A;  2H0I A;  3DD3 A;  2ALB A;  4CW9 A;  3IAS 2;  3KP9 A;  4F03 A;  4XRD A;  1XBS A;  3N5O A;  1V98 A;  3TOU A;  1PQN A;  1SU9 A;  2G2Q A;  2A2P A;  2IME A;  3DWV A;  1SD8 A;  3TB2 A;  2K18 A;  4GQC A;  1GP1 A;  2R0G A;  1O8W A;  4MCU A;  3GST A;  3ZL5 A;  3CBU A;  3L0H A;  1ILO A;  4XTS A;  1SL0 B;  1V40 A;  1PX7 A;  1CQG A;  2B5Y A;  1X5E A;  1O85 A;  4ZXG A;  3BBY A;  3TGZ A;  5ECK B;  4WBJ A;  1Z7R A;  1W89 A;  1FHE A;  2G0F A;  2A2R A;  2KP1 A;  3C71 A;  3F3R A;  1GNW A;  3ZIT A;  1V2A A;  4MK3 A;  1Q98 A;  5HR0 A;  1XVW A;  3K8N A;  1KNG A;  2H75 A;  3JCM L;  1QXH A;  2WRT A;  4DEJ A;  3LQ7 A;  3LWA A;  1DBY A;  2LV3 A;  3H8Q A;  5B6M A;  3GFK A;  4K0N A;  3ERF A;  3VFI A;  3UMA A;  1PRX A;  2H71 A;  4HOJ A;  2GSS A;  1U88 A;  3DEX A;  6GSW A;  2DMM A;  2C8U A;  3G9B A;  2HSN A;  2IIY A;  5DJL A;  4JR6 A;  4WR5 A;  2R6K A;  1A2L A;  1SK0 A;  4IP6 A;  4FIW A;  2VOC A;  4KSO A;  2LRN A;  2KHP A;  4POL A;  3APS A;  4WKW A;  4Z2U A;  5F07 A;  4KX4 A;  4H86 A;  4MZB A;  4PQH A;  4JED A;  2GQL A;  5DCG A;  3F4R A;  4DSR A;  3KTL A;  3ZFB A;  5DCH A;  5A4V A;  2K8V A;  2H0G A;  3CYN A;  2J9H A;  3CTF A;  4IJ3 A;  4JBB A;  1X9M B;  3OR5 A;  2WVZ A;  4KCA A;  1JZW A;  1ZL9 A;  2FD3 A;  4QL7 A;  4PTS A;  7GSS A;  3ZRD A;  3C7M A;  1TI3 A;  2REM A;  3FZ4 A;  1NSW A;  4V2M A;  3HKR A;  5IIZ A;  3HJP A;  2VCV A;  1F9M A;  1FB0 A;  1UVZ A;  2YWO A;  3A2V A;  1GTI A;  2DJK A;  1YY7 A;  1O73 A;  2V32 A;  1A2M A;  3HYP A;  4TR1 B;  3D4M A;  2HRN A;  3ISO A;  5ECI B;  1NW2 A;  2VAF A;  2ZNM A;  2GZY A;  4KCE A;  4G2E A;  3GTU A;  4ZB6 A;  2R2J A;  2BJX A;  1PL2 A;  4KND A;  2B1K A;  2PER A;  5IPH A;  1TK0 B;  3R2Q A;  4ECC A;  4ML6 A;  3CHX C;  1I5G A;  1N8J A;  4WET A;  2HQT A;  5CAX A;  3A2W A;  3GKK A;  3CSH A;  5A34 A;  3GHA A;  2IFQ A;  2LQO A;  4K6X A;  1SYX A;  4JU5 A;  1TRU A;  5ECL B;  1VF1 A;  1K3L A;  1K0N A;  1UA5 A;  2WUL A;  3QFA C;  3QCP A;  4Q5Q A;  4IS0 A;  1S4B P;  3QR6 A;  4O5U A;  4GDF A;  1ERU A;  4EUY A;  3E9J B;  1QK8 A;  2MZC A;  1ZCP A;  4KUN A;  5JWR B;  2XBI A;  3CXG A;  3M9J A;  2JZR A;  3H4K A;  3FZ9 A;  5CO3 A;  1GRX A;  2V41 A;  1TRS A;  2CAQ A;  2DJJ A;  5EVO A;  5ECM B;  2HRF A;  2R0C A;  2WW0 A;  1B4Q A;  2PN8 A;  4LMW A;  3FR9 A;  3RHB A;  1TU7 A;  2NDO A;  1GSD A;  2CAI A;  5GZZ B;  4MNN A;  1R5P A;  3VI7 A;  1WPI A;  2HT9 A;  3MWH A;  4XCS A;  2FNO A;  2XPD A;  2VL3 A;  4MZW A;  2KP2 A;  1TK8 