1V43A

Crystal structure of atpase subunit of abc sugar transporter
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
367
structure length
353
Chain Sequence
VIKMVEVKLENLTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYLPPKDRNISMVFQHMTVYENIAFPLKKFPKDEIDKRVRWAAELLQIEELLNRYPAQLSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKVTTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLRPNSVFVATFIGAPEMNILEVSVGDGYLEGRGFRIELPQMDLLKDYVGKTVLFGIRPEHMTVEGVHMKRTARLIGKVDFVEALGTDTILHVKFGDELVKVKLPGHIPIEPGREVKVIMDLDMIHVFDKDTEKAIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ATP-binding cassette of multisugar transporter from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transport protein
molecule keywords sugar-binding transport ATP-binding protein
total genus 96
structure length 353
sequence length 367
ec nomenclature
pdb deposition date 2003-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1v43A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1v43A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1v43A01
4C0QC 5B2ZA 2DHRA 5J5CA 4NZYA 1KJYA 3GJ0A 3CCEA 1JXMA 4FD2A 1QHIA 5IP7H 4PTLA 5IK2A 1JBKA 4OHXA 5HY6A 5JHGB 4EKDA 4LSGA 3THWA 1UKZA 2A1AA 2AKYA 1SHZA 2PX0A 3OZXA 2VSFA 2JDIA 2Q21A 2AD5A 5A0FA 3IFTA 4LJ4A 2I3BA 1QG4A 4TMWA 2CW0C 1OXXK 4KFTA 5C4XG 2ODWA 1X1RA 1RRPA 5JMTA 1KGDA 3UK6A 3A7LA 1HH4A 1XCPA 3CC4A 3KJIA 4GZMA 3K0FA 4GOKA 1LS1A 5L3QB 1LF0A 1YKSA 1G41A 1NIPA 4Z1MA 5K36H 1MRNA 4NCJA 1OB2A 1PH5A 1H9MA 1PLJA 4NYIR 2NN6I 1V43A 2B6HA 3FVQA 4A92A 4IOAA 1SULA 5DYGA 3TQYA 3EWAA 3RYTC 3TS0A 4GDFA 1KRTA 1KJZA 1TF7A 2QN6A 4DV4Q 2GCNA 2IS6A 2ZU6A 1DAEA 1G7CA 4LPKA 4Q1BA 4R4OA 3PEYA 4ACBA 4JT4A 1J5EQ 5LD2C 1E1RA 3TUZC 1BH2A 2WKRA 2D2FA 1E2LA 2GVAA 2HCJB 1NSFA 2C95A 1KJWA 1E1OA 2I5MX 3G71A 2DFLA 2YJTD 4EPVA 1KI8A 1TWHH 2IC5A 1EIFA 2F7SA 1ZVQA 4DV5L 3MJRA 3EG5A 4KXFB 4Q5IA 3A36A 2P2LA 2O0JA 4IDOA 1S96A 4NYIQ 4A93G 1G3RA 1S3GA 3V00A 5JRJA 1HT2E 4LY6A 4ZIRB 3AP2A 2Z5FA 2AWOA 2E5LQ 1P8LA 4DB4A 3PEUA 2LWIA 2UVQA 4TQ9A 3BH7A 4PPQA 2Q9BA 1HZAA 1T8UA 3GQBA 2ERYA 2YZ2A 3IBGA 3QVVA 2IX1A 1P6XA 1GL9B 4OK3A 2IWHA 4DV7L 3RRZA 4OI2A 3BK7A 4QGUA 2RGEA 4FCWA 4DT1A 1P9NA 3FMCA 3HU2A 4EPYA 3QIAA 1L4UA 2JLXA 2AFHE 5C2JB 1M8PA 4B3DA 1DXMA 1G19A 1EXMA 1I5FA 4AH6A 2BJVA 2GBLA 2JJ2D 2VO1A 4MRVA 521PA 1DELA 4LDJA 2RH5A 2BC9A 3WWVA 2VNUD 2BM1A 4B3TQ 2KCMA 3QSYA 2GTPA 1UDXA 4QGGA 4Q01A 1EESA 4V0KA 3EZ7A 2WAXA 2GRJA 1R0XA 2K14A 3AB9A 1YE8A 4IKEA 4LI0A 4TT3D 4AG5A 6Q21A 4QJFA 1HH2P 1VQFA 2HHHL 4DR7L 2GJSA 2GNOA 3HOWG 4NTZA 2F1RA 3U7FB 4HIKA 1W36D 5BN4A 4NE2A 1IHUA 1XXHB 5FBWB 2IUSA 4D80A 3KJPA 2AHOA 2O5VA 4KKSA 2I0QA 3SHWA 1UE7A 4IDHA 2BA0A 1RYFA 3CD6A 3BERA 3CW2A 5EE5B 5E95A 4AIIA 1DARA 4MYHA 3B6EA 1XTIA 4NL4H 2UU9Q 2VHQA 5FTKA 3EBEA 1IBMQ 2OTJA 3LW8A 1FPMA 4KU4A 3QXHA 4A8JC 4DV2Q 4B3XA 2GAOA 3LQRA 1E79A 2BDOA 3CAMA 2CCJA 1XEFA 2MO0A 1MKYA 4P4SA 4B3ML 5J4LA 4RY2A 1KK0A 4G5OA 4LC0A 1DPFA 2ZRKA 4R2HA 5B30A 4US2R 4OI0A 3R9WA 1KK2A 1MR3F 1OH7A 1GRQA 1PUIA 1XD2B 4BFWA 3RR5A 1AZSC 3EPJA 4B32A 1LB1B 3EA0A 4P4SB 1GL7A 3RS0A 3ER0A 1C0AA 1IXZA 3B2EA 4Q1AA 4C9BA 4A0FA 2F4VQ 2BEKA 1ESMA 3IO5A 2NGRA 2C2HA 2R65A 3BS4A 2VRWA 2FMXA 5EP3A 4MYTA 3KFXA 4KMUC 3T15A 4DCNA 4KBGA 2V7QA 4HZUA 4XSHA 1GAJA 2NPFA 3B6YA 1MABA 1X1SA 2V9PA 5SZIA 5KTYA 4XOIA 4I7ZC 4YQFA 5JSZA 1GKUB 1HE1C 2JA7G 3Q3JB 3U3MA 1JI0A 4UP9A 2KBFA 2OE2A 5LMNL 4G7OC 3TE6A 2VQFQ 4DEXA 2VP2A 2MO1A 3HOWH 2IXGA 3CKLA 1QHHB 4LBYA 4M53A 1BBUA 3SHFA 4DK6C 1U99A 1YZQA 3ASYA 3BAFA 3KB1A 2NN6H 5LB4A 4DDWA 1VQKA 1II8B 5GJWC 5BR8L 3CH4B 4LHXA 1FYCA 2GWHA 4IFDJ 2PMZE 4JG2A 2J0UA 4RSGA 4RD0A 3SFZA 1CKOA 1Q46A 2IYUA 4OXPA 1TWAH 5E4FA 2I5LX 2ZJYA 3UWOA 3VA7A 2MSDB 3BORA 3RS2A 5C18A 4KHPQ 2H57A 4II7A 4B3SL 4ZI2A 1XZQA 1Z6GA 3UANA 3CRVA 2DYKA 2VHCA 3OHMA 3BJUA 1M1KC 3CXCA 4P33A 1BVSA 4Q4HB 2QMUA 1X54A 3QF7A 4PZZA 1EFWA 1FMJA 4G5SA 4JOIA 3U6BA 5FI0B 4KVGA 1XRJA 1EX6A 2OTLA 1HYQA 1JXOA 1XJCA 3VDYA 4B2IA 1QUQA 4A93H 3U7GA 3U4VA 5KSOA 3LLMA 3LVRE 5CM9C 4P3YA 5IP9H 1KO5A 1M2OB 3THXA 3VR2A 4QHYA 4GP7A 3PUYA 5SZJA 3UE0A 4KKUA 2UZIR 1CBUA 5FLMG 1PV4A 3LH5A 2QG6A 1E2JA 1YHNA 4M9XA 1RJ9B 3WNCA 2XAUA 4TTRA 3SN6A 3BU2A 1U2RA 3HOYH 2JLWA 5JI2E 4H0LC 1QG2A 2P5SA 3CB4A 1Z6AA 5DHAA 1TWFH 4RD6A 3GTPH 3BIFA 4XD7D 3QXXA 5FBRB 2VBCA 2QRZA 2YYZA 1GO3E 4HDCA 1AKEA 1CLUA 2F3IA 2ECKA 3JVVA 3KDSE 4LBVA 3LY5A 2O52A 3RS5A 1DVRA 2WKPA 4HSEA 1WYDA 3GJ7A 1SXJB 3A1UA 3W90A 3KQKA 2DPXA 1W49A 4IOCA 1KMHB 4GSYA 1R9TH 5J4KA 1F6BA 1KAOA 2D06A 4NYJQ 1DO2A 1Q3TA 2VH5R 2ZI4A 3K0AA 3VU9A 4Q7KA 2FZLA 4NYMQ 2WIBA 4JZKA 3M3YH 1ZU5A 3LWNA 1SHKA 3NBXX 4TWZA 1R8QA 2B8TA 1Q90A 3T12A 4JI3L 1MO3A 1N33L 3ECCA 2OXRA 3U58A 4HUTA 4MKFA 4XSGA 4M8NE 4BEBA 1UFQA 3OTOQ 3DMNA 4C3IH 2KB0A 3KJEA 4Q1FA 2IYRA 2PT7A 4DC9A 4GNXC 2V7QD 4EIWA 5M04A 5FLMH 1N32L 3AKEA 1OPXA 2ZYUX 3E70C 3T1HQ 4JI8L 2ORWA 3OTOL 4R4IA 4M2LA 4ZCLA 3HDTA 4HYYA 3CCUA 2SHKA 1FMLA 4J15A 3H3VH 3LV8A 4IOKA 5E7JA 3PVSA 2JA7H 1Q44A 4EJSC 3BB4A 5K8UA 3GLGB 3PV0A 2GF0A 2ZEJA 1GRRA 4J0QA 1HZCA 2ZTDA 1BMFA 1HEIA 4WXRA 2ZJRA 2OBLA 3WHLA 2MFIA 2ZI5A 4AQYQ 4NXMQ 1VCOA 2VQEL 3S16H 5EXPA 1E2VA 3IRBA 5IT9c 4CZ2A 1VQ6A 3RWOA 3CP0A 3FKQA 3QE0A 4M1TA 1ESNA 3UWKA 4YDSA 3J80c 2ZS9A 4Q18A 4H44C 2G1KA 3BJIC 2WPDA 4XVQA 4UP7A 1NVVR 4Q00A 4HJ7A 2XOKD 3GFPA 3NG1A 4LJYA 4F7WA 1KDTA 5DI3A 2HQLA 1OB5A 4IPDA 1KO1A 4IFDG 2ORVA 4TSFA 4A3BH 4JYAQ 2J59A 4HAVA 1X56A 4HB0A 5M5WH 1OT3A 4EX5A 3K0CC 1R8SA 2P67A 2EVWX 3H94A 1H9SA 2EQBA 3L2PA 3RNUA 2VIIA 3IO3A 4DUGA 1EG7A 4LF6Q 1O3YA 3DDCA 5F9HA 2J7PD 1X3EA 1S9DA 3SYKA 1KXLA 1OIVA 4GKJL 2F9MA 1JB1A 2NOAA 2LXJA 2OBNA 3ZQJA 1OE0A 4IJMA 4X8OA 1Z22A 4XD7A 1Q0UA 4L8GA 1F60A 1Z0AA 3CPHA 1YRAA 4GOJA 5HCNA 5KOYA 3THYA 2CL7X 4DLZA 2WM9B 1XTRA 1KTVA 2QF7A 3GTJH 2YWFA 5HGQA 2ZREA 4Q66C 2W0MA 3SFVA 3SJAA 1II0A 3TUJC 3GLIB 2D74A 4PC1A 1NRJB 3FKSD 4HJ8A 1YZNA 1GVNB 4WZAE 3OE7A 1ODFA 3LQQA 4TL9A 3PUXA 4TLAA 1U90A 1UEBA 2EXDA 1WMSA 4Q9JA 3SR0A 3WRYC 4E5UA 1OHHD 2HXYA 5CIWA 1VQGA 1Y63A 3NBHB 1TQ4A 4DR6L 2ZXUA 3UG6A 2XGTA 4RZUA 4GT1A 3ND9A 4TLCA 4C0HA 1IYJB 3AF4A 1K5DA 4TYWA 4GS3A 1N3BA 2YHSA 1YR8A 4A3FG 1MRSA 2FF7A 5GJVC 2JJ1D 3T1QA 1IBRA 3LWUA 2VQEQ 4WJ3M 2O8BB 2QT0A 2UKDA 4PPFA 4AWXA 1ZNWA 2DWPA 5HE9A 2IXEA 3ZDQA 4PSAA 4RD2A 2R7ZH 2WB1E 1JJCB 1RJ9A 4B35A 3WMEA 3T35A 4CDGA 4M1KA 2K5VA 1GG2A 4B71A 4POFA 4Q02A 1AS2A 2OAP1 2PZEA 5J3BA 4NMMA 1KAGA 3NH6A 1HNZQ 1UPTA 2E9SA 3BGWA 4C30A 3T1VA 3T34A 4IVQA 3SE0A 1GZSA 2JLSA 1IN5A 2A5GA 3BBPA 1RRGA 3FOZA 5F98A 5C3EH 2KHIA 4ACAA 1QVGA 3UDXA 1EQQA 2Z6KA 3KXLA 1K3RA 2HF8A 2PJRA 3NXSA 1KSHA 2ZRDA 4JLJA 3H1TA 1Z29A 2QAGB 2ZI9A 4HUQB 4LCBA 5FH9A 2ZJPA 3LLUA 4Z54A 4D0NA 3WYGA 4OYHA 3A37A 3W9YA 2ZRJA 1I6HH 4Q1DA 1J5EL 2R2AA 4LJZC 4EFNA 2L15A 1TUIA 3HOXH 4QM6A 3QKSB 3QY0A 4DSNA 4TL8A 3JAMi 1U0HC 1YRBA 1AQYA 1UM8A 4AD8A 4JMPA 5C4XH 4GLXA 2HLDD 2J0VA 3DOEA 1IQPA 3AVTA 3EN2A 4TYQA 3LD9A 3G4SA 5TDHA 1FQKA 1L1OB 4OQXA 3RS3A 3C15C 2CE7A 1NLFA 5C44H 1KI2A 4FMCB 5CJPA 3TSWA 1KDRA 2PBRA 1NTGA 3L8ZA 4RZ3A 3UMRA 2ZRFA 2OSBA 4HB4A 3GCGA 3WNDA 3KZ1E 2EJFC 1Q21A 4HDQB 1PYBA 4GKKQ 1TQ2A 1AGPA 1YU9A 1EYGA 3B8HA 3KJHA 3TH5A 3CCJA 2ES2A 4B74A 3U5ZB 1FFHA 2OAQ1 4O25A 1ZMXA 1LFDB 1W5TA 3J81i 1BIFA 4BY1H 1LF5A 1T5LA 1HQMC 4BA2I 2HT6A 1OJLA 3F0TA 1PJRA 4EPXA 2XXAA 3W5OA 3GFTA 1UEIA 3BD9A 3PEVA 2GZAA 1T3HA 2JDID 3O8DA 1G5TA 4HJAA 2B29A 1HT1E 2QMEA 3U2QA 5IRCD 4CGZA 2CKZB 5AK0A 4BWYA 2FX3A 2PNRC 1P2SA 1YNXA 2P0EA 2WIAA 4NCKA 3WMGA 4DIDA 3ADDA 3U3RA 2CVFA 2GK6A 5ELNA 1GD7A 3PFIA 3GLIE 2CL6X 1PUJA 2NO6A 2WBLC 4LV6A 4UNRA 1PMRA 3D3QA 4BPBA 1KRSA 4UNNA 5JEAH 1JALA 5FTNA 1E2MA 1AH9A 4F93B 5EUQB 4DHEA 2VUMG 2A78A 5IP7G 4URXR 4NBSA 3A6PC 1YQTA 2DNEA 2G1JA 4YC7A 1LVGA 2QP4A 2OG2A 2MQHA 1JJ7A 4GNKA 3GO5A 2ZIAA 3EZ6A 2H5XA 4DR2L 2F6RA 2IYYA 1OFTA 1P75A 4ZCMA 1E99A 3THWB 3HU1A 2ODBA 5JFGA 4JI2L 4LWZA 4GN5A 4QQBX 3FKIG 4KSCA 1TU4A 1KIMA 2NVYH 2OLKA 4A3EH 3CNNA 4IDQA 1EK0A 4MRNA 3RANA 3SJBA 3K9LA 1XMQQ 5AJVB 1FZQA 4L16A 4N1AA 5BYJA 2FNAA 1TXYA 5LMNQ 1FTNA 1VPLA 1XTQA 1YZKA 4GMXA 3SI7A 3E9IA 1TF5A 2O8FB 2DCUA 1Z6TA 3GJ5A 1HV8A 2YTVA 5FI1B 4IOJA 1W1WA 1LTLA 3PCOB 1XMSA 2VP4A 3K70B 5LB2A 1E0AA 5TVKA 5F2EA 1YNNC 1B0UA 1OKKA 3DVLA 4JI1L 3UE1A 2CHGA 4M0LA 4S35A 3ZH9B 3H0GH 5M3MH 1X8JA 1IY0A 1COWD 4Y7NH 4PO1A 5HKKA 1YR6A 4ARZA 1R5BA 1GRNA 1RW4A 2R44A 4IVPA 1CJTC 1VQAA 3CQZH 3SNHA 1W46A 5JEAG 5AUOB 4BE7B 2ODNA 4UNSA 1S9HA 5JLJA 4EAQA 1K73C 1BYUA 1XEWX 2CDNA 4GMDA 1JT8A 1E2WA 2Q3HA 2ZTEA 4RCZA 4XVRA 4D4LA 2C9CA 4BFYA 3MEFA 3D7MA 2FFHA 4BBSH 5KDDA 4X64Q 2KENA 4IHQA 3T1YQ 2Z6VA 1CKEA 3FHCB 4F4JA 4DVGA 2XGJA 2TMKA 4TT3A 2B63H 1TF2A 4PMWA 1Z0FA 2YU9H 5E7MA 3ND8A 2XTMA 4LHYA 3TSOA 5H8WA 2UU9L 4HLUC 4PO8A 4GP6A 1T3LA 5FTMA 4X6AH 1E1QA 3I72A 2ZJAA 3S15H 4BY7G 2FV8A 4L8JA 1SROA 3FE2A 3HWSA 4A2PA 1B23P 1AE2A 1J70A 1LS6A 1I6VC 1VHTA 2OFOA 4DK1A 4LWCA 4EQ5A 2JLQA 3QBTA 4PO9A 5A5GA 1TTTA 4YY3Q 1J6QA 5BN3A 2XSZD 1XDBA 5E3HA 1F2TA 3U4ZA 5F3WB 1S72A 3VFDA 1S8FA 1YJ5A 2ZETA 2ZE7A 4KLNA 4M21A 5BYKA 1PVOA 4Q7JB 4CT4B 721PA 5IF9A 5CLLA 5GVRA 3PGZA 1ZC3A 1MJCA 2W0SA 1AIPA 4E07A 4LJ6A 2RMKA 3ZYCA 4WJ4A 2REBA 3LAWA 1GNQA 2R92G 1GNPA 2VY3A 3UG7A 5D3QA 2C9OA 4JI2Q 5H1SE 4V0ME 1Z0KA 2WVJA 1E9CA 2JLRA 2YTYA 3CCMA 5KNBA 3X1DA 1PYSB 1CULC 2XJ9A 1VECA 3TR5A 4MGKR 5KUTA 4JL6A 1I3QH 4BEJA 1PFSA 5FPHA 3REFA 2PQAA 4M1MA 2VUMH 1ZCBA 2JLYA 3C4JA 1VQCA 1Z28A 1OXSC 4HLQB 2VPPA 4D0LB 1UF9A 1A7JA 3FYHA 4JOIC 4B3MQ 5TXGA 1B9MA 4P71A 4YHHQ 2IF0A 1KDOA 4K81B 3DKPA 1KI1A 4Y52H 1SVOA 2EFGA 4V0MA 4KKTA 5AJXA 2A69C 1IN4A 5AJYA 4BRUA 3UATA 2FG5A 1KSJA 2QGNA 4JI4L 1YITA 1TEVA 2H8KA 4BLTA 1JJGA 1OIXA 3GTOH 4LJ8A 3AKYA 3AGQA 3G0HA 4L4UA 2VZAA 3I7FA 5K36G 3I8XA 3WHKA 3EC1A 3E5HA 4TKOB 1XEXA 2AL7A 2ID0A 2FXQA 2JASA 2UUCQ 3EPHA 2WWWA 4B48A 1VQJA 1QZHA 3R8FA 5J40A 2ZJQA 5GAGC 2A5DA 3CRKC 3NEJA 3K70D 3GP8A 3ZVNA 5LMNW 2A7QA 3MRSA 4K0KQ 3KKMA 2VQFL 3KL4A 1N5LA 1RRFA 2G83A 5SZHB 4C4PA 5G3YA 3K9GA 4JKYA 5LD2B 1GVPA 2W2XA 4P31A 3D6TB 4B3RL 4G3XA 3HU3A 2ZSAA 3BE4A 1V8QA 4DR1Q 5DGXA 1LYLA 4Q4LA 1A0IA 2CNWD 1QHGA 3VX4A 4ZDKA 3B13B 1XP8A 1II8A 4LJAA 1KNQA 1WA5A 2GETA 3RABA 3TR0A 1XEWY 4W5HA 1TWGH 2HDNB 3TW4A 2FJUA 1HR0L 4GNXA 1S1MA 1W36C 1RVDA 2XB4A 2CCKA 3MD0A 3DKVA 1IONA 2RHMA 2Y8EA 2QTVB 4A3JG 1R10A 3P4YA 3BH0A 4HZIA 