1V43A

Crystal structure of atpase subunit of abc sugar transporter
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
367
structure length
353
Chain Sequence
VIKMVEVKLENLTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYLPPKDRNISMVFQHMTVYENIAFPLKKFPKDEIDKRVRWAAELLQIEELLNRYPAQLSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKVTTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLRPNSVFVATFIGAPEMNILEVSVGDGYLEGRGFRIELPQMDLLKDYVGKTVLFGIRPEHMTVEGVHMKRTARLIGKVDFVEALGTDTILHVKFGDELVKVKLPGHIPIEPGREVKVIMDLDMIHVFDKDTEKAIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ATP-binding cassette of multisugar transporter from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transport protein
molecule keywords sugar-binding transport ATP-binding protein
total genus 96
structure length 353
sequence length 367
ec nomenclature
pdb deposition date 2003-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1v43A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1v43A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1v43A01
2H57A 1QHIA 1U2RA 3Q9LA 4MGIR 4AC9A 4BY7H 4HDOB 3T5GA 2PEZA 1C7YA 3TQCA 2J0VA 1QG4A 4GI7A 3UDXA 2BMDA 1G51A 3L2OB 4QNMA 4HLUC 4PAQA 1VQIA 1ZM9A 4NYJQ 4UKDA 3CCQA 4DC9A 1OXVA 1E79D 4XSHA 4M1SA 4EPWA 2QE7A 2F1RA 2FV8A 3GJ4A 4N0DA 2KCMA 3GO5A 2IHBA 2QTHA 2RHDA 3ADCA 2Q3FA 1EYGA 1E9CA 1G5TA 4M0LA 2ZTEA 3I32A 5E4FA 8OHMA 2LWIA 3N5CA 3UKDA 4B3FX 5DHFA 1SKYE 4ZDKA 1BOFA 2OAP1 1FTNA 2ZI9A 3C8UA 3M0EA 5IT9c 4AKHA 2B3GA 3DPUA 4UQOA 4M9QA 2JLWA 4AIMA 1CBUA 3VR3A 4A0GA 1AQYA 2CXXA 4JYCA 4EFLA 1WQ1R 2OBMA 4CVNA 1W1WA 1NKSA 4DV7Q 1XTDA 2GN5A 3T1YQ 1E96A 1P2VA 2I1QA 3IPXA 2BKEA 3C5CA 3IRBA 5D3MA 3T53B 4KHZA 3GLHE 1TWHH 2IY5B 2EWWA 2FU5C 4MUBA 1CTMA 3JZMA 3TR0A 1NY5A 1Q86C 4US0R 4M4SA 3QUSA 4JI4L 4PO1A 1E2JA 3PQCA 3L0OA 1ZIOA 2NIPA 5BN5A 4A36A 3ZD6A 5DO9A 2NOAA 5LB2A 2QF7A 2PZGA 2B7CA 1V8QA 5GAHC 2H92A 2GILA 1P5ZB 4MRNA 3CZQA 1N6HA 2ZSEA 4HJ7A 5G41A 2D2CC 2AN9A 4CZ2A 4TLBA 4KKUA 2HCJB 2WV9A 3BJIC 1Z29A 2G77B 2H17A 2YKGA 2GVZC 4BA2I 2PNHA 1ASYA 3HKZG 2ZM5A 5J4YA 1AH9A 1WRBA 3PUVA 1HQMC 1U0JA 2FFQA 3CW2A 4PC1A 3HYRA 4R4QA 2QGZA 3K7UC 1K83H 2PLRA 1CUKA 2A68D 2ZVPX 3ZD7A 5M3FH 2ZRNA 4C0JA 4A8JA 1WA5A 2F3TA 1UE7A 1LYLA 1JR3D 2IW3A 4OHVA 3RAPR 3KDSE 4BEBA 2WSSA 2BMEA 4I1VA 4CIDA 1QF9A 3RNUA 2UZ3A 4GKKQ 1CFMA 3Q7QA 4DV6Q 5DN6A 4G7ZC 2HIVA 3E5HA 3ULLA 3QKRA 4L5QA 1D7QA 5FBQB 4YY3Q 4DAYB 3SZRA 3RLNA 1Z9FA 1VQCA 3FDIA 1Q7YC 4RD4A 3U4QB 1P2SA 2ZSAA 4QGUA 4KHPQ 2VP2A 4XWKA 5IWAQ 1FYCA 1XJQA 1DD2A 1UE6A 4I99A 4JI8L 2CE2X 4II7A 2YHSA 3K0XA 1OXTA 3NEMA 4JI1Q 1EUJA 3DKPA 1E7ZA 1E94E 5DH9A 5LD2B 2WJHA 5AUQA 1I50H 3FKIG 4YHHL 3I4OA 2O52A 3RDPA 4DLXA 4NTZA 1OHHA 1Y1VH 2KB0A 3SQWA 2HXSA 1S1MA 2IYSA 4QG7A 4WAUA 1KMHA 1LFDB 1I4LD 721PA 4HIDA 2GVAA 2EQBA 3OIVA 3BG3A 1J8MF 1W2HA 2DNCA 1XTQA 1Q0UA 1YR6A 2MSEB 4B33A 4Q9LA 4JI3Q 1N2CE 2DCUA 1PJRA 1VG1A 2XNDA 2BH8A 2FH5B 3RRMA 4GMDA 2VHUA 3E2IA 4A3FH 4M9SA 4QJ5A 3R7WB 2MO1A 4DB4A 3K9NA 1PMRA 3OIYA 2Q2HA 3GLGE 3B9QA 2A69D 2ID0A 1Z6TA 2QG6A 4C0KA 4JVLA 1QVGA 2AXNA 3PJRA 5JSZB 1QZHA 2DFNA 3OIUA 2OEPA 4M1MA 1LM0A 4TMXA 3BZCA 1VMAA 1C9KA 1PA6A 3VKGA 5M3MH 1KHIA 1K8AC 1G20E 2CWPA 4P3YA 1KOFA 5JS7A 1ZRHA 2O8EA 1G8PA 3PITA 5J3BA 4RFSA 4IOJA 5SZHB 3WMGA 2XTMA 4LHZA 1QVCA 2CCZA 2E5LL 2ZR9A 1ZMXA 3HOYH 4DV0L 1BH2A 3RHFA 4D6PA 1RW4A 4LFBQ 2QRZA 4Q18A 3AKYA 4MRRA 4Q9HA 3J81k 1XZQA 1CJVC 3RS2A 4P74A 4XH9B 1EOVA 1JBKA 2UUAL 3C7KA 2W2XA 1IONA 2ZRJA 5DSZA 2AHOA 5HTKA 2JK8A 3AQ4A 2B6HA 2RGXA 3GJ7A 1VG8A 1I94L 4D82A 3WWVA 1E9AA 2G83A 4DR3Q 1Q82C 3BB1A 4TYQA 1K8GA 3OPOA 1XJVA 3GLFA 1XD2A 1Z0KA 2G3YA 4TYYA 2VP9A 3SC3A 1N9WA 4IPCA 5FOTA 5K36G 4A75A 1ASZA 4FCTA 3I7FA 1BBUA 3EA0A 1PLJA 1KIMA 3KQUA 2O8DB 3RLOA 2JA6H 2O0KA 2A3RA 1UKZA 3K70B 2AWOA 2QBYA 1VQ6A 2XSZA 1E0KA 1M74A 4FMCF 4CEIB 5A5GA 4BFWA 1XTIA 1NRJB 2J7KA 4F7WA 3MG9A 1YBYA 4O3MA 3J80c 4KU4A 3T1VA 2K52A 4DAMA 5FTJA 1R5OA 4TQ9A 2A5FA 3CLVA 1RKBA 1H9MA 1K6MA 1DELA 1G18A 4Q4JA 2AWNA 1HE8B 2CKZB 1NTGA 3IQXA 1X86B 3N2EA 3KXIA 5CIQA 3ZGXA 1E2GA 4IXNA 1MJCA 1XD2B 4KITB 1VQPA 4Q1DA 4B3SL 3ZZ0A 2QL6A 2RKOA 5IYDH 1XEXB 4A3LH 1US8A 1T8TA 4PHFA 4UNNA 2PCFB 1GKIA 1E4VA 2ZM6Q 2F9LA 5AJXA 4KCGA 1E1OA 1L0WA 2J59A 3K0FB 4LFAL 5E7IA 2V54A 3EN2A 2UXCQ 2GAAA 1VQFA 2FGKA 4TZ0A 5CB6A 1A5TA 1MRNA 1ESNA 3B6EA 2PI2A 1HPCA 1XEWY 1NVVR 4DLSA 1NJIC 3I4NH 2VBCA 2FE4A 5L3SA 2P5TB 3SGIA 1SHZA 4KN4C 3FMPB 4LF9Q 1LS6A 5FPYA 3NEYA 4Q4HB 4L5TA 2QT0A 2WB1E 3QF4A 1Z8FA 1X8JA 4BEJA 2B63G 2VUMG 4LFBL 1N34L 3EPJA 1Y69U 3SYLA 4IVQA 4JT4A 1FR3A 1E9DA 4EJSB 4OI0A 2D7CA 3E9IA 1K8MA 1VS0A 4X62L 1YZKA 2EFHB 1X3FA 1IBLQ 3ZH9B 2H5XA 1GUOA 1GVPA 2K4KA 2YTYA 4A4IA 3S16H 1Y63A 1YHBA 1Y1WG 1SZPA 1E2EA 3SYNA 5BW8A 4HUQB 5EXTA 1KRSA 2C96A 4QL3A 3I4NG 4DLWA 3THYB 1PH5A 3WBKA 3W90A 4QBGB 5JCZA 2IX1A 2GWHA 2XXAA 1WCV1 4DSOA 2NPIA 4CYMA 2BMFA 1I4TD 2CHVA 4ESHA 2W6IA 2N78A 2DGYA 1RRPA 1Z08A 4LX0A 5HE8A 2JJ2D 4AD8A 1XNRL 2ZTSA 4LJAA 2IYYA 2WWHA 3IBYA 4LV5B 3K9GA 4P75A 5FR1A 4B75A 2JLSA 4QHYA 3LQRA 4YC7A 2ERYA 3T06B 3I72A 3H1TA 3RSOA 4OO1I 5HR5A 5JWHA 4AQYQ 1NF3A 3TREA 3LBIA 2C04A 