B;  1EEJ A;  3EE2 A;  4ZB8 A;  2B1L A;  4XRA A;  1GTA A;  2VKZ G;  3VWX A;  2HNL A;  3IDV A;  4YKF A;  1GUH A;  5JCU A;  1M2D A;  2IWT A;  2L57 A;  1VRS D;  5C00 A;  2A4H A;  5DBQ A;  3FRC A;  2CX3 A;  3LEF A;  3PGT A;  2OT3 A;  1M9B A;  3GSS A;  2F51 A;  4OFN A;  3N9J A;  1WE0 A;  4YQV A;  4CY8 A;  3FEU A;  1CQH A;  2FWF A;  4O5Q A;  3TJK A;  3TKP A;  1S3A A;  3KP8 A;  3J7Y b;  2H72 A;  1SL2 B;  2BTO T;  1WWJ A;  3QD9 A;  4ZIL A;  5J3R A;  1RW1 A;  1EV9 A;  5IMF A;  6GSU A;  5A5H A;  3FW2 A;  1ZYE A;  2DIY A;  1KBN A;  1M7T A;  4HQS A;  1OC9 A;  3F4T A;  1MDI A;  5KOX A;  1PD2 1;  1PSQ A;  4V2L A;  3CTG A;  2FGX A;  5JCG A;  5IMZ A;  2VL2 C;  4K8M A;  3UBL A;  4LL4 B;  9GSS A;  4AI6 A;  3KTB A;  3RPN A;  4RQX A;  2HFD A;  2ZCT A;  4KB3 A;  3F3Q A;  2MBS A;  2FY6 A;  1EGR A;  1PKW A;  2CX4 A;  4HI7 A;  1ERV A;  5CNW A;  1GLP A;  1GLQ A;  4PHZ C;  5CRH A;  3LJR A;  2FWG A;  4J2F A;  1WIK A;  4GSN A;  1Y6E A;  4ACS A;  1WJK A;  3QFB C;  4GTU A;  4I2T A;  4ZB9 A;  1VGL A;  5HR3 A;  2VCX A;  1XOB A;  1YF0 A;  3PH9 A;  1WOU A;  4P3Y B;  1M3I A;  2LTK A;  2OBK A;  4Z2T A;  6GSV A;  2X64 A;  4L8E A;  1XXU A;  1URM A;  4GCI A;  1AXD A;  3P7X A;  2YZH A;  6GSY A;  2K8S A;  3F0I A;  4W66 A;  4K0G A;  1K0C A;  1JZO A;  3KMN A;  1F2E A;  2E2M A;  3GTU B;  4DSS B;  3KJY A;  3A5I A;  1ZZY A;  2WW1 A;  8GSS A;  3W8S A;  2N5A A;  2DJ3 A;  1ON4 A;  2OE3 A;  1FOV A;  3EIN A;  5AIS A;  1AQV A;  1EP7 A;  4PUA A;  1PMT A;  1A23 A;  2M80 A;  2VL2 A;  3ZYW A;  2QKE A;  2IFQ B;  5ECH B;  3APQ A;  3GRX A;  5J9C A;  3ZTL A;  1TJD A;  2GQK A;  1GTU A;  1E2Y A;  3HZ8 A;  18GS A;  2GT5 A;  3KZQ A;  5ID2 B;  4NV2 A;  5AN1 A;  3ZIJ A;  4D73 B;  2C0E A;  4YQM A;  1TI1 A;  2OKA A;  2KUC A;  5IO2 A;  4FYB A;  5GAP D;  3GKX A;  3DKS A;  1SK2 A;  1K0O A;  4AKG A;  4AJ7 A;  4KF9 A;  1TW9 A;  4LL1 B;  4G01 A;  1MDK A;  2VD1 A;  4MF7 A; 
#chains in the Genus database with same CATH homology
 4I8B A;  2X8C A;  20GS A;  3C1R A;  1ERT A;  2X49 A;  1ZYP A;  4K9Z A;  2IMF A;  4OWY A;  1SL1 B;  3FZA A;  4XS4 B;  3LFL A;  3LYP A;  2AYT A;  2B7J A;  3TUE A;  3RPP A;  5KN3 A;  5G1K A;  4IJI A;  4OFM A;  1UC7 A;  2GQM A;  3BJ5 A;  2LST A;  4NMU A;  1SEN A;  2CVB A;  13GS A;  1T4Z A;  2HSM B;  2LNT A;  1THO A;  5CRG A;  5HR1 A;  4OD7 A;  1NHO A;  4AJ8 A;  5G2Z A;  1W4V A;  2GST A;  1SKR B;  5ENU A;  3GNJ A;  2I1U A;  5BMU B;  1OAZ A;  2YZU A;  1A24 A;  2QC7 A;  