1V43A

Crystal structure of atpase subunit of abc sugar transporter
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
367
structure length
353
Chain Sequence
b'VIKMVEVKLENLTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYLPPKDRNISMVFQHMTVYENIAFPLKKFPKDEIDKRVRWAAELLQIEELLNRYPAQLSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKVTTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLRPNSVFVATFIGAPEMNILEVSVGDGYLEGRGFRIELPQMDLLKDYVGKTVLFGIRPEHMTVEGVHMKRTARLIGKVDFVEALGTDTILHVKFGDELVKVKLPGHIPIEPGREVKVIMDLDMIHVFDKDTEKAIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sugar-binding transport ATP-binding protein
publication title Crystal structure of the ATP-binding cassette of multisugar transporter from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transport protein
total genus 96
structure length 353
sequence length 367
ec nomenclature
pdb deposition date 2003-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1v43A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1v43A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1v43A01
2HQLA 4A3MG 4A3BG 3CCQA 2NQ2C 2BMFA 3S15H 4LUOA 3U3OA 2Z6VA 1ZM4A 3H2YA 1VQPA 1Y1WG 4DHEA 2A68D 4LF8L 1P7CA 2ZRDA 1NP6A 4KITB 3S14H 3BFKA 4IDNA 3EARA 1QZHA 1XX6A 3HKSA 2FSGA 2QI9C 3KTAB 2F9LA 4YWKA 4M9ZA 3CX6A 1IN5A 1G64A 3BRWD 2O5IC 1RJ9A 2QG6A 3LWNA 4D0GA 4EPXA 3HOVH 3DPUA 4S2EA 1PMRA 2DN8A 4GOXA 3THXA 2E1RA 2F43B 2HLDA 4DEYA 3KJGA 3B85A 1HURA 2DWPA 3RRYA 3S1AB 4PC3A 4GSYA 3GLHE 3QJYA 4BA1I 3T1VA 3TSOA 4CEJA 1G7RA 4DNIA 4LFAL 3DDCA 1CFMA 4RZ2A 1E7ZA 4DCTA 3PV0A 1A4RA 1PUJA 3U61B 4LF6L 3N2IA 4UNNA 4BLRA 3VR2A 4E09A 4LW1A 4C30A 5JI3E 1CSPA 4B3MQ 1L8QA 3LBHA 2XSZD 2BIFA 4PG3A 3S16H 1JR3A 3FMCA 3PIOA 5HE8A 4KYUA 2WJHA 1Z47A 2X1VA 4DK6C 1GRQA 1TQDA 3ECCA 1CJVC 3QKSB 4D4LA 5J47A 1T0HB 1TU2B 2J87A 3GJ4A 3FFBA 1XZQA 3SYLA 5B30A 1T5EA 1W2HA 2K32A 3A7LA 4Q48A 3QPWA 1FMLA 3DXJC 4IXMA 2JLQA 2OLJA 2PEYA 2OCBA 3RRZA 1NI3A 2QMHA 2ZROA 4RD3A 4Q7LA 2ZRMA 4EJSC 3D4RA 2F43A 1DEKA 2YC2C 2DFKB 1W47A 1G6OA 4N0DA 3S1AA 3RN5A 2GVDC 2IYVA 2ZR7A 4B3CA 1YQTA 2B29A 1TNDA 5DIFA 4A3DG 4PV1C 3NBXX 1CULC 3A8JE 4QGAA 3TVTA 5HKKA 5JCZA 1TWHH 2C8VA 1OTCA 3HOZH 4A3GH 2GHIA 2RKOA 3CF2A 4K46A 4L5BA 2H5EA 1PZNA 1OKKA 4X65Q 3QKSA 2HUPA 2XITA 4ASUA 5FTMA 4RFSB 4DLYA 3CRQA 3OZXA 1I94L 1VQLA 1CJKC 4D4KA 4WW0A 4L5TA 3QIAA 3ZJYC 1DAHA 4JVNA 2ZSBA 5EXTA 2G1JA 5FFMA 1JJCB 3X1XA 1W36D 2QAGB 3X2SA 3EZFA 1OFIA 2FGJA 4R4TA 3OTOL 1U0HC 4HAWA 4YC7A 4Q66C 1A6XA 1MABB 4DKXA 2IUTA 3EA0A 1ZM2A 4GI7A 3DZDA 3KJIA 3TGPA 2OESA 2D4HA 4BE7B 1MKHA 4A0RA 4H1VA 5M3FH 5IT5A 4I1SA 1K83H 1KGDA 5E7JA 4TWZA 4P73A 4BY7G 4FCVA 4TT3A 3CC2A 4JSTA 4XWKA 1LUZA 1UKVY 2VF7A 2ZJ2A 2CE2X 4OBEA 3LA6A 4D0LB 3SOPA 5HZKA 5IYDG 4Q1EA 3VR1A 4L15A 2K5HA 1YZKA 2CFMA 4DCVA 4URZR 4ALPA 1N34Q 2CLDX 2V4ZA 1Z6XA 3U4QB 1ZU4A 3B8HA 1GDDA 1QHGA 2RHSB 2BDTA 1SXJB 1CP2A 4JYCA 4NE2A 2QAGA 3V9PA 3CPHA 4RZUA 1WMSA 3OOCA 2G1KA 2OFXA 1WE2A 3W6PA 4NXNL 3H0GH 1XMQQ 1YVCA 1G5PA 1MABA 2JJ1D 3NEJA 2AKWB 3PUVA 3RWOA 4BLTA 4WZBE 1XNQQ 5KSZA 1VQ7A 1II9A 1PFSA 3TSWA 2VQFQ 5DHFA 1EIYB 4KVGA 621PA 2DWQA 2XGTA 3X1ZA 1SVWA 1GJXA 2BE5D 5GAEC 1F2TB 1T0JB 3KB1A 1Z6YA 3E9HA 3A4LA 4JI0L 4NYIQ 5FTJA 1KOFA 2IHBA 3HOXH 3S2DH 4WZAE 1RKBA 2E74C 3U4QA 5DGXA 4OK5A 3ZIAD 1JECA 3ND9A 3K8AA 4DUYL 1U9IA 2FMXA 2J41A 4A3CH 2A5FA 3GTPH 2FEMA 2IYLD 1SXJA 2QAGC 1R5OA 4DLUA 1IXZA 2WJGA 4DV7L 2DYKA 1X6OA 5C0XH 3QKUA 5TARA 1E96A 1VHTA 3W8RA 2Z4RA 4GRAA 4ILEA 3PR1A 4M1SA 2UXCQ 3HU3A 4H9GA 1EFWA 1S3GA 1IN8A 1KI6B 1TWAH 2NIPA 3HR8A 1P4SA 1G3UA 1VQ5A 1Z08A 5FPSA 4M1WA 1EWHA 5AWFC 1OHHA 2Q9AA 3VA7A 3F2DA 1GNQA 1SGWA 1TQ2A 2J46A 4MRSA 4QFMA 3KLWA 2IWHA 3PCRB 1ZCAA 5JECA 3TE6A 5L3QB 3PSIA 1GKUB 2A9KA 4C7OB 1NVXQ 2OG2A 2YWGA 5FOXA 3U7EB 3WRYC 5KYKA 2O5JC 1HT2E 2ZS8A 4P32A 1P60A 3BZCA 3SYKA 3X1YA 1S96A 1U9IC 4QHYA 2AL7A 4BZPA 1AN0A 4JT4A 1SXJC 2ERYA 2OHFA 3FHTA 3RLOA 3MWJA 4FI3C 3SJZA 3TEHB 1P2TA 4LK2A 1IW7C 5J4HA 4DLVA 3W1BA 2OBLA 2OAQ1 2VBCA 1ZD1A 1A62A 1EK0A 2QGZA 1BKDR 4EFLA 4PAOA 1KI6A 5A4JA 1GAJA 1YJ9A 4MYTA 1IOZA 4Q4AB 2VHQA 2BCJQ 2HT6A 2YWEA 2E5LQ 3ZYCA 3BXZA 1YZLA 4C7OA 3T1HQ 5BXQC 5L3QA 3A6PC 2KBNA 1GUGA 1Z6GA 4DNTB 3M6AA 2ZJYA 4AWXA 3T1YL 3ICQB 3U4VA 4LF5L 1VIAA 3ZD6A 2FPMA 2IHYA 4I4LA 4CT4B 1GIAA 4C0AC 4RD6A 2WMOB 4DV1Q 3OFNA 3NG1A 4JI7Q 1WCMH 4B73A 3UMFA 1XP8A 3K81C 4PMWA 3RS7A 1T5LA 2GK6A 2KJQA 2P0EA 1QUQA 3RS0A 4Q02A 3AKDA 1PA6A 4ERNA 3ZVNA 1D9ZA 1CI3M 2UVQA 2L5TA 5IYBH 1P9NA 1QVAA 5C44G 2CCGA 2GCPA 3L2OB 4JL8A 4OHYA 1YBYA 3LVRE 3CCJA 3FMFA 4Q4AA 1ZUIA 1VQ9A 4KHPL 2D7CA 3CBQA 5JEAH 5AJXA 4D2IA 2PPBC 4NYMQ 2UUCL 2W6IA 2WICA 4DV5Q 1G3IA 1QF9A 3C15C 3Q8XB 2IHFA 2V6JA 4MRVA 1GUTA 1E6CA 2QMEA 2MQHA 2KCCA 4PX9A 2LKCA 1E9FA 5FL7A 3AB3A 2AN9A 1H9MA 4OX9Q 3D7MA 4OQXA 3I4NH 4DV2L 2QA5A 4YXWD 1ZINA 1T8UA 2FFQA 5SZIA 3A1SA 3UDFA 2QP3A 3GQBA 4I81A 1NIPA 4OGQC 4ASUD 4YMTA 2DPXA 1RFLA 2AFIE 2F7SA 2WMNB 2ZJOA 4O25A 5P21A 1XMIA 5JWHA 2ZXUA 4A92A 2OO7A 4TYNA 4GN3B 3FGNA 3T1QA 4MDEA 3QXSA 3H3VH 3FOZA 2C95A 1I4TD 2K5UA 1G6PA 4DDWA 3Q72A 1FYCA 2IUSA 3SBEA 3U6BA 1G41A 4KFRA 1JR6A 3HOYH 3ZQ6A 