1ZUHA 2WM9B 2ERXA 5C2JB 1YJNA 1E1RA 4ZPXA 2XB4A 4FMDF 1X3EA 2IYZA 2KE5A 4URXR 4XOIA 3CRW1 1D9XA 1NMFA 2R92G 3ASYA 3IO5A 3X2SA 4B48A 2PL3A 3DDCA 2E2HH 2F7SA 5JBQA 4YHHQ 4DCUA 1RRFA 2F1HA 2FFHA 2IYUA 2ORWA 4PX9A 3P32A 3BJUA 2YTXA 1CKNA 1EWIA 1GD7A 1EG7A 2VF8A 3GJ5A 2O8FB 1J7KA 4B2LA 4A15A 1NN1A 1A6XA 2F43A 4IOKA 4DV3L 2V4ZA 4C3JH 2D2EA 3THYA 1E79A 5L8VA 2P65A 4LJ8A 1S3GA 3KKOA 2GVBA 1NI3A 1PYSB 2ZUBA 2N1BA 2ZR0A 4GZMA 1G21E 4JLPA 4US1R 2ZI4A 3HR7A 4NL4H 3U6BA 1X9NA 4HZIA 5K8LA 2UXBL 4RZ3A 5A4JA 1CTQA 1YR7A 2P3SA 4RJLA 2ORVA 1U8AA 1BYIA 4P0TA 2MSDB 4LRWA 1ZU5A 3LY5A 4LJ7A 2EVWX 2PCJA 3RS7A 1KKMA 2H18A 1NBMA 3TAHA 3LWUA 4BXXH 1QHNA 4JI6L 1PLLA 4A2PA 4ASUD 4LNQA 4DK0A 1KY3A 3WNBA 1GIAA 3GTJH 1NSTA 1WBDA 2BBOA 4JK1C 3P27A 5H70A 1W7AA 3RS5A 1CULC 1UBGA 2N8NA 1G17A 5KSOA 4S2EA 4HLQB 2VF7A 3JZAA 3K7AH 3LBHA 4TTQA 3D7MA 1YITA 2UVQA 3NH9A 4PZZA 1SVMA 1FPMA 2KSQA 3ER0A 1XTKA 4DEYA 2K32A 5BYJA 2HYIC 3G4SA 4ZIRB 4GNXB 4GKJL 1W48A 4JBMA 3TW8B 4DV4L 1VF7A 4WA7A 3KQHA 3BDOA 4POGA 1AS0A 4JI5L 1TQDA 1E9FA 2K14A 2RB4A 3KJPA 3W6PA 2N49A 1DG1G 1SROA 1UBFA 1WDTA 2BC9A 2EW1A 3OEEA 4BLPA 5EAYA 2UXDL 4LWCA 1YR9A 3H4MA 2L5TA 4LF9L 1KJYA 5C44H 1PH8A 4PANA 1G3QA 3UK6A 2C99A 1YJ9A 2REBA 1OW3B 4M1YA 3PF4A 121PA 3OEHD 5EXXA 5EP4A 2IYWA 1FL9A 1VQ9A 2ZSFA 1G16A 4A3CH 5EUMA 2A1AA 3G82C 1CI3M 3DXJC 4PG3A 3KF8B 4O2RA 2AK2A 3M85A 4DV3Q 1G6OA 2UKDA 2VTKA 3KDFA 3AUXA 2FFBA 2OV2A 1Y8OB 2BH2A 3EWSA 4JKYA 4Q02A 5EXSA 3TVDA 1X8LA 3I1FA 4C3ZA 1W0JD 4EKDA 2MFIA 2V4DA 4TWZA 2JLVA 4XTCS 4HZUA 3OEED 1WOCA 1XPUA 2CL6X 1VCIA 2QTFA 4DV2Q 4C9BA 1A62A 1K8OA 3U50C 4LF8Q 1XNQL 2FEMA 2YTVA 2NVXH 4ASUA 1IAQA 2QP9X 4KSCA 3GTGH 2KBEA 4EQ5A 4AKEA 3QXCA 3STBC 3GTQH 1YZQA 2F4VQ 3OHMA 3NC1C 4FIDA 2QT1A 1TWAH 1OH6A 3I5XA 1WCMH 4B76A 3EC2A 3TNFA 2K5HA 1HNWL 4QGHA 1Y1VG 5JRJA 2ZJBA 1ANKA 3CQZH 1A63A 4W5JA 2R8RA 3R7WA 1GITA 1RFLA 2JASA 1A2BA 2HLDD 3I3SR 2ZANA 2FMXA 4K0KQ 4XVQA 5JFGA 4RMFA 3NBXX 3DMDA 2GKSA 4ILEA 3AH8A 3GLFB 1KO7A 4BZQA 4X66Q 1YRAA 3BFVA 2QSZA 3A8IE 3NWJA 2AXPA 4JLMA 4BPBA 3REGA 1BYUA 4LHWA 2YWHA 3WBJA 1XNJA 4MTNA 4HZUB 2ZRAA 3SFZA 3AVYA 1E6CA 2E2JH 2I5MX 1A4RA 5FPTA 1L4UA 2O5VA 5D3QA 3KYHC 5FPSA 1L1OB 4CF7A 2P6NA 4FCWA 2FJUA 2WMNB 1EIFA 2C9YA 1EFCA 3PEWA 4G7HC 1F48A 4DR2L 1JJVA 4C2MH 3UG7A 4KJZA 3EQLC 4P71A 2W58A 5IK2A 4DLZA 4JBXA 2F43B 1SVOA 1HE1C 1ZAKA 3AFPA 5LB4A 4LZZA 2IYRA 1GL9B 2RGNC 3VU9A 1S4QA 1IXZA 2CJWA 1OH8A 3DZ8A 1W47A 1X6VA 2BDTA 1H9SA 4DUYL 1AZSC 5FUXA 1IOZA 2P0EA 1B8AA 4A0HA 3LW8A 2V6IA 1L4YA 4GNKA 1DAGA 3MSXA 1W0KA 3CW2C 4IPHA 1E0SA 2QGNA 4FWIB 4LV6A 2D4HA 3TQFA 1SVLA 5ELNA 3B13B 1GVNB 4DCTA 1IN4A 1HR0L 2GEVA 4NP6A 2ZJ2A 3TZUA 3X1XA 1CLUA 4HEJA 4RD2A 2AKYA 2OT3B 2QQEA 3VX3A 3WYAA 1NL3A 4JSYA 4AIIA 3IFTA 3EPHA 1QHHA 3TRZA 1NVXQ 3LA6A 1CKNB 3SNHA 2O8FA 3MMPA 2ASEA 4NB3A 2V55B 4JOIC 3RSLA 4HJ9A 4EUNA 4KFSA 4F38A 2EVBA 3H94A 4GLAC 1IBKL 5B2ZA 4Q4JB 4A0FA 2D06A 3HOUG 1G8HA 3K0SA 1VQ7A 1EQRA 3PEVA 3TBKA 2WB1G 5M5WH 3LDAA 2N42A 5P21A 3FTQA 2WWYA 2G0NA 2NTYC 1A82A 2JJ8A 2VRWA 4K46A 4PHTA 1HNZL 3A4MA 4FINA 4NKRA 1OH5A 2VLIA 3HKSA 2QP4A 1Z7TA 2RGEA 1YHAA 1LF5A 1QVRA 4DDTA 4RG1A 2ALYB 4GZLA 4OQMA 2OBLA 2G88A 1Q3TA 2X77A 3GQBA 2GF0A 1H9SB 3C5HA 5CM8B 3THXA 4V0MA 1F2TA 4LJ6A 4PSVA 1B0UA 4NBSA 1OE0A 1N6LA 1T3HA 1FX0B 1JR3A 1GWNA 2W2TA 3EIHA 3FHCB 5B64A 4D25A 3K53A 5SZKB 3S1MH 4UY8C 1K5GA 2LXKA 5GAEC 2OUKA 2Y0SE 4IPDA 5EP1A 3T1OA 4L15A 5KDDA 1OPXA 1IZ6A 3Q85A 4BZXA 4MDFA 1CJMA 2QSYA 1RZ3A 3CPWA 1ZBDA 2OTLA 1FUKA 4DIDA 4DV4Q 2BCJQ 1C0AA 4QBIA 1O3YA 5DI3A 4DXAA 2IS4A 2J45A 2AX4A 4DWJA 1EFHA 1MJEA 2GXQA 4W7SA 1XRJA 1CIPA 1VQ4A 1QHXA 2XSZD 3KB2A 1EX6A 4JVSB 3SFVA 1VIYA 3NG1A 3FMIA 5C4JH 1YI2A 1XDBA 2XXAB 3BXZA 3EZ9A 4DRZA 1SR3A 3TSOA 1E98A 2F9MA 2ATXA 1HCZA 2D3WA 3T1TA 3PUYA 3AV0B 2K50A 1BIFA 1G7SA 3AEVA 2DN8A 2ZRMA 5J4VA 2GK6A 5JEEA 3TEHB 4A4DA 2HF8A 2BOVA 3CWZA 5JMTA 2KI5A 3Q8DA 4DUZQ 4OI2A 5AJVB 5KDLA 4IOCA 3HOZG 2Q3MA 2ZI7A 3CWQA 1P2UA 4P4TA 1EFRD 1T5LA 1ZW6A 1KAOA 2CE7A 1L1OC 3A8JE 2GXUA 4EPRA 2CFMA 1WXQA 3CRVA 3KXLA 3Q5DA 3QXJA 3FPPA 1XFAA 2O0HA 3FVQA 3CRLC 1G4UR 5FOSA 5L3SB 4LFAQ 2ODEA 4URZR 3WMEA 2VP5A 3R9IA 1OF1A 5HY6A 4O0MA 1CJTC 5FOVA 3TS2A 2GCNA 1NN3A 3RRYA 2CLCX 3LRPA 2R7FA 4DNRB 4Q1FA 3HWSA 2F3IA 2IX0A 3HOZH 4OONA 1LTQA 3FMCA 1CP2A 1DAIA 1UDWA 1XEXA 2JJ2A 4MRPA 4B3DA 4CEIA 2QMUA 3OE7A 5TV2A 4K8OA 4Q1AA 4Z51A 4DK3C 1HH2P 1MV5A 1XTRA 4HIMA 2CW0C 3DHWC 2WICA 4DR4L 5C4MA 4DV7L 3ULJA 2Q8IB 1Z0FA 2HEIA 3QVVA 3RN5A 1U8YA 2VH5R 1TF5A 3TUZC 1M1YE 2NZJA 3VR6A 3GCGA 4FMBB 3KJGA 4HI0E 5FTNA 2QQ0A 1P6XA 1BVSA 2IXEA 4JZKA 1G3RA 3BE4A 4RZ2A 3GFTA 3NBFA 1UDXA 3CX8A 5IYBH 4YWKA 3PUWA 1JJ2A 4B47A 2IT1A 1QHSA 2NO9A 3MUFA 4MGZR 4F4CA 4JBJA 1IXRA 1MO6A 3U2QA 2HHHQ 4M8NE 2PZFA 2DY1A 4Y7NH 3ULPA 3A1SA 3AEZA 1QVFA 4GMXA 4CEHB 3OAAD 3ICQB 1WF3A 1ZNYA 4FI3C 4PPQA 1CKOA 1U9IC 1VYVA 2ZRGA 4PXAA 4RFSB 2QGQA 5FFMA 2FZ4A 3GTOH 5EE0A 2YYZA 5JWOA 2AD5A 2DR3A 2IYVA 3SHFA 2Q2TA 3OF5A 2VSFA 3IHWA 3IILA 3WP1B 1XTSA 2EWVA 2QU8A 3B60A 3K09C 3AVPA 3JVUA 4ZIRA 1FW6A 2C78A 1U99A 4O2DA 3FYHA 1N33Q 4B3RL 2HF9A 2OG2A 3CNLA 2EYUA 4DLRA 5B30A 5TMPA 4JLAA 5CYOA 1VIAA 