2O8EA 5G3ZA 5C46F 2BH8A 1TUEA 2C04A 4W5WA 3S1AA 3PJRA 4LUZA 3NVAA 4HIMA 1B70B 4RKEA 1XMOL 1T0HB 4A6XA 3K70C 4NONA 1TU3A 1IBLL 1BDOA 2UZ3A 4JVMA 2O8EB 1DAHA 3K09C 5EXTA 4F38A 2Z43A 1PH6A 1PH8A 2V3CC 3Q72A 5KU1A 5LDDC 4HIOA 3LW7A 5FL7A 4LF9Q 3M4YA 2XX3A 2UXDL 1KHIA 1Z2CA 1NG9A 3CNLA 1Z07A 4RZ2A 3U7EB 5KPDA 1IBKQ 2AR7A 3TVDA 1RFLA 4DR1L 2E87A 4PC3A 1K8MA 4HJ5A 5IYDH 1Z6YA 2RGBA 3I5XA 1FX0B 1ZM4A 2AKAB 2IHBA 5J4YA 3GMTA 4JV5Q 5DI3B 2QROA 4RFVA 2JA5H 1UKVY 4KO8A 2GBLC 2IK8A 2R6CA 2ZJZA 3AFPA 3KF6A 5C3EG 3I4LA 1GUAA 1D2MA 2GJ9A 1K8AC 2JJ8A 2MMCA 4KVAA 2YC2C 4M4SA 4EDHA 3O8CA 4E09A 1P72A 2CBZA 5J4VA 4FWTA 2ZTSA 2PH1A 3GJ4A 4MUAA 2D3WA 1VQ7A 2ZT9C 2R8RA 4TMVA 3TK1A 2BCJQ 3RN5A 2UUBL 1VF5C 5JJKA 2GK7A 2P6UA 1VIYA 2ZYVX 3CF6R 3KUDA 3VU9B 2GZHA 4UY8C 4OO1G 1E22A 4DV7Q 4JI4Q 1XNQQ 2IYTA 2QE7A 2ZI3A 4V0LA 5G40A 2V1XA 2QNRA 3VQTA 1WE2A 3CF2A 3A8JE 1CFMA 1WOCA 4KYUA 2ZU0C 4A0GA 2I1QA 2YKGA 3DMDA 3A5ZB 2ZAMA 3TVTA 2W6ID 1H8ED 1J90A 3GTLH 3FWYA 3WXMA 3VR4A 4DV5Q 2F1JA 1L4YA 2Q0HA 2YTXA 3FFBA 4JI7L 3CX8A 3K0AB 4Q47A 3FMPB 2O5IC 1EUJA 1IAQA 1QVAA 2XNDD 1SGWA 4Z8YA 5IHPA 2OCPA 3PITA 4TQAA 2G88A 2OCEA 4QOSA 3EW9A 2B8FA 4QY7A 4X65Q 4LBZA 3N6RA 3ZIAA 2YV5A 3KDFB 1GKIA 1EWIA 2Z0MA 5IWAL 2NVQH 1IOZA 2HEIA 2GVBA 1XXHA 4NCHA 5UKDA 4GOPB 4AY2A 3S1AB 4HJ9A 3DOFA 2IS4A 4MZ9A 1A8VA 2QPTA 3FKIH 2RGXA 3B60A 2WB1G 3U61B 1Q7YC 3K7UC 2OUKA 1Z47A 3B9PA 1R6BX 4P73A 1F2UA 3RSOA 1MABB 4NH0A 2RGDA 4HI0E 5EE3A 4B34A 1SKYB 1G4AE 1ZD1A 2P5TB 3GDEA 1U9IC 2DY1A 2DFTA 4LYFA 4QFMA 1J2JA 1QZGA 4PQFA 2X19A 3G5UA 2A69D 1U81A 4IVRA 1Y8OB 2CCZA 1T8TA 1IBKL 1Z0DA 3HR7A 4DV0Q 1AZTA 3NTUA 4NPHA 4B2PA 4BFUA 3NDPA 2NZJA 1YJNA 3CCVA 1S40A 3OAAA 4M9QA 1T5EA 2J0SA 1E9RA 1NY4A 2VF7A 3WP1B 2REOA 2OQKA 1KO8A 3W1BA 5C4MA 1OFIA 4ME3A 1U94A 2Q6TA 4A3LG 4BY1G 1N9WA 2W6JD 3F2DA 3AVXA 1VG0B 1QVRA 3CR8A 5D3MB 4EPWA 1ELOA 2QP3A 5HTKA 1XJ0A 3CM0A 2H7VA 3VHXA 2W83A 3KFUA 4AK9A 4GL2A 4P4TA 1XTDA 3QPVA 5EP2A 2YWHA 3A4NA 4KFUA 2D0OA 3AVOA 1O87A 1WQ1R 2ATXA 2QGZA 2VP9A 3PENA 2JA8H 2ASBA 4A3GG 4DLRA 4RD4A 1E1RD 5K8LA 3TJZA 2PPBC 2HYIC 2H92A 4G7HC 1M6NA 2R6DA 3CRW1 3AQQA 3OPOA 2GVDC 4JBJA 2ZJBA 4XWOA 4GPTA 5FR2A 3BWDD 4Z51A 1M74A 1EGAA 2RGCA 4RG1A 4DCTA 1G8YA 4PAOA 3Q8DA 5E7IA 4IDPA 5JWOA 2JIZA 5H68A 1W0KA 1XPOA 1CJKC 3SQXA 2FGKA 1SKQA 1E9DA 1H95A 1LNZA 3L7ZC 1E2PA 4JLPA 1E4YA 4Q19A 1C1YA 3PG5A 4LF5L 1E2EA 2WMNB 3LDAA 4M1YA 2V4ZA 2ZJOA 4C2MH 2AUJD 3R7WA 3W3ZB 5CB8A 2PEYA 1N36Q 2ZAOA 2BE5D 1NBMA 1XFAA 3NHBA 5DN6D 1OSNA 5IK2D 3OW7A 4LF9L 4DUZL 3NWJA 4L5TA 4P72A 2YOFA 5AUQA 5FOWA 3SJCA 2O8CB 1KMHA 3RRNA 2Q2UA 3B78A 3HP1A 2WOJA 4DDTA 2QMOA 3MUFA 2J0QA 4QL5A 2A3RA 1QHSA 3A8IE 4C3ZA 1XCMA 1F2UB 2QSYA 1VTKA 3NDBB 1CUKA 1P2UA 2WHXA 3IBYA 4H9GA 5KNCA 4QBIA 4OWWB 1R0ZA 4URVR 5CM8B 5GQOA 4BLQA 2GEDA 1Z83A 1OHHA 3HOUH 2HIXA 1G3UA 4PV1C 5EUMA 2ZRNA 4X8LA 4A3CH 5AR1A 1NJFA 1Q22A 1RL2A 4HAYA 3A4LA 3DZDA 4IDNA 3H2YA 5EZ5A 2BBOA 2D0PA 3DZ8A 1NI3A 3TQCA 3TEHB 1A1VA 4BZPA 2QMHA 2OCAA 3KUCA 1VDZA 1U8YA 2RKOA 4RD3A 4JYAL 3KF8B 1AS0A 4DUYQ 1R5OA 3AF2A 3QOFA 4DWJA 2FSHA 4IPGA 3VX3A 1WB9A 1P3JA 3BH6A 1SVMA 2FSFA 4O0MA 4R71A 4R4CA 3T53B 1I2MA 2CJWA 2NO7A 4NDZA 1VQNA 4L15A 3U7HB 4DNRB 3T1OA 2NN6G 3OOCA 1T5IA 2GDJA 3FHOA 2IBMA 4D4MA 4O0AA 3HPRA 3F3YA 3Q85A 4GOXA 2QY9A 3L0IB 4B3TL 4BY7H 4WAUA 2LCFA 1Y69U 2OEPA 4ZDWA 3QF4A 4I1VA 3ADKA 4AG6A 1HTWA 1AQUA 3SS8A 2Q9AA 4H1UA 2NTYC 4ARZB 1WCMH 1JPNA 1EWQA 5FPSA 1JR3D 2IYVA 4LK1C 5P21A 3EZ2A 1ONBA 4PPGA 2BCGY 4M1WA 4D25A 1JQJC 3UMSA 5HR5A 4KCGA 3TW8B 5FPTA 1Y8PB 1P2VA 3M7NA 2VP5A 3RLFA 1A2KC 2IF2A 2JGNA 1P60A 1QHYA 3OEED 4A0HA 2IYQA 4HUQA 3OESA 3PF4A 1YHBA 5AJ3Q 2FSGA 4EJSB 1N32Q 2V8OA 2AMCB 3AEZA 2DWOA 821PA 4YLGA 3VR5A 3LXXA 4URUR 4AKIA 2OFXA 3PIOA 5FUYA 3LBIA 1Z63A 3TGPA 3ZD6A 3GJ3A 4MKGA 3A8TA 4TTPA 3WBKA 3MWJA 3Q7QA 1ZUNB 3EZ9A 2XOKA 4ZDIA 5GVSA 2EJGC 2RHSB 1Z0IA 5F9FA 3RS4A 5A4JA 2GILA 4JSTA 2PMKA 3MGCA 1ZM2A 2OV2A 4D2IA 3NH9A 3PO3G 1HUQA 3RWMB 4TSFD 4DSUA 5FTJA 2K5HA 1GHJA 3M1IA 2WJYA 4DR3L 4JBKA 5SZKB 2CQOA 3K53A 1AN0A 2PEZA 2A6ED 3VR3A 3AVPA 2P3SA 2ZRMA 3QPUA 3IEUA 4LJ9A 3WMFA 2NVTH 1VIAA 1E2ZA 2NVXH 3W8NA 3I32A 4MH0R 4ZV4A 3I5YA 4XIGS 2K52A 2OO7A 2R6AA 2FEMA 2IYZA 4MKIA 2JQOA 2C99A 2ZPTX 3VKWA 2ZRIA 2IHFA 1UBGA 3LX5A 1XNJA 3O47A 2JEOA 1UKYA 1NVWQ 3ZGXA 1N5KA 3AP3A 2F4VL 1PLLA 2ZR0A 1PH2A 4QHSA 3TSZA 1MO6A 4A9AA 1H8HA 3L82B 4CEJB 1IN7A 1E1QD 3N70A 4ALPA 2ZE6A 1ZBDA 2XB2A 1GFIA 2Q2TA 3NC1C 1L2FA 3A1VA 3VHLB 4DK3C 4A3DG 1W2HA 1VQLA 4GRAA 5BW8A 2ZM5A 3UDFA 4BLOA 4X66L 3TREA 4JI7Q 2JATA 2WWHA 2ZR9A 4C0JA 3AEVA 2BBSA 2ZTCA 2GJ8A 3W5IA 1XJVA 1TEXA 3CZPA 5CDFE 3HGBA 4PZLA 2A68C 3THOA 5EP1A 5J4HA 3GPLA 2IUUA 3BZCA 3GJ8A 4QGHA 5FL3A 2A5YB 1HZBA 1TQDA 2WSSA 1P2TA 4B3SQ 4G5GA 3L0OA 1W4RA 2IEYA 4U7DA 4Q7LA 5HZKA 3O8RA 1W7AA 1UE6A 1XEXB 2DFKB 3FTQA 4HB2A 1EFHA 4DV1L 3N5CA 5KNDA 5C0XJ 1IXRC 1FL9A 1K6MA 2NQ2C 3E1SA 4JS0A 4C0LA 2EIFA 3OF5A 1DAMA 5C0XI 3KOJA 2JJ1A 3ZLJA 3TBKA 1KI6A 2GXQA 2QSZA 4LFAQ 2ZI6A 3HPQA 4IEEA 4NYJR 2GAAA 4QIWE 5BR8Q 4QRHA 4EQ6A 5JS7A 2W58A 3C14C 1RKBA 3ZQ6A 2X1VA 4BFZA 4MGYR 4A36A 4O2RA 3IIMA 3OIUA 2ZJ5A 2EWWA 4GKKL 3H0KA 4MITA 4OJQA 