4TR1 A;  5GST A;  2QGV A;  2FLS A;  4AKI A;  5DVB A;  4HU7 A;  1S3C A;  1OE8 A;  3VPQ A;  2C0G A;  5DDL A;  4WBR D;  1YEP A;  4IGJ A;  1PN9 A;  5FT3 A;  2HZF A;  3EYT A;  1F3A A;  2JAC A;  1M2A A;  4OCE A;  3M9K A;  5CRD A;  5ABR A;  1XW5 A;  3DVX A;  3IAM 2;  4G9H A;  1BYE A;  2KLX A;  4BL7 B;  1OVN A;  4K7I A;  2AJQ B;  1BED A;  3MYD A;  2MMZ A;  4F0C A;  2V1M A;  4HS1 A;  5J47 A;  4OO5 A;  1ZYN A;  2N5B A;  2FCH A;  2PPT A;  2CZ2 A;  3EC3 A;  2X8H A;  4BPY A;  3KH9 A;  2PWJ A;  5G5F A;  3F9U A;  1XW6 A;  1WP0 A;  3O76 A;  1TRV A;  4YKG A;  4HU9 A;  2YOI A;  5J4Y A;  3D4T A;  1OC8 A;  3IC4 A;  1VF3 A;  4K5S A;  4PGT A;  5ECN B;  3UVH A;  3IK7 A;  5B7C A;  2YCD A;  4MJB A;  4QQ7 A;  1B9X C;  4GLT A;  4KDY A;  5ECO B;  4OMV A;  5DJM A;  5IMC A;  2TIR A;  4IEL A;  2P0G A;  3MIX A;  1XWK A;  1TP9 A;  3CSI A;  1U3A A;  4EC0 A;  3RBT A;  2FA4 A;  2HRA A;  4E8E A;  3ERW A;  2GGT A;  3WT1 A;  3HA9 A;  4CDO A;  2H1L A;  3SWL A;  4ECB A;  2Z9S A;  2L6C A;  1H4O A;  5F06 A;  3KMO A;  3WT2 A;  6GST A;  2HRK B;  4TN8 A;  2CV4 A;  2EIO A;  3CRT A;  4FO5 A;  3U6V A;  1JFU A;  5CRE A;  4RI6 A;  1M9A A;  2DBC A;  1ERW A;  2V6O A;  4I2U A;  2EIQ A;  1HQO A;  2YN1 A;  4HUA A;  1B9Y C;  1BG1 A;  5IO0 A;  1DSB A;  2GDR A;  1FO5 A;  4OFT A;  5C04 A;  4MF6 A;  4ECI A;  2WFC A;  3TJF A;  2DJ2 A;  2OA7 A;  4KH7 A;  4AKH A;  5H5Q A;  4K1F A;  4IBP A;  3FZ5 A;  3KIJ A;  4KSM A;  5D9V A;  1DUG A;  1EGO A;  1U87 A;  2MMN A;  2WGR A;  1ML6 A;  1T1V A;  1TKD B;  2KOK A;  3Q18 A;  5F8B A;  2H73 A;  4KDX A;  1XFL A;  3VPT A;  2H6Y A;  3GN3 A;  3MDK A;  1QGV A;  1XWC A;  3F8U A;  1SJ6 A;  4BWS A;  5JWO B;  5AIX A;  1Z3E A;  2R5G A;  4O32 A;  3A5W A;  1S3D A;  1EOH A;  3TJG A;  3DML A;  5A4W A;  3IXR A;  4AJ6 A;  4L5L A;  1YDK A;  4JZQ A;  1M99 A;  4MPG A;  3HD5 A;  3HVV A;  5E59 A;  3TJB A;  1UN2 A;  4BA7 A;  2LJR A;  3HMJ G;  4IKH A;  3UEM A;  1K3O A;  5D8I A;  3BOA A;  2IL3 A;  5DQS A;  3RDW A;  2EC4 A;  2MMA A;  2R37 A;  4MLY A;  3H79 A;  2C80 A;  5B6N A;  3PIN A;  1FAA A;  3MNG A;  2VM1 A;  4KE3 A;  5IMD A;  4QL9 A;  1LBK A;  2E0Q A;  3NOF A;  4HZ4 A;  3H1N A;  5J4V A;  3G7I A;  5ELG A;  2HSH A;  1MEK A;  2ON7 A;  4DSS A;  1T00 A;  4NPB A;  3D22 A;  2F9S A;  4A5P A;  3TRQ A;  3IPZ A;  4PUF C;  4EO3 A;  2H1A A;  2H19 A;  2RM6 A;  3E3E A;  3UL3 A;  4O7H A;  1PKZ A;  4ULX A;  3FKF A;  5LD0 A;  3ME8 A;  3Q6O A;  3GKM A;  4ML1 A;  4HQZ A;  4GQF A;  