1GL7A 4OL0A 1Q22A 3RS4A 1YZ6A 2A5DA 3BD9A 5HCIA 4D0NA 4PV1C 4P4SA 1W36C 4LI0A 3CF5A 4NXML 2UZIR 1B7YB 3GTLH 2GZAA 2QN6A 1ELOA 2WP8J 2D0PA 4I7ZC 1T5EA 4BFSA 5IT5A 4AY2A 1YNXA 4A9AA 4BFXA 2RGNA 2G9NA 2Q0HA 2XZPA 3MWLA 5DISB 1KSJA 4NH0A 2OQKA 1W36D 3HYTA 2Q21A 4MQBA 4DCSA 2BJVA 4JC0A 1GTVA 4Q21A 3THOA 3QENA 1AGRA 4JI6Q 3OW2A 4AYBE 1E2IA 4AG5A 4B3SQ 4G3XA 3VKHA 4U02A 5AUOB 4P31A 3THWB 3OTOL 1IXRC 2E9SA 3W5OA 2WOJA 2F6RA 3PENA 5F9HA 1G8FA 2WSMA 1R0XA 4FDBA 1M8PA 3ZZTA 4DT1A 4Y52H 1SLJA 2GHIA 5L3QA 3B1YA 2EJGC 1VQGA 1HQYE 1XMIA 2OXCA 1VKJA 4IFDH 1EFUA 1L7VC 4QHTA 3W8RA 2VL6A 1W44A 4Z54A 1PH6A 4HB0A 2R7ZH 1MKHA 1SFOH 1YJ5A 2AKWB 2CLSA 2VSXA 2KJQA 4Y0VA 4CT4B 1KL9A 5LMNW 4JCVE 1SULA 1DE0A 1TU4A 2NZ8A 1MIUA 2HHHL 3U7FB 4N1AA 4LJ4A 4YY3L 1IN7A 3QF7A 4BXXG 4OJKA 1R5BA 3DOEA 1TEVA 3O47A 3FHOA 5CB8A 1PH3A 3LO5A 4H1UA 4PO8A 4EPXA 1FOEB 3LBNA 1R10A 2ZRPA 4OI4A 2R93H 2V3CC 3AVTA 2VP6A 1K73C 1N6PA 2ZJQA 3FFAA 2GEUA 3HOXH 1SXJE 1XF9A 1N6RA 2CJWB 3ZIAD 5DNYB 2ZE8A 3CZPA 2O5IC 1WYDA 2HYDA 1Y3AA 5K8IA 2CNWD 1VQEA 4NYJR 2GA8A 2C35B 4O25A 4MH0R 4R2IA 5GJCA 4KVGA 1IQPA 1DBSA 2BA0A 1CR4A 5IP7G 1E2KA 1ZNWA 1U90A 2UUAQ 1SKYB 1XX6A 1VYUA 2IS6A 1PHJA 4B3TL 1TF7A 1XNRQ 1XCGB 1G8GA 2A68C 3T1HL 3EIQA 1C1YA 1VG0B 4M9XA 1KO4A 1KSFX 1MO5A 4DNIA 3CX7A 4FMDB 5IHPA 1VQJA 5TXGA 4N3NA 4D80A 5KSPA 3TS0A 2RGCA 1ZIPA 4FN5A 3KTAA 3DM9B 2A8VA 1IY0A 1ZCBA 2C9CA 3LNNA 2VHJA 1GL6A 3UANA 4BFVA 2Z4SA 4IDPA 1SXJD 3VAAA 3CR7A 2PT7A 2ZEJA 4V0KA 1WMSA 5GADl 1G3IA 1XCMA 2ZUCA 1JI0A 2OFOA 3B1VA 1TQ6A 4ZDWA 2LSSA 4IJHA 1OT3A 1DAKA 2A19A 1FX0A 4KFUA 3G5UA 4WZAE 1KSHA 3CRKC 1DXMA 4LBWA 3B6YA 3IEUA 3QBVA 4H9GA 3D6TB 2CMKA 3SJZA 2EXDA 4LYJA 2ONKA 3S15H 1P75A 5BWMA 2OCEA 1PYBA 5KPJA 2PQAB 5KPDA 3ERSX 2KHJA 1JB1A 1N0VC 1TQ2A 4Y0AA 4EJSC 2V8OA 1AJEA 4A3IH 4PSAA 3LD9A 1FJGL 2XOKD 2Z5FA 4HB2A 4PC7A 3LW7A 2CL7X 2E8GA 3EXAA 3QE0A 4ACBA 5J4HA 4Q7JB 2XOKA 4PZ8A 1EWHA 2ONJA 1S9HA 2PJRA 3FOZA 2ZM6L 1WBBA 1E0JA 3EPKA 4KLZA 2O5JC 3ASZA 4F4IA 3SDZA 1HQCA 1P4SA 5AJWA 3DO6A 2A6HC 3K8AA 1V5WA 1W4AA 2GCOA 2NO7A 4JI7L 3PVSA 2XB2A 2HDNB 1YHQA 5FBRB 4TYWA 1JPJA 3BFKA 1OV4A 3K9HA 3RZOH 1LB1B 1P9WA 2PX0A 3PSIA 1XCPA 2VP4A 3TRFA 4OX9L 3L0SA 3PCRB 1T5IA 2IHFA 1SMXA 1G7TA 1GSIA 1KDRA 4BY1H 1Z5ZA 1T9HA 2IA5A 4PFSA 5FTMA 3EZ7A 2I3BA 4G5RA 4DKXA 2E74C 3CPHA 1UEIA 3T35A 2DPXA 4BBRH 1U98A 2LKCA 4OX9Q 1KYIA 2WJGA 2ZS8A 1W49A 3K0CA 1S40A 1OHHD 1UBCA 1H9JA 5K8TA 1CR2A 2ZE7A 4WJ3M 2R6FA 1EFRA 1VPLA 4P33A 2QY9A 2BWJA 4DBLC 4Q9JA 4GOXA 1OJLA 2WSSD 3Q72A 521PA 2JA8H 2GK7A 1SXJA 3CUEF 5C4XH 4JVMA 3RN2A 1NMYA 1ZNXA 5CIWA 3AFQA 3P26A 2A2ZA 1CEEA 5FUWA 2K5VA 4DR3L 4GPTA 2GZDA 4HUQA 4ARZB 4A3FG 2BBSA 3A4LA 3JAMi 3QXHA 4RD0A 4NYMR 2R6DA 2Z43A 1ZD1A 4FXPA 1TPZA 5BXQC 4X62Q 1KAGA 3NH6A 4X8MA 1T6NA 5LMNL 4ZI3A 2WFWA 5M04A 1F60A 3L82B 2CCJA 4OBEA 4NXMQ 4GSYA 4LPKA 5F3WB 1W0JA 1PH2A 221PA 2F1IA 3O8CA 1OH7A 3H86A 2NVQH 2YJTD 1N5IA 1R2QA 2GJ8A 3AF2A 3LV8A 4JI5Q 3TH5A 1D8TA 1M2OB 1T8UA 4LYFA 2PPBC 3KFUA 2VQEL 4KV9A 3RWMB 2WJIA 2NVYH 2QEXA 3GTMH 1HT1E 1II0A 4DUZL 2WIAA 4GFDA 5EP3A 2GBLA 1TF2A 1VQBA 2X19A 3A4NA 4MUAA 4BUJA 3U6KA 4EIWA 1GRNA 1FVIA 1TQ4A 1WCMG 3U4VA 2ES2A 5FPKA 2DWQA 1UM8A 5IK2D 3BB3A 3KKNA 4R2HA 4LC1A 4IVRA 4YLGA 3TMKA 1XBTA 2G1KA 2KWIA 3IO3A 2WKQA 5GQOA 1D2MA 2RGDA 3FWYA 1ZNZA 2OFWA 4TSFA 3AF3A 3TK1A 1HZCA 2NO1A 2UUBL 5UKDA 3RVBA 3NHAA 4D4JA 3AP3A 5FTKA 4TYNA 1A0IA 2OZEA 2Q9AA 4Q19A 2WWGA 3ZZUA 5HZHA 1DOAA 3A74A 4IDOA 5JJLA 2GJAA 1H8ED 3WHLA 2VY3A 1NVWQ 5AJYA 1M90C 4LF8L 1XNQQ 4RKFA 4DLVA 3MFYA 1O7IA 4BASA 4A3KG 4DJTA 1VQ5A 2XNDD 2FDCA 4M9ZA 1RPZA 1ZYUA 2JQOA 2UUCQ 2Z6VA 3B8HA 2X8AA 2OHFA 3T12A 2EJFC 2FSIA 1U8ZA 1M6NA 3Q8XB 2YZ2A 1S9DA 3TUIC 4YXWD 1OFIA 2PH1A 4EPYA 1VQKA 2VNUD 2VHTA 3NBHB 2ZT9C 1IHUA 2ZJYA 1NIPA 2PT5A 1KI6A 5FLXc 3A36A 3DM3A 4L5RC 1HT2E 2HV8A 3EAQA 1EIYB 1F2TB 3L0IB 4LSGA 4RD1A 4AURA 3BU2A 1YEZA 2ZAMA 1D9ZA 1K5DA 1LV7A 1KI4A 5GJWC 4OI1A 4W5WA 1JXOA 4U7DA 3J81j 4QIWE 4B73A 2EQSA 2C77A 3BWDD 1VQAA 3PO3G 4JJKA 3TLXA 2CL0X 4IOMA 3PXGA 3A5UA 2QENA 5DYGA 5E7MA 3WRXC 1N32Q 3GFOA 2C03A 2D62A 2SHKA 3A7LA 5EE9A 4C0HA 2YWEA 2I5HA 3HP1A 3HU2A 5KSYA 1UAAA 1LUZA 1VYTA 3GEEA 3KL4A 2AFIE 2IYLD 5HE9A 2IX3A 4MNOA 1KDOA 2ANBA 1W3SA 1XEWX 4BBSG 2J7PD 2ODWA 3GP8A 1A1VA 3EC1A 1P16A 4OXPA 3ICEA 2DHRA 2FPLA 3GEHA 1J5EL 3CKLA 3BC1A 2JLUA 4LJ5A 1E2HA 1XPOA 5KTYA 2O8EB 4Q00A 3E9HA 2VP0A 3R8FA 4NCJA 1PH9A 1GRRA 1NLFA 5FL7A 5EJEA 2CBZA 4HIOA 4YDHB 1G5PA 3FPAA 4AG6A 5BR8Q 4DUYQ 2IXGA 1GO3E 3BAFA 1H9RA 4PO9A 4F92B 4C4PA 2BDOA 1TAGA 2J5XA 4HAUA 2KBNA 4A82A 4IHQA 1XMVA 4A3MG 2GCPA 4ZCIA 1QZGA 4ARZA 1NMXA 3BK7A 4NDZA 3SI7A 3J81c 3B85A 3A0JA 4N0EA 4GLXA 1Z22A 2RCNA 1SQ5A 3M6AA 4IDQA 4V03A 2OBNA 4DR6L 2QNRA 1R0ZA 3GLHB 1FJGQ 2EIFA 4NE2A 4D26A 1I6VC 3W1BA 2CNWA 2ZJZA 5GAGC 2UXBQ 1GP2A 4B43A 4JI8Q 1HYQA 1SVKA 5IRCD 1X3GA 2NQ2C 4QFMA 4BZPA 3RC3A 4ZDJA 4PC3A 4HUTA 1AS3A 1T0HB 4HSEA 1KY2A 1J6QA 3GMTA 3VNVA 3NDBB 5FOUA 3KFVA 2KCTA 2GRJA 2QPTA 4KODA 2O8BB 4GOPB 2CHQA 3I92A 4QXAA 2B8FA 5IYCG 4UXHA 4GKKL 4HAYA 4IKEA 3VHXA 3H15A 3IIKA 2JEBI 1HJPA 1R8SA 3UMFA 5B57C 2F4VL 3FKSA 3IEVA 1ESMA 4L9WA 3S1AB 3ZLJA 4YMVA 