1FQJA 1HQCA 1TNDA 1ZNXA 3GLFB 4G1UC 4LYAA 1SZPA 5AUNB 1RZ3A 5JWRA 1X3SA 5FFMA 4BQSA 3QBVA 3A4MA 2V55B 3QUSA 3ASZA 1EFTA 2ZRGA 4BFXA 2LKCA 3T1TA 4LUCA 3AGPA 2D5DA 2BOVA 3TRFA 4A3MG 5M5YH 2CWPA 5GAEC 5AJZA 4NCIA 1UAAA 5GADC 1IL2A 3CMAA 1N25A 1G1MA 4FMDB 3KKPA 2CWAA 1AGRA 1NF3A 2HUPA 2QQEA 3K7AH 3MSXA 3SZRA 3U3JA 3GTGH 2J87A 2ZYWX 1XBTA 1JAHA 1IXRA 3DL0A 4NP6A 1P9RA 2CLDX 1YJ9A 4BRWA 4O3MA 2GKSA 2ZQ5A 1AK2A 1L0WA 2ZS8A 4UNPA 3RRYA 4YMUA 1OH8A 3WYFA 4P74A 1SQ5A 3PEWA 1YBYA 2DUDA 1LM0A 4LJ5A 4PHFA 4DB2A 1KD1C 4O2DA 3KXIA 3MXNB 4A3LH 3I4NG 1CR2A 1KQSA 3IIKA 3QQ5A 4MRPA 2QEXA 4OKSA 3X1WA 1MJEA 2RGGA 1ONLA 3TMKA 3SBEA 4MNOA 4CEJA 2UUBQ 5IYCG 2ZUDA 3FPAA 3NKVA 4ASUD 3SJZA 3Q7PA 3NE5B 1NN0A 3WYAA 4DLTA 1XJQA 3Q5EA 1SKYE 1M34E 2VA8A 4JLKA 3AKCA 5CYOA 3G48A 1V9PA 4C2UA 1KI9A 1VQHA 4OK6A 2VEDA 3BZKA 1TQ6A 4JI0Q 1ZYUA 4Q7MB 4C0AC 1D9XA 2G3YA 3DEFA 1IYVA 3H4MA 3KXKA 3QKUA 3EIVA 4BA1I 4JSYA 1EFRD 4L5RC 1E79D 1OIWA 4KODA 4LZZA 4WOPA 5KO2A 4HR7B 2ZSFA 4Q9IA 2A5JA 3KKNA 4AURA 5A35A 2C03A 2PI2E 1M7GA 3N2IA 4DR6Q 4NXML 3HR8A 3I4OA 2PL3A 1NBWA 2ZROA 2HYDA 5JHHB 3EIQA 4K8OA 4IO9A 1B8AA 3UDIA 2PLFA 3SQWA 4TZ6A 5H70A 1KKLA 4FW9A 1GJXA 4DUYL 3FKSA 4HZUB 1SVIA 4IOMA 4EQ6B 4FINA 1GUOA 3L0PA 1E3PA 4TTQA 1FR3A 1N2CE 3DO6A 1QF9A 3T1HL 1YJWA 2ODEA 3C16C 3A0JA 3EX7C 4PC7A 5LMUQ 3A8KE 5IE8A 1GP2A 4R9UC 2NO9A 4PAMA 5AJ3L 1G6HA 4QHTA 4A3JH 1NVUQ 1ZD9A 4MUBA 4DAMA 1DS6A 5CK5A 3CIOA 3EPLA 4LC1A 2ASEA 1FGUA 2NG1A 3EIEA 4A0RA 1S2MA 4E03A 1NJGA 4CEIA 4ZKDA 2ZSEA 2YNMA 4KBFA 4A4DA 2YOHA 3KKQA 3W1GA 3SGIA 1NN5A 1ZNZA 2IHYA 2QUZA 2BMDA 4I99A 4TMTA 5CLQA 5EP4A 4GBMA 1OTCA 3I8SA 5FPKA 3K0XA 4HLDA 4EFMA 3HOVH 4JVLA 4QBGB 2IY5B 2KSQA 4M9ZA 4R7ZA 4DV0L 2V6JA 4QGFA 3J81c 3PIRA 3HKSA 2BHRA 1RRCA 4TLDA 2WWGA 2WWYA 2UXCQ 2F1MA 4KHZA 2HV8A 2JA1A 3TNFA 4Q4HA 1KSGA 5HKKD 4CEHB 4QNRA 2R93H 2EWVA 3A1TA 3CC2A 4OJKA 4LBWA 4K0KL 2E2IH 1Q82C 2GJAA 4MDFA 4CF7A 1IJFA 4L5BA 2J7PA 2C5LA 5LBIA 4DDVA 3SDZA 1YVDA 4YMSA 1EIYB 2WAYA 4TLBA 5BWMA 5JSZB 5LPNA 4UJ3A 4Q48A 4BBRG 5CIQA 2IXFA 1EWHA 2N8NA 1E2NA 5IYDG 1SVSA 2N42A 4RKFA 4X65L 2CHVA 3CMEA 4PZ6A 2XTZA 4TMKA 1KY3A 4ZDJA 1KI6B 2GXUA 2D2EA 3RZDH 3GJXC 3L0SA 4BECA 3M4QA 3GJ6A 3DHWC 4A3MH 3U3OA 4OHVA 3BFKA 2RGNA 1EOVA 4US0R 2ZSBA 4PSVA 1DEKA 1CRPA 1W44A 3B82A 2AX4A 2P6RA 1WRBA 2ZM6L 3SBDA 1X3GA 2GN5A 2EFDB 3RRMA 4YWMA 1T3SA 3A58B 2AWNA 4IFBA 1X65A 1ZW6A 3K8AA 1NP6A 4M1SA 3J7ZC 1C7YA 1YR9A 4OQNA 3UDGA 5K8TA 1CSQA 1U98A 3OIWA 1SLJA 5C0XH 5AWFC 5EQTA 4D0GA 4AIMA 4WA7A 2BKUA 4OQFA 2WWFA 1YZUA 2R7ZG 2F1HA 2FFQA 3NEMA 1NY6A 4DAYB 4DUZQ 1VCIA 4JBXA 5C4GB 3QKTA 2CEAA 3I55A 5FJ8G 4JBMA 1E0JA 2I5HA 2ZR7A 3D0FA 5JEAJ 4OI4A 3SYLA 1EQRA 1D5CA 2GJKA 2I4IA 2G0NA 3H15A 2KHJA 2WMOB 1DG3A 4JI1Q 4A3FH 1XMVA 4QNMA 5DISB 3IDQA 121PA 3X1ZA 1XD2A 5C0XG 1E24A 5DLQC 2KA7A 3BC1A 2B3GA 4OQMA 3ZVRA 4YMTA 4AI6A 4F4CA 1N6KA 2KWIA 2K50A 3J81j 5DO9A 1Q1BA 1BOFA 5FBQB 4D4JA 2ZJ8A 1GIAA 4YCWA 3D8BA 3B9QA 3NELA 1XMQL 2RB4A 4PAQA 1AJEA 1KI7A 4BFTA 4IW3B 3Q9LA 4AYXA 3M0EA 4A3IH 1OW3B 4ERNA 5CB6A 4DR4Q 2W6IA 3AUXA 5DSZA 4C0KA 4ZPXA 3OFNA 1US8B 3KQLA 3TAHA 2O8BA 1Q8KA 2A9KA 1PA6A 4FI3C 4APVA 4D26A 2BE5C 1VYVA 3W34A 1NMGA 3H86A 4UXHA 3PSIA 2GCOA 1QVCA 2EW1A 3FMFA 3IQXA 5M3FH 4CEIB 1WI5A 2YINC 4E22A 4TMXA 4QGAA 2ZUBA 4YWLA 3I4MG 4A82A 2ZRBA 1ZIOA 1IW7D 2IYLD 2JIZD 4PHHA 5IY0A 1D6JA 1MV5A 1WCV1 2WV9A 2G9NA 4DSTA 4DCSA 4JI3Q 1YZLA 4JT2A 1FJGQ 2AK3A 3OEHD 3QI2A 4LHZA 1K83H 2QORA 4QJ3A 5B58C 2F1IA 2NPIA 1G8FA 1TU2B 4B2LA 2ANCA 2AK2A 4DPGA 1W48A 1T91A 3GD7A 1ZKOA 2W2TA 4LF4L 2AFIE 1Z6HA 3ETLA 4MGIR 1P7CA 2VP0A 2GVZC 5L8VA 3GLGA 3U4QB 3VNUA 2IA5A 1JMCA 4FMDF 1G8GA 2QM8A 4MTNA 3QKSA 3A5UA 4IFDI 4LYHA 2DGYA 3U50C 1NVVQ 3T5DA 4KI0A 2R92H 1IY1A 1KSFX 3CCQA 4YCUA 2QTFA 3EXAA 4FIDA 1WXQA 2ZE8A 4PHTA 1G20E 1P73A 5D3MA 1L8QA 4LX0A 1D7QA 1I94Q 4DLXA 3ZJYC 2B21A 4C3JH 3W5JA 4NPSA 1L7VC 4IPHA 1Y1VH 1WP9A 1W3SA 4PQYA 4JV5L 2YVUA 4RD1A 3H0GG 1OXVA 1AS3A 4UXJA 1Q81C 1S4QA 1SVWA 1KK3A 3ZJYA 4B76A 1XNRL 3MLEA 4UKDA 1NMZA 2XZLA 1DTSA 1CJVC 3LVQE 1AA9A 4URYR 3VKHA 3UPUA 1OYYA 4LK2A 2JE6I 3QPWA 3AF1A 1UBEA 4XTRA 3FHTA 2RCNA 1W2BA 1Z6XA 3IIJA 3OE7D 1C9KA 4OQLA 1Y14B 5CJ2A 2V54A 3X1XA 1PH1A 1HNWL 5JS8A 1DD2A 3MG9A 3NBZC 4Q03A 2JA9A 1E4VA 1PH3A 4A75A 4TZ0A 1ETUA 3EARA 4JI6L 1KZGB 4BBSG 1D8TA 1MO4A 4L9SA 4A3CG 3RDPA 3I4NH 1JE5A 4YWKA 2QAGC 4QBHA 1Q12A 4R4TA 3HOUG 2BMFA 4B43A 1US8A 1V5WA 2X8AA 2PLRA 2ZITA 2BEJA 2BKEA 1IBML 3S14H 2IYXA 1CKNA 1AM4D 2ZRPA 1UJ2A 4KITB 1X86B 3GFOA 2BV3A 1JR3A 4JL5A 4D4KA 3VR6A 1VQBA 4FWIB 3IPXA 5BXQC 3MXUA 4X62Q 1N6LA 1C9OA 4A4IA 3CRMA 1OFHA 5KDLA 4DLWA 4BXXH 5IYCH 4PPNA 4NU0A 1UE5A 2MNAA 3OFND 3QG5A 4Q4AB 1W0JD 2J0UB 3C5HA 4BASA 3KQUA 1IN6A 1KKMA 1RIFA 2BBWA 4R4QA 4R98A 2H1LA 5L3VA 2HF9A 4P32A 4MDEA 3BRWD 1T4GA 1CSPA 3CR7A 1P62B 4GLAC 5FPYA 1HQYE 3ULJA 3GEIA 4A3EG 2AD1A 2L5TA 2WWXA 4MQBA 4XH9B 2J41A 2ONJA 2Q3FA 1E9FA 5C1BA 3AYHB 4A3IG 5IWAQ 3DXJC 1VYUA 3HOXG 2RGAA 2HCBA 2KCTA 4RFSB 1QHNA 2WKQA 3OEHA 2K7VA 3WP0A 1E69A 1YZGA 2FU5C 2JLUA 1N6IA 3U9SA 4LFBL 1D9ZA 3CPWA 2PCLA 3EAQA 1R0WA 1Z0JA 3WRXC 3THXB 4PC2A 4C7OA 1MH1A 4LFCL 3NC0C 1GKHA 1F5NA 