4TR4 A;  2JZS A;  3TJJ A;  3U5R E;  4L5O A;  3Q19 A;  3RHC A;  2XBQ A;  1GWC A;  1MD3 A;  4MJA A;  5ID2 A;  4D73 A;  5HR2 A;  2HXK A;  1OKT A;  3EMX A;  4X0X A;  1YZX A;  3BCK A;  3IC8 A;  3LXT A;  1IYH A;  4N30 A;  2GTU A;  1KTE A;  2F3M A;  4GWR A;  2VCZ A;  1GSF A;  4K2X A;  3LYK A;  5KEJ A;  4PUR A;  2EIR A;  1PX6 A;  2QA2 A;  3M3M A;  4ZIJ A;  3VWW A;  3UJ1 A;  3D6I A;  2O89 A;  4PXO A;  3DYR A;  2K9F A;  3FHK A;  3GUS A;  2MMO A;  4XS4 A;  3HY2 A;  3GYK A;  5F0G A;  4DVC A;  5JWQ B;  5KN1 A;  4BVX B;  1MTC A;  5IPG A;  4NWY A;  1M2B A;  1FW1 A;  4N10 A;  2C4J A;  1DE2 A;  2VUP A;  2HSM A;  3GMF A;  1X9S B;  2XC2 A;  2HZE B;  2DKI A;  2RLI A;  4TKY A;  1IYI A;  1U3I A;  4F82 A;  5GAN D;  3I9V 2;  5BMU A;  2QSI A;  1M0U A;  5JCW A;  4EE0 A;  5A5K A;  5A1N B;  4RUV A;  5G30 A;  2YWN A;  3QOU A;  2HI7 A;  4RQR A;  2B6M A;  2TRX A;  2H6X A;  3M8N A;  4TW5 A;  2V2G A;  1HNA A;  5ELA A;  2A4V A;  2JZT A;  2GS3 A;  2C3Q A;  3F63 A;  2IPA A;  3TRP A;  3CMI A;  1G7E A;  2LEG A;  1K3Y A;  3VWU A;  1TTZ A;  4AF2 A;  4EDY A;  4YQU A;  4MP4 A;  2XHF A;  2OAC A;  3FY7 A;  5ECP B;  2H6Z A;  2GZZ A;  1J9B A;  2FWE A;  4BL7 A;  3NIV A;  4HZ2 A;  1PL1 A;  2OJL A;  1FOH A;  3LGC A;  4XS6 A;  2YPM A;  3ZRE A;  2RUE A;  3L9V A;  3KD0 A;  5DAK B;  3ZVJ D;  3ED3 A;  1XVQ A;  4ZB7 A;  1HD2 A;  1ST9 A;  4LLR A;  1HNC A;  1JLW A;  1TK5 B;  2R4V A;  5HFG A;  5DAL B;  1A0F A;  1Y25 A;  2DKH A;  3D21 A;  1X5D A;  2IMD A;  2X8G A;  4NV5 A;  3LOR A;  2D2Z A;  2VLV A;  4GSS A;  3KEB A;  3LXZ A;  3GX8 A;  4XHM A;  3VK9 A;  4Z2R A;  2ZUP A;  2O5V A;  5B8A A;  3BD2 A;  4G10 A;  2CT6 A;  3QPM A;  3IV4 A;  1SK1 A;  4EVM A;  3ZML A;  3HJM A;  4X43 A;  3GH9 A;  2GSR A;  4MF5 A;  4EF0 A;  1VF4 A;  2OAD A;  5ECQ B;  2H1G A;  2DJ0 A;  4POM A;  3GL3 A;  2VM2 A;  4IP1 A;  11GS A;  1LJR A;  2H74 A;  2HRK A;  1SD9 A;  3HZ4 A;  3QAG A;  4K7O A;  4MPF A;  2CVK A;  2XPE A;  5IOW A;  4GRF A;  10GS A;  4PNF A;  1ZYQ B;  6GSX A;  3UVT A;  3EPT A;  2GSQ A;  4X4J A;  1FG4 A;  3R3E A;  2L6D A;  2ES7 A;  3FMW A;  2LQQ A;  3FR6 A;  4ISD A;  1I9D A;  2H8L A;  1XCC A;  3UBK A;  2HSY A;  1THX A;  4ILF A;  4N11 A;  4K2D A;  3HCZ A;  3CSJ A;  5KN2 A;  2DC5 A;  1GL8 A;  4MMM A;  1SVL A;  1KEB A;  3I69 A;  4JRR A;  1G6Y A;  1ACV A;  1QFN A;  3I43 A;  1K0D A;  2NTO A;  1XW9 A;  1SJI A;  3C1S A;  4N0Z A;  3TDG A;  2RM5 A;  2B3S A;  4AKX B;  2P31 A;  2IN3 A;  2RII A;  1T7P B;  