4DHEA 1CRQA 2ZSBA 1WE2A 2Z0MA 1AS2A 3KXKA 1G19A 3A58B 1NNEA 3K0FA 4HAXA 5CITA 1PLKA 2XITA 1F2UA 4TMVA 2QBYB 1OIXA 1HR0W 5KNDA 1H8HD 3ADKA 3GDEA 1SGWA 3QVUA 4Q1EA 3REFA 1ONLA 1JJ7A 4B3TQ 4MITA 5IYCH 1MKYA 4OWXB 2B29A 2FN4A 2WKPA 4AKGA 4PZLA 3K0AA 3I4LA 4JT2A 3KKMA 3V9PA 4POAA 1AE3A 3PIOA 1E1QA 4TL8A 4KI0A 4CEHA 1U5KA 3H3VI 2VA8A 2ZS7A 1Q1BA 2OLJA 3LAWA 2ZI3A 1NJGA 3EX7C 1MRSA 1W2BA 2AK3A 4ZDIA 3OESA 1LNZA 2UU9L 1LW7A 4YMSA 3W6NA 4R71A 2AHOB 1KK3A 4ZO4A 4G0NA 2J7PA 3UATA 1P9NA 2CVHA 4RFVA 3KJHA 1P60A 4TMKA 1O78A 1VQ8A 1LVGA 3W5JA 2I1VB 2FNAA 2D0OA 1II8A 2JA6G 1TL7C 2KHIA 1JAIA 2A30A 2Q6TA 3QF4B 4OQNA 1IYUA 4H02A 2VQEQ 5HZKA 2C95A 4GL2A 1AKYA 5BN3A 2W0SA 4DV5Q 1DTSA 4IO9A 1E1RD 4HAZA 5J4LA 4AQYL 2KCCA 4LFCL 2RAPA 2H7VA 3F2CA 2OQ0A 1E9RA 1NP6A 1KO1A 2V9PA 2J0QA 1GUSA 1HTPA 2GDJA 4E22A 5G3YA 4IQZA 3VFDA 4QBFA 2PQAA 4X64L 1GAJA 1Z3IX 4OK3A 2A9KA 3PEYA 3ZJYA 1QHHB 4PZYA 4EDHA 3BH0A 4PQFA 1ZKOA 2A6ED 3SJAA 1N36Q 3D4RA 1KDTA 3K9LA 1NG9A 2BBWA 1TTTA 2W0MA 1SVSA 1OB5A 1K3RA 2QA5A 3CCLA 4B71A 1GUTA 3W3ZB 2R44A 2ZTCA 3ZQ6A 4JI2Q 4IJLA 4GNXA 3U7HB 1WI5A 4YWLA 1RIFA 4KAXA 4MGYR 1FMLA 4LY6A 2WJVA 1UWVA 3PV0A 1CU1A 1H8HA 3FFBA 3U60B 3BIFA 3PO2G 1DG3A 1O7LA 5HCNA 4Z1MD 4B35A 1XJCA 4HJ5A 1II8B 1Z28A 3RNLA 2V7QD 3GEIA 4Q9IA 1KQSA 1CSPA 2YVUA 4LJ9A 3WP0A 1OXXK 1E2QA 1Z6AA 2QM8A 2VUMH 1HNXQ 1TU3A 2CQOA 2V1UA 4A3JH 1RYFA 2YV5A 4C30A 3HPRA 1W2GA 2ZPTX 1E2WA 1KAWA 1ZVQA 1YVCA 1KRTA 2YOGA 4WZBE 1N0WA 5TB5A 4E5UA 4A3BH 3D8BA 1SMYC 4DV2L 2I4IA 2K5UA 3I4MH 3KUCA 3UDFA 3OE7D 4Q7KA 3ZQJA 1VHLA 5KU1A 2O8CA 1N25A 4M2LA 4QM6A 2JE6I 3CH5A 1NBWA 2CWAA 3SJBA 3KF6B 4DCVA 3QNUA 2XGJA 2B8WA 3DM5A 1IW7D 2D2FA 3AVUA 3BB4A 3QKTA 5K36H 5CJPA 4JLOA 1VQNA 2OCAA 1M7HA 1W5TA 2OM2A 5JEAJ 2E1RA 2AMCB 4QJ4A 4FMCB 1YR8A 4MKHA 4DDVA 2J87A 2J46A 3WYFA 2MO0A 1Z0JA 4LF7L 3MJRA 5IDVA 4WXRA 2HLDA 1Q90A 4DV6L 3X1ZA 3CH4B 3KB1A 2WKRA 3X1YA 4PR0A 1IBRA 1P3JA 5FJ8H 1NKTA 1T3LA 3R9WA 4HDCA 3KJOA 4KYUA 4MKIA 1UEJA 5LDDC 1ZM4A 5KOYA 1ZUNB 1HR0Q 4ME3A 1KNXA 4P4SB 3UWKA 1IN5A 3HOVH 4A3DG 2A7QA 3QKSA 1GJXA 4Q9KA 5FBLB 3TE6A 4QJ3A 3S2HH 4GDFA 2DFKB 4ESVA 3PGZA 1DS6A 2C98A 2EYQA 3KZ1E 3QOFA 3F1ZA 1SHKA 4R4TA 4A3IG 1GHJA 3B1XA 3M7NA 1LY1A 3TSWA 4HIKA 4BLOA 3TIFA 3WHKA 1DAHA 1XD9A 4I4LA 2WAXA 1E1QD 3BZKA 4JL5A 2ZROA 2IYQA 1ZM2A 2WWFA 1JB7A 1OXUA 1J2JA 5H1SE 5J5CA 2ZE6A 5F9FA 4AH6A 2JGNA 2BM1A 4DR5L 4GLVB 3HPQA 1ZC4A 3B5JA 5E7JA 4A93G 1P8LA 4JI3L 1R9TH 2K33A 1AGPA 2Q9CA 2ZETA 1Q46A 4OO1H 3BFXA 3PEUA 3GJ8A 4IEIA 4Q4AA 1FNMA 1G291 1EX7A 3E70C 4XVRA 2ZJPA 3DLLA 4A2WA 1RJ9A 4L8JA 1FQKA 2Z0SA 1NMZA 4IVPA 1G7RA 5EZ5A 2FPMA 3U3JA 4GN3B 2A5GA 4Q48A 1Y8NB 4JI0L 2Y8EA 3S1NH 1M7GA 2GETA 4LOAA 1H65A 3T1YL 1PUJA 1SVIA 3AVOA 3O8RA 1KI7A 3HU1A 3I73A 4GKJQ 4UPAA 3MXUA 4U5XA 3DVLA 2JA9A 3S24A 4BBRG 4P32A 1VDZA 1I2MA 5BN4A 1P9RA 2J1LA 4C0QC 5KUTA 3AB9A 4CT5A 1Q44A 2O8DA 1QUQB 2ZSDA 1E69A 2WTUA 4H13C 1HNWQ 4C2UA 3VTKA 4HLUA 3CB4A 2UXCL 4A3KH 1HY3A 2JA8G 3U7EB 5HKKA 1IW7C 3NELA 1YIJA 2FEOA 1BMFD 3EIVA 1TXYA 3T1HQ 2D74A 4DK1A 2WAQE 5AUPB 2XZLA 1GUAA 5C4GB 4Q1BA 4B34A 4KVAA 2IHYA 4JBYA 5G53C 1Q20A 1FQJA 4LF5L 1KI1A 2YOFA 3U58A 4G5OA 1NBME 1KKLA 3WDNA 2Z6KC 2ZUDA 5EUQB 4MZ9A 3FKQA 3STBD 4LHYA 3U44A 2C5LA 2Q2UA 4EAQA 1K8RA 2WJJA 1GM5A 4Q4LA 3CF2A 4JLKA 1T3SA 2J41A 1FTSA 4ZV4A 2OO7A 2PZEA 1E4YA 2A5YB 1VECA 5CK5A 1JJGA 2QMHA 4DR4Q 1Z2AA 2A6HD 4LUZA 3IGFA 4IFBA 5JEDA 2QAGB 1S72A 4B74A 1NVUQ 3CIOA 5BR8L 2QEQA 3IUYA 1X56A 4M1KA 5AK0A 3N2IA 3BH7A 5FI0B 1D6JA 3GJ3A 2OILA 1GFIA 5FL3A 4ITRC 1YKSA 2B8GA 1HH4A 2QTVB 2RHMA 1NSFA 1ZM7A 4NYMQ 2UXDQ 3KJIA 4TQAA 5CLQA 2V1XA 3ND9A 3SE0A 3GLHA 1PH1A 4C0BA 2JLXA 5EP2A 4HJ8A 1YRBA 3BS4A 2A6EC 2MNAA 4L4UA 2JEAI 4LDJA 1IBKQ 1EFTA 4NHOA 1CKEA 1Q1ZA 1G6PA 1HA3A 4UP9A 4DR7L 1WP9A 3Q3JB 4MGKR 6Q21A 4HB3A 1MR3F 4B3GA 4MKFA 3FHWA 1Z0AA 3MWYW 5DI3B 1FL0A 3A1TA 1S3OA 4A76A 1HTWA 1TNDA 2DFLA 4YONB 3LFUA 4RKEA 4IDHA 2CK3A 5KNBA 2ANCA 1OLOA 1XZPA 2VO1A 3UIEA 3MRSA 1K0RA 4A8JB 4DSTA 2B21A 1U94A 5M5YH 3RLFA 4PC2A 4JV5L 4ERNA 1IYJB 3AF1A 1E1TA 4OJQA 3UXMA 2F1JA 2JA1A 5EQTA 2IEYA 4CW7A 4D2IA 5JWRA 1VQMA 2V7QA 4OKSA 2O8BA 3VMFA 1YE8A 4KXFB 2WVJA 4YCVA 1CR1A 1TU2B 3QXSA 1NJFA 1Z2CA 2PNRC 4A3EG 4A8JC 3KQKA 2W6JD 4R7ZA 1UE5A 4HR7B 4IEEA 1EWRA 3QG1A 1IBLL 4JSTA 2UUCL 2EFCB 5JCPA 2XZOA 4MA4A 2JLZA 1XEFA 3EZ6A 4LUCA 5IP9G 4URYR 3UPUA 3ZJYC 2JLRA 2P67A 4JYAQ 1XMOQ 2GF9A 4LHVA 4LF7Q 2EDGA 1I5FA 3F8TA 2BE5C 1Q12A 1OKKD 2ZITA 3CRQA 4RD3A 2AUKA 5HGQA 4PC6A 4S35A 2IS2A 2PI2E 3UMSA 2NN6I 1M7BA 1DADA 1ZJ6A 3BGWA 4X66L 1IL2A 3LXXA 1E9SA 1OYYA 4PHHA 4A3CG 4TYPA 3T15A 3MJHA 5IYBG 2J0UA 4BBSH 3QY0A 4NCHA 4QKQA 4TTPA 3LX8A 4BLTA 1GDDA 3A37A 1JR6A 2H16A 4Q66C 2BE5D 1QG2A 4DEXA 2QAGC 2DWPA 4NPHA 4LBZA 3MXNB 1KTVA 2BKUA 3PF5A 1NIJA 3SYKA 2WBLC 4DZZA 4NU0A 1EQQA 2DUDA 1J90A 2NG1A 3QQ5A 2FSHA 1TMKA 2AD1A 5D3MB 4A3MH 1TKWB 3G48A 4Z8YA 1KI8A 5C1BA 5C0XJ 5KYKA 2VS1A 2E87A 3QKRB 4AWXA 3EBEA 1G3MA 1OTCA 1YZNA 3SOPA 1EXMA 4A0RA 4G01B 1XMSA 1LTLA 4B2IA 4A6PA 1B9MA 3AKEA 4L5SA 2JLYA 2ZJ8A 3OZXA 2ZRIA 1XTJA 2YWGA 2R6GA 3K8YA 1U81A 3QPUA 4EJSA 4JI2L 1TWCH 3K80C 4R98A 5LBIA 4XWAA 1G3UA 4RCNA 1E2ZA 