3PUYA 1FUUA 2H16A 1JJVA 4LBYA 4DCUA 1SVSA 2REBA 2NVQH 1TQ4A 5FUWA 4A0HA 1ZNZA 2C35B 1YEZA 1MIUA 2LXKA 3QI2A 1W3SA 3FKSD 4BY1H 1O3YA 4GKJQ 2O8BB 3LWUA 2WPDD 5F98A 3BG3A 3UE0A 4TL8A 1U8YA 2V9PA 4US0R 1Y14B 2YKGA 1U5KA 1DPFA 5J4YA 3GLGB 1P6XA 3GJXC 1W4AA 2P2LA 3AFQA 1PH2A 2EFDB 3PXGA 3J81k 4B3ML 1EWIA 2PQAB 1YKSA 2FV8A 1DCZA 2IA5A 2KBEA 2DR3A 2X8AA 3X1WA 2IYUA 2JA7H 2N8NA 1AIPA 1IBKQ 1Z0JA 4LWZA 4JI6Q 1TQ6A 3RZDH 1N5KA 2ZJ8A 3AQQA 3VKGA 3T1OA 1SHKA 3NELA 5IDVA 3SI7A 5FOWA 4AKIA 2ORIA 2O8BA 4AKGA 3RNLA 4IO9A 4LF4L 3BH7A 3WP0A 3VX4A 5KNCA 3BORA 2GBLA 2WM9B 3GLGA 1W0JD 1H9KA 1UE7A 3BB1A 2ID0A 2W58A 5E7MA 2RB4A 1BH2A 4GN5A 4Z51A 1PH4A 1YITA 2RGDA 5CK5A 4AIIA 2PQAA 4KLKA 3G5UA 1IXRA 2H7VA 1R7RA 4JBWA 4QHSA 4B3XA 4NYJQ 4QBFA 4QQBX 4X65L 3AFPA 2AD5A 4JI5L 1DAIA 1YU9A 2V1CC 4YWMA 2CNWD 1A5TA 3CRRA 5FPYA 4C3ZA 2JLUA 1E9EA 1XU4A 2G0TA 4PZZA 5KO2A 4XVRA 3UXMA 1WRBA 1UJ2A 4TLDA 4Y52H 1E4YA 1NNEA 1N6KA 1GRRA 2GBLC 3FPAA 5IY0A 4QL3A 2GXAA 4HUQB 4JSYA 2WAQG 5L8VA 2Q9CA 3ULLA 1JB1A 2YHSA 2R2AA 1BBUA 1VQMA 1B0UA 5E3HA 1RVDA 1IXRC 1PUIA 2ZTSA 4LJAA 1CR2A 1G8HA 4G5GA 2ZS9A 3F3YA 3SU8A 2X19A 1BDOA 2VZAA 3LV8A 4Y7NH 4NCJA 4JBXA 4U5XA 1P73A 1KZGB 1OSNA 2VUMG 1MRSA 2PCJA 1N34L 4JC0A 2A19A 5D3QA 4TYYA 1QHIA 2CWAA 1L4YA 2GZDA 2AHOB 1NKSA 2BBSA 3CONA 3U3JA 4HUTA 1E99A 4DB4A 4MKIA 3HOUG 1Q1QA 1N32Q 1XMQL 4P4TA 421PA 2ZI3A 1XNQL 3U9SA 3MG9A 1S9HA 1Y8PB 5M5WH 4JS0A 1TADA 2VQFL 2C98A 1MT0A 1UPTA 4GLXA 2GJAA 1GUOA 5JS7A 5K8TA 1VS0A 4B3RQ 1G8PA 1QBKC 5C4JH 2UZ3A 3SFZA 3VR5A 3GTMH 1GWNA 4QG7A 2NGRA 4IDPA 1Z0FA 1NJIC 3DZ8A 2IS2A 1NBMD 4UXHA 2OV2A 1PLJA 4G5OA 3CB4A 1XXHE 2BH8A 4LC1A 5L3RA 2R93H 1PH8A 3K70C 2GRJA 4OO1G 1C0AA 1W4CA 1L0WA 1YIJA 1SVIA 4MGZR 221PA 2AHOA 5E7IA 3MXUA 3B9PA 4QGGA 3OE7D 2CL6X 4OQMA 3D8BA 1K8MA 1OLOA 3C5HA 2CVHA 4HZIA 5FL7D 1COWD 2ZI6A 2UXCL 1W1WA 3GFPA 1TF2A 5JJIA 1OE0A 4DEXA 5K8UA 4LUZA 3HP1A 1P61B 2B7CA 2ZYWX 4LF8Q 2GXSA 4LPKA 2D3WA 1Z6TA 2R62A 2R6GA 1ZYRC 2ZYTX 2DY1A 1YR8A 2ZI5A 3GLIE 1N36Q 2AWOA 1HY3A 1XTKA 2JA5H 4RJLA 3B1ZA 4PHTA 3UDXA 4RY2A 2IBMA 3HOXG 2HIXA 2R6FA 2ZR0A 3PF5A 2ZTCA 1P2UA 1EXMA 2NO9A 1ESNA 2XZLA 3TJZA 2WV9A 4QOSA 3BU2A 2FSFA 1JMCA 4LFAQ 3BJUA 3U4ZA 1NBWA 3C7KA 2WP8J 1H9RA 4A3LG 1S0UA 4KKSA 4QHTA 4EJSA 3TQCA 2EU8A 2NPFA 2E5LL 2IHEA 3G6EA 1CR4A 2ZUBA 3OEHD 3T1HL 3QPVA 2EIFA 4PPQA 3VR4A 1NL3A 4JL6A 2ZETA 3HR7A 4NKRA 2LSSA 1S3SA 4URWR 2GZHA 1VQGA 1P9WA 5J40A 1U99A 1ZW6A 4PSVA 4F93B 4X66Q 1JAHA 3JVVA 4DV1L 4LBVA 3I8XA 4Q01A 4JI7L 4DLZA 4W9MC 2IEYA 1X54A 2ZJRA 2QZ4A 2D2CC 1L4UA 3E2IA 4GOPB 2MO0A 4JJKA 1XTJA 4OQLA 3B1VA 1C4OA 3KKOA 3U3KA 2K5VA 4A3IH 1EWRA 2BMDA 5CLLA 4BFZA 2YC4C 3CP0A 3I8SA 3KFVA 4J15A 5IK2A 1WQ1R 1K3RA 5GJCA 3REGA 3K53A 1BYUA 4PSAA 3DO6A 4UKDA 4BFVA 3T61A 1E2FA 1M74A 2O52A 4RCZA 3L82B 3W9YA 4D6PA 4D26A 4NCHA 2ZM5A 4DV5L 4G7OC 3S1MH 1EFTA 1A82A 1SVOA 3K0CA 4O0AA 3KL4A 4POGA 1HQYE 4LJYA 1VQCA 4IDHA 4PC6A 3EPHA 1VCIA 1I94Q 2FSHA 2I1QA 1U94A 3BB4A 4FMBB 1NLFA 1V8QA 4JI1Q 4OX9L 4AH6A 1M1KC 4BXXH 1M6NA 2QQEA 3GEHA 4JLDA 4A75A 4KVAA 4OI2A 1QVFA 4GOPA 3A4MA 4Q1BA 1GKYA 5KSYA 3IDQA 3TLXA 4TTPA 3M4QA 1SZPA 2VL7A 1DAGA 3NDBB 1CF4A 1CR1A 1HH4A 4LF9Q 1LF5A 1ZRHA 1E3PA 1NLYA 2C2HA 1Q1ZA 2C77A 2CL0X 1B9NA 1CSQA 4YLGA 3ULJA 2R6DA 3EC2A 1SN8A 2HXYA 2D7DA 4M21A 5AUQA 4IJHA 1ZBDA 4ESHA 1KRTA 3CM0A 3GEEA 3K0CC 5FUVA 3HU1A 2IY5B 1XXHB 2H1LA 3IIKA 5FUYA 3WYAA 2AKAB 1LTQA 2ZANA 5KDLA 1H9JA 1CJMA 1HEIA 1JQLB 1RW4A 1W0KD 2EQBA 2ODWA 1U90A 4PC2A 1EESA 2H18A 1KAOA 4OXPA 2AX4A 2E75C 5K36G 4L8GA 2Q2UA 2O8FB 4GOPC 4G5RA 3Q9LA 4A0FA 2K14A 1P2VA 2ZAOA 1TAGA 4UQOA 2A68C 4GKJL 3PEUA 2A78A 2IX1A 3UWKA 1HQMC 3K70D 4A36A 1DO2A 2XGJA 1K8RA 1Z07A 2J1LA 4POAA 1N3BA 2NZ8A 3W6OA 2P6NA 4R4IA 3AKYA 2UUBQ 3QF4B 3AVVA 1XTQA 2NO7A 3TH5A 3AVWA 2D5DA 1GITA 4P72A 4GNXB 1W36B 3B5JA 1XXHA 1NVWQ 1U8ZA 2DFTA 2QT1A 1VCMA 3KUCA 5FPTA 2N1BA 1N9WA 2PZEA 1KY3A 4JG2A 4QGUA 1IBKL 1FMJA 2JJ2D 2Q3FA 4FWIB 1OIVA 1DAFA 4M9QA 4JI6L 4MH0R 4EQ6B 2IS1A 4N3NA 2O8FA 1H8HD 4EKDA 3I5XA 3WNCA 5BW8A 2JGNA 5H1SE 1M90C 1G16A 4PPNA 3UG6A 4F92B 3AVUA 2X2EA 1E1OA 3EAQA 3RLNA 4ITRC 5EUQB 1W46A 2ZT9C 4HSEA 3I62A 5IYCG 5EZ6B 2CEAA 1R0ZA 1F6BA 1BVSA 2NZOA 3LDAA 5JHGB 2B8WA 4DV0Q 3GD7A 4H0LC 1SULA 2GEDA 3DMNA 3QF4A 2BA0A 4QM7A 1HNWQ 2O0JA 4Q1CA 4R98A 4GNXA 1KAWA 1I6VC 1Z2AA 1AS0A 4JI4L 2ODBA 1VQJA 4DDUA 3EG5A 3O8RA 2H17A 2QBYB 1ZC3A 3BK7A 4EX5A 1N6PA 1CTMA 3OESA 4TLAA 3L8YA 1FUKA 1TX4B 2MSCB 3QEJA 4EQ6A 5FLXc 3A36A 1VQ4A 2RGNA 1JBKA 3DL0A 1R5BA 2VTKA 1LS1A 3P26A 2G6BA 4D82A 1JALA 3QKTA 2EQSA 3ASZA 3L0IB 4TL9A 3R7WB 2LCFA 3EA5A 1TUIA 1US8B 2HCJB 3T1TA 3D0FA 4LX0A 5AUPB 2YTYA 3CR7A 1K8OA 1NN1A 2KBFA 4IW3B 1R8SA 2WBLC 4G7HC 2J5XA 5EXXA 5CJ2A 1VF5C 4GNXC 1SE8A 5FTNA 1W36C 5DE3A 2B6HA 4CEHB 2ZVQX 2QBYA 4DCNA 4URXR 3J80i 3EQLC 2PMDA 5CK4A 2CHGA 2AR7A 1TXYA 2FU5C 1G17A 2JJ1A 2Q2TA 1KJZA 2RGNC 4BRWA 2K5NA 5JEEA 1E2IA 3I4MH 4KHZA 2WB1E 2JA8H 4W7SA 2WKQA 1GSIA 3SQWA 2G9NA 2GCOB 2ASEA 1N32L 3VQTA 2JE6I 4OO1I 3FE2A 3I72A 2CHVA 2YINC 3LY5A 2IC5A 1US8A 2RGEA 2W0SA 4EFMA 3A8KE 2V54A 3I55A 2VNUD 4WJ3M 3QG5A 4FMCB 2ZS7A 1WFQA 4N0EA 3SJCA 1LVGA 4BLQA 2AMCB 4O2LA 2UUCQ 