4POK A;  2EFE A;  1G7O A;  4L0U A;  3GUR A;  5J4U A;  1GH2 A;  2PGT A;  1T3B A;  1XIY A;  1FB6 A;  1XWA A;  2H30 A;  1EOG A;  3HVS A;  4I97 A;  2GLR A;  1WRY A;  3TU3 B;  1XWB A;  3TOT A;  2CVD A;  4TXV A;  4NAX A;  1RQM A;  2HLS A;  3GIX A;  4POB A;  1ZOF A;  4WF4 A;  3TCO A;  5D96 A;  1GSS A;  1ZGN A;  1YF1 A;  5G5E A;  2LRT A;  3GL5 A;  1F3B A;  2AAW A;  2YJH A;  2B7K A;  4X1U A;  4MA9 A;  4GF0 A;  2IJY A;  2LUS A;  1BQ7 A;  2E7P A;  2TRC P;  1YKA A;  1NM3 A;  1TDI A;  2L59 A;  1JLV A;  5G1L A;  5INY A;  4MJE A;  5CP1 A;  3VI5 A;  2C0F A;  1GNE A;  2JSZ A;  1K0B A;  12GS A;  4KAE A;  1O8X A;  1MDJ A;  1B4P A;  4ZBA A;  2C1Y A;  5H5R A;  4TVE A;  4CHS A;  2B5E A;  4TXO A;  5KN0 A;  5HFK A;  1ABA A;  5F05 A;  3BCI A;  4DSQ A;  4KDU A;  4I6X A;  2C0D A;  3UAR A;  3KXO A;  1R7H A;  4RI7 A;  2FUG 2;  3EUR A;  4Z7X A;  1USB A;  3ZIV A;  4K5R A;  2JSY A;  3TKS C;  4EIP A;  4CY6 A;  2CA8 A;  3UAP A;  3WD6 A;  1N2A A;  2LKU A;  2X99 A;  5H5S A;  2NVL A;  1V57 A;  3QMX A;  2R3X A;  1U6T A;  3J7Y k;  1EWX A;  1A2J A;  1SVO A;  3A3T A;  1SVM A;  2P5Q A;  4IQA A;  1GSU A;  1JHB A;  5A4U A;  4V1A g;  5J40 A;  3ZZX A;  4G0I A;  3LG6 A;  2H0H A;  1SYR A;  1T8E B;  3IA1 A;  3US3 A;  1AQX A;  1K0M A;  1LU4 A;  4BVX A;  4PNG A;  1BAY A;  4LMV A;  1AUC A;  4JR4 A;  1TXX A;  4G0L A;  2PUK C;  4MDC A;  2HZE A;  4TR0 A;  1Y1U A;  4OO4 A;  2DLX A;  1QUW A;  1OE7 A;  3TKS A;  3FR3 A;  2L4C A;  2WJU A;  3SBC A;  1EV4 A;  2LJA A;  5A1N A;  2GZP A;  1DE1 A;  1Z6M A;  4O92 A;  3TKR A;  4HJ2 A;  4V1A p;  4MJC A;  3TKQ A;  1F37 A;  5IMV A;  3ZFL A;  1J0F A;  1GSE A;  2O85 A;  4QMK A;  4J57 E;  2A2S A;  5HQP A;  3W6G A;  3QAW A;  3FYG A;  4WEY A;  4XS1 A;  2OE1 A;  4LA1 A;  3HHV A;  3WGE A;  4PQI A;  6GSS A;  1BF5 A;  2YWM A;  3IE3 A;  5B8B A;  1PGT A;  3L9S A;  2C3T A;  1Z5Y E;  4MH2 A;  5DAK A;  2YV7 A;  1X9W B;  1Z9H A;  2CQ9 A;  4PX1 A;  1J08 A;  3HDC A;  1BX9 A;  1K0A A;  1GTB A;  3KCM A;  4ZL9 A;  3IOS A;  2YWI A;  4WR4 A;  14GS A;  4PQ1 A;  1XZO A;  5DAL A;  4AGS A;  3GA4 A;  1GUK A;  3VUR A;  3Q74 A;  4EDZ A;  3KGK A;  3LW9 A;  1GSQ A;  3C8E A;  5J9B A;  1ZMA A;  1BG5 A;  3E0U A;  3ME7 A;  5KOW A;  1SJZ A;  3HVX A;  3W8J A;  3QDN A;  3HXS A;  3P90 A;  3WYW A;  4MAB A;  5FWG A;  3KH7 A;  1G6W A;  2VCQ A;  4BVY B;  2VD0 A;  3DXB A;  4USS A;  3D5J A;  3L4N A;  1V9W A;  22GS A;  2N5F A;  3G7Y A;  2L4Q A;  2PU9 C;  4IVF A;  3QAV A;  3O6T A;  