2H5EA 1UEBA 1DAFA 3M4PA 2LXJA 2WWXA 3LXRA 3KQLA 4Q4AB 4HB4A 3BORA 3ND8A 4NYIR 1RRCA 2ZJ5A 3NTUA 1SXJC 1HZ9A 1KI2A 3KKQA 4TLEA 3GLFE 1UFQA 3FGNA 3GJXC 4R1JA 4MRVA 3LVQE 1DPFA 3UWOA 2FSGA 2F3RA 3K0CC 4IOAA 1GOTA 3FKIH 3S14H 1V9PA 3CR8A 1R6BX 4QHSA 5KHOC 1F6BA 1EESA 1IN8A 2HJVA 4C3IH 3VKWA 4LFCQ 1KJZA 1KZGB 3K09A 2PMDA 3SS8A 1DGSA 1DARA 2VSOA 4YMUA 5C46F 5LD2C 3SQXA 1IM2A 3CO5A 3KUDA 1MABA 4A2QA 3D31A 3H3VH 2XAUA 5DE3A 3R9XA 4LUVA 4TL7A 4QQBX 1K9MC 4QRHA 4FW9A 2NVTH 4HYYA 2ZU0C 5IYDG 1E2MA 3AUYA 1SVWA 3EG5A 4IJMA 4IW3B 3PR1A 2QI9C 5FL7D 1KK0A 4D81A 1ODFA 2JATA 3QG5A 3TQYA 3PCOB 1FP6A 4JI7Q 1N6IA 3C14C 4A3JG 3MLEA 2WPDA 4BLRA 5F98A 5CLLA 4HATA 3P4YA 3W34A 1A7JA 5JI3E 2NN6G 3CCVA 4FD2A 1G1MA 1N5LA 3GLGA 3GTKH 3WRYC 5EXPA 1XMJA 1X1RA 2ZVQX 3T51B 3OW7A 4DSUA 2YC4C 3AP1A 5B58C 1J5EQ 1OYWA 4JYBA 3F2BA 4Q7LA 4LF4Q 1CJUC 4XD7D 2F55A 2ZE5A 3AGPA 2YU9H 1JR3E 1J70A 2NO0A 2OESA 4UJ5A 3W8NA 3THXB 4JYAL 3VR2A 4UJ3A 1IYVA 4DR1L 1RYHA 4V0ME 2F52A 3A8KE 2E2IH 2QPOA 3T34A 3K1JA 3C15C 3IBGA 2NN6H 5J40A 2WMOB 3L43A 4C0SA 1HUQA 1VCNA 3OAAA 2ODNA 3HOUH 2GESA 3K70C 3NDPA 2ZRLA 2NGRA 4B3CA 1TWGH 1Z0DA 1BS1A 1XWIA 2BVNA 3LH5A 3P4XA 2VEDA 3RABA 3KKPA 3LWNA 3M9BA 3WNCA 2RMKA 3KX2A 1QUQA 5AJZA 5H1YA 1G41A 1N5JA 4M21A 2HT6A 3HJNA 3PG5A 1P72A 3M4YA 2R7DA 4GN5A 2BEKA 4C0AC 4Q5IA 5FH9A 5JI2E 3NBYC 4X64Q 5JECA 4E09A 3ZVLA 5KSZA 5FR2A 2RGAA 2I0QA 4KN7C 3D0FA 1XXHA 4A3GG 4QGGA 3MCAA 5EE1A 4IFDJ 3RS0A 3W9YA 5DN6D 1SN8A 1HV8A 3NKVA 1E0AA 3H0GH 3TAUA 2Z6KA 1ZM3A 1S0UA 1DAMA 3EARA 2R65A 5KO2A 3I62A 5JEAH 4LF6L 2QP3A 4K0KL 5CDFA 4B32A 2JDID 3NE5B 3CCJA 1UADA 4LCBA 3QIAA 3EIEA 3IIJA 1GNRA 3ECCA 4G5SA 2B8TA 4OK6A 2QRNA 3AB3A 1MO3A 4HLCA 3MD0A 4UNQA 3ZIAA 5FPHA 2L15A 3CNOA 4UP8A 1XP8A 1WFQA 1R0YA 4WW0A 4BE7B 4TMTA 1HNXL 1F2UB 2FF7A 1GNQA 1Z6HA 4PPNA 4GN4B 5M3FG 2OE2A 2E76C 4LYAA 4GOJA 4KFRA 4B6EA 3S1AA 1FGUA 4B3ML 1SRUA 5LPNA 1PFSA 1CRPA 1Q3HA 4JBWA 4RY2A 4D4KA 3BERA 3T61A 5E3HA 1AN0A 4CEJB 3OTOQ 2VL7A 4UXJA 1KK2A 3CMAA 2ATVA 4PQRA 1V1QA 3L8YA 2EFGA 3HR8A 4ZI2A 1Y8PB 3K0EA 3DKVA 3FKSD 4Q03A 4EQ6B 3CRMA 4I1SA 5DI9A 1D8LA 4QBHA 2WIBA 3IHLA 5A0FA 4DV1L 3FB4A 1KGDA 2V6JA 4EFNA 3Q5EA 5FBWB 2FXQA 4Q1CA 1BO6A 1YZLA 2VPPA 5E95A 2B92A 621PA 1Z47A 1FNNA 3OIWA 1LACA 3PUXA 5LMUL 4V0LA 1G4AE 5DLQC 3V4FA 1E9EA 5CDFE 1VCMA 4J0QA 3OOCA 5JSZA 5JRZA 2ZU6A 4CRWB 1IBML 4HAVA 1IJFA 3T1QA 5EZ6B 1N3BA 1Q21A 2ZRBA 2ZYUX 3RRNA 5GVSA 1GRQA 4BLQA 1Q81C 1XXHE 2P6UA 2FX3A 4DR7Q 4PMWA 1YHNA 3S1QH 1DO0A 2R6CA 2VHQA 4TT3A 4X8OA 4EQ6A 3U4QA 2J3EA 2J0UB 1PZNA 2WOOA 1U9IA 1Z0IA 3CPFA 5C18A 3CPJB 3A8TA 2PCLA 2YWFA 1JQJC 4GRAA 3X1DA 4A1FA 1FP7A 5EE5B 3LNCA 1JEEA 2NMVA 4URUR 5M3MG 4A3BG 4HLDA 3VU9B 4NXNQ 4GOPC 4PZ7A 4U00A 4JL6A 2IUUA 1JE5A 4WXPA 1DVRA 4OGQC 1XD8A 4HAWA 5IE8A 2W83A 3R20A 1AK2A 3HOYG 2DFTA 1OIWA 1HEIA 2ZRFA 4OYHA 3CF6R 1Y14B 1N33L 1X1SA 5C3EG 1JALA 1FZQA 4NPSA 4JI0Q 1N34Q 3CRRA 2IBMA 2W6ID 3DZDA 4XSGA 2GXSA 3F5FA 5FTLA 4AI6A 4UXIA 4UNRA 3W3AA 2C2HA 3RYTC 3I8SA 2CLDX 3I61A 1Y1WH 4PTLA 3EWAA 3O8DA 4FCVA 3TW4A 2CDNA 1FMJA 1TADA 1G8YA 1EK0A 2OCPA 1P7CA 5FJ8G 2O8CB 4OHYA 4MYTA 3GPLA 3J81i 3CCSA 2CCKA 3HOVG 4A3DH 4LF4L 3JC66 4DUGA 1ZUIA 5C3EH 2XJ4A 1W0KD 4OHXA 4R4IA 1PH7A 1KIXA 3F0TA 3ZS9A 4AYXA 1CF4A 5ELOA 3LVRE 2YOHA 3ZVRA 4EPVA 3BBPA 4JLBA 3AKDA 1LS1A 3TVTA 4KFTA 1Z6YA 4BECA 4XD7A 1ZC3A 1I3QH 2DNEA 4DDUA 4P73A 4YXWA 4F4JA 4MRSA 2IC5A 1VQHA 4R4OA 2Q2IA 1US8B 4I1UA 1KC8C 5JZVA 3AVWA 5TVKA 2MMCA 1E22A 1NY4A 5L3QB 4UP7A 2WAQG 2GZHA 3KOJA 1PV4A 2JA5H 3C16C 4TLCA 3RANA 3ADBA 2DB3A 2FZLA 1IY1A 1E2DA 2JCSA 2ZJOA 1E9BA 2ZRKA 2ZQ5A 4ZKDA 1ZP6A 4DK6C 2CK3D 2WWWA 2VIIA 4C7OB 3AQQA 4OO1G 4EFMA 1XJ0A 3BRWD 1CS4C 3FMOB 4DUGD 1RL2A 1JECA 2R6AA 3HGBA 1GKHA 1O87A 5H8WA 1J8YF 4A3LG 1R8QA 3FP9A 2PMZE 3QSYA 1N6OA 3AYHB 4IDNA 2JA5G 2JLQA 1N0UA 1A8VA 1NY6A 1AE2A 1TEXA 4G5GA 1QZXA 4LC0A 3NXSA 3P1JA 4BRWA 3F2DA 4L16A 5JS8A 2OCYC 4RVCA 5KNCA 4M1TA 1M1KC 3ZDQA 2RGBA 1Z83A 2OXRA 2CHGA 5TDHA 2FG5A 2EJMA 5HKKD 1YNJC 3B1ZA 3DOFA 2GCOB 1VQLA 1UBEA 3D3QA 4DPGA 3M4OH 1KHTA 3QPVA 1KO5A 1OFHA 3QPWA 5IY0A 2ZRDA 2C8VA 4WOPA 4BY7G 1E2VA 1ZYRC 4TVAB 5L3RA 4OQFA 3HFZB 1EGAA 4D0LB 1TUEA 2JAQA 4DDWA 4PPGA 4D4LA 1YJWA 1E3PA 2OTJA 4CDGA 2BM0A 2N46A 3JVVA 4LBYA 5SZJA 4ABYA 1RC8A 3KTAB 3JAMc 4KYIB 4TMZA 2AUJD 3N6RA 2K5NA 4NCIA 4DVGA 4C7OA 1VQDA 1XMQQ 3CCUA 2ZREA 1JEDA 3Q7PA 4GOPA 2GTPA 3W6OA 4DLTA 3OFND 4L8GA 3KLWA 2JJ1D 5FUVA 4D4MA 3L0PA 1T0JB 3MGCA 1I2DA 4V0OA 4I1OA 3RRZA 2X1VA 1SKQA 1V43A 4JLDA 4LK1C 3OFNA 3AM1A 2AR7A 3B9PA 2UU9Q 4BWYA 4DR2Q 1JQLB 1OIVA 3I56A 1COWA 4JLNA 3V00A 2NPFA 3T56B 1TWFH 1C4OA 2K75A 5C0XI 1DAEA 1RE0A 3AP2A 2A78A 2BMJA 4LYHA 4PAOA 4JI4Q 1PUIA 3TKLA 4QC2A 2ZJAA 3MAAC 2JIZA 3O8BA 4P4UA 3CF0A 5G3ZA 4LF5Q 3J7ZC 1NBMD 3MWJA 4LV8B 5DHAA 3AF4A 2JA7H 2UUBQ 4DV5L 1W4CA 4MYUA 1D2NA 4YDSA 1EFWA 5SZIA 1CJKC 2MMGA 3CD6A 4YCUA 5GJVC 2VQFL 2XTZA 2DYKA 2JJQA 2KENA 2GVDC 3NEJA 4KHPL 4JG2A 5FLMG 2IHEA 3FE2A 2AKAB 3U7GA 4LK2A 4TZ6A 1COWD 4JLVA 2GJSA 3B7GA 4JLJA 2REOA 1D5CA 4IXMA 3VR4A 4URVR 2JA7G 4BFUA 4BA1I 1B70B 5TY0A 2H8KA 1Z6GA 2W6JA 1Q8KA 5G40A 1QHGA 2Z4RA 3LQQA 3SR0A 2IF0A 5F2EA 3UG6A 3B1WA 4LJYA 4JV5Q 1EWQA 4US2R 4ZKEA 3EA5A 1VF5C 2LCFA 3RWOA 3RZDH 1WJJA 1Z06A 4B44A 5AUNB 3AVQA 1AM4D 2WJYA 4GOKA 5FLMH 3TUJC 3UE0A 3U3OA 3GLGB 3VA7A 4GNXC 2GXAA 2OWOA 4DR6Q 4OK5A 1ZD8A 1KNQA 1RJ9B 3KFXA 2QUZA 1U0LA 3LGJA 3UDIA 3WMFA 3AF0A 3H2YA 2FFAA 1X3SA 4WVFA 1C9OA 2I5LX 4DKAC 5IP9H 4XIGS 3U9SA 1KD1C 1S2MA 2A69C 2IYTA 1KMHB 4H44C 2ATWA 1M34E 1XB2A 3CNNA 2G1JA 3NC0C 4QOSA 1KI9A 1QDEA 4BFTA 2VHCA 2Z83A 1BBWA 1LF0A 4LWZA 2XX3A 2EU8A 4KKTA 2VW9A 1JMCA 3UMRA 4AK9A 3I5YA 1W36B 2X2EA 3U3KA 4MYHA 3H0GG 4AKIA 1JAHA 4POFA 1CR0A 4G5QA 2BV3A 3WNDA 3G71A 4DLUA 4GBMA 4MKGA 4ZCLA 4QGAA 1GG2A 2OLKA 2V1CC 2JEOA 1TX4B 2XGTA 3U4ZA 3FHTA 3SEAA 3N70A 5JJKA 3J7A5 1UE1A 4LUOA 2ZYTX 3NHBA 4W5HA 1N32L 3CX6A 3RR5A 4Z1MA 4WJ4A 3CMEA 1MT0A 3SBDA 3THWA 1VG9B 2XNSA 1B9NA 2IS1A 3WXMA 4R4CA 3DL0A 3B78A 2X2FA 3GLIB 3E1SA 3U5ZB 3ZVMA 3W5IA 4IFDI 3ZS8A 1L1OA 4A6XA 4E03A 3VHLB 1N6KA 1P2TA 2ECKA 4DIEA 2IUTA 1OSNA 1W4BA 4KLKA 2E75C 2IYXA 4KO8A 3V4RA 4GT1A 2HUPA 2KBFA 4ALPA 2RGGA 4Q7MB 1R4AA 2FSFA 3UE1A 1QHYA 3CCEA 4DV1Q 4M1OA 2HQLA 2KA7A 3CCRA 4PSKA 5AR1A 1E99A 4H1VA 3KLRA 3B2EA 4FWTA 1G9XA 1KI6B 1P62B 3NENA 1S8FA 3I2ZA 4QJFA 4RCZA 4LPSA 1H8EA 3NBZC 2QM7A 1SE8A 4X65L 2WPDD 1BKBA 4X8HA 4Z8XA 1I4DD 4BQSA 4LBVA 2PBRA 4D0GA 1HZBA 3H84A 2ORIA 2FOLA 3M1IA 5FUYA 4B3MQ 1KSGA 2PX3A 1KDPA 3QKUA 1KI3A 1YU9A 2HJGA 1ETUA 4JL8A 1XXHB 3HKZE 5BQ5A 3IKJA 4X65Q 4C2TA 1KK1A 2BBTA 2EFEB 1E32A 4K81B 4LHXA 3CM0A 5EE3A 4URWR 4TSFD 4TT3D 4UNSA 2F1MA 1E2FA 4KBGA 3CBQA 3B82A 4F93B 1N36L 2OCBA 4M53A 3KQNA 1SXJB 3IDQA 4JKIA 1E3MA 3H0KA 3VQTA 4RCYA 4WBSA 2PMKA 4M1WA 4A92A 4JS0A 2FWRA 1WB9A 2PLFA 2R9VA 1GHKA 3CAMA 4XWOA 3SHWA 1OFUX 4I81A 4H0LC 4KKSA 2JIZD 1PH4A 2P5SA 3X1WA 5CM9C 4EX5A 2ZS9A 3AGQA 3C4JA 4TMWA 4A93H 5JHGB 1NE3A 4B6FA 3BH6A 1HURA 3CPEA 1F5NA 1QVAA 1E24A 1Q1QA 1IBMQ 2AL7A 3QI2A 2W00A 3J80i 1A2KC 1KZ7B 3A1VA 5J47A 3VNUA 5GJBA 4JOIA 4V02A 1E2LA 2R7ZG 4X8LA 3T5DA 3CC2A 3AKCA 1ZU4A 1HZAA 2R62A 3DEFA 4OWTB 4DV0Q 1XU4A 2WWIA 3R8CA 2P6RA 4TKOB 3BOSA 5LMNQ 1N5KA 4R9UC 4F91B 4DLYA 1G5RA 4G7OC 1ONBA 3S1RH 4TL6A 4JIMA 3VR1A 5CJ2A 2ZYVX 2D7DA 3I4MG 4MYCA 5A35A 2CEAA 4NMMA 3KJEA 2NO6A 3S17H 4BLSA 2JDIA 4IRUB 3ZYCA 2XJ9A 5M5XH 4B3XA 2ZR7A 1Z63A 2GEDA 2GBLC 1NLYA 1P73A 5AWFC 1QBKC 2B63H 1H9KA 1H95A 3VR5A 2G0TA 2WZQA 4C0LA 2ODBA 4W9MC 2LKDA 1NN0A 2RH5A 2HIXA 3U44B 2DWOA 2DBYA 4BFZA 4TQUS 2Y0SG 4CGZA 2ZTDA 3CP0A 1NLZA 1UKYA 4NYIQ 1YQTA 4RSGA 3CC7A 1G7CA 1CKMA 1UPTA 3DMNA 2TMKA 4B2PA 4DR1Q 3VDYA 1W4RA 3AVXA 2QROA 1G64A 1W46A 1X54A 4LW1A 4APVA 2QAGA 5JJIA 3TGPA 1ZCAA 2HXYA 4A3GH 2Q3HA 2QAJA 3GFPA 2ZXUA 2A5JA 3HOWG 5DLQE 4BFYA 3UDGA 2EFDB 2MQHA 3PFIA 4PPFA 5HPYB 2P2LA 3A6PC 4YMWA 5GADC 3RC8A 2QMEA 1DO2A 4JI1L 5FI1B 4TLAA 5JLJA 5JEAG 2ZYWX 2IK8A 3GJ6A 1OFTA 1S3SA 1KO8A 5AJ3L 1MOZA 1OXSC 2VZAA 5IWAL 2QORA 1JJCB 4JJZA 1MO4A 4V0NA 1JT8A 2K7VA 2AFHE 2BCGY 1X6OA 4C3HH 2JJ1A 3QJYA 4B3RQ 4KLNA 2B7BA 4LGMA 1BMFA 1QJOA 4GP7A 3KDFB 3EZ2A 4PHGA 3I55A 3CC4A 2RF4A 3HOWH 3A1WA 1FFHA 2Q9BA 2WHXA 4JBKA 5FBVB 3W1GA 2JXMB 1T4GA 3OEHA 4NCKA 1RIPA 1CSQA 3TJZA 1JNYA 1AA9A 421PA 4WZ6A 2BIFA 1GKYA 2VYFA 4KSBA 2GJKA 4IFDG 1Q57A 4LJZC 4E07A 5DIFA 1II9A 1IXSB 5KDOA 2XTIA 4NXNL 4O0AA 3A7AB 3QKSB 4L9SA 4TTRA 3EPLA 1IJEA 5J4KA 2QE7D 3HU3A 4XTRA 4MDEA 4AYBG 5FOXA 1KMQA 2L0XA 3GJ0A 2RHSB 1YZGA 4M22A 3SBEA 3QBTA 4PZ6A 2MSCB 4G1UC 3RS3A 3SN6A 4YQFA 2R93G 2ZIAA 3QEOA 5FOWA 1YZTA 1UKEA 4ZCMA 4YWMA 1XMQL 3IIMA 4OQXA 4XJXA 4BGDA 3K70D 3PUZA 3CXCA 2W2VA 3M4QA 4Q4HA 4IFEA 4DT1B 2YNMA 3LLMA 3ADDA 1GILA 2C9OA 4ACAA 3PIPA 3GLIE 1RRGA 5IP7H 1ZINA 3WY9A 1VTKA 1L2TA 4QGFA 3TR5A 2E5LQ 2ZAOA 2IWRA 4YMTA 2ASBA 4GZYC 2GNOA 3WYGA 3VX4A 4HJAA 2FGJA 3MWKA 2REXB 3ZVNA 3M3YH 1KXLA 4DSNA 2N3SA 2FPKA 2VQSA 2OAQ1 4OHWA 3E0EA 1R0WA 5GVRA 3IQWA 2H1LA 4OQLA 4CEJA 1TUIA 1LABA 1S1CA 2YC2C 3L2PA 1Z6XA 3AVVA 5BYKA 3TSZA 1X8KA 5H68A 4P72A 1HNZQ 1GZSA 2PEYA 1J99A 3U3MA 3ONWA 3G0HA 5AJ3Q 4QL5A 1I6HH 4XVUA 5CYPA 2VQFQ 4PAMA 4RZXA 1G6HA 5E7NA 2ZI5A 3CCMA 1JXMA 2BJWA 1YVDA 4NONA 3PO2H 1P61B 1DEKA 4IPGA 2ZJRA 1YNNC 3PIRA 3QXXA 4DCNA 2IEZA 5GROA 1YZUA 5IF9A 5C44G 2ZI6A 2G6BA 3A1UA 4AYWA 1N8RC 3SU8A 4DB2A 2XTNA 2LMCB 3CONA 1XMOL 5L3VA 2GJ9A 2QZ4A 4EPTA 1L8QA 4Q47A 4RD6A 4DR5Q 3K81C 3F3YA 1U0HC 3KF6A 2QPAA 1MH1A 4TL9A 1JPNA 4PQYA 3GD7A 1UF9A 1UKVY 3HDTA 4QNRA 4WIAA 2XEXA 1S96A 1BDOA 3K0AB 2HT1A 4YCWA 4GP6A 3L7ZC 4DNTB 3IPYA 3LLUA 3HOXG 1W5SA 2IUSA 2BHRA 4NZYA 2GAOA 3EASA 3LX5A 1QRAA 5CK4A 1I94Q 3GTPH 821PA 1OB2A 3A5ZB 2ZRHA 1E2NA 1BKDR 4L5BA 4OHZA 2J0SA 3S2DH 1DCZA 1VCOA 4GS3A 2ZRCA 1AKEA 5DGXA 5ANRB 3SJCA 4X6AH 1AQUA 1VHTA 2QMOA 4BY1G 2IWHA 2R2AA 4LF6Q 2FA9A 3U3RA 3GLIA 1B23P 1IY2A 1Z07A 4A3EH 1RVDA 2J9RA 1E2PA 3I8XA 4KBFA 2NZHA 5DYIA 4BRUA 5ELXA 1NG1A 4NCNA 2PJZA 1NMGA 3NVAA 1AIPA 2IF2A 1N6NA 4TN1A 5C0XG 1Q1EA 3EW9A 2RHQB 2IL1A 4HDQB 1NN5A 4IOLA 3EZFA 2NZOA 1F3OA 2YINC 1ZD9A 4O2LA 2CVFA 2OFXA 2CCGA 3FMFA 1D2EA 4UNPA 4J15A 1VQOA 5C4XG 1NVVQ 3NIBA 5LMUQ 2D5DA 2BA1A 1GKUB 1XPRA 2O0JA 1CXZA 1KJWA 4RZUA 5TARA 3C41J 2R92H 4ON9A 1PVOA 1IN6A 2IXFA 5C0XH 3ETLA 4QY7A 1X55A 4Q01A 1FUUA 4B3BA 4AYTA 3G6EA 4JVNA 4TLDA 1GNPA 3QEJA 5JHHB 3MEFA 3P20A 3U61B 1UJ2A 2HCBA 4KMUC 3PO3H 1R5NA 2OSBA 3L8ZA 4JMPA 4QM7A 1MABB 2QA4A 1GUGA 2BEJA 1OKKA 1GUNA 3OYYA 1T91A 1AZTA 1X65A 5K8UA 1L2FA 4OWWB 1R7RA 2WAYA