3ZIAA 4CYMA 3KX2A 1Q12A 3A5UA 1CUKA 3CPFA 2EFCB 2ZRAA 3FB4A 5LDDC 2BBWA 1KMHA 1XCPA 4ZCLA 3CH5A 3U44B 3REFA 2VA8A 5AJVB 3KXIA 3P32A 1G51A 3FP9A 4BBRH 1E2HA 1YNXA 3L2PA 2JA6G 4GMXA 1KSGA 1HZAA 5C3EH 2IYWA 3B60A 5AJZA 3KDSE 5DHAA 4GS3A 1YR7A 2G83A 4PTLA 2GCOA 3UMSA 4GFDA 1Z2CA 4YCWA 1AJEA 1ZNXA 1MO5A 3G48A 4JT2A 4LBZA 1E94E 1ZM9A 1QHNA 3RRNA 4HZUB 4FDBA 3PO3G 4E03A 1NG1A 3HGBA 4JK1C 2YOHA 3UG7A 2PZGA 4DLWA 2XB2A 2VHCA 2YVUA 4QRHA 4ARZA 3HYRA 3SDZA 1VDZA 1SROA 3CRLC 1S40A 5C0XI 1A2KC 3LQRA 4NCKA 5BWMA 1R0XA 1SKYB 1Z3IX 2IYXA 5B2ZA 1HZCA 1N36L 1ZU5A 3U44A 4JLPA 1ASYA 1G21E 4WBSA 4BLOA 2I1VB 1KD1C 3MUFA 1TU4A 3QBVA 4ZI3A 2KB0A 2O0KA 4OWXB 1D9XA 1KO4A 3TUZC 1JI0A 2WAQE 2E2JH 1ANKA 2Q21A 3OIYA 3MD0A 2C9OA 3QVUA 1NIJA 3TAHA 2R7ZG 1D6JA 1HR0W 5E4FA 3TSZA 5HZHA 2GA8A 1LY1A 2OE2A 3MGCA 4DR3Q 3SC3A 1B23P 1OXVA 1JT8A 2PT5A 3KDFB 1W5SA 4CVNA 4DDVA 3QXCA 2UXBQ 1FPMA 4HZUA 4TLCA 2ZRBA 4GBMA 5FPKA 3BD9A 5J4LA 1FL0A 1XZPA 1GL7A 4B3DA 3KFUA 2P6RA 3CZPA 2FDCA 4DK3C 5EJEA 5FOTA 3HPQA 2ZRIA 3K7AH 5M5XH 2CKZB 1PH7A 4UXIA 1NMYA 1MO3A 5SZHB 1E1RA 1XD9A 4NXMQ 4X66L 2Z6KA 2VW9A 2GAOA 3TZUA 2PH1A 1MKYA 3FVQA 2CCZA 4IXNA 5F9FA 4AKHA 1E2DA 1AE3A 5CIWA 4Q7KA 4Q5IA 3AH8A 1RRFA 4R4CA 2C9YA 1I4DD 4A76A 1HYQA 2VH5R 1W44A 3MWKA 1N0VC 2CLCX 4LFCL 1ZCBA 2VYFA 4DR2Q 5AJYA 4EPWA 1CEEA 4LF4Q 3HOWG 1SKQA 1G8FA 3NBFA 1JAIA 3QENA 1D8LA 1Q8KA 1QHSA 3MAAC 3K1JA 4ON9A 4BZQA 5M04A 3KKMA 3KDFA 4A3JG 1XJQA 5LMNW 1NY5A 5M3MG 4NDZA 2ANCA 1AH9A 1FL9A 4HJ8A 5FBLB 3T06B 4YXWA 1UE5A 1IY0A 4A2QA 3N6RA 4DK0A 1Z0IA 1XTRA 1Z5ZA 3MWLA 4M9SA 1ZNWA 4YDHB 4EPTA 4IOAA 3CWZA 5G53C 3TW4A 4JI5Q 1GO3E 2Z6KC 3AKCA 4B48A 3STBD 3FYHA 2CW0C 1KO7A 3I1FA 3PG5A 4HAYA 4JI1L 4LGMA 3FKQA 4BUJA 3HYTA 5B57C 4A4IA 2UUAQ 2HF9A 2NO0A 2CMKA 3PO2G 1HQCA 2REXB 4WA7A 4XH9B 5EZ5A 1J70A 4PR0A 2QE7D 4TL6A 4F7WA 5CB6A 5HGQA 2HF8A 4LF9L 2EJMA 3BS4A 4GZLA 4OWWB 1ZM3A 3ZVMA 1XJVA 1Z83A 1NMGA 3NBYC 2D06A 2YJTD 4LY6A 1E2VA 5BN4A 4FXPA 3NBHB 4MNOA 3EC1A 2X2FA 4KFUA 4A3EH 1IYVA 3ERSX 1CRQA 1HUQA 4K81B 3KQUA 4Q00A 3G71A 1DVRA 2P3SA 2B63H 2JATA 2K33A 2QROA 3KKQA 5GADl 4I1VA 3P4YA 2OXCA 1HA3A 3BFVA 1E9AA 1W4RA 4F4IA 3D6TB 1I5FA 3FKSA 2A6EC 3BWDD 3PUXA 4RG1A 1N6NA 1NVVQ 1AGRA 2WPDA 3U3RA 1T3SA 1OB2A 4TL7A 3KF6B 4GMDA 3Q8DA 5HTKA 3H3VI 3KF8B 2JLRA 3FHOA 3IBGA 4WXPA 2ZRGA 2CHQA 4IKEA 4ZO4A 2GZAA 2OCAA 2VQSA 5J4KA 1G3RA 3ADCA 1OIXA 2BM1A 1EG7A 1NVUQ 3LQQA 4DZZA 2ODNA 5HY6A 2NN6H 3LXRA 4IVRA 4JLOA 4XWAA 2GJSA 2ZTEA 4A3FH 3RS3A 2ASBA 4DUGD 1OH6A 1A0IA 2UUBL 1W7AA 1OXUA 2EYQA 5JI2E 2ZE6A 1FNMA 1VG9B 2G77B 2K75A 1U8AA 2GDJA 1AKYA 2L15A 1KSHA 2FE4A 3EIVA 1VCNA 2ATWA 4S35A 5GADC 4FWTA 2OQKA 5KDOA 2W0MA 4AI6A 3KF6A 1EOVA 4C3HH 3TMKA 3CAMA 2OLKA 1OFHA 4B3BA 5GAGC 1W0JA 3KKPA 2VP2A 2J3EA 2YWHA 2ONJA 3UANA 2A5JA 2DB3A 2JIZD 1M7GA 4JMPA 1DG1G 3SZRA 2WKRA 5DH9A 3AP1A 5B64A 3DLLA 4KBFA 1XPRA 4DV0L 4XTRA 3GLGE 2R44A 4OJKA 1JB7A 2LXJA 2CNWA 1HNWL 2J0UB 5TXGA 4DSNA 1B9MA 2BH2A 1NN5A 2CVFA 2HXSA 4A3KH 1N2CE 1T3HA 2ZYVX 3TVDA 4F91B 2BVNA 1XD8A 1Z29A 4BLSA 1VG0B 4TN1A 4DR7Q 3EIQA 1F2UB 4KJZA 4RVCA 4B75A 3ASYA 2NZHA 1XJ0A 2YNMA 5GROA 2BEKA 4LC0A 3VR3A 3GTJH 2BWJA 4IVQA 2QGQA 4DT1B 1AQYA 4FMDF 3KQLA 1YNJC 2VLIA 1QUQB 4JLJA 4XIGS 2DGYA 2OCYC 2UZIR 2H8KA 1I4LD 3VKHA 2XNDD 3E70C 1KSJA 4P0TA 3V00A 1CKNB 5UKDA 2NG1A 4D4MA 1FJGQ 1WXQA 5C4XG 1ZUNB 4JZKA 3P20A 1VQFA 2B8FA 1E2PA 3NH6A 3ZVRA 4BBSH 1V1QA 1TEVA 2J0UA 3CRVA 2CWPA 1GVNB 2N42A 4C2UA 1HR0Q 3W1GA 2D2EA 1AZTA 1XDBA 4OWTB 1PYBA 1VQ8A 2OXRA 2WSSD 4HLUA 3LW7A 4NZYA 3SS8A 3WNBA 2R92H 1TTTA 3HFZB 1OV4A 3NWJA 4HB0A 1F2UA 4TMTA 4HJAA 4IPGA 1PHJA 2KSQA 2ONKA 2R65A 4MDFA 4DLXA 1I50H 4B33A 4U00A 3T12A 4DLSA 1JJGA 2IXGA 4MKFA 3TUJC 5JFGA 2FX3A 1E2ZA 2WAYA 1D7QA 3KZ1E 4F4JA 1E1RD 2Q6TA 2WHXA 3LW8A 4I1UA 4TLBA 4IFDH 4P71A 2QPTA 1CKNA 2VEDA 1A63A 4QNRA 4NPHA 2DHRA 2GTPA 4LHVA 3TRFA 1LS6A 3LBIA 4JLMA 5KDDA 3EN2A 1NBMA 1EFRA 3IPXA 4JVLA 3GTOH 3AF0A 2ZTDA 1R0WA 2GN5A 3ADKA 4DUZQ 1JPJA 3X1DA 4DPGA 2F6RA 2R6CA 4AYWA 4QIWE 1XEFA 3T53B 4DKAC 3IILA 2OSBA 4HLUC 1E9BA 3T5GA 3K0AB 1EFHA 2UXDQ 1N6OA 3OE7A 4YMVA 1AQUA 1F48A 1YVDA 2FSIA 2Z43A 1FZQA 4D4JA 4QGHA 1COWA 3LAWA 3IQXA 3R9XA 2IYTA 4A9AA 5LMNQ 3JZAA 1GKIA 2XZOA 3IUYA 1T5IA 1JJ7A 1VKJA 2DWOA 3BH6A 4IPDA 4UJ3A 3ZZUA 4DIEA 2J0QA 4R7ZA 2QTVB 5JRJA 2NVXH 5FOUA 2JEOA 2A6ED 3H15A 4YMSA 1NJGA 1WF3A 5IP7G 4LJ9A 4A4DA 3GJ7A 4OHVA 3AVXA 3CCSA 2JASA 3A58B 3SEAA 4Q47A 4UNSA 1OXSC 1MJEA 4WAUA 2ZE8A 4UY8C 2Y0SE 1DTSA 4NONA 2OCEA 2A6HD 1TMKA 1IM2A 1YZNA 2F3TA 3RS2A 1X8KA 3OPOA 4CW7A 1RZ3A 3E5HA 2YTXA 1A8VA 2AUJD 4NMMA 3FHCB 1T3LA 3K0AA 1R4AA 4BECA 1EFCA 3LGJA 3CMAA 2REOA 4IOMA 1XEWX 4AKEA 2F3IA 2IW3A 4Q1DA 2CCKA 3T56B 4B74A 1VTKA 4B34A 1NF3A 1DE0A 1RE0A 1IN7A 1I2DA 4HIOA 2F1IA 1E98A 1VG1A 2RGBA 2WJYA 3VMFA 1CKOA 4JI8Q 1N0WA 1D5CA 3OEHA 4DR3L 1NTGA 2OBNA 2QM8A 4B35A 5IHPA 1UBFA 3AM1A 1NJFA 1ETUA 1XB2A 1AGPA 3IIJA 4H02A 1GM5A 5BN5A 1HCZA 2WB1G 2UXBL 2C03A 2DFNA 4O3MA 2A1AA 3K8YA 2OM2A 2BDOA 3BZKA 5FOVA 4D80A 2ZJZA 3GP8A 1XWIA 2HJVA 4IVPA 4TMWA 4OHZA 3A1WA 2CXXA 3F8TA 2EFGA 3OEED 3PGZA 2HDNB 4A2PA 1R2QA 2GEVA 3T51B 2KCMA 3CF6R 4A2WA 1OB5A 4M1OA 