1XZPA 4MRSA 4KSBA 4XVUA 4JI6Q 5TMPA 1I4DD 1FJGL 2VSOA 3C41J 5HCIA 1VCNA 1TX4B 2XEXA 3H84A 1CEEA 4JBWA 3FHWA 1VQ4A 1EFUA 4GOPA 2BBTA 4YHHL 3LA6A 2ZVPX 5IT5A 3UXMA 3IEVA 4LRWA 3B7GA 4BXXG 2FEOA 4LF6L 3CRLC 1RYHA 2QI9C 2XTIA 3EASA 2CNWA 3PR1A 3REGA 1GHKA 3TQFA 2QP9X 4LFCQ 2QPOA 3AVWA 2WZQA 2BA1A 5JEDA 3E9HA 2VLIA 4DNTB 1Z8FA 2GESA 4Z8XA 2ATWA 2J5XA 3GLHB 4G0NA 4DEYA 1XPRA 3WY9A 3KB2A 3RHFA 2Z0SA 1F48A 2H5EA 4OX9L 4DUGD 1N6NA 4LGMA 3DM3A 2GZDA 3A7AB 4Q9KA 1YHAA 2R93G 2F43A 2N49A 3QF4B 2F3RA 3QKRB 2QQ0A 5ELXA 4YCVA 4CIDA 4A3DH 1QHHA 1LV7A 2WJJA 4WZBE 1W4CA 1RC8A 2CK3A 1Q3HA 1XPUA 4DV6L 3CNOA 1E9EA 3PUZA 2FA9A 1BKDR 1S3SA 4ZKEA 1KAWA 4Q9HA 2O8DA 1BS1A 1Y3AA 4JI5L 3CLVA 1CJUC 4TLEA 2OCBA 4NCNA 4MGZR 2IX0A 4A3BG 2B7CA 5M3MG 1VS0A 2H17A 1R4AA 3CWQA 1XWIA 4TQUS 3NBFA 1HCZA 1BMFD 5EE1A 3V4FA 1ASYA 4CVNA 3ADBA 3LNNA 2QAGA 2L0XA 3PO2H 3MMPA 4FCTA 4DIEA 5TY0A 5CITA 3EQLC 5JCPA 2LSSA 1L2TA 4A3KG 2EYUA 1N34Q 1XMJA 1GKYA 2RHQB 2ALYB 2DFNA 5FOTA 4OL0A 1OH5A 2JLVA 2B92A 3AVUA 1O78A 2G77B 2PCJA 2FFBA 4PZYA 1TPZA 1FP6A 4JC0A 5FUWA 5KSYA 2F55A 4KN4C 3TRZA 2KJQA 2QEQA 4EUNA 1QHXA 3CWZA 3RNLA 2OM2A 3A74A 4RFSA 4DJTA 4EPTA 2FZ4A 1CTMA 2Q9CA 1G7SA 1I4TD 1N33Q 3U60B 4TYYA 2B8GA 4GLVB 4IFDH 5EAYA 2FFAA 3CX7A 3CH5A 2JJQA 3R7WB 1VG1A 4B73A 1ZYRC 1G3MA 1NVXQ 2FPLA 4F92B 4U00A 3CCSA 1QZXA 3I1FA 3SC3A 4B6FA 3FFAA 3EPKA 1TMKA 3UKDA 4EJSA 2OZEA 2HHHQ 1A82A 1K5GA 4TN1A 4US1R 4BFSA 5HZHA 4YY3L 2A19A 1FNMA 3CONA 3LXRA 2EYQA 4M9SA 3DPUA 2NO1A 2IYWA 4V02A 2ZUCA 1NMXA 4IQZA 4PXAA 1VG9B 3KKOA 2EFEB 5FUXA 1SXJC 3GLHA 4UQOA 1J99A 4QM7A 3G6EA 1SVKA 3R9XA 4C7OB 1SMYC 4UNQA 4WVFA 3UIEA 3JZAA 3CRQA 2DB3A 1O7LA 4LFAL 4C0SA 3E0EA 4FMBB 2QZ4A 3F5FA 2Z6KC 3STBC 1G7TA 3AB3A 2IL1A 3BB1A 1SXJE 1S0UA 3MCAA 3I4MH 4BGDA 2G6BA 4QJ5A 5DHFA 3B5JA 4A2QA 1SE8A 3QJYA 2VL6A 1XMOQ 1Q1QA 1XCGB 1ZD8A 2LKDA 1G7RA 2NIPA 2D2CC 2WAQE 3TIFA 2HXSA 3JVUA 2E5LL 3WBJA 1H9JA 4MA4A 4TVAB 2C98A 3S1MH 4DV3L 3KTAB 4BZXA 5JBQA 1EFRA 1J8YF 1OF1A 1K8OA 3CW2C 1VQPA 2CJWB 1KZ7B 2RHDA 2JCSA 4X8HA 5JWHA 4EPRA 4LUOA 1IJEA 3AH8A 4DZZA 1HR0Q 1ZIPA 1PH7A 1M90C 1AKYA 3E2IA 1Z3IX 3LX8A 4NB3A 1ANKA 2CK3D 2WSMA 2GEUA 2A2ZA 4JKIA 2NO0A 3F8TA 4D81A 3JAMc 4LYJA 1SN8A 4LFBQ 1RE0A 5IP9G 3W3AA 2CFMA 1IW7C 4NXNQ 2FGJA 3BFVA 2AXPA 3PUWA 1OH6A 1DOAA 5FBVB 2Q3MA 1E2DA 4DR7Q 3PCRB 4KAXA 2J46A 3K0FB 4UXIA 1GL6A 3PF5A 3BDOA 1O7IA 2FWRA 2OESA 2EFHB 3K9NA 4JIMA 3MWYW 2EDGA 5ANRB 5IDVA 3W6OA 3GLGE 2K4KA 3FMIA 4ZO4A 4D82A 4IJHA 5KYKA 4LHVA 8OHMA 1A5TA 1E2FA 1FX0A 2CCGA 2EU8A 2UXBQ 3G82C 3MWKA 5FUVA 2NZOA 3IHWA 2ANBA 3PIPA 1XF9A 2ZVQX 4QBFA 421PA 3F2CA 3SU8A 3IPYA 1NKTA 3AV0B 4XWAA 4U5XA 2W2VA 3AM1A 4AQYL 2A68D 2EQSA 3NIBA 4RCNA 2XNDA 1G8PA 2Y0SE 4Y0VA 2X2FA 1UBFA 4DLYA 3D31A 2N3SA 3SEAA 4ESVA 3L8YA 1KO4A 3ZVLA 2J9RA 4MKHA 2ZJ2A 3TUIC 1JNYA 3CUEF 3P27A 1IN8A 2BJWA 2C78A 1UADA 3GEEA 1Z06A 3P32A 1DAIA 2R9VA 3J81k 1XXHE 4UP8A 3UMFA 3HOYG 1YHQA 1ZINA 4KYIB 4MRRA 4YMWA 1WDTA 2VSXA 4B47A 1A62A 4ITRC 3T61A 3ZD7A 5JJIA 2H18A 1X55A 1DBSA 2VP6A 4G5RA 2QT1A 1N34L 1G3QA 2OLJA 4B3FX 4PC6A 4TMZA 4AKGA 2REXB 1BBWA 2G0TA 2OILA 3D4RA 4POGA 2EFCB 1OXUA 1Q1ZA 2GCPA 1X3FA 1JAIA 2QENA 1CR4A 4HATA 5KHOC 3KQNA 2A6EC 4IRUB 1NNEA 3K8YA 1DE0A 1PHJA 4YXWD 4LJ7A 3LBNA 2NZ8A 4B3CA 3CC7A 2Q2HA 1XU4A 1ZP6A 3EIHA 3IHLA 1K8RA 3OYYA 1L1OC 2IYSA 2CXXA 4GZLA 1GITA 1TAGA 4FN5A 1E0SA 3R20A 4JLAA 1MOZA 5L3SB 2GEVA 1QJOA 3KFVA 2O8FA 4JK1C 2P65A 3C7KA 3LNCA 3GTKH 1JEDA 2WTUA 1UEJA 4ABYA 4LV8B 3CRRA 3IGFA 3K1JA 2CE2X 5L3SA 4WZ6A 1VHLA 4FXPA 5EXXA 3RC3A 4F91B 1VG8A 2PT5A 4XTCS 2VS1A 5H1YA 3CF5A 2DWQA 1NG1A 3B1WA 3TZUA 3LBHA 4DLSA 4V0OA 3K81C 1BO6A 4O2LA 1OYWA 1ZC4A 4Q9LA 2WSSD 3RN2A 1PLKA 4FMCF 4V0NA 4H13C 2ERXA 4HAUA 4OO1H 1T6NA 2XSZA 4GOPC 1ZM7A 1N8RC 4QKQA 5EJEA 3HKZE 2YWGA 3MJHA 4Z1MD 1KL9A 2PCFB 4HLUA 2CVHA 3KF6B 3BOSA 1KO7A 2R7DA 4JLVA 5KSZA 2KCCA 3NBYC 4TL7A 3AUYA 4JVSB 4JL8A 4I1UA 1KIXA 2A5FA 2PMDA 1HZ9A 2VTKA 2A6HD 5BN5A 1II9A 1W5SA 4CRWB 3ERSX 2ZRCA 1XTSA 2B7BA 3M6AA 1U0LA 4KV9A 3I61A 5DLQE 3CCLA 1CIPA 1LUZA 2FPKA 4PFSA 3U4QA 4URWR 3T51B 3PO2G 1VQDA 5JI3E 2E74C 1N6RA 1Y1WH 1COWA 1VQOA 4U02A 5FTLA 1WFQA 2YOGA 1ZUHA 1A6XA 1G291 5EE0A 4AKHA 3DM5A 1E9SA 3FMOB 1DADA 3QG1A 2QM7A 2GF9A 3S2DH 1G3IA 1JQLB 1N5JA 1UBCA 1U9IA 1VYTA 2A30A 4ON9A 4DT1B 3VKGA 1A63A 2E76C 1G6PA 2Z4SA 1NLYA 2ATVA 5DIFA 3H3VI 4BUJA 3STBD 1B7YB 2ONKA 3CX6A 4W5JA 4R1JA 5CK4A 5KSPA 4S2EA 4YMVA 1MIUA 1EFCA 4WIAA 5GJBA 3FDIA 2AXNA 2K32A 2I1VB 1J8MF 221PA 4DBLC 3F1ZA 2UUCL 1EWRA 4LPSA 3R9IA 1I4LD 4PZ8A 4C2TA 3GLIA 4LV5B 4N0EA 2KBNA 2QRNA 3Q8XB 4LW1A 2XXAB 1E6CA 1KC8C 2RAPA 1WCMG 1CKMA 3AVYA 1YEZA 2JJ2A 2WJVA 2O0KA 4DV1Q 1K0RA 1S1CA 1Y8NB 4KFRA 4X8MA 3TKLA 3P4XA 4BLSA 4QXAA 1ZCAA 2IX3A 4DLVA 1W36B 2CLSA 3B1VA 2DBYA 1ZAKA 1JR3E 1PH4A 1IXSB 1HPCA 5E7NA 4LNQA 1B9NA 1VQ8A 1GSIA 1N6HA 3GEHA 2EJMA 1DG1G 1Z9FA 4WW0A 4ZIRA 2V1UA 2R6FA 4N0DA 4YXWA 4A76A 621PA 3GLHE 1X8LA 3T1YL 2OT3B 2VL7A 3IILA 4JVNA 4JBYA 4LF7L 1Z7TA 4X66Q 1T9HA 4B3BA 2WWIA 4DKAC 4UPAA 3RLOA 1U8ZA 3QEJA 4G5QA 4OGQC 1LACA 3LO5A 1F2TB 3K0CA 3NEYA 5C4JH 1DGSA 1GWNA 2N78A 2OHFA 2PI2A 4GNXB 5G41A 1G64A 2ZRLA 3ULPA 4HAZA 3PXGA 3V4RA 2IS2A 1KNXA 1E0KA 5KDOA 1HR0W 1A2BA 2XZPA 1NJIC 1NN1A 3BXZA 1TWCH 4A2WA 2BH2A 2K75A 2VF8A 2BWJA 1GUGA 2JLZA 2ZYTX 3PQCA 1RIPA 3RSLA 5GROA 3B1XA 3LGJA 4W7SA 5B64A 3AVQA 2FPMA 3TAUA 3I2ZA 4BLPA 3AF3A 1W4AA 4LOAA 1SVLA 3X2SA 4A6PA 3ZS9A 4TYNA 3DLLA 4OWTB 4JI0L 2UUAQ 2J3EA 2GXSA 3A1WA 3WNBA 1N0UA 2W6JA 2FH5B 2K5UA 4B6EA 5TV2A 3QXSA 4LF8Q 4RJLA 4RZXA 2QAJA 5M3FG 3QENA 5L3QA 2J7KA 4DRZA 2XNSA 4X62L 4A3KH 2C9YA 3OW2A 1CTQA 2EVBA 2VHTA 3B1YA 2JA6H 3SOPA 1IYUA 3MFYA 1CP2A 3QEOA 1E98A 5FOUA 5FLXc 1YI2A 2OFWA 2ORIA 4QG7A 5BQ5A 5G53C 3K9HA 1OXTA 2BMEA 1G51A 4BZQA 4IPCA 2V4DA 3CCRA 4Q21A 2BIFA 1UDWA 3RS7A 4ESHA 1I50H 1CF4A 4AYTA 4YONB 1W0JA 4MYUA 1CU1A 5JZVA 4IOLA 4PX9A 3CO5A 5AJWA 4L5SA 4DLUA 4GKJQ 2K5NA 2WP8J 3EC2A 4RVCA 1NBME 4YDHB 3HKZG 3VAAA 2LXKA 1W2GA 1OKKD 3PO3H 2KBEA 2ZS7A 1R0YA 3BB3A 5DE3A 2FE4A 3RC8A 3HYRA 2QE7D 1H9SB 3KJOA 2AN9A 4DDUA 1OFUX 2ZI7A 3W6PA 1ZUIA 2QA5A 3ZS8A 3I3SR 1H8HD 3LFUA 1QUQB 4DCVA 1WBDA 3T5GA 3S1RH 1NSTA 2WJIA 3AQ4A 3CZQA 1NIJA 2KI5A 1G5RA 1E9AA 1G8HA 1UKEA 3I92A 3AKDA 5TB5A 4CT5A 4D6PA 4F4IA 5DYIA 2N46A 2WOOA 3W8RA 1I94L 4KLKA 5AUPB 1KY2A 3ADCA 3AFQA 5JECA 2AUKA 3ULLA 2YWEA 3Q5DA 2X77A 1NKSA 1FL0A 1SR3A 1LTQA 1XTKA 2UXCL 1P4SA 1XMIA 4BFVA 3AF0A 3HYTA 1R7RA 1CJMA 1KMQA 3KDFA 4RMFA 1FW6A 3VNVA 4OX9Q 4GN3B 2E2JH 3HJNA 4XJXA 1A4RA 1OLOA 2A6HC 2BVNA 3IQWA 1KI4A 2JEAI 2ZRAA 5JJLA 1GOTA 4WXPA 3A1SA 3LRPA 2JXMB 2O8CA 5EXSA 1XX6A 5CYPA 5GADl 2XTNA 2C8VA 4M22A 2A8VA 1YVCA 3S17H 1E96A 3JZMA 2QU8A 1K9MC 5IYBG 4LHWA 1YR7A 2LMCB 3ZZ0A 4JI8Q 2HJVA 2FOLA 1WBBA 2GCOB 2HT1A 2CHQA 3L2OB 2NZHA 4Q1CA 1E32A 4DXAA 3C5CA 1E9BA 4AKEA 4KHPL 1Z2AA 2OBMA 2E75C 1CS4C 3M9BA 1BYIA 1M7BA 4H1VA 1OV4A 4DR5L 1JJ2A 1W0KD 3OAAD 4P75A 4L9WA 2B8WA 2V1CC 3QXCA 1W47A 1DAFA 2MSCB 1UWVA 1X8KA 3M85A 1PZNA 2N1BA 1ZM9A 2XZOA 5IYBH 5M5XH 1ZNYA 3GLFE 1HNXQ 1R5NA 2CL0X 4HDOB 4WBSA 5DN6A 3CPFA 2Z83A 1CI3M 1H65A 4MYCA 3ZVMA 2VHUA 2FN4A 1X6VA 4JJKA 3ZZUA 1G16A 1F3OA 1G17A 1P61B 1SXJA 1KHTA 3KLRA 2OWOA 4DV6Q 1CR1A 2JEBI 3AVVA 3RAPR 5JCZA 4I1OA 4I4LA 3IKJA 1GDDA 4HIDA 1KYIA 1HE8B 1Q20A 1TKWB 1G5PA 3FGNA 3K0EA 2AKWB 1Y1WG 3CPEA 4IXMA 3VTKA 4EFLA 2OQ0A 3GLFA 5J47A 1VKJA 1GILA 4QJ4A 2D62A 3J80i 1U5KA 1I2DA 3TLXA 4ZI3A 1L1OA 2HJGA 4TYPA 3QVUA 3KYHC 1ZU4A 2E1RA 4LF4Q 4PHGA 4ASUA 5FOXA 2X2EA 4Q4JB 1Q57A 1Z5ZA 1ZM3A 3OIYA 5JEEA 1IBLQ 1KOFA 4HAXA 2WPDD 2E8GA 3S1NH 1GM5A 1NMFA 1VQIA 4H02A 1KDPA 4CW7A 2O8DB 4PZ7A 4AC9A 3HOZG 1NBMD 2VW9A 4TL6A 3RLNA 1DCZA 1E2QA 4P4UA 5GJCA 4DSOA 4KN7C 4CEHA 1M1YE 1YIJA 2D7CA 4ILEA 4M1OA 2BM0A 3KQHA 4HEJA 3PUVA 3I62A 1GUTA 1XTJA 1D2NA 4OBEA 4OK5A 1XNQL 4OHYA 2FDCA 1GUSA 1QBKC 4GZYC 1WJJA 1FUKA 5L3RA 3B85A 3CPJB 2R7FA 1CRQA 2C77A 2K33A 2V6IA 3S24A 1BKBA 3IUYA 4HB3A 3QXJA 3FP9A 1VQ5A 3FB4A 5HPYB 3U44B 3N2EA 3DM9B 1SRUA 4B3RQ 4GFDA 4DR4L 2VYFA 2WAQG 1UE1A 4RCYA 2DN8A 1N36L 4GN4B 4JLBA 1N0WA 4LF8L 2JAQA 1HTPA 1X9NA 4DK0A 2JA6G 1GNRA 1KI3A 1NMYA 4PANA 5HE8A 2F3TA 2J1LA 1LW7A 2OCYC 4C0BA 3EZFA 1FP7A 2QL6A 4C3HH 1E2KA 2FSIA 2WJHA 1YZTA 4OONA 4IEIA 4DR2Q 1Z08A 3P20A 1T0JB 1HA3A 1C4OA 1YNJC 1E2IA 3SYNA 2F52A 1TADA 2YC4C 3HOVG 1LABA 3THYB 3F2BA 2QPAA 4JYCA 1IY2A 4Y0AA 1JECA 2JK8A 4FDBA 3KJGA 4NYMR 3VR1A 4AYBG 2QBYB 1NE3A 4B44A 3KLWA 1NL3A 1XD9A 3M4OH 1N5IA 3HFZB 4PG3A 1H9RA 2RF4A 1E94E 1N0VC 4IFEA 1SFOH 1VCMA 1V1QA 2VHJA 3X1YA 2C35B 1N6OA 3MWLA 1JR6A 3AP1A 4OO1I 5LMUL 2QGQA 3NENA 1G4UR 1R2QA 5FBLB 1VF7A 1H9KA 1X6OA 4BBRH 1P9WA 4OHZA 2WICA 1QVFA 1SXJD 2VQSA 4PQRA 4DV2L 5C44G 4A8JA 2ZM6Q 4XWKA 4W9MC 3T06B 3KX2A 3I73A 5CDFA 1ZRHA 3B1ZA 5FJ8H 4PR0A 3ICQB 4AYWA 3W6NA 1U0JA 4JLNA 2WJGA 4N3NA 4A8JB 1G9XA 3MAAC 1WF3A 1CR0A 4JLOA 4OWXB 1AE3A 3VMFA 1E2HA 2Z4RA 1XNRQ 1VMAA 1DO0A 1MKHA 3KTAA 2UUAL 1J7KA 1DAGA 4QL3A 1FOEB 1E1TA 1D2EA 2F43B 3QKRA 4IJLA 3GTMH 2UXBL 1H8EA 1Q86C 3FPPA 2F9LA 2PZGA 5K8IA 2PX3A 1N6PA 2PZFA 4JCVE 3I56A 2IT1A 2R62A 4V03A 3ICEA 4URZR 1FTSA 4GI7A 1P16A 4NHOA 1W4BA 2J45A 4ZCIA 1M7HA 1JPJA 1E3MA 1HNXL 4I1SA 2B63G 4KFSA 2PJZA 3ZIAD 1RPZA 3RVBA 1FNNA 4B75A 2H16A 3GTQH 1E7ZA 1XD8A 1ZJ6A 4NXNL 4KLZA 5DNYB 2KE5A 5FL7D 3K09A 3M4PA 2C96A 2P6NA 1IZ6A 2NMVA 2GXAA 2MMGA 2E2HH 3K80C 3P1JA 4HLCA 2ZANA 2IW3A 2DR3A 3L43A 4X64L 4POAA 1D8LA 5ELOA 3TS2A 2BMJA 1HURA 2XJ4A 1ASZA 3T56B 2CMKA 2MSEB 2O0HA 2QA4A 1GUNA 1K8GA 3J7A5 1MO5A 1HNWQ 1MT0A 2GA8A 2RGNC 3O8BA 4P0TA 4DCUA 1SMXA 1IM2A 4B3GA 3HOZH 1PH9A 4JJZA 4PSKA 4QC2A 1HNZL 3U6KA 1QDEA 2WFWA 5EE9A 5DI9A 4G01B 1VQ9A 1P5ZB 5KPJA 2IWRA 2D4HA 1QRAA 3S2HH 2ZRHA 2PQAB 4UJ5A 4OHWA 1CXZA 1YZ6A 3BFXA 3QNUA 5FR1A 5JRZA 4Q4JA 1U8AA 3JC66 2QBYA 1HJPA 4OI1A 4JYBA 4HAWA 1VQEA 2Q2IA 1LY1A 2Y0SG 3EA5A 1G21E 2IHEA 2JA5G 4JI5Q 1KK1A 5FOSA 1XB2A 4JLMA 3S1QH 3OIVA 3K0SA 5DH9A 4DV4L 3OEEA 2R6GA 3BG3A 1FVIA 5FOVA 2PNHA 4A1FA 4JLDA 1Q1EA 4I81A 1EX7A 5GAHC 1NLZA 4IXNA 3WDNA 5TARA 3RZOH 2ZE5A 4LF5Q 3NHAA 1DAKA 3CF0A 1Y1VG 1S3OA 2IS1A 4KJZA 4FCVA 4BLRA 1HY3A 1NN3A 1G18A 1GTVA 1TL7C 2Q8IB 4DR3Q 4L5QA 4B33A 2IUTA 1VQMA 3ZZTA 3V9PA 2IEZA 2O5JC 2JA8G 4A3GH 3U44A 2UXDQ 2OXCA 4R2IA 5EZ6B 1E2GA 2HLDA 3CBQA 3EWSA 4NKRA 2CLCX 4K46A 5B57C 1CKNB 2QTHA 1G6OA 3R8CA 4LUVA 2AHOB 1NY5A 3ONWA 4A15A 2XITA 4DR5Q 2D7DA 4DV3Q 2BDTA 4Q1EA 2HIVA 2GHIA 4CYMA 1FUUA 3U3KA 3P26A 3C8UA 4AYBE 1JJVA 4LF7Q 2W00A 4Q4AA 4DKXA 4DNIA 2DNCA 4G7ZC 1JB7A 1JEEA 2ZSDA