3PPU A;  4HDE A;  3M0F A;  4YAV A;  1YQ1 A;  2DIZ A;  2O7K A;  4HJM A;  5J41 A;  2VL9 A;  3GX0 A;  2H70 A;  4TR3 A;  4ZBB A;  5D9W A;  2BMX A;  4TXO B;  1RK4 A;  5GSS A;  3F4S A;  5J5N A;  2RUF A;  2YJ7 A;  4TRX A;  2JAD A;  1R4W A;  2UV8 G;  3TKS E;  1Z6N A;  3G7J A;  1FVK A;  4FH8 A;  4TOP A;  4KA0 A;  2L5O A;  4Q5R A;  4FYU A;  2ON5 A;  2DJ1 A;  4F0B A;  4JE1 A;  1G0T A;  2C3N A;  1EP8 A;  2MYG A;  1EZK A;  2GVP A;  4F2I A;  5ECS A;  3UIW A;  1A8L A;  4NHZ A;  1NHY A;  1R5A A;  1QQ2 A;  1N25 A;  4KGI A;  2K6V A;  4ZL7 A;  2VIM A;  4MH3 A;  16GS A;  1A0R P;  3S9F A;  2VCT A;  1OC3 A;  4ECJ A;  3PR8 A;  4E68 A;  4ZBD A;  4IHU A;  4XIH A;  1AAZ A;  1FVJ A;  5D93 A;  3L9U A;  2H1D A;  1YEX A;  5D9X A;  1TXU A;  2H66 A;  1YKC A;  2IMK A;  2IMI A;  1WMJ A;  3VLN A;  2VCW A;  3ERG A;  2H01 A;  3V1W A;  3IR4 A;  1R26 A;  1AIU A;  1X0R A;  1B48 A;  4ICY A;  1PN0 A;  3GKN A;  2MBT A;  4NXI A;  2EFC A;  2WS2 A;  2B5X A;  2AHE A;  3WGX A;  5AGY A;  2I81 A;  3CRU A;  2HSN B;  1TU8 A;  3IHG A;  3GH6 A;  2OBI A;  3HJO A;  2I4A A;  3MAK A;  5IQY A;  3EWL A;  4K7N A;  3O3T A;  4YAP A;  5LNK e;  2M72 A;  2EFD A;  3P2A A;  2YV9 A;  1VF2 A;  1YJ6 A;  2CZ3 A;  5AIV A;  1TRW A;  3F6F A;  2R0P A;  3D0Z A;  1OKD A;  3DRN A;  2E2G A;  2F8F A;  1QMV A;  1OYJ A;  2DSA A;  2J23 A;  5L71 A;  3ZMK A;  1C72 A;  3GV1 A;  2AB6 A;  1XOA A;  3H93 A;  1V58 A;  4MZC A;  2FWH A;  2OE0 A;  2I3Y A;  4OCF A;  4ID0 A;  1Q4J A;  2VLU A;  2AUV A;  2HE3 A;  3CWG A;  3A2X A;  4J56 E;  3ZLP A;  3IHQ A;  3I6A A;  3IRA A;  1O6J A;  3EU3 A;  4G19 A;  3WGD A;  3IBH A;  5IMA A;  1O81 A;  3EU4 A;  3P8W A;  2NBS A;  2X4A A;  2YP6 A;  2LNS A;  3NZN A;  4G0K A;  5EPF A;  4YH2 A;  2F8A A;  4KW6 A;  1HYU A;  1BJX A;  2PBJ A;  1H75 A;  3FK8 A;  4EXJ A;  1XWG A;  4N3Z A;  2EFH A;  3DIE A;  4WF5 A;  5E4W A;  3C73 A;  5IM9 A;  3AY8 A;  4HEA 2;  1A8Y A;  3RAZ A;  5D73 A;  3ZVJ A;  1JZR A;  4IN0 A;  3VWV A;  5A34 B;  4FYC A;  3EVI A;  1AQW A;  5EY6 A;  5HFI A;  1GUL A;  2O87 A;  2PVO C;  2JU5 A;  4FQU A;  19GS A;  2JL4 A;  2GT6 A;  2WCI A;  1PA3 A;  1T4Y A;  4I5Q A;  4BWQ A;  3APO A;  2H76 A;  3UOM A;  1AC1 A;  2H1B A;  3L78 A;  1F6M C;  1Z7P A;  4Q5F A;  1SKS B;  4E8H A;  4EKZ A;  4EIQ A;  2HYX A;  1EEM A;  2FA8 A;  1X5C A;  2M46 A;  1JZD A;  1XPV A;  3IK9 A;  2I9H A;  2P5R A;  4N0V A;  2QA1 A;  2YNX A;  4NHW A;  2NPB A;  5D9T A;  2UZ8 A;  2LS5 A;  5DQY A;  1E6B A;  1MD4 