chains in the Genus database with same CATH superfamily
2H57A 2WUEA 3OJ0A 1VJRA 4OF4A 4Y7CA 4AC9A 1B8NA 2G80A 2FG6C 3P2EA 4QAQA 2RI6A 4B6PA 2VLBA 4RTLA 4HPXB 2VDNB 2AQ3B 5M5BA 1ZM9A 4KDCA 1FNUA 4F1KA 3IT1A 4XSHA 4WRDA 4PRYA 2NUTA 1I6WA 4N0DA 4JX8A 4M8LA 3SLGA 2IHBA 2RHDA 2OCIA 3HNPA 4G8BA 1PZEA 5K8CA 3IR7A 2BZGA 1G5TA 3I28A 3G13A 4AT1A 4MV9A 3M6XA 4HQ0A 3MUEA 3UKDA 5HA5A 4Y9DA 5DHFA 1SKYE 3C8UA 1FTNA 5IT9c 1SR8A 1NVDA 3KR9A 3DPUA 3U0BA 4UD2A 3QOLA 4M9QA 4Z0PA 4AIMA 1CBUA 4A0GA 1AQYA 2CXXA 4JYCA 3IT0A 4IHJB 4WLOA 4HFMA 3B6IA 5CPBA 5T1GA 4FJ0A 1JRLA 5DMXA 3ZY3A 5C5CA 1SA0B 3QU5A 1KRWA 3IPXA 1ZUD1 1P2VA 2C7BA 2IEAA 1AXGA 2I1QA 4V2IA 1BGVA 5BN3B 1SBNE 3T53B 2WP0A 3GLHE 3GLRA 2IY5B 3V2HA 1QPZA 2Y1GA 1Y81A 1FDVA 3TR0A 1DV1A 3NO4A 5G0TA 2XMSA 4M4SA 5C32A 4DRXA 3A6JA 3FAZA 3WK6A 1E2JA 2PW7A 1UFKA 3ZX4A 3L0OA 2NIPA 5FI5A 3IBSA 1MRZA 3E22B 4CKCA 1Q7BA 3DSRA 5LB2A 3I52A 4E5NA 5A9RA 1RHJA 3DMHA 1KVRA 1IHXA 1AZLA 2HB6A 4ZPJA 5FUQA 4HJ7A 3C1FA 1K88A 1DYQA 4ER3A 3OTWA 2YRXA 4CZ2A 4UDYX 2PUJA 4OGWA 1LWNA 2GEJA 2G4LA 5AI0A 4BA2I 1J06A 1PRYA 3EZNA 5GZ3A 1ASYA 3HKZG 2PGNA 4QULA 4F2HA 3OU6A 1RODA 1WXIA 1U0JA 2FFQA 3PNQA 2O0LA 3OIFA 3SJ7A 4CNQA 2FKAA 4R4QA 4R1PA 1LTHR 1CUKA 4BGEA 3ISTA 2ZRNA 4C0JA 2IW3A 4KK7A 5ADUS 4OHVA 2WSSA 1PR2A 1F9RA 4RQUA 1B26A 4EX7A 2E37A 5E8JA 1JR2A 4C3IB 4GKKQ 3NX4A 2RDGA 5EUBA 2W2PA 4WOKA 2HIVA 4G7ZC 1BHSA 2ILTA 2PZ8A 3EIUA 4JP3A 4CCYA 1RF2D 5BRAA 1KEEB 2RK6A 4JFRA 3SC6A 4KEAA 3K9QO 3DV0A 4JGGA 5K3CA 1NYTA 2N9UA 1DIHA 1SB8A 4RD4A 1UZUA 4DR2B 3OQJA 4QGUA 4RGYA 2HM7A 4XWKA 4KKVA 3U1TA 4WI1A 1FYCA 4Z0NA 3ENKA 1QU2A 2CE2X 2YHIB 2WG1A 1X9GA 1E94E 4FTWA 1EMDA 1I50H 3QR8A 2O52A 3I4OA 3RDPA 1GZ3A 2W8BA 4B4OA 1WIWA 4L72A 4NTZA 1MJ5A 1TTQB 2WE7A 1W8IA 2HPHA 4Q3KA 4DJFC 5K3DA 2EZ4A 2HXSA 4ND6A 3AC0A 4QEZA 4ZUIA 3ZI0A 3VMMA 5C4JB 1T9DA 4KQMA 3SK4A 4HIDA 3L93A 2I3AA 3PC8C 1RABA 1J8MF 1W2HA 2HSWA 4X3CA 1YR6A 4IHAA 4Q9LA 1HXYD 4JI3Q 5EEGA 1N2CE 3EPLA 1RBZA 4A82A 2DCUA 1VG1A 2XNDA 3EFOB 4LCJA 2BH8A 2B36A 2VHUA 3E2IA 4A3FH 2ID7A 4WZAA 4JXKA 3OIYA 2HCFA 1Q3LA 3TIXB 4LVNA 2B2WA 1T2UA 1W88A 4BL5A 3CVXA 3ZDCA 2Z4IA 3GWZA 3N07A 5DJ5A 4JVLA 1QVGA 4YDQA 5FEMA 4DMGA 3KZKA 4MJ3A 4AMGA 3MWDA 3OIUA 2OEPA 3AI7A 4TMXA 1VMAA 2OYRA 3ZJ5A 5M3MH 5JS7A 1SVNA 3NBQA 4C4XA 5IAEA 2J85A 1YC2A 2IV2X 1G8PA 4BO8A 5J3BA 3E9YA 1ID8A 5ITVA 1L7MA 1FFDA 2XTMA 1YUBA 4JVZA 3G0DA 5AIBA 2QLJA 4CMCA 1G8KA 4RQBA 3HOYH 4NP5A 1VOTA 1X7YB 1LBHA 2FR8C 1LT4D 3CZCA 2BL4A 2OD7A 3EWNA 2VHWA 5E4JA 3RYCB 1CJVC 2QMQA 4IIDA 4XH9B 3C7KA 1O08A 1KFEB 2W2XA 4J1QA 1V35A 1M0SA 4F72A 2JK8A 3WGJA 3RRFA 3GJ7A 4WBNB 5LMUB 3R2TA 2G83A 3SHTA 3AFHA 3BB1A 4JU9A 1K8GA 1AMNA 3OPOA 1Z7EA 1N2XA 3KCQA 2JIBA 1JQDA 3LUDA 1DC4A 2IITA 5BT8A 3DWAA 3DLTA 1GUYA 4A75A 4OQDA 4FCTA 1U3CA 3IE1A 3M8KA 2AZ4A 3IQZA 1CR6A 1KIMA 4YRBA 2O8DB 3EA6A 3NBHA 1NZFA 4OM7A 3ZU2A 3K70B 1VQ6A 2XSZA 3ECSA 1E0KA 1M6YA 5G1PA 1JR0D 4P92A 4JI4B 4FMCF 1Z39A 4OXKA 3K58A 2DETA 4WNYA 1WAMA 2J7KA 4ATNA 4F7WA 1SKBA 1SNDA 3IVAA 4M87A 1NXSA 1VJ0A 4HZGA 1AHIA 1CEQA 1Z4QA 4JXJA 4DAMA 1XTBA 4C56C 1DBPA 4D9NA 5LIPA 1NI4B 4PIMA 4NMZA 1DELA 1G18A 2AWNA 2A0XA 3IQXA 4YJFA 4CHTA 2FMMA 5HQTA 3EVCA 4IXNA 5C1DA 4AG3A 1XD2B 3MJEA 1S8OA 5CVDA 9ATCA 1LC3A 1Y9AA 4K26A 3CEJA 4GPZA 4MVJI 3RPEA 4FHDA 5IYDH 3ZZ0A 4AULA 3C97A 1US8A 1O4VA 4PHFA 3IVMA 4IJUA 2D5BA 3NJRA 1PEYA 1N9ZA 3DOCA 3NJ8A 5AJXA 4KCGA 3A6GA 3FTFA 1E1OA 3ONVA 5E6RA 1JWUD 4OU5A 4LFAL 3VDQA 1FNBA 3EN2A 2UXCQ 1AHPA 1W36B 4TZ0A 2I2DA 1QTNA 4P35A 1LT6D 1A5TA 1R4MA 1PCXA 3L6CA 1Z5UA 4HXEB 3SYTA 3S2IA 3B6EA 2VTBA 4NBUA 2FK8A 3TIGA 2VBCA 1TAHA 5CUQA 2GCGA 2XGOA 5A2QA 2P5TB 3SGIA 4J0GA 5L3SA 5AXAA 4LF9Q 4PYLA 5FPYA 3ZH2A 3V33A 3VZRA 1P17A 4DIBA 5A6SA 2O3TA 1B6RA 4Q4HB 2EQAA 4JPBW 2F90A 3QF4A 4IMPA 2XYPA 4R9RA 2B63G 2VUMG 3UUGA 1N34L 4KQCA 4Z4HA 3EPJA 4EJSB 2OA0A 4OI0A 5KTSA 3E9IA 4INOA 3K2EA 1NJ5A 4Y2UA 5IANA 2D4AA 2IHUA 2X86A 4WUVA 4J94A 1DKPA 3ORRA 1R50A 1EG2A 1WUIS 3O5AA 1Y1WG 1SZPA 3OX2A 4YAWA 3SYNA 5ITWA 1IULA 2DWCA 1PH5A 1Q6ZA 3EZGA 4RPLA 1W6KA 1N3IA 2PYIA 3AT1A 3FPUB 3W90A 3ZHVA 1BOSA 1XRNA 2AH5A 4CLEA 3KVRA 5CA1F 2BGRA 5D1NA 2NPIA 4XOUA 3T7EA 4H7KA 4CYMA 3H1GA 1QR2A 2BMFA 4HS4A 4Y3UA 3DMGA 5FEUA 2I0FA 5DXJA 1OZHA 2QX7A 3NWSA 1K7YA 4DOMA 1CQIB 2DGYA 2BEUB 1ZOIA 2GM9A 1PR9A 3LQKA 1XNRL 3D02A 4XM2A 1UMCA 1O97C 1YBFA 2WSYB 3IBYA 3K9GA 3HI4A 2JLSA 2YW2A 1EA7A 3C3XA 3HFJA 4V2UA 3ZWKA 4AZSA 2XKJE 5A9SA 4AO7A 4L78A 1JEQB 5JWHA 2VPIA 5ELFA 3GGSA 5JNLA 1NF3A 2G63A 3VBCA 1ZUHA 5B1EA 1YJNA 1ADJA 2O3UA 2QN8A 4ZRZA 2HK8A 2XB4A 1X3EA 1RM0A 2ZTMA 4FMDF 2MSLA 4URXR 4TTTS 1JTVA 1NMFA 1DRVA 1H1LA 3WE7A 3K9WA 1U8EA 3ZEIA 1HRKA 3PJEA 2HK6A 4OHRA 4ZV7A 1ECBA 3WBBA 3UK2A 1H4QA 2K1BA 1IE3A 2PX6A 2QWXA 4KPUA 4RADA 3QWFA 4UZSA 1C14A 1P5FA 4RPKA 4B87A 1EWIA 4RF3A 2X4IA 1FFSA 2PFGA 3CTPA 2XDWA 4B2LA 2XUZA 4PMCA 2V4ZA 3LKBA 2D2EA 3GFFA 4I2NA 3VXKA 1ONPA 2R6HA 4YCMA 2P65A 5DM2A 1M6VA 4KRXA 1MEEA 3SVLA 2I80A 1FSFA 2ZUBA 3CPSA 4M8SA 