4NXML 4Z8YA 1EWQA 2JEBI 4Q7JB 3SHWA 2QT0A 1CKMA 2GF9A 3EZ6A 3SFVA 5FLMH 3EIEA 4CF7A 2I0QA 4PPGA 3QVVA 2ZUCA 1WDTA 4QC2A 1EUJA 4JCVE 1T6NA 4DR2L 1JJ2A 2NZJA 5A5GA 4A82A 3HOVG 2QNRA 5CM9C 3EIHA 1OH7A 1P16A 3QF7A 3IGFA 2ZRFA 1AA9A 1K6MA 1AM4D 2R7DA 5LMUQ 4U02A 1VQEA 2XX3A 3RN2A 1E0SA 1XNRQ 5C1BA 1Y1VH 2JLZA 3CPWA 3CC7A 3C5CA 5FBQB 5TV2A 3FKIH 3QXJA 4JI4Q 5JMTA 2QP4A 2WWFA 2EJGC 1IONA 2QORA 721PA 4NCNA 1S3OA 1YJWA 4F4CA 3K70B 1YR9A 3A8IE 1UE1A 4P4SB 1CIPA 3TR0A 2UUAL 2WJIA 1XD2B 2OBMA 1TPZA 4Q21A 4E22A 4UXJA 3J7A5 1KI4A 5IP9H 4BEBA 1IZ6A 2ZSEA 3V4FA 2PCFB 1KDRA 1M34E 4R4OA 2ZJBA 5FH9A 4M1TA 1GG2A 1JQJC 4JVSB 2B7BA 1W0KA 4Y0VA 1VQAA 2E87A 1MO4A 2TMKA 4NB3A 3TIFA 3PEVA 4F38A 1N5JA 1YZ6A 3GPLA 1NMXA 2EYUA 5F2EA 2W2VA 1UDXA 5EP1A 2ZEJA 2JQOA 3GTKH 2F1RA 3HOZG 3L7ZC 4A3GG 4DV3Q 2PT7A 2XTIA 4A93H 1HTWA 5IWAQ 1KK0A 2LWIA 4UNQA 4EIWA 1P62B 4P4SA 4ZKDA 2B92A 3PEYA 3SN6A 1NE3A 3KJOA 1GUAA 2XB4A 1XD2A 4JLKA 5DYIA 1A2BA 5TMPA 3N2EA 3GJ6A 3S1QH 4NTZA 3JZMA 1D8TA 1UBGA 2ZUDA 3QY0A 5JSZB 1DG3A 3CKLA 3BAFA 3A37A 2WOJA 2X77A 3OF5A 4KSBA 3KOJA 3CCUA 5C18A 2CK3D 3PFIA 1EQQA 2E9SA 4IDQA 4LYHA 2A7QA 2JJ2A 2EDGA 3AF1A 1ELOA 2NVYH 4MZ9A 2J7PD 4Z8XA 3TW8B 3AF2A 4Q1AA 1H8HA 5M3FG 5FTKA 4PFSA 3W6NA 3NC0C 1EFRD 1GL6A 2B63G 1VQDA 3S1NH 1WA5A 2NMVA 2O8DB 4CIDA 4NYIR 3U7FB 3M7NA 4QL5A 1KK1A 3DOFA 1KMQA 5SZJA 4A3MH 4A3BH 4J0QA 1XRJA 1IBMQ 2QMUA 1E9RA 3LFUA 1PV4A 1AS2A 1O87A 5A0FA 4KFSA 2DBYA 2IL1A 2GETA 1Y1WH 2PJZA 3B1YA 4DDTA 4ZDKA 3RNUA 3A1VA 4KXFB 5JSZA 2G0NA 4PZ8A 1G7CA 1MR3F 1N5IA 4U7DA 1VCOA 5ELXA 3W3ZB 2E2HH 2GWHA 1X86B 3H0GG 2BCGY 2IYYA 2A8VA 3OIVA 2WWWA 4TMVA 5FUXA 2XTMA 1IYJB 3BERA 1OIWA 3M1IA 4DCSA 4L5RC 4PZ6A 3QKRB 2ORVA 3QE0A 4HB3A 2Z0MA 1KY2A 3TR5A 1ZNYA 3DEFA 4KCGA 4X8HA 1UAAA 2J45A 1WB9A 1N0UA 1HTPA 1Q0UA 4DR7L 1IBRA 4LV8B 2O8DA 4BFSA 1SVKA 1OYYA 3GJ0A 4HLDA 2GAAA 1DGSA 5M5YH 1G6HA 1BBWA 2WWGA 3GJ3A 1XCGB 2KHJA 3J80c 1VYVA 2PX3A 4A3CG 3CH4B 3QNUA 5CLQA 3EASA 4Q4HB 5C0XG 2KE5A 8OHMA 1Q86C 2HHHQ 4GPTA 1Y63A 4B76A 1FJGL 4LSGA 1LTLA 1CS4C 4MQBA 3WBJA 5D3MB 5G3ZA 4Z1MD 1M8PA 2ZRJA 4HLQB 2ZRNA 3BIFA 1HR0L 3QKRA 1IHUA 4PHGA 4K8OA 4IQZA 5C0XJ 4BFUA 4DB2A 1Z9FA 2EJFC 1IL2A 2ZSDA 3C41J 3LXXA 5GJWC 1E32A 4IDOA 4A3DH 4W5JA 4US2R 3KJEA 4LZZA 2ZRKA 5E95A 4LFCQ 3HKZE 2ZE5A 5H68A 1X56A 2QTHA 4QM6A 2YTVA 1XPOA 3NC1C 2IS6A 3KUDA 4PQRA 5CITA 4Q4HA 3ZDQA 3ZVLA 3AUYA 5K8IA 1KC8C 1EIFA 3L0PA 1VECA 3PENA 1O7LA 1YI2A 2VL6A 1ZAKA 5FR2A 3WMGA 4DVGA 1U98A 1YNNC 3VR6A 1E0KA 1KNXA 5D3MA 1RRGA 5KSOA 3KQKA 4DUZL 3S24A 4ZDJA 4PZYA 2FZLA 4JBMA 5BYJA 2PI2E 1ZVQA 5ELNA 4BBSG 3SR0A 1Q7YC 1GRNA 1ONLA 2UXDL 4MGKR 4HJ5A 2V6IA 4NYMR 3WMFA 3BB3A 3K09A 3GTLH 1Y8OB 1QHXA 2ATXA 5A35A 3LLUA 3M9BA 3GFOA 821PA 1OXTA 4PPFA 3RC3A 5LMNL 3AVOA 2HYIC 4DBLC 3OW7A 3J81i 1WCMG 4NCIA 3D3QA 2JLWA 4A6XA 1Q1BA 3SJBA 4LV6A 2BBTA 4KYIB 4BY7H 4LDJA 1AE2A 5DYGA 1G5TA 4G7ZC 4PC7A 4RFVA 2N3SA 2OEPA 5IYDH 5IYBG 3S2HH 2B21A 2YZ2A 4IFBA 2Q3HA 5EQTA 3EPJA 3CR8A 3TQFA 4HDQB 5L3SB 1CKEA 2IXFA 3CC4A 2ECKA 2HEIA 2IEZA 2OFWA 3I4OA 5JEAG 3EZ9A 3HDTA 1N6IA 2IUUA 3W5JA 1DAMA 2Q8IB 2QPOA 2Z0SA 4M1KA 2I5LX 2J0SA 3B6YA 4OONA 2AKYA 4JLAA 3T35A 3E9IA 5KPDA 1W49A 3BE4A 2ZI4A 5CIQA 2F3RA 3SJAA 5EE3A 1Z22A 4DR6Q 3AEZA 3R9WA 3Q7PA 1BYIA 3I4NG 3H0KA 5JEAJ 4JI8L 1WP9A 1XCMA 2K50A 1MH1A 2P6UA 3GJ8A 2GESA 3DHWC 3IKJA 3KB2A 3NIBA 3VX3A 3W8NA 4QNMA 4YMUA 3PEWA 2I5MX 1ASZA 1OW3B 4R2HA 1A1VA 1IBLQ 1VYTA 4IHQA 3CCVA 3QQ5A 2IYQA 1DELA 1NY4A 2ZQ5A 4MUBA 4AYXA 3RABA 5L3SA 1K5DA 2ERXA 4GDFA 4AK9A 3FMOB 4OI4A 1U0JA 4C0LA 2OWOA 1FX0B 1L2TA 1ZM7A 4Q7MB 4TTRA 4ESVA 1VYUA 3I2ZA 1H9SB 1JNYA 1SKYE 1R0YA 1ZUHA 3HOYG 2GF0A 4HIDA 4XVQA 4EDHA 1P9RA 1G8YA 4HAXA 3DM3A 4JLNA 4MRNA 1TWGH 1G4AE 1Z0DA 3G0HA 1DAKA 1VHLA 1AKEA 4BFTA 3CZQA 5LBIA 3EPLA 2Z83A 5FBVB 1TUEA 5HPYB 4Q18A 4Q9JA 3CW2A 3NXSA 4MKGA 4RKEA 2ZREA 4B2IA 4LJZC 1SMXA 1B7YB 4BY1G 1HNZQ 2MMGA 1T9HA 1GTVA 3O8BA 4KKTA 4LUCA 4MRPA 2PMKA 5LMUL 3VNUA 5JS8A 1Y69U 4MTNA 3BH0A 1G18A 1X55A 1PH1A 1XNRL 1TF5A 2WWIA 4YONB 1LW7A 4ZKEA 4X8LA 2QL6A 4M1YA 4QJFA 2FG5A 3I92A 5EE0A 5FI0B 5CDFA 2QQ0A 1FX0A 4DLRA 3ZS8A 2QE7A 4KI0A 2Y0SG 1BO6A 1KDOA 1H9SA 2ZIAA 4OHXA 4K0KQ 2P65A 1XNJA 4LJ5A 4DSUA 4NYJR 3UATA 2JA7G 3W5OA 1BMFA 4LHYA 3RRMA 4B6FA 3THWA 3ER0A 3TQYA 4B47A 4EAQA 4OYHA 2ZRCA 3NHAA 4L16A 4TYPA 1K73C 1NN0A 1S9DA 1TU3A 2JLVA 3FHWA 4ZIRB 3CW2C 3RS4A 5IF9A 4GNKA 3CNOA 1KRSA 1Q57A 1T91A 1E0AA 2FGKA 4TTQA 3WHLA 2A5YB 1GUSA 3UE1A 5EAYA 4C3JH 5JJLA 4LJ8A 4LK1C 3STBC 1MOZA 4DV4Q 3RDPA 2G3YA 3FDIA 2ANBA 4RD4A 1IJEA 5KNBA 3U60B 3Q5EA 1UEJA 1M1YE 1QHHB 5AJWA 1E2LA 1KMHB 2D2FA 1F3OA 4G1UC 2IS4A 1XMOQ 1X9NA 1ZIOA 4MA4A 1PH9A 2C9CA 2VSXA 4DV3L 5C44H 1LF0A 5IWAL 3I4LA 2F55A 1UKZA 4TYWA 3HWSA 5KUTA 1Z6HA 1LFDB 1Q22A 4PC1A 2WWYA 5DI3A 4ZDIA 3TK1A 3WYGA 4DUGA 4XD7D 4RD1A 4LUVA 5CYOA 4GLAC 3RSLA 4CRWB 4ZIRA 3RWMB 1G291 2RGCA 5CYPA 1N33L 3TAUA 4HIMA 3ICEA 3E1SA 4HEJA 3A74A 2WIBA 1DOAA 3J7ZC 3T15A 2R8RA 3CX8A 3PIRA 4FW9A 2PI2A 3BBPA 4ARZB 1RC8A 4ME3A 2XAUA 1JEEA 1QHHA 1IYUA 3WXMA 3I73A 1FGUA 1SHZA 2ORWA 3DMDA 4FCWA 1Z6AA 2ZITA 1F5NA 2G88A 4O2DA 1G4UR 2JIZA 1GHJA 1NSFA 2LKDA 4C9BA 2WTUA 3OAAD 