A;  5G31 A;  4GXZ A;  1TOF A;  4V2N A;  1SKW B;  4BVY A;  4O5R A;  5BRT A;  3KM6 A;  3TRX A;  2YAN A;  2DML A;  4GST A;  1GUM A;  3LSZ A;  5IOX A;  4F9Z A;  3M1G A;  5FHI A;  2V6K A;  1B8X A;  2L5L A;  4IQ1 A;  4ZL8 A;  5CYY A;  3MSZ A;  4WXT A;  3EMP A;  4L0W A;  1HNB A;  2WDU A;  1AW9 A;  2PMT A;  3F6D A;  2LRC A;  2WZ9 A;  1O7U A;  4EL1 A;  3DVW A;  5COH A;  5ECR B;  2VLT A;  5LCZ A;  5EL8 A;  2O8V B;  2FHE A;  2WB9 A;  2VO4 A;  1YVL A;  5A5H B;  4IW9 A;  3DGQ A;  2LJK A;  1GSY A;  2AV4 A;  17GS A;  5CRW A;  2PVQ A;  1OC9 B;  4Q5N A;  2H0I A;  3DD3 A;  2ALB A;  4CW9 A;  3IAS 2;  3KP9 A;  4F03 A;  4XRD A;  1XBS A;  3N5O A;  1V98 A;  3TOU A;  1PQN A;  1SU9 A;  2G2Q A;  2A2P A;  2IME A;  3DWV A;  1SD8 A;  3TB2 A;  2K18 A;  4GQC A;  1GP1 A;  2R0G A;  1O8W A;  4MCU A;  3GST A;  3ZL5 A;  3CBU A;  3L0H A;  1ILO A;  4XTS A;  1SL0 B;  1V40 A;  1PX7 A;  1CQG A;  2B5Y A;  1X5E A;  1O85 A;  4ZXG A;  3BBY A;  3TGZ A;  5ECK B;  4WBJ A;  1Z7R A;  1W89 A;  1FHE A;  2G0F A;  2A2R A;  2KP1 A;  3C71 A;  3F3R A;  1GNW A;  3ZIT A;  1V2A A;  4MK3 A;  1Q98 A;  5HR0 A;  1XVW A;  3K8N A;  1KNG A;  2H75 A;  3JCM L;  1QXH A;  2WRT A;  4DEJ A;  3LQ7 A;  3LWA A;  1DBY A;  2LV3 A;  3H8Q A;  5B6M A;  3GFK A;  4K0N A;  3ERF A;  3VFI A;  3UMA A;  1PRX A;  2H71 A;  4HOJ A;  2GSS A;  1U88 A;  3DEX A;  6GSW A;  2DMM A;  2C8U A;  3G9B A;  2HSN A;  2IIY A;  5DJL A;  4JR6 A;  4WR5 A;  2R6K A;  1A2L A;  1SK0 A;  4IP6 A;  4FIW A;  2VOC A;  4KSO A;  2LRN A;  2KHP A;  4POL A;  3APS A;  4WKW A;  4Z2U A;  5F07 A;  4KX4 A;  4H86 A;  4MZB A;  4PQH A;  4JED A;  2GQL A;  5DCG A;  3F4R A;  4DSR A;  3KTL A;  3ZFB A;  5DCH A;  5A4V A;  2K8V A;  2H0G A;  3CYN A;  2J9H A;  3CTF A;  4IJ3 A;  4JBB A;  1X9M B;  3OR5 A;  4KCA A;  1JZW A;  1ZL9 A;  2FD3 A;  4QL7 A;  4PTS A;  7GSS A;  3ZRD A;  3C7M A;  1TI3 A;  2REM A;  3FZ4 A;  1NSW A;  4V2M A;  3HKR A;  5IIZ A;  3HJP A;  2VCV A;  1F9M A;  1FB0 A;  1UVZ A;  2YWO A;  3A2V A;  1GTI A;  2DJK A;  1YY7 A;  1O73 A;  2V32 A;  1A2M A;  3HYP A;  4TR1 B;  3D4M A;  2HRN A;  3ISO A;  5ECI B;  1NW2 A;  2VAF A;  2ZNM A;  2GZY A;  4KCE A;  4G2E A;  3GTU A;  4ZB6 A;  2R2J A;  2BJX A;  1PL2 A;  4KND A;  2B1K A;  2PER A;  5IPH A;  1TK0 B;  3R2Q A;  4ECC A;  4ML6 A;  1I5G A;  1N8J A;  4WET A;  2HQT A;  5CAX A;  3A2W A;  3GKK A;  3CSH A;  5A34 A;  3GHA A;  2IFQ A;  2LQO A;  4K6X A;  1SYX A;  4JU5 A;  1TRU A;  5ECL B;  1VF1 A;  1K3L A;  1K0N