chains in the Genus database with same CATH superfamily
4TM7A 2R8YA 3HXMA 2DHRA 4TRMA 4PBTA 2H06A 4FD2A 1CZRA 5IK2A 1QHIA 3HY6A 1QKIA 4W6ZA 2WM3A 5C0OE 5F5LA 4O4HA 3O74A 2XWSA 1PGPA 2AZMA 3DL7A 3TMYA 2GHQA 1XNHA 3FOCA 3U7JA 1UKZA 3VC2A 3K16A 3OZXA 2VSFA 4ID9A 5AKXA 5A0FA 3DJYA 1XNRB 2I3BA 1M2VB 3O8OA 3TKYA 1DAOA 2CW0C 1OXXK 4KFTA 3SLGA 4G4GA 5C31A 3UQYS 4YAKA 4KR2A 1X1RA 1U1IA 3UK6A 1DEXA 4QYWA 1BE6A 3HBAA 3HKEB 4IO1A 3HL4A 3CC4A 4MR8A 1XDUA 3B6MA 2IHKA 2PGJA 1YKSA 1NIPA 2VDKB 5DTIA 3PA6A 1MRNA 3STWA 4YRSA 3GMDA 4OGFA 1PH5A 2D1YA 5CPFA 3UGKA 4ADSG 2NN6I 1V43A 4C3IG 4WUTA 4ES6A 1KVSA 4F84A 5HSGA 4P36A 2XDQB 2IRWA 3NPAA 1EXWA 2NVOA 2QN6A 4YIJA 4MGHA 2IS6A 2ZU6A 3CLUC 3HM2A 4Q1BA 1KIAA 1Y48E 1ZGBA 1JXQA 4EG8A 2O7RA 5BR4A 5SY9A 4GPZA 2W6NA 4FOSA 4N65A 2IIQA 3PX7A 5JAIA 3MRVA 2PQMA 3BXHA 3F7MA 2WKRA 5BY2A 1Q6YA 2EY2A 3GDOA 4A8PA 1RJFA 1V7ZA 1P4RA 1ICFB 2D4AA 3UUEA 4CL2A 1KI8A 1TWHH 3A6EA 1YZHA 2F7SA 4KXFB 3Q7EA 4OYRA 4DADA 4B4KA 5AM2A 4UMFA 1YIAA 4PSCA 3ND5A 1HT2E 4ZIRB 3AP2A 2WSIA 4D9IA 1YH3A 4DB4A 1SD2A 2LWIA 3I53A 2OD7A 3O3MB 4UUBA 3C6ZA 2IUYA 3GQBA 1KORA 1PO7A 3L0BA 4LQLA 2FZ5A 2H11A 4KWTA 1P9NA 1YFKA 4G0QA 4WI1A 4GO1A 5C2JB 1A2UA 3SZLA 1M8PA 1KLUD 3RUFA 4ZUIA 3RU3A 2JARA 3VI4B 4B3DA 4AH6A 2BFDA 4FHCA 4CM8A 3EH2A 2XGGA 1MG5A 521PA 5CB4F 4UQLA 4HXYA 2VNUD 2WW8A 3O31A 4ZV9A 3TOVA 4WOKA 4LZJA 1UDXA 1VGRA 1WXDA 2FG6C 2ZSHA 3BKXA 4PLYA 4EW2A 5LNK1 1EESA 2MR5A 2BR4A 4DGQA 5AVZA 4JXZA 5FA6A 3O82A 4P86A 2V59A 3IVGA 3WB2A 1N7IA 2K14A 1YE8A 4J6EA 4TKVB 4DLPA 4AG5A 2GJSA 2GNOA 3HOWG 4A3FB 2H65A 3GIDA 4BNXA 5KNLA 5KYTA 2F1RA 1HGXA 1MB2A 1MJHA 3D6AA 4IPTA 2M6KA 1XXHB 1Y42X 1TWHB 4ZRZA 2AHOA 4UTXA 1JHRA 3BERA 5EE5B 5E95A 2BSQA 1LRKA 4RYDA 1DARA 3BMCA 4MPDA 3UAYA 4MYHA 4AIIA 4DQDA 2C7BA 2DJFC 1XTIA 3B6EA 4DQLA 2VHQA 3EBEA 1IBMQ 2OTJA 3LW8A 4GMFA 1B00A 5FYQA 4KU4A 2DKFA 1K63A 4P3XA 3MUEA 4FYPA 4KQ2A 2AC4A 2GAOA 3CX4A 4GLFA 2BDOA 1O9GA 5BRNA 5SYAA 5AICA 4G24A 4F5YA 4LXGA 2VTDA 3RIEA 4ISCA 5J4LA 5JCXA 1DMRA 5M29A 2HCRA 4OXYA 4FB5A 3KR0A 1Y9JA 3KZKA 3PNSA 4JB8A 3U1VA 3SDBA 5CV4A 4AZ3B 1QIFA 5HURA 3NT5A 3WL5A 3EPJA 1LB1B 1OA1A 4RGMA 2V7TA 5A0TA 1GL7A 2LXNA 4B6RA 1CD5A 5JFOA 1U7PA 3I8ZA 1IXZA 1GQFA 3FRPB 2RI1A 4A0FA 1XZHA 2BEKA 1MC4A 3TP5A 4Y6PA 4BJ6A 5JZSA 2P9EA 4U2KA 2WMYA 1SBZA 5E6RA 2FMXA 3G9ZA 2QV7A 2QUJA 3E8XA 2C2BA 5ES3A 3Q6SA 5FTWA 3OO1A 5KCMA 3A9CA 1LPBB 4YJDA 3T1NA 1FP4B 4MS3A 1GAJA 3UUWA 2NPFA 3E03A 3AW8A 3GROA 1MABA 2JFYA 1GKUB 4RPIA 1AZWA 4ND8B 1E3DA 1JI0A 2R7MA 2KBFA 4XD2A 4G7OC 3EQ7A 4YA6A 2NZ1D 2VP2A 1QHHB 1BBUA 4KG7A 1PDVA 2QLMA 3KB1A 2NN6H 3ENKA 1R3DA 1II8B 2OPHA 3I9FA 3G6WA 3Q9NA 3MF4A 5GJWC 1NXWA 5BR8L 2B20A 3D0OA 1D1TA 1Z5OA 3DWGA 3IPLA 5EJAA 5CCEA 5IH7A 2NU8A 4RSGA 3LQKA 4O3FA 2EC5A 4ARUA 2IYUA 1KVTA 3GRUA 5EBCA 3WIVA 4RDCA 2VJAA 1THMA 4N7MA 5E1OA 4E7OA 2R751 3RS2A 1NXPA 4D3DA 3U13A 1CNMA 4ZICA 4B3SL 3BDCA 1V16B 3G0OA 4AS2A 3A2MA 2FZWA 3DCNA 2LPMA 3G6KA 3OHMA 1CV2A 4P33A 3CXCA 4IFIA 4ZT3A 3V42A 1I8TA 2YUTA 3HO8A 1JSCA 1M72A 4TRNA 3SWWA 3OA0A 4OAQA 3KJNA 2QMUA 5KYLA 1JDNA 1FMJA 1LI4A 2A3NA 1VSQA 3II6X 4KVGA 3SXUB 1HYQA 2OTLA 2RHRA 1JXOA 1A96A 3U4VA 1P0IA 2GH1A 4H1TA 3LVRE 4LRXA 3THXA 1KO5A 3WAGA 2WK1A 3BMNB 1BMDA 3PUYA 4ESEA 1GGEA 2UZIR 1OC4A 1CF2O 1PV4A 1D2AA 2JP1A 1GYQA 3KTDA 1YHNA 4M9XA 3L77A 4IGKA 3WNCA 1NXVA 2UU9B 1S8NA 5JI2E 1GXSA 2JLWA 4GX0A 1SUCA 2IH5A 4D98A 3GTPH 2C1ZA 3R93A 2RHHA 3CSDA 2QRZA 2YYZA 1GO3E 1H1LB 2J3IA 1DC3A 2F3IA 2ECKA 3KDSE 4LZAA 4PLHA 4RVDA 3OJ0A 2CF6A 5LUBA 1Z4MA 4ZYZA 5JZ9A 2B34A 5EPUA 3RR2A 2PL9A 2RG7A 4ZHSA 5KNCD 3RMHA 3IDZA 2DPXA 4WXHA 1W49A 2QT9A 3OCJA 5B1EA 1KMHB 4DA0A 5REQA 4EVQA 1EL0A 4GL4A 1PRTD 3L7NA 4AIRA 3KHTA 2JCXA 1W93A 3FNRA 5JASA 4OQ4A 4YREA 1PTKA 1SHKA 3NBXX 4TWZA 5EHXA 5BOVA 3BRSA 5BW4A 4JI3L 1MO3A 1PR1A 5AW8A 1ZN9A 4ZAZA 2FSVC 3VPHA 3CCBA 4HUTA 1GGHA 1USGA 4MKFA 1SN7A 3NX4A 4XEUA 3DMNA 2EX4A 3L8CA 5K1ZA 4OVKA 4YV0A 3EVDA 3C7TA 2C0PA 2G04A 3LT1A 2V7QD 2DHDA 2ODAA 3OOSA 4YJFB 4O2BA 3VUEA 2NU7B 3AB8A 5EPEA 4FP9A 5M5WB 4FFSA 4Z2YA 3Q8LA 2HK9A 4JI8L 3V8NA 1CWUA 2QN1A 3HDTA 4HYYA 3E23A 2QU7A 1FUYB 3H9GA 3LV8A 4IOKA 3S6JA 3LFHA 4E5PA 2Z8ZA 1WVIA 2JA7H 4XYQA 3GTPB 2DGDA 1Q44A 3MTSA 3FBGA 3BB4A 3HR4A 4CF3A 1Q7RA 3PV0A 2IH2A 1YV9A 2AHRA 2ZEJA 5AW1A 1H6BA 4PLVA 5SICE 5K7SA 1BMFA 1V26A 4P81A 2NSDA 6YASA 2TMPA 5H7XA 4NOKA 4ODIA 2QM3A 5DNDA 3UJDA 2QE6A 3V9AA 3J7YW 2C7PA 4IF6A 3S16H 1E2VA 3DP9A 3LWDA 2CVPA 1PS8A 3CZ9A 4FZVA 3CP0A 4GI1A 4K40A 3WOEA 5EL0A 4BVAA 1F8XA 4RTKA 3FHJA 1YUBA 1XGKA 2CNOA 3EGEA 4M1TA 1ESNA 1JE0A 3TECE 2Y0SB 1BQQT 2JAXA 3E05A 1GGMA 1XTCD 2XVAA 3R76A 4AXBA 4UP7A 4MVJG 4CJXA 5BW5A 2XOKD 4O4JF 5L95A 4BCCA 2ZBPA 1DINA 3BMQA 3FNEA 4LMRA 4ZCTA 2PU5A 2F00A 3E2PA 1OB5A 3AEYA 1DXQA 3F7OA 3PKIA 1T1RA 1KO1A 1DC5A 3RH0A 5HKAA 3ISJA 4D9CA 3N59A 2ORVA 4MV9A 1IPHA 2QW8A 4TTTS 4JYAQ 3GZ4A 2J59A 1MQ9A 3N0XA 4L28A 4Y1EA 1EXDA 5M5WH 2L42A 4U1RA 4GPEA 3T13A 5BNWA 4DREA 1N1EA 1AY0A 2IDKA 3UFXA 1H9SA 