4EUFA 1SKAA 3OZTA 1G21E 4US1R 2ZI4A 2BGIA 3HR7A 4JKOA 3ESRA 4DADA 4BLWA 4RZ3A 5EQJB 3T3MB 1ILEA 1CTQA 1YR7A 3WO0A 2HRRA 3ETDA 4GKJB 4RJLA 2ORVA 3BZWA 3NYIA 4BN4A 2C5CA 1CQIA 2BEUA 1NBAA 4FFDA 1H3NA 1ZMTA 3FUXA 3O2QB 1FS4A 4TVOA 5F52A 2WWRA 1L7RA 4IUYA 3FZEA 2NSHA 3I2JA 3COVA 4LRWA 5ALUA 1ZU5A 2AFHB 1Q8IA 5ELMA 1T4DA 1Y6QA 1J56A 3KEFA 4QASA 3D6UA 4BXXH 3JAKA 3B52X 5BSWA 1UINA 4FOPA 2BFDB 2HNKA 3FSEA 1EWYA 4IMIB 4JR0A 4M76B 4LNQA 4DK0A 1NBHA 3FFTA 1RT9A 1MB2A 3WNBA 3GTJH 4D96A 4IN3A 4BYMA 5CW1A 1EL0A 1II3A 2A6PA 3A2LA 1VIMA 4TS1A 4DDMA 5HOEA 1DIOB 4D9IA 2ZAIA 4BC0A 4MWDA 2BCOA 1OV6A 4HLQB 4S2EA 4EENA 2J6IA 3PHJA 3MYRA 5E3FA 4RJJA 2XNAC 3G9UA 1XVAA 4PZZA 2EY1A 5K7SA 5DNWA 1V2HE 4G4SO 2EDCA 3AM5A 4DEYA 3GHYA 4H7HA 4DBZA 2AQ2B 1W48A 2AOUB 4JBMA 2OGWA 2Q2OA 1WMFA 2J4CA 1GRVA 4CT0A 1LNQA 5IT9A 3KB6A 3W6PA 5GADl 2RB4A 1DONA 5M5YB 3KJPA 1SQGA 1DG1G 4WD3A 1UBFA 3IAUA 1I36A 3WL6A 4BLPA 5CU7A 1YNJD 4FOTA 4ZALA 1NXPA 1A88A 2FCAA 3E3OA 4OG2A 4WZAB 5ECGC 1YJ9A 2REBA 1OW3B 2XAAA 4YRFA 5BOSA 3PF4A 3UMVA 1XIVA 4YY3B 3N8GA 1I7QB 1DQSA 2G9UA 5IT9E 4FEGA 5K1ZA 2AE1A 3LT2A 5I7EA 1CQZA 1WETA 3HJFA 3TGWA 4FS3A 1PYDA 3FWHA 4JAVC 4FE3A 4LQLA 2XUIA 3WGUA 2Y1OA 3R3XA 1VA5A 5FPPA 4ZK6A 3IX7A 5F7OA 3KDFA 1KDAA 2OXPA 2YXEA 5ER6A 2QTBA 4O4IA 4GYJA 5JRDS 4BB6A 2EEPA 2XMRA 4LOJA 3G23A 4C3ZA 4EKDA 4TWZA 5BMOA 2R8YA 4XTCS 4HZUA 2CL6X 1JE1A 2QTFA 2YWRA 4C9BA 1K8OA 1ZA2A 4H18A 1SXHA 1KU0A 1AN9A 3CLTC 1TB4A 2YTVA 2PGIA 3DTVD 3PA8A 5ALTA 3WB9A 2QRVB 1THZA 3V55A 5JOQA 3AG5A 3RHSA 1P29A 3GTGH 4Q39A 4WNAB 4EQ5A 3QXCA 1LX7A 4R9NA 5KTNA 2VYQA 3NC1C 3VPXA 3DDNA 2QT1A 4RGTA 1LDYA 2V97A 4M7OA 1U2SA 1L8OA 2ZWIA 5SV2A 1RIIA 4B76A 3OPXA 1TXGA 1NJ1A 2A86A 2C4NA 1VSUA 3RODA 3V8VA 4CCAA 1E5XA 2ISSD 3I3OA 1WNFA 5HF6A 1JIXA 1ZGGA 4L73A 2Z08A 4RSRA 1CIJA 1UXHA 3CKKA 2FJ2A 1PT9A 4KO3S 1QG0A 1AB5A 5J2UA 1RFLA 5HQ3B 2HLDD 4EJ0A 4FE7A 3QBJA 3BMCA 3O91A 4MCIA 2ZKLA 4K0KQ 1KFBB 3N6VA 4XVQA 2BSQA 3T5BA 4CDNA 3DMDA 4HVLA 5EBCA 2X5OA 1XQ1A 3R2JA 4W5TA 2H4HA 3GLFB 1KO7A 4UCQA 4BZQA 3DMPA 3ZHZA 1AUOA 1YRAA 1P8AA 2MYPA 3TXXA 4D9CA 4LF9B 3A8IE 2WWVD 3S2DB 2FAXA 5BNTA 1XNJA 3OFSA 1R3DA 4TTJA 3AVYA 5M3MB 2I5MX 1RHPA 1HT3A 1S01A 1MD9A 4NIMA 4RQTA 5D3QA 3G68A 1A9ZA 3E3LA 1L1OB 5FO0A 4FCWA 3TQSA 4DWOA 4CF7A 2WMNB 4UHKA 3L01A 3DNPA 4S1OA 4EHDA 3GRKA 4KJZA 4P71A 1DCTA 5MHTA 1CUJA 3WOVA 4DG9A 1C0PA 2MPMA 5JPCA 1UK6A 4QRIA 1OLUB 1S4QA 4FD3A 5TMEA 1UDCA 3NANA 2CJWA 5K4AA 1OH8A 3DZ8A 1SUFA 5HTOA 3I2FA 2BDTA 1OA1A 1ZLYA 2N75A 3DNMA 1AZSC 4PXSA 1WD7A 3KOUA 3WL7A 1WZIA 4BXOA 4FYHA 2QX4A 2CDCA 1YB7A 2X58A 3VYUB 4GNKA 3AMUA 4C5BA 4IPHA 1NQUA 2WLSA 2NWQA 3WIVA 2ZIEA 4E2ZA 2WUGA 5E2IA 5ELNA 1LQTA 3GAFA 2X1MA 1GVNB 3GIWA 4DCTA 3BL5A 2EWMA 3ZV4A 4JY7A 4CMJA 3AEUA 4IDAA 4HEJA 3TD9A 2AKYA 2GN8A 3AFNA 5P8WA 3VX3A 3WYAA 3MTSA 5LZ2A 3EPHA 5CAEB 2J0EA 3LA6A 3E9RA 3EXHC 5LP1A 2MWMA 2O8FA 1ZN9A 1SO8A 1V3UA 4NB3A 2EG9A 4JOIC 2P6MA 3V9AA 4EUNA 4DRYA 2MSKA 1UJ5A 2I1LA 2EVBA 4GLAC 3ZW7A 2YN4A 1XZMA 3IL8A 2H3HA 5FD8A 1AUXA 2WAQB 5TPZA 1OPRA 3W8NA 2E3JA 1V1RB 3E3NA 1T0UA 2G0NA 5EGSA 1A9TA 1UC4B 1A82A 3BHNA 1Z7YA 2VRWA 3D54D 3OJEA 1HNZL 1A9OA 3LT4A 4K46A 5DLYA 5GONF 4FGKA 4BWGA 5DCWA 6ADHA 3S1MB 2VLIA 2PSFA 4GI3A 5CBKA 3HKSA 2D9UA 1Q15A 4L5IA 4DPKA 4FB4A 3DB1A 3RV3A 2XF2A 2ALYB 4C4RA 4WNIA 2OBLA 2G88A 3C5HA 4DSAA 3THXA 2GF0A 2Z3VA 1UMKA 3KVOA 2VNSA 2JJYA 4PSVA 4WTOA 5HKOA 1Q0RA 5KREA 1QQBA 2BTOA 5G0VA 3SC2B 5JCJA 1T3HA 1FX0B 1MH9A 3T1NA 3GDHA 1CD5A 3LU1A 3K53A 4L57A 4DA4A 4UY8C 1NA5A 1O4WA 1D1KA 2OUKA 2PSHA 2YYYA 2Y0SE 1J4AA 3I5AA 5EP1A 4KQIA 4L15A 3I4CA 4BZXA 1GQFA 4ZOLA 2I34A 3L18A 1CQPA 4MHSA 2OTLA 1HYBA 2GN1A 4XE5A 1T9BA 3V7WA 4DV4Q 1P77A 2FFRA 3L6EA 4QBIA 1C80A 5BSRA 4U3JB 3TLMA 4DXAA 3KG2A 2A4KA 4IDEA 4W7SA 4MVJF 4NNPA 4PMBA 5COBA 1EX6A 2EKZA 4LXUA 1VIYA 4TT8A 4XFKA 4BTLA 1YI2A 3M6FA 2B99A 4D9GA 2UUBB 2B4KA 1SR3A 4ZO9A 4ZANA 4CKWA 4KR9A 2K50A 1G7SA 1VRCA 2DN8A 3DHQA 1SOUA 1PX2A 2GK6A 3O93A 1Y3FE 4QQFA 2QN9A 1YGYA 2BOVA 3B6JA 2KI5A 4DUZQ 1OTXA 4OI2A 4OQYA 4RY0A 5AJVB 1C9JA 3VR4H 1EFRD 4TZKA 2CE7A 2H7CA 2NVTB 2OV8A 2HRQA 2I8CA 3L4BC 3OM8A 2QUKA 3BSYA 1WXQA 3R7SA 1SUIA 3QXJA 1E92A 3FPPA 3EEOA 5FOSA 3CRLC 3AERB 2X0DA 4CNBA 1YHYA 2XECA 4I1RA 3RS5A 3WMEA 1XUOA 2VP5A 5KEEA 2YXDA 3ESYA 4GECA 5ALKA 4J4HA 4FO2A 1Y1WB 1LTTD 4ZGBA 4CHTB 1YOVA 3PWZA 2WB2A 2OAEA 4KR0A 4RESA 3OKAA 3RNOA 5HW0A 4Y1RA 4MJXA 2CLCX 5AHXA 3SYKA 4B84A 2PE5A 2F3IA 4PBRA 4Y2VA 3I6MA 1TCBA 4A92A 3FMCA 1ACMA 1DAIA 1UDWA 2BDEA 2GCIA 4MRPA 3S40A 4RKYA 1D6EC 4B3DA 5KKAA 4WN9B 2FMHA 2QMUA 3L02A 3R5TA 4WY2A 4Q1AA 3WLFA 4YLYA 4XQEA 4Z51A 4DK3C 4Q5VA 1O58A 1SK9A 4G0WA 2OGSA 2KEDA 1WVGA 3DHWC 3FR7A 1OWMA 4DR4L 3OPYB 2FP4B 3PO3B 2Q8IB 1KXJA 1SXIA 3QVVA 4RNDB 7MDHA 1M9NA 4KDRA 4FMBB 4MIEA 1W6RA 3HVUA 5KVVA 2QQ0A 3X2EA 2PGJA 3F6SA 4R9SA 4UVDA 5F51A 4JZKA 6AT1A 2R1VA 2H0RA 2N3ZA 3QV1A 4DUPA 4JI5B 3D3KA 4MRMA 4UEOA 3ZDRA 4FFMA 4RHTA 4LEIA 1KQFA 5J9FA 3I45A 2OCLA 2OC9A 2K6GA 3CX8A 1VGVA 2VZ0A 3CLKA 2R3ZA 5ISRA 1W88B 1JJ2A 3MMXA 5DTMA 1TT7A 4MULA 1R15A 2JGMA 3W5DA 2IT1A 1QHSA 1MPTA 2PUAA 4QWWA 4JBJA 3HKDB 1DMSA 2C31A 4M8NE 3WA7A 5JZBA 3D1VA