4TKOB 2VHTA 2ZU0C 1EFUA 1GUNA 4JKYA 2A69D 1S4QA 1IBML 3DM5A 2FNAA 4ZCMA 3U50C 1NKTA 1GL9B 2V4DA 1XFAA 2XJ4A 4G0NA 2AK3A 4P4UA 2FA9A 4PO9A 1KI2A 1DD2A 1NMFA 4JYBA 1II0A 4WXRA 4YCUA 4L5QA 5JJKA 1KAGA 5KOYA 3QSYA 3R8FA 2EWWA 5JHHB 4QJ5A 1PVOA 3RAPR 1R10A 2VRWA 2OT3B 3CWQA 4HDCA 1H8ED 1RL2A 2KHIA 2Q3MA 4N1AA 4MYUA 4PSKA 3UWOA 4AYBG 2PCLA 4ZV4A 2XNDA 1G8GA 2RGXA 3IO5A 2JK8A 2B3GA 1JE5A 1AS3A 3B9QA 5LPNA 1E79D 4LI0A 2R93G 1SRUA 1KIXA 4LJ6A 5AJ3Q 4LF7Q 3VU9A 3S17H 1CRPA 2FFBA 1MRNA 4IRUB 4DR5Q 3AVQA 1Q81C 3SBDA 4Q9IA 1TL7C 3F1ZA 1UM8A 4I7ZC 2WSSA 2XTNA 3ZD7A 1B70B 4FCTA 2HHHL 3O8DA 4V0NA 1KYIA 1UF9A 3F5FA 5DNYB 4E5UA 1DBSA 4A8JB 3B78A 2QRZA 2OAP1 5BQ5A 1SFOH 4TVAB 3U2QA 4GOJA 1ESMA 1KK3A 4Q03A 3UK6A 1ZJ6A 1GHKA 4HIKA 1XF9A 1H65A 1XJCA 1VQHA 2F1JA 4QBIA 5GVRA 5F3WB 5FPHA 5GQOA 2IK8A 3JVUA 4O0MA 1YHNA 4CT5A 2VIIA 3O47A 4TMKA 1FR3A 2QF7A 3CMEA 5JBQA 4L8JA 4G5QA 5TVKA 1GVPA 1B8AA 2JA5G 4JOIA 1M2OB 5DN6D 1X3EA 2B8TA 5B58C 3MJRA 3R8CA 1DXMA 2Q2IA 3MMPA 3WY9A 1VIYA 3P1JA 1X8LA 5BYKA 1GOTA 1P72A 4ZDWA 5TB5A 2VS1A 2XEXA 4AQYQ 4PHFA 1OT3A 3CCLA 4DLTA 3LX8A 1NBME 3QBTA 3U3MA 4A8JA 3KTAA 3IQWA 1UWVA 5FOSA 1QHYA 1CR0A 5FI1B 3RHFA 4D81A 4DT1A 4YDSA 1QG2A 5DLQE 1I3QH 1Y3AA 4IFDI 2FF7A 2WWHA 3W90A 3ZJYA 1GNRA 3ZQJA 4C0JA 4DSOA 5JWRA 5EP2A 1G7SA 3A8TA 2ZJQA 3G4SA 1E22A 1VQKA 4HJ9A 4FD2A 3VFDA 1K9MC 4JOIC 4C0HA 4OI0A 3IEVA 1JXOA 2QEQA 2EVWX 4OK3A 3SNHA 2IT1A 4BLPA 2ZJAA 1J5EQ 1QG4A 1T4GA 3P4XA 2FPKA 3VNVA 1BMFD 4KLZA 1O78A 2IYSA 4A3IG 2XTZA 1GZSA 3CF0A 2HYDA 4I1OA 1K8GA 4D0NA 4B3SL 5KU1A 1KXLA 1Q1EA 2VUMH 2O5VA 2YWFA 4A8JC 1W5TA 1X1SA 2QGNA 1PYSB 3KKNA 3R9IA 1E0JA 4DNRB 4V0MA 1E69A 2RHQB 5LD2B 4MGIR 4Q4LA 2RAPA 1ZKOA 3EWSA 2B8GA 4B3TQ 3W3AA 3HOUH 1V5WA 4QBGB 3WP1B 3WMEA 1TKWB 1VQIA 2JCSA 4KODA 3U7HB 3KLRA 5ANRB 1X8JA 5CJPA 3C14C 4DR6L 2A6HC 2GJKA 3DKVA 4TSFD 2Q0HA 4BXXG 4OKSA 2BMEA 2A5GA 1SR3A 4IPCA 2BJVA 2AK2A 4YY3Q 2O8EB 1IJFA 2BOVA 2VSOA 3CPJB 3NDPA 4H13C 3OEEA 3V4RA 5IE8A 4GKKQ 1E9CA 1UEBA 2CCJA 1VQ6A 1IBLL 3PVSA 1N8RC 3HKZG 3JC66 3RC8A 1YJNA 1OJLA 4KBGA 4OO1H 4KO8A 1QVGA 1CLUA 1KTVA 4H1UA 4PAQA 4RFSA 3M4OH 3LX5A 1X3FA 4QGFA 4X8MA 2FWRA 2GKSA 1ZIPA 1E24A 2E8GA 4OL0A 1FVIA 3GTQH 5K8LA 2Q2HA 3KJPA 4R1JA 2RCNA 4HB4A 2VPPA 2NO6A 3T34A 1LM0A 4KMUC 3TREA 1V9PA 1CBUA 1DO0A 2ZM6L 3A5ZB 1FQKA 2IYRA 2N46A 1FFHA 4TQUS 3FFAA 1P8LA 4ZPXA 3PCOB 2OQ0A 3IRBA 3G82C 1KI7A 2VSFA 2DUDA 3H86A 3WRXC 3FTQA 5C4MA 5L3VA 1X3GA 3U5ZB 1K8AC 5FJ8H 2O8EA 3CCMA 2NTYC 4MUAA 1RPZA 1O7IA 3ETLA 5ELOA 1HNZL 3RR5A 3DOEA 2V3CC 4LBWA 2FN4A 1E2QA 3SYNA 4MYHA 5CM8B 4AD8A 1Y8NB 3K0EA 4DIDA 1NMZA 1RRCA 4UJ5A 3KYHC 2FXQA 3A4NA 5LD2C 5AUNB 1U0LA 2YOFA 1DARA 4IEIA 5H70A 1NSTA 3BJIC 5SZKB 5DSZA 3IHLA 1D2NA 4K0KL 4M9XA 3GLHB 1WI5A 2K4KA 2E2IH 3L43A 1EGAA 2F4VQ 1E1QA 4P74A 4A3LH 3EZ7A 2OUKA 4X62Q 2CJWB 3NEYA 1HZBA 4X6AH 4RD0A 2OFOA 3MWYW 4L9SA 3DM9B 4EFNA 4IJMA 3AGPA 4GT1A 2OTLA 3A1TA 4HYYA 3IFTA 2PJRA 1P75A 1OFTA 2NVTH 4LFBQ 1QDEA 1LACA 4AIMA 1IAQA 3J81j 1F2TA 1YZQA 3GCGA 4IEEA 2GJ8A 4DV4L 3AUXA 4II7A 4M0LA 3I56A 4DK1A 2JDIA 3VAAA 4KLNA 4BEJA 5JWOA 1KZ7B 4QXAA 1G7TA 1CU1A 2ZSAA 4KU4A 5DISB 3M3YH 1Q46A 4XSHA 3MJHA 1G19A 4C3IH 3GO5A 2L0XA 3TUIC 4Z54A 1VF7A 3B13B 1XMOL 3B1WA 1KHIA 1LNZA 1XTDA 4E07A 2AUKA 1V43A 3EPKA 2UU9Q 3WDNA 2P5SA 4LV5B 3GLHA 4P31A 1UE6A 1E2JA 3WWVA 2CJWA 4OJQA 3S1RH 1HH2P 3K9NA 3ZH9B 1UBEA 2CK3A 3M4PA 2QEXA 4LHWA 2J7PA 4TZ0A 4C4PA 1KI9A 3AVPA 2KENA 2H92A 2HLDD 3HU2A 2GK7A 4A0GA 2PLFA 3K7UC 3MXNB 4P33A 3IEUA 3TS0A 2CQOA 2PL3A 4NP6A 2BBOA 4URUR 4H44C 1XTSA 2R9VA 2QSZA 2V7QA 2RHMA 1MV5A 3WYFA 2GXQA 2EFEB 1JR3D 3U7GA 1II8B 2HV8A 1GD7A 4FMCF 2C5LA 1TWCH 1G5RA 2P5TB 4DV6Q 1GP2A 1W2BA 1Z7TA 2ZI9A 3BFXA 3KJHA 4HAUA 1ZP6A 3UDGA 3C4JA 1IQPA 5FL3A 1VMAA 3IIMA 4CEIB 4A6PA 1GFIA 3K0SA 4JYAQ 1KDTA 2ZRHA 3TNFA 1FTNA 1F60A 1KL9A 3I4MG 2JA8G 3I7FA 1WBDA 4JV5Q 3EXAA 2EW1A 4WOPA 4X64Q 3BOSA 4G3XA 4C0QC 2IYZA 5EE9A 1Q21A 4KN7C 2FOLA 3RANA 3VHLB 2PMZE 4BASA 1C9OA 2K52A 3MRSA 4NHOA 3CRKC 2JA9A 3B1XA 3LLMA 4Q19A 3GFTA 4RSGA 5BN3A 5K36H 5DLQC 5HKKD 1M7HA 4C2TA 1M7BA 5IT9c 3KXKA 5EE1A 1HE8B 1WOCA 2VHUA 1II8A 4BA2I 2IF0A 2PZFA 2ZYUX 2OTJA 3OIUA 4LNQA 2CDNA 4HAVA 2YYZA 1OKKD 3PJRA 3ADDA 4L4UA 2KA7A 1CJTC 3IO3A 2C78A 3M4YA 3P27A 2MFIA 1YE8A 1C9KA 1UADA 2JLXA 2BJWA 1KKMA 4JJZA 5AJ3L 4LF7L 4CEIA 1PH3A 4Z1MA 4BBRG 1PLKA 5HCNA 4DR5L 3NHBA 1R6BX 5C3EG 1PJRA 1LV7A 1DS6A 3NVAA 1KI3A 1KI8A 3RLFA 4HB2A 4V03A 2A3RA 1PLLA 1S1CA 3UMRA 4B6EA 4KN4C 4HDOB 2W83A 2RH5A 1BOFA 4MYCA 2J59A 3CCRA 1D2MA 5GVSA 1WYDA 1TWFH 1CTQA 4B43A 2YV5A 1C7YA 5GAHC 3CXCA 1ONBA 1XTIA 3K9LA 4TT3D 3AVYA 2FPLA 1QZGA 4IPHA 5IYCH 2H57A 3AQ4A 3CF5A 4D25A 4UNPA 1SQ5A 1YR6A 4NPSA 1DADA 3M0EA 1WBBA 3AP2A 4GZMA 3CD6A 3AGQA 4AYTA 2QENA 3QXHA 4DC9A 4DR4Q 1ZMXA 1N5LA 2ZRLA 3J81c 1JXMA 4MKHA 4AQYL 1KO1A 3NTUA 1KQSA 4JVMA 3IHWA 2ES2A 4IOLA 2PLRA 3LVQE 1QZXA 2AFHE 4OQNA 4PZLA 4TZ6A 2WVJA 1D2EA 3VHXA 2AD1A 2R7FA 5IRCD 1KDPA 3HJNA 3AP3A 2MSDB 4EPYA 1ZC4A 4LHXA 4XWOA 5JZVA 2EVBA 1R5NA 2MSEB 4BWYA 2VQEQ 5KPJA 4M53A 1YHQA 2I3BA 2XZPA 2IX0A 3ZZ0A 4M2LA 3QUSA 4M22A 1OYWA 3CLVA 3ONWA 4GP6A 3GEIA 3VTKA 4JI2Q 3NH9A 2W2XA 2VP6A 4EUNA 1SXJD 1Z0KA 1QVCA 1YHBA 1J90A 1J5EL 3VDYA 2MNAA 1E1QD 1BKBA 1IW7D 3NENA 2BV3A 2QU8A 2WWXA 3MLEA 3PF4A 2VP4A 4W5WA 4L5SA 4AYBE 1FTSA 3SE0A 2ATVA 2YU9H 2C99A 3IBYA 3THOA 5CB8A 1S72A 2DCUA 1OHHD 3I61A 4HI0E 4B3GA 3GTGH 521PA 2BEJA 3F2BA 3B6EA 1W48A 3H1TA 2Z4SA 2Q9BA 3F2CA 5FR1A 1LABA 4B3TL 1S8FA 3B82A 4NU0A 3OYYA 2MMCA 2K7VA 2XOKA 1LYLA 5C2JB 3TBKA 1DAEA 4R4QA 2JDID 2J0VA 1ZD9A 2F1HA 3MSXA 3L0OA 4EQ5A 1NVVR 3CCEA 3K0XA 2OZEA 4PZ7A 1HZ9A 1Z8FA 1RIFA 2WIAA 1HNXQ 3Q5DA 2RGAA 5AK0A 5TY0A 2AXNA 3A0JA 3PITA 2KI5A 4PAMA 4OHWA 4MRRA 4OQFA 1E9DA 4YY3L 1N33Q 2YOGA 4KV9A 1XMJA 3CNLA 1OH8A 4GKKL 4G5SA 4XVUA 4A15A 1YHAA 4AURA 4JI3Q 121PA 4URVR 1J6QA 2HT1A 2CL7X 3OIWA 4TQAA 3GJ5A 2EXDA 5FTLA 1OH5A 3RVBA 4OI1A 4YHHQ 2F9MA 2N49A 3LO5A 2BM0A 2JA6H 4A3EG 1J8MF 1I2MA 1VPLA 3AB9A 1PH5A 3N5CA 1ODFA 4JIMA 2WAXA 2WFWA 1KHTA 2A30A 1GKHA 2PNHA 3SGIA 1LB1B 1U2RA 1HE1C 4LYFA 5G41A 3UKDA 2HJGA 3WHKA 2XXAB 2MO1A 1BIFA 2H5XA 1YZUA 4UP8A 2V7QD 4XSGA 3OFND 3PO3H 4HAZA 4GLVB 1KIMA 4IOCA 4IOKA 3SQXA 2OCPA 3WNDA 4Q9LA 2CE7A 2ZI7A 3CO5A 4HUQA 5H8WA 2JJQA 3U58A 3A7AB 4LJ7A 4DR1Q 1EX6A 2RMKA 1N25A 4I99A 2A2ZA 4RCNA 4LJ4A 2C96A 5JEDA 2LMCB 4QBHA 4GL2A 3CIOA 4RCYA 2VP9A 3HPRA 4YWLA 4JBKA 4GP7A 4P75A 2NN6G 3LD9A 4DJTA 3OW2A 1P2SA 5EUMA 3UDIA 4A3FG 2O8CB 2JA1A 4FN5A 2WKPA 3W5IA 5BR8Q 2W6ID 2V8OA 2P67A 2R7ZH 1KO5A 4JBJA 1KSFX 1HT1E 5CDFE 4FINA 4DAMA 3AV0B 1G3MA 1W2GA 2C04A 1Q90A 2W6JA 3NBZC 1SLJA 2XXAA 2N78A 2F4VL 1UDWA 4R2IA 1G9XA 4FIDA 4AY2A 4X62L 4BFYA 1QRAA 2J7KA 1VG8A 2NO1A 3D31A 4R9UC 1XBTA 1YRBA 4UP7A 3CRW1 5H1YA 3EWAA 3CUEF 1E3MA 4KAXA 1UBCA 2QMOA 2QM7A 4NBSA 2IF2A 1BS1A 3IPYA 4ABYA 1E2GA 5JCPA 1X6VA 1XEWY 1E2MA 4LFBL 4ACBA 3RZOH 1H95A 5FJ8G 1U81A 1Z06A 4QJ4A 3JAMc 4XJXA 5GJBA 4BFWA 2QAJA 4ZI2A 2O8CA 4L9WA 3QG1A 5AUOB 1HPCA 3LH5A 4BFXA 2XNSA 3PQCA 2D62A 1KJYA 4BRUA 4XD7A 3HOWH 4JKIA 4LRWA 2F1MA 4A3KG 3QXXA 2UU9L 1NLZA 1ZD8A 1G20E 2VY3A 2BC9A 3U6KA 2D0PA 4CDGA 1T8TA 4A3JH 2WJJA 5LB2A 5M3MH 5EXPA 2FFAA 5C4GB 1KI1A 1WCV1 3KFXA 1N6RA 4LF6Q 2ODEA 2ZPTX 3B2EA 5HR5A 2A5DA 5KHOC 5G3YA 4C0SA 3ZS9A 4HATA 4O2RA 1IXSB 1S1MA 2DFLA 4OK6A 1OPXA 3CNNA 2ZRPA 3MEFA 3LBNA 5J4VA 4LCBA 1Z63A 2R6AA 1HJPA 1MJCA 2RF4A 3AF4A 3OAAA 4BQSA 4R71A 1E1TA 4YQFA 3AYHB 1ZYUA 3B7GA 3PO2H 4P3YA 1SMYC 4B2LA 4UP9A 4WVFA 1FP6A 1KJWA 1L7VC 3GLFE 4A1FA 4PO1A 1RYFA 3MCAA 4WJ4A 1CXZA 2ZSFA 4DV6L 2EWVA 2R92G 3AF3A 1QJOA 2PEZA 3FWYA 3H4MA 3H94A 2QUZA 4JBYA 4MGYR 3A1UA 3ADBA 3NKVA 2ZU6A 4AG6A 3KQHA 4JYAL 3E0EA 5JRZA 2FZ4A 3DVLA 1EYGA 3VKWA 4C2MH 4IJLA 3ULPA 4JV5L 1UKYA 2I5HA 1H8EA 1Z0AA 2PBRA 1IN6A 1K0RA 4X64L 4URYR 1MO6A 5DO9A 4B3SQ 3N70A 3RSOA 4IFDG 4QKQA 1J7KA 1SVMA 2NOAA 3THYB 2QSYA 3I3SR 2FFHA 1E4VA 3QOFA 5EP4A 2QA4A 1J8YF 1GILA 1OFUX 3BC1A 3K9HA 2A69C 4LHZA 2ALYB 1E79A 5EE5B 5G40A 4PQFA 3K9GA 1Q20A 3K09C 5HCIA 4AC9A 2WZQA 4QJ3A 4KFTA 4IFDJ 3Q7QA 2SHKA 3OHMA 5LB4A 3OTOQ 3T5DA 2QRNA 2J9RA 2GEUA 1OXXK 4V0LA 2AWNA 5KTYA 1I6HH 1S2MA 1P3JA 2JXMB 1W4BA 2VP5A 3R20A 3SHFA 1YJ5A 2XOKD 5J3BA 4M8NE 5EXSA 4PANA 1KO8A 4HR7B 3K0FB 4NL4H 1J99A 3BDOA 3EZ2A 1WJJA 6Q21A 4POFA 3PUZA 1NN3A 1VQBA 2JAQA 5KNDA 4B71A 3THYA 4V02A 1CJUC 3W34A 4KSCA 1XMSA 1EQRA 2QY9A 4RKFA 2IXEA 1UFQA 2JJ8A 1KK2A 4TMXA 1YZGA 4DRZA 3UPUA 4QY7A 4V0OA 2ZR9A 2V1XA 1XMVA 5DN6A 1JPNA 4XOIA 1OF1A 3NE5B 5KSPA 4APVA 2HCBA 4LPSA 4TMZA 5HE9A 2ZM6Q 4M4SA 4EPVA 4EPRA 4WIAA 3ZZTA 4NXNQ 2GVAA 5DI9A 1K5GA 2XSZA 4LYJA 1N6HA 3THWB 2XJ9A 1AZSC 2VHJA 3RYTC 2IWRA 3EW9A 3GMTA 1J2JA 1L1OB 4HLCA 2JLSA 4B32A 1NY6A 1Q44A 4DR4L 1R9TH 3K0FA 4JLBA 4B2PA 1RYHA 3I32A 1Q3TA 3L0SA 2NPIA 2RGGA 2HIVA 1QVRA 2ZAMA 1N6LA 2ZE7A 2V55B 4JI0Q 5EP3A 4BGDA 3GLIB 1X65A 2BKUA 5JLJA 1L2FA 1JR3E 3CPEA 1IY2A 2DNEA 3C16C 4AG5A 3I5YA 2QPAA 2V1UA 5AR1A 1Z28A 1YZTA 4Q9KA 3TKLA 3PUWA 5E7NA 4DUYQ 3QPUA 4V0KA 4CZ2A 4IOJA 2WSMA 2GXUA 2VO1A 4DV7Q 1C1YA 4CGZA 2VQEL 2W00A 2ZVPX 4RZ3A 4Q9HA 4M1MA 4NH0A 2VP0A 5C4XH 2D74A 1X1RA 3AVTA 3Q85A 5DI3B 4JL5A 4GN4B 3NEMA 4JI2L 2GVBA 1FNNA 4ZCIA 4TLEA 1Q82C 4WZ6A 1L1OA 1IN4A 2FJUA 5FLMG 4PXAA 1SVLA 2GJ9A 2PX0A 2W6JD 2QN6A 3EBEA 5TDHA 2VF8A 1G3QA 1KKLA 1UKEA 2QTFA 5GJVC 4FMDB 4C0BA 2E76C 3GLIA 3FMIA 4RZXA 2CLSA 2WJVA 1NG9A 2DNCA 2I4IA 4LOAA 4YCVA 4Q4JB 4LWCA 2Y8EA 3GLFB 2UKDA 4TSFA 1A7JA 1Y1VG 4B3FX 4DSTA 5FBRB 1XEXB 4V0ME 5F9HA 3FKIG 4PQYA 2QP9X 3TRZA 3LNNA 1IY1A 2F52A 2W2TA 3LNCA 4PO8A 3O8CA 2BHRA 2GILA 4W5HA 1E2WA 4TYQA 1L1OC 3JAMi 1HNXL 2EFHB 1R8QA 3M85A 2BKEA 1G1MA 2O0HA 3RS5A 4XTCS 2D0OA 2FH5B 1JEDA 3PIPA 4RD2A 3BGWA 1P5ZB 4PHHA 5IP9G 3AKEA 4US1R 4X8OA 4JI3L 3F0TA 4YMWA 3CRMA 1E2NA 3T1YQ 1PH6A 4LF5Q 3K80C 4YHHL 3GDEA 2OILA 3QEOA 4G01B 2CBZA 2IX3A 4Q4JA 4JLVA 3GLFA 2PNRC 4Y0AA 3WBKA 1EX7A 3L8ZA 4BPBA 1XEXA 1FW6A 1XPUA 1TEXA 1Q3HA 1GNPA 5IP7H 1FP7A 2GNOA 2NN6I 2FEOA 3MFYA 3FMPB 3VU9B 1HV8A 2RHDA 1AK2A 2GVZC 3TS2A 4A93G 2Z5FA 3C8UA 3DKPA 3R7WA 5FBWB 4B44A 2KWIA 5J5CA 1KNQA 1E2KA 1RRPA 4KHPQ 2KCTA 4GOKA 4MITA 3FPPA 1RIPA 1NRJB 4RMFA 3UIEA 4ACAA 4DR1L 1E9SA 4DXAA 5C46F 4B3RL 4UPAA 3H84A 1UEIA 2ZJ5A 4Q1FA 5IK2D 3KXLA 3KQNA 4CEHA 1YRAA 2WOOA 1FOEB 1TF7A 3ND8A 3Q3JB 4BZXA 3CX7A 3CQZH 1RJ9B 1X3SA 5BR8L 2JLYA 4DV2Q 4C0KA 3ZGXA 3ZLJA 4KKUA 2GCNA 4HJ7A 1VQOA 4TQ9A 4GZYC 4DAYB 4UNRA 4LYAA 2AXPA 3EX7C 3THXB 2JEAI 2ZJPA 1SXJE 4EJSB 3LRPA 1FQJA 2BE5C 3AEVA 4DWJA 4IFEA 4CEJB 1VQNA 1E2EA 2BMJA 2BA1A
chains in the Genus database with same CATH superfamily
3CCQA 4DHEA 4OH7A 4IDNA 4PYKA 4PBTA 5C44B 2HJRA 2X6GA 4EL5A 1D5ZC 2M6LA 2O5IC 1RJ9A 2UUPA 2QG6A 1JEJA 3JQ7B 2HR1A 1PT8A 1L7PA 1U3CA 1DRJA 4PC3A 3QJYA 2IIQA 4XGNA 1UAYA 3B5EA 1KMCA 3IMCA 2XSZD 1GRQA 1CJVC 1ZN9A 2V5VA 5B30A 5CFZA 2JFUA 4XX0A 5JH7F 2OCBA 2WD8A 3HMKA 2RHGB 5JC8A 2IYVA 3A2NA 3PCXA 4MEAA 3L6UA 2B29A 4ZODA 1XQ1A 2NU9B 2O19A 3UBTA 4K46A 4L5BA 1UJ6A 3W79A 4A0SA 2KCNA 2JC3A 4H7EA 1ZH2A 2QX9A 4UZFA 3EA0A 1ZM2A 1GUWA 4BE7B 3EHEA 3FB1A 4IGKA 3D6VA 2JGLA 2CE2X 3LA6A 3T7KA 5HZKA 4UUMA 3NHFA 2BDTA 1C7QA 2QAGA 4PWYA 5LMNB 1WMSA 4MULA 5KSZA 2AKWB 4GMGA 3ZNPA 3DZCA 621PA 3E4DA 3E9HA 1UXOA 3N9IA 2E0IA 3GRYA 2B83A 2ZZNA 3T7RA 3QKUA 3R2TA 2Z4RA 3EWNA 4WZZA 3WLSA 1FDIA 1G3UA 2B37A 2Q9AA 1A98A 5KRUA 3WK7A 4LSWA 2ZS8A 1WU8A 1DSSG 2R3ZA 2HK6A 4UD2A 4JT4A 3T4UA 3MTDA 4OQDA 1A5ZA 1EVYA 2WB4A 4JEUA 2E5LQ 3M6AA 3PJGA 3NG1A 1XP8A 4D8XA 2HV9A 5JZBA 3OUUA 3PRHA 1CUAA 4IM7A 3H1PA 4JL8A 1G2PA 1TYZA 3V34A 2PPBC 1Q14A 2VSYA 3MBIA 1Q7GA 4L2IB 5M2QA 3OY2A 2GLXA 2CW5A 1Q0RA 3FNHA 4UMEA 3VHRA 3B53X 3IP3A 3UHPA 1GVHA 4L5JA 2NVTB 4OP2A 3AFIA 4TYNA 3IR7A 1PG0A 4DDWA 1QOPB 3TQOA 2A1TR 1G41A 5ALLA 1POXA 3GNTA 4WZAB 4AF8A 4JP2A 2EOTA 1MDBA 4A5SA 2Q27A 1MIHA 2OOSA 1EJ2A 4WRRA 3NBQA 1IBMB 3UE0A 2OAGA 1G5FA 3HDJA 1P1CA 1A9XA 1PGJA 3GJXC 2QJTA 3UUEA 1XRMA 1I6KA 4HV4A 1BQQT 3OWEB 1E6WA 1ESDA 1KZ9A 1Z0JA 3ABIA 3B51X 3PGLA 4R9RA 2AXQA 2FF5A 1WHTA 1V1PB 4G24A 1HZJA 2YWRA 4AIIA 3UGKA 2IZOA 1U7XA 1WCXA 3P9QA 2DKNA 3VH1A 4P2BA 4WACA 4PW0A 1DC4A 4EHHA 3A56A 2XT6A 1XDWA 3VR3D 3ULLA 2Q1SA 5E3HA 2XCLA 4LJAA 3IPRA 3SU8A 4ZYWA 1T25A 4JBXA 5BV1A 5A5VA 1MPXA 2XLCA 3KALA 1J0AA 1N32Q 421PA 3MG9A 2VQFL 2B1QA 1ZK4A 2UDPA 4TWAA 2XDYA 1QILA 1V9CA 4Q3AA 3VYTB 4E31A 3LECA 2K7ZA 5JAHA 4QGGA 3D8BA 4HZIA 5IHXA 3SG0A 4HMIA 5F12A 2GBIA 5AD1A 3OE5A 4FQ7A 1ENFA 4M88A 2ICAA 3SHQA 5EKDA 5GP1A 2VNJA 1Q8IA 4AX4A 5BOSB 3C3MA 2NPFA 2E49A 2JA2A 4AZ0B 3HR7A 4NKRA 3SXUA 1VQGA 4TUYF 1FSPA 1JR0D 3DQZA 4ZLTF 2RGUA 3GEPA 3IHTA 5LKAA 4I9UA 1C4OA 2ZB8A 3USZA 2HM7A 3OM1A 3REGA 1ML4A 3VH2A 2A4MA 1N1MA 2ONCA 1M74A 2R1TA 4CG0A 4D5GA 5PNTA 4RYLA 3FZGA 3P8ZA 2MJ8A 1PNRA 4C6TB 4MRMA 4GM1A 3T7JA 3TLXA 3WZMA 2GLTA 3KWFA 4IUTA 1EE9A 1VOTA 4UHEA 3NGXA 2BUCA 2C54A 3TRJA 5DPMA 3KWLA 4WESB 1RW4A 2OSVA 3GCWA 1J0EA 3K58A 4GOPC 3HVHA 3DWEX 3H9UA 1PS0A 3BFJA 4FE7A 3K70D 1TVCA 4G85A 2L18A 4UOQA 1OWMA 4CM1A 4GNXB 3HDGA 3RAFC 2VTDA 4NZOA 1XVAA 4OHJA 1DDOA 2JJ2D 1OIVA 5GIOE 3FUCA 1EWYA 5H4HA 4JEHA 4UM7A 1EHIA 4ITRC 5EUQB 3QI7A 5C5DA 4CIWA 2VJLA 4DV0Q 1KR5A 1VQJA 3V8VA 3C6BA 2R79A 1ORRA 3VMMA 2HF7A 3PIO3 1DKUA 2LCFA 1QH8B 4JEMA 3JRXA 2NU6A 4LJLA 4LVCA 4DBVO 1Z4JA 1ZKDA 2OXEA 1YZ3A 3IC5A 2DH6A 1SNQA 1Z74A 5JEEA 1Z7WA 3U3ZA 4NECA 2WKQA 3ZU2A 1DKLA 1F12A 4YRAA 1EAYA 3KX2A 4C05A 3JASB 3CH5A 3U44B 1K1EA 4XDYA 2A35A 1GQSA 3E15A 5I9IA 1HZAA 3MGKA 2QCPX 4KN8A 5AJZA 2GCOA 5CPFA 1FDVA 4X3PA 4PFKA 4EENA 2RCYA 3UG7A 4YA6A 4EY7A 2B2YA 3LQRA 4ZU1X 1KYWA 1HZCA 1ASYA 2I1VB 4FNGA 4AU1A 4MVYA 4B40A 1A9RA 2M1XA 3KQYA 1EY9A 1FPMA 1PWEA 1SNCA 3L5KA 3Q6NA 3CE6A 4X95A 4DQXA 4OLBA 4FZRA 4JNCA 3JSXA 5F9FA 3D3EA 4X1KB 4LFCL 1T2FA 5ECDA 1CEEA 4MX8A 3DWPA 1IY0A 3CWZA 1PSDA 1SKUA 2PIAA 2WB1B 3S15B 3ROTA 3BS4A 4GZLA 1Z15A 4LY6A 5BN4A 3BULA 1PTOB 3I0NA 1I5FA 3FKSA 1AGRA 2RD2A 1A7AA 1ABEA 5E8JA 1OWOA 3UJPA 4FGJA 5K3DA 3KF8B 4ZO4A 2VI5A 4O3FA 1NPTO 4GNRA 1EG7A 3C3JA 4IALA 2ZTEA 3DHEA 2GUWA 4HNHA 1KE2A 5CD9A 1CX9B 1B1ZA 4MEBA 4AF6A 5DM1A 3CAMA 2OLKA 2I91A 4BHTA 5SY9A 1RWVA 2GEBA 3LSYA 1SCJA 4REQA 5CNMA 2A14A 3VDMA 3LXMA 2HXSA 5D00A 2ZBEA 1KZ1A 5ALSA 5BVGA 1I3LA 2YNMA 3IXQA 1DC5A 5AW5A 4FS3A 4ZZIA 2PM8A 3L06A 4EH1A 5TQVA 3Q40A 5CNIA 3AMUA 4P84A 1F2UA 3KDAA 5KMGA 2KSQA 2WE8A 4DLSA 2IXGA 2MUYA 2Q6TA 4AJ4A 4TLBA 3QEKA 2I71A 4HLUC 1E9BA 5FUMA 3GDGA 1COWA 3BH6A 1WF3A 4OHVA 5TS2A 1ULBA 3W5AA 3IOEA 4AY6A 4DJJA 2F3TA 3WLJA 4UVIA 1BCPC 3FHCB 1SOWA 3CLUD 5KWJA 2QTVA 5H3CA 4J2OA 3W3AD 2DE0X 4K2KA 3K8YA 1F0KA 2BDOA 3BA1A 5T8KC 2LD4A 4BP8A 4EHAA 4NXML 4AJKA 5BR8B 2HU5A 3H2HA 3SFVA 4PPGA 5CLIA 3UN1A 1D1PA 3G9ZA 4A82A 2EJUA 5CM9C 1K6MA 1XV5A 1AM4D 4H27A 1VJ5A 2JLZA 5DWVA 1F0YA 1UPBA 1B8UA 4GKBA 5G0VA 3HBFA 3UY4A 5B58T 1CETA 3H4TA 1NW9B 4P4SB 1W73A 3AERA 2OBMA 2VOEA 3K9BA 4ZHQB 5MFZA 4MR7B 4KE7A 2IUFA 4ZT6A 3I6ZA 4I1IA 4OM8A 5LZ5A 1F4LA 2E87A 2XUOA 1U5CA 3QR8A 2OWEA 3RASA 4BY1B 3PHHA 1RAFA 1XD2A 3UKOA 4NTZA 5BSFA 3BAFA 5KYYA 5T4FA 5M3FG 2H85A 4BQQA 2R1UA 1NURA 3M7NA 4R4JA 1PYDA 1E9RA 4UTZA 1O87A 4ZDKA 5HBRA 5FFFA 2F03A 4ZU6X 4RWSC 3TR5A 1TW2A 1ZNYA 1TKCA 2YR0A 2CVQA 1QFSA 3W5VA 2X5OA 2PZKA 3KHKA 2DPLA 1VYVA 1G9SA 3BVZA 3LCCA 3G0GA 5FV4A 2FW1A 1DCMA 3WK9A 1U8XX 2ZRJA 2BRUA 4R8NA 3OA0A 1TT5B 1RLIA 5JNUA 5F2OA 1Z9FA 2VAXA 1EU1A 4OQEA 1XRPA 2JD0A 1SDFA 4AYBB 4AIRA 1O7LA 3REOA 4QYXA 3U17A 2NPOA 1TS4A 4J76A 4JBMA 1MD2D 5L4SA 4HO1X 3LT1A 3IPLA 3TLBA 3ESZA 2NUTA 4UAVA 1W94A 4OFXA 2WZBA 4KYIB 3GLKA 2CHEA 1YQUA 1CKEA 2IEZA 4AM8A 