1JDJA 2CBXA 3BYYB 1GG8A 4L6CA 5ILQA 4CQLA 4DUGA 2YIJA 3GV3A 4HSPA 2J7PD 2Q4RA 3V48A 2XUAA 3SYKA 3VYSA 1PHRA 1MGOA 3KBOA 2F9MA 3DE5X 4EWLA 4LNUA 3U7FB 1JB1A 4TTAA 3CWCA 4G0VA 3EA6A 1Z22A 4QEDA 3RSFA 3HRZC 2IXTA 4L8GA 4UMDA 3S99A 5KOYA 4UTRA 1RI5A 1QHFA 4QASA 5BSEA 2OFPA 4WHMA 3TI7A 3ANMA 5D3DA 5C3EB 1J9GA 2YWFA 2W0MA 2G28A 3BX1A 3LK7A 4UREA 5EUBA 5JFTA 3GLIB 2D74A 2WMDA 3PFWO 1GVNB 2ILVA 3D6CA 4IXWA 1ODFA 4P54A 5HG0A 4TL9A 3SR0A 2EXDA 3AF5A 2IU0A 1SE4A 4MW5A 2QJOA 1UBJS 3IBSA 2PUCA 3TM4A 1OI4A 4YS6A 1NV9A 3VJMA 2Q5IA 5EA2A 1PL6A 1IG0A 1QC5A 4MIUA 1JIXA 2D00A 5EJ9A 5T7BA 4KQ1A 5EIXA 4QUBA 1FK8A 3ZY3A 4GS3A 1KU0A 1P45A 2YHSA 4OEHA 2JA2A 4EECA 1YR8A 4A3FG 3CF4G 2W43A 1NWHA 2Q4EA 1C4QA 1J9EA 1R9JA 2X3FA 4IIUA 5GJVC 1IBRA 3T1QA 5LYJB 4ZEOA 3GLQA 1OROA 4PPFA 1E7MA 1ZNWA 1YI8A 1B3QA 2DWPA 2IXEA 4NFHA 4PSAA 4RD2A 1DOZA 1JJCB 1HQDA 1YWGO 3K32A 3A2KA 1L1QA 2WYIA 2PX8A 3OMLA 4POFA 4XXHA 5DMHA 1AS2A 3GFRA 4PGMA 5J3BA 4JEUA 1KAGA 1WU7A 2ZK7A 1UBHS 1UPTA 3NH6A 5BT9A 5IMSA 3WLNA 3M3DA 5JYBA 4JUDX 5A9SB 1FSFA 2V9ZA 4OBBA 5C3EH 5AHOA 3TPZA 3O5AA 3UDXA 1YSCA 2Z6KA 4Z7OB 1K3RA 3WWYA 3U3ZA 3EG9A 1KZ6A 3WSTA 1QQ7A 1KSHA 1Q7EA 1B7GO 1Z29A 2ID7A 2XEDA 2XV1A 2ZI9A 3QOYA 4HUQB 4J1QA 4UUNA 3T1HB 3ENNA 2HN9A 3A37A 4RZQA 2ZRJA 2GCEA 1GRCA 1J5EL 3L93A 4JCOA 1I5RA 2R2AA 3LZCA 4Q1DA 4QDTA 4M0DA 4CM4B 4EFNA 2Q62A 1QR2A 5I8PA 5KOHA 4DSNA 1V6CA 1Y7LA 3BRCA 1YRBA 5AI9A 3OJXA 3GXOA 1LWOA 5HIJA 3HG7A 3ED5A 4JP5A 3EN2A 2C7RA 4ITVA 4TYQA 4FJ1A 4YRAA 5TDHA 4OQXA 1EX1A 1AX9A 2Q3DA 2CE7A 3C15C 3WYDA 4E94A 4RUKA 1OZ0A 2WF9A 3UMRA 5KWJA 3CJQA 5ALGA 1EUQA 4HB4A 1LTTD 1FU7A 2G5PA 1GTSA 2F62A 4ALJA 5T4HA 2EJFC 1Q21A 2H3HA 5LA6F 2ZYDA 4U7HA 1R5JA 3JZFA 2EJVA 1U1DA 3KJHA 1J09A 5IBRA 4KPEC 4O25A 1LPMA 2DG2A 1Z0ZA 4LA4A 2VDPB 2GPYA 4RJJA 1LFDB 3LFTA 2XLBA 1T5LA 2JAHA 3ELYA 3VH4A 4EHHA 4JYAB 1RDPD 3ZOZA 1GAEO 1BCPC 2G72A 4EPXA 5LZ5A 1BX1A 3W5OA 3FWHA 1UEIA 2ZJ3A 3PEVA 1W6UA 4PG4A 4QVGA 3EEIA 1ZI6A 5H3CA 1K4KA 1DJRD 1I1NA 1G5TA 2PWAA 4ARAA 4LNHA 1ZA1A 1XR3A 3OQHA 3D8TA 1T9GR 4OP2A 2P0EA 2PNRC 3ADDA 1YNXA 5FI5A 4RTMA 2CB9A 3D6JA 4O2AB 4Y9SA 3U3RA 4PM4A 2CVFA 3L5KA 3UWOA 3H0GB 3JATB 4MLCA 3VM6A 1MOSA 2ERCA 2PZLA 4HVTA 5J2TA 1BO0A 3R3XA 4OJNA 3V2HA 3SICE 4UNNA 4PXSA 5JEAH 1JALA 2VDWB 1IYZA 5FTNA 2G5GX 1K7XB 4QGBA 3S2SA 1V3UA 2IPLA 4BTVA 1XCJA 2ZW9A 3QMMA 4DHEA 4EGQA 5JSZA 1PQYA 2APJA 2G09A 2PZKA 4TVKA 4E33A 1DBPA 1TO2E 2GHRA 1U1EA 1YQTA 2DNEA 1GY8A 2G1JA 1WVMA 2EEPA 2HK8A 1GUDA 2QP4A 1JJ7A 3NIDB 4H6VA 3X1DA 4DUZB 4DR6B 2A88A 1DTEA 2IOQA 2IYYA 3VPBA 2E1PA 1P75A 2PTGA 3GLUA 3JU3A 3DT9A 2AYXA 2ODBA 4LWZA 4QQBX 3LOUA 1VKHA 3TZBA 3CNNA 3MT7A 2OR3A 5A4KA 5AXCA 3K9LA 1XMQQ 2CN1A 3LE8A 4KX5A 1FZQA 3SX0A 1UUPA 4WNAA 5AW0A 2FNAA 2IY8A 1VPTA 3KOOA 1YZKA 2QW1A 3AONB 3DEZA 4KLRA 2O8FB 2DCUA 2DWCA 1BC5A 3OEYA 2YTVA 2DH6A 1ESEA 1W1WA 4IOJA 3ZHZA 3AUJB 2XIWA 1Z62A 1OYOA 4OHUA 3WISA 5F2EA 1OKKA 3DVLA 4PN7A 2G1AA 3WIOA 3UE1A 1FY2A 4CXMA 1C9DB 1EU4A 5FWXA 5JNSA 3H0GH 4CG3A 4DBZA 1VP9A 2X9LA 3RU2A 1KIFA 1YR6A 1R5BA 5EWLB 3VZSA 4ARZA 1PD0A 1RW4A 4C3VA 3E27A 5I7OA 3MFQA 1XKTA 1WO8A 4B3SB 3R5JA 3G49A 1W46A 4ZVOA 1HZZA 4BE7B 1U4MA 1L1FA 4S24A 1K73C 2Q07A 4KUEA 1K9SA 3GJSA 1JT8A 4XVRA 5F78A 1CY7A 2QG9A 3K4QA 4BFYA 3MEFA 2PWBA 4YMGA 5C3WA 4BBSH 2PUHA 3AKZA 5D00A 1IEXA 1Z7EA 2CZGA 4L3VA 3ZK8A 2PUAA 2Z6VA 5TEVA 1X9GA 3Q8MA 1CT9A 3MC1A 4OXRA 4TT3A 3V46A 5FULA 4AB1A 4MW9A 4PMWA 1E1CB 1RRKA 1Z0FA 1ZKMA 3GVXA 1O54A 5E7MA 3WL4A 5LQJA 4YN3A 1C9YA 3H16A 3OLZA 3OU2A 3TSOA 4D4IA 4GP6A 4IUVA 5FTMA 5LQCA 1L7DA 2E7ZA 1X1AA 2AG1A 2IITA 5FF9A 4GAEA 3K20A 3OMCA 4BVFA 1EM6A 1EYZA 1JG2A 4CCWA 4KV6A 1E7YA 2XKBA 4CI9A 2R7NA 1I6VC 1VHTA 2OFOA 1UPCA 4DK1A 3VA5A 3QA9A 5DV9A 3TSAA 1TTTA 4EGFA 3ZDDA 4YY3Q 2NM0A 5BN3A 2P4SA 2VPYA 1SXHA 1F2TA 3U4ZA 1KJNA 3KE8A 3MJVA 5JMPA 4AUKA 4KMMA 3CB2A 2CJFA 4M21A 2PU7A 5BYKA 1PVOA 3IQEA 1MC1A 4CT4B 721PA 3ZXSA 4CKYA 3PGZA 2HQEA 2W0SA 2IGTA 3OX1A 4PG8A 5TSSA 2B2VC 3UG7A 4HNUA 4H4CA 2R92G 1GNPA 2P2DA 3ETDA 5D3QA 1ORVA 5H1SE 3L9XA 4DRXA 5BVGB 3GA0A 2Z1CA 1Z0KA 1WD0A 3TBIB 4J0EA 2XY4A 4TV8A 1PYSB 4BBSB 3X2EA 4BTEA 4TS3A 3A6ZA 2VJQA 4DC0A 2D3TA 3KD2A 1VE5A 2QL9A 4BEJA 3CKYA 1KEEB 1VRVA 1Z4NA 3E9QA 4Q9AA 2MHCA 1JFVA 1I2ZA 1ZCBA 4Y2JA 1EQAA 1OXSC 1QXSA 2VPPA 3FYHA 4B3MQ 2ID9A 1VPDA 2B82A 1KDOA 3WKAA 3FYDA 3HEAA 3DKPA 4KOEC 2QD5A 1E3MA 4LCJA 2VK8A 3R7AA 2EFGA 3OP4A 2RGUA 5T3YA 5AJXA 1IN4A 2FVYA 2JHPA 2SECE 3HJFA 2OP1A 4W1RA 5IKMA 1RC0A 1SVNA 3ORFA 3E9YA 3ZC3A 4ER0A 1YITA 1TEVA 1UH5A 3GPCA 3H5VA 4MW1A 4QUEA 3QOJA 1V5IA 3LKZA 1JB3A 3UJNA 5LL6X 2II6A 4L4UA 1FZTA 3WHKA 3MZ5A 1TS2A 2AIRA 2PFSA 3CINA 4OGKA 3UKJA 1BD4A 3DTTA 4DW8A 3A6JA 3SP1A 2FXQA 1MEOA 5KBYA 3EPHA 2YVKA 4N03A 3QO2A 2QWXA 3K70D 2A5DA 4AVYA 3ZVNA 3C48A 3T7DA 4UHCA 3KL4A 1U9CA 1N5LA 1L5LA 5SZHB 2JB9A 3FNGA 3NGLA 2Q1YA 3A3KA 1GVPA 1XAIA 4HVAA 4JKYA 1YVEI 2C2XA 5EMLA 3U40A 2NUCA 4YUAA 4R2JA 1Y9EA 1E7RA 2HQOA 1A8SA 2ZSAA 4GP9A 4N6OA 3Q7SA 2XA9A 1A0IA 4HBGA 4HWOA 1E5VA 3VX4A 3D59A 1ENZA 4WFQA 4ZDKA 3WTBA 3MGGA 2XTJA 4HQNA 1Z35A 5COQA 1JSXA 3LWZA 3RABA 2C8LA 3MXPA 1I01A 1XEWY 3DTYA 4KZKA 4NHEA 4W5HA 3TR0A 1QP4A