A;  1UA5 A;  2WUL A;  3QFA C;  3QCP A;  4Q5Q A;  4IS0 A;  3QR6 A;  4O5U A;  4GDF A;  1ERU A;  4EUY A;  3E9J B;  1QK8 A;  2MZC A;  1ZCP A;  4KUN A;  5JWR B;  2XBI A;  3CXG A;  3M9J A;  2JZR A;  3H4K A;  3FZ9 A;  5CO3 A;  1GRX A;  2V41 A;  1TRS A;  2CAQ A;  2DJJ A;  5EVO A;  5ECM B;  2HRF A;  2R0C A;  1B4Q A;  2PN8 A;  4LMW A;  3FR9 A;  3RHB A;  1TU7 A;  2NDO A;  1GSD A;  2CAI A;  5GZZ B;  4MNN A;  1R5P A;  3VI7 A;  1WPI A;  2HT9 A;  3MWH A;  4XCS A;  2FNO A;  2XPD A;  2VL3 A;  4MZW A;  2KP2 A;  1TK8 B;  1EEJ A;  3EE2 A;  4ZB8 A;  2B1L A;  4XRA A;  1GTA A;  2VKZ G;  3VWX A;  2HNL A;  3IDV A;  4YKF A;  1GUH A;  5JCU A;  1M2D A;  2IWT A;  2L57 A;  1VRS D;  5C00 A;  2A4H A;  5DBQ A;  3FRC A;  2CX3 A;  3LEF A;  3PGT A;  2OT3 A;  1M9B A;  3GSS A;  2F51 A;  4OFN A;  3N9J A;  1WE0 A;  4YQV A;  4CY8 A;  3FEU A;  1CQH A;  2FWF A;  4O5Q A;  3TJK A;  3TKP A;  1S3A A;  3KP8 A;  3J7Y b;  2H72 A;  1SL2 B;  2BTO T;  1WWJ A;  3QD9 A;  4ZIL A;  5J3R A;  1RW1 A;  1EV9 A;  5IMF A;  6GSU A;  5A5H A;  3FW2 A;  1ZYE A;  2DIY A;  1KBN A;  1M7T A;  4HQS A;  1OC9 A;  3F4T A;  1MDI A;  5KOX A;  1PD2 1;  1PSQ A;  4V2L A;  3CTG A;  2FGX A;  5JCG A;  5IMZ A;  2VL2 C;  4K8M A;  3UBL A;  4LL4 B;  9GSS A;  4AI6 A;  3KTB A;  3RPN A;  4RQX A;  2HFD A;  2ZCT A;  4KB3 A;  3F3Q A;  2MBS A;  2FY6 A;  1EGR A;  1PKW A;  2CX4 A;  4HI7 A;  1ERV A;  5CNW A;  1GLP A;  1GLQ A;  5CRH A;  3LJR A;  2FWG A;  4J2F A;  1WIK A;  4GSN A;  1Y6E A;  4ACS A;  1WJK A;  3QFB C;  4GTU A;  4I2T A;  4ZB9 A;  1VGL A;  5HR3 A;  2VCX A;  1XOB A;  1YF0 A;  3PH9 A;  1WOU A;  4P3Y B;  2LTK A;  2OBK A;  4Z2T A;  6GSV A;  2X64 A;  4L8E A;  1XXU A;  1URM A;  4GCI A;  1AXD A;  3P7X A;  2YZH A;  6GSY A;  2K8S A;  3F0I A;  4W66 A;  4K0G A;  1K0C A;  1JZO A;  3KMN A;  1F2E A;  2E2M A;  3GTU B;  4DSS B;  3KJY A;  3A5I A;  1ZZY A;  8GSS A;  3W8S A;  2N5A A;  2DJ3 A;  1ON4 A;  2OE3 A;  1FOV A;  3EIN A;  5AIS A;  1AQV A;  1EP7 A;  4PUA A;  1PMT A;  1A23 A;  2M80 A;  2VL2 A;  3ZYW A;  2QKE A;  2IFQ B;  5ECH B;  3APQ A;  3GRX A;  5J9C A;  3ZTL A;  1TJD A;  2GQK A;  1GTU A;  1E2Y A;  3HZ8 A;  18GS A;  2GT5 A;  3KZQ A;  5ID2 B;  4NV2 A;  5AN1 A;  3ZIJ A;  4D73 B;  2C0E A;  4YQM A;  1TI1 A;  2OKA A;  2KUC A;  5IO2 A;  4FYB A;  5GAP D;  3GKX A;  3DKS A;  1SK2 A;  1K0O A;  4AKG A;  4AJ7 A;  4KF9 A;  1TW9 A;  4LL1 B;  4G01 A;  1MDK A;  2VD1 A;  4MF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...