3EZ9A 4R83A 1X80A 4BKOA 1V3VA 4KLRA 3BE4A 4UM9B 3W8NA 3M81A 5HRAA 3UJ6A 2RJOA 2AQ2B 1L2TA 1R6XA 2IDJA 3K15A 1TR5A 4M0UA 4FONA 1ESZA 3ITNA 5JSUA 4MRNA 5CNJA 5B3LA 5LBIA 4TWRA 4B2IA 1T9HA 2O14A 3BFPA 1T6ZA 1H2ZA 1TF5A 3UOAB 3IFSA 1YFLA 4Q3OA 4L75A 2Y0SG 2JAUA 3SZMA 3D8TA 4MS3A 3TQYA 3ZG6A 3RF7A 4ZIRB 5CLFA 1KRSA 4TTQA 3FDIA 4I1YA 4CQMA 3L79A 1X9NA 1SJED 5FA8A 2Z30A 2C9CA 3E5MA 5CBEE 1QUEA 4FYKA 4ICIA 4DQKA 2F55A 4GLAC 1BD4A 2R60A 2J8ZA 4L0MA 1DOAA 5B4UA 3D3RA 3ZE7A 2PI2A 1RC8A 3TZBA 1FSGA 4H3VA 4DMRA 3EH2A 2UUOA 1GUNA 3GDOA 5IAJA 3DUFA 2WT8A 3HVUA 3TPFA 1Z0ZA 1YUBA 2PVSA 1YB1A 1KGSA 1WV1A 3LKDA 4PE5B 3AEUA 4Y6PA 4R7GA 4XB6B 1R10A 3VDXA 4IDCA 3O21A 1QAQA 5DLPA 1BU8A 2VTBA 1E79D 2R93G 1NUSA 3UJAA 2MR5A 4DR5Q 4OG2A 1IHOA 4DU9A 2WSSA 4FR5A 2OC4A 1S01A 4IGFA 1ESMA 4DT1B 2NYZD 4UAIA 1H65A 1K2VN 1VQHA 4U7TB 5FPHA 1JPUA 5KNDD 4B87A 3VH4A 5CXXA 1B8AA 4FXDA 1SA0B 3FYUA 5CT5A 1ET9A 4IUUA 3W05A 1DXMA 3BX1A 3P1JA 5BN4B 2XEXA 1P39A 4DLTA 1EAMA 3LDFA 3BJMA 3G2HA 2I7DA 1RCVD 3TFOA 3ZJYA 1ONOA 5C3EB 3A8TA 5CX1A 4FXGC 1E22A 2FMMA 1JHYA 2O48X 4P2GA 5L51A 1J5XA 3ICWA 3LP6A 4ZAGA 4A8JC 1W5TA 1X74A 5KBYA 1PYSB 4HX2A 2RK4A 1D2GA 3DFIA 1L8XA 3ELBA 2RAPA 3EWSA 3HOUH 3OCZA 1TKWB 1VQIA 1D2RA 5I9MA 1EG2A 3DDOA 3L0DA 2BJVA 4UNIA 2L11A 3ADOA 2HA3A 4K2AA 2C31A 2IXAA 4XFDA 3CEJA 3X3HA 4RFSA 3KOOA 1UINA 4HB4A 3T34A 3DAYA 5HGJA 3KSRA 3A5ZB 4LXXA 3HZHA 1H0RA 2PS3A 4AD8A 1PFWA 2X5KO 1EBBA 3ZE0B 5LD2C 5ITZA 3N76A 5I5EA 5JVDB 4G4SP 3UA3A 4ZJYA 3QYFA 2K2WA 2CJWB 5DASA 2OFOA 3DM9B 2HOQA 2Y77A 1P75A 1GSAA 1GZUA 3J81j 4DV4L 4M0LA 1HQRD 1ZN8A 3TUIC 4BYMA 1PGPA 3ILVA 4A3FB 3SP1A 2C07A 2QRUA 1IDN1 3ROMA 4PZ0A 4QUIA 2X6TA 1IG0A 1JW9B 4JBIA 2GM9A 1EY7A 1P4GA 5AHRA 2ZI9A 3R2IA 3EMKA 3IIMA 2G70A 4J0FA 4KIWA 3MTAA 4WOPA 3BOSA 5B1YA 1SCNE 1UUPA 3VHLB 3LUBA 1CUJA 1OILA 1XN1A 3GFTA 3KAJA 1UCFA 1HE8B 3R3OA 2YYZA 1SBQA 1CY4A 2V7EA 4AUKA 4AJLA 1PJRA 3ILXA 4QPJC 1BXZA 1PLLA 2W83A 1M2VA 1D2MA 3T94A 2EZVA 4YR9A 1I50B 3H2GA 4KO4S 2CZQA 2QR3A 2WT9A 3WHPA 1MZPA 2DWUA 3ETNA 2CJFA 4U2KA 3CSUA 1G66A 2AW5A 2PO7A 4JQOA 2A86A 3WGOA 4YAUA 2OV3A 3KTOA 4WLNA 2DSTA 3RNOA 2XZPA 4NRDA 1NUCA 2V59A 3MJTA 5D8DA 2I6XA 2RONA 1IW7D 2BV3A 3MXOA 3ME5A 2ATVA 2WQ7A 2VKQA 3HGTA 2F1HA 4BBAA 2WIAA 4Y1RB 2AXNA 4GKKL 3DBIA 3R0XA 1J49A 1EA5A 3NOQA 2F9MA 1ODIA 1O9GA 4JJFA 3SGIA 1KIFA 4LYFA 1X1TA 3D4BA 3ZLBA 3BTOA 2FPGA 5ARDA 2O2CA 3STWA 2C96A 4P75A 2WKPA 3W5IA 2QV0A 1IAVA 2R7ZH 3MRVA 2B9EA 4D3ZA 3DHQA 3AV0B 2XXAA 3ESQA 2P1RA 1AF7A 3MZ0A 2HGZA 3CRW1 3R4VA 3QTBA 2BDNA 1GZ5A 1QE6A 4LRYA 3VPCA 1H95A 3FOWA 5A3JA 2XNSA 3PQCA 1HTTA 3F7TA 2M6RA 3RYHB 1ZD8A 3ETCA 2B69A 5H82A 5JISA 1FA9A 3MA0A 5EXPA 3NPAA 4V1CA 1KI1A 4CV3A 1S1MA 1GRCA 1HNWB 2Q6LA 3OAAA 4PLTA 2Q3DA 1ZYUA 4DQ0A 4G0MA 2DPMA 1J8FA 5FO0A 4C3IG 4YPVA 4KK4A 2E6KA 3PDJA 1C3EA 3DVLA 1CUGA 3VKWA 1Z0AA 2VDRB 1K0RA 1W35A 4J0HA 1S4MA 1UBNA 3QWIA 5C7OO 5EPUA 5KTPA 1V3QE 3RIYA 4EW2A 1SUBA 4IJ5A 2AEFA 3AM4A 4XIJA 4WCDA 1A3TA 3C98A 1LTKA 4O0LA 1NVAA 3MYRA 3I2JA 2V1XA 4RKBA 5M3MB 4RW0A 2D9UA 2QPLA 2QS9A 2CSXA 1XNGA 2GVAA 5DI9A 4LYJA 3SY8A 2LZ0A 3FCAA 1N7JA 4HR7A 1TZBA 1TDJA 5LQJA 2RGGA 4KRGA 5EP3A 2ZE7A 4M7RA 2XMPA 1X65A 2QPAA 1YZTA 4V0KA 4CGZA 5FFNA 4IVNA 4WNIA 1CS0B 4JFAA 2PXAA 1IN1A 1GZ4A 4Y0NA 4NEGA 3EFXD 5K0TA 3RFXA 1YGYA 2JFQA 4NKLA 2RH8A 5FBRB 2XQGA 3E9CA 4C1BA 3DGEC 4HDNB 4UAJA 4DRXA 2O0HA 5DM4A 1JIVA 1ZAYA 4IZOA 1JG4A 1ISPA 2B82A 3A1CA 3BVGA 3WBKA 5MHTA 4J0IA 4B7AA 5IP7H 3H2JA 4R9WA 1SBCA 3R7WA 2Y6UA 1I2CA 2KCTA 4ACAA 4QFDA 1MHPA 4GRIA 5K4GA 3H84A 1UEIA 2NTJA 4Q1FA 3IKLA 4C14A 4JWTA 2ZJ6A 1X3SA 1U2DC 5K9ZA 2X40A 1WXHA 4QYMA 1Z4NA 4ZAYA 2ZIWB 4IJKA 4QDKA 1JA9A 3AETA 4F2HA 1P7CA 3FF4A 3KEGA 2PSSA 2Y1CA 2GOYA 3P97A 2QI9C 4ZWNA 4MYDA 2EXXA 1G64A 1JJIA 1JBEA 1O77A 2Q5QA 2F43B 2POCA 5FF9A 1YL7A 4RDIA 2BFOA 4DJFC 3ZGVA 1TQDA 1JFFB 2GD0A 2PEYA 1KPGA 4P92A 1G6OA 3V2HA 5E9JA 3LBFA 2ZB2A 4H18A 2P4QA 5LQRA 4RFSB 1CJKC 1VQLA 4HAWA 2Z98A 3ZCQA 3KJIA 3D7NA 1K83H 1SFOB 3ZHVA 3ZHTA 4DUZB 5LUBA 5KCZA 1DMRA 5JJBA 3SOPA 4LXYA 4FD3A 1RI5A 1GCIA 3AUSA 1O7JA 3OBIA 2VQFQ 1HETA 4AUMA 2XWBB 1J0XO 1TO2E 3F6YA 4WBNB 5AW0A 3IP7A 1EP9A 4WZAE 3HFSA 4EO7A 1BXGB 1JECA 1DRUA 1S2DA 2FMXA 3GMDA 1XO1A 4YAKA 4GRAA 4RY9A 5CVTA 1QE5A 3HU3A 3LIIA 3PL1A 4UFOA 1KI6B 1ULSA 3WL4A 5DM73 3D81A 3EMDA 2ID4A 3KLWA 4AO7A 3O4RA 4CG3A 3HZXA 4G0ZA 2PUCA 3FUWA 1G21A 2PA3A 1M1NB 1L1FA 1H9AA 4C6HA 1AN0A 3OQIA 3RIEA 3S28A 4V1CI 4ILKA 2F3PA 2Y6VA 3D4LA 1L7OA 3NYRA 2GCEA 1O7YA 1WVMA 2ZJYA 4M87A 2FYTA 1GNVA 4MQFB 3RS0A 3AKDA 1RHPA 2UVQA 2CCGA 1D0IA 2GNPA 4O6VA 2BONA 1EVKA 4D2IA 3E7FA 3GZNB 1QF9A 1QCBD 4DCCA 1GUTA 4YT5A 4BQPA 2LKCA 5IT9E 4Y8VA 4UEJA 1NIPA 3VTAA 4ASUD 4KTVE 4MMYB 4O25A 2ZXUA 4A92A 3L6OO 3AUFA 1I4TD 4E5NA 3DE2X 1Q7RA 3PUYA 1R5JA 2Z9HA 1XLWA 4Z6KA 5D6NA 4K8IA 4ZT7A 3IMEA 1XK6A 4YUWA 2WC1A 3OLCX 2LBPA 5EMLA 4RHCA 5K20A 3WFJA 1YRWA 1N2EA 2KBEA 2IA5A 3O7MA 4RVHA 4KZPA 1FFXA 4LHSA 4X6XA 2XQIA 4LWZA 4ZK6A 2GS9A 3RZDH 5IDVA 3UAWA 4BGUA 3U5TA 2H59A 1UM9B 1EM6A 4X6UA 4H7IA 3JVEA 1D6NA 1WMBA 4YWMA 2HA6A 5TIIA 1WRBA 4GIBA 4DJ5X 9LDTA 1ZRSA 1DFHA 2GBLC 2I03A 1K6EA 4OOEA 3MQ4A 4J29A 7MDHA