1V43A

Crystal structure of atpase subunit of abc sugar transporter
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
367
structure length
353
Chain Sequence
VIKMVEVKLENLTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYLPPKDRNISMVFQHMTVYENIAFPLKKFPKDEIDKRVRWAAELLQIEELLNRYPAQLSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKVTTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLRPNSVFVATFIGAPEMNILEVSVGDGYLEGRGFRIELPQMDLLKDYVGKTVLFGIRPEHMTVEGVHMKRTARLIGKVDFVEALGTDTILHVKFGDELVKVKLPGHIPIEPGREVKVIMDLDMIHVFDKDTEKAIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sugar-binding transport ATP-binding protein
publication title Crystal structure of the ATP-binding cassette of multisugar transporter from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transport protein
total genus 96
structure length 353
sequence length 367
ec nomenclature
pdb deposition date 2003-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1v43A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1v43A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1v43A01
3GFPA 4XWAA 4K81B 4XH9B 3H86A 2NIPA 4UP9A 2B7CA 3CMEA 3W6PA 4NMMA 5C46F 1NKSA 4WZAE 1IAQA 4B74A 5L3VA 1YBYA 3E2IA 3BFKA 4TSFA 2BA1A 4OQLA 1XX6A 3G5UA 1Z08A 1D7QA 3QJYA 1KSFX 2ORWA 3A1SA 4PHGA 3U7EB 1XTIA 4KBFA 4CT4B 3SHFA 4R71A 3CONA 1P75A 5JHGB 3A1WA 3B6YA 1Q21A 1DD2A 1T6NA 2FFAA 3C4JA 3Q3JB 4ITRC 2JQOA 1Q22A 4LHXA 3R7WA 4EPXA 4BE7B 3PIPA 3A7AB 2A3RA 1G17A 4HAVA 1YHAA 4Q47A 3A7LA 2YTVA 4JBKA 1RFLA 5B30A 4URXR 4ZI3A 1XCMA 4LHYA 4OQNA 3MG9A 1JT8A 1N6RA 1TAGA 4Q48A 5JJIA 2GVZC 2B6HA 3E1SA 3PSIA 1T8TA 1CR4A 1OXVA 1WJJA 3E9IA 3GTOH 3W8RA 3LW7A 1EQRA 4DDWA 5EP4A 4M9SA 3LXXA 1H9MA 4LF4Q 1PHJA 3B85A 2FV8A 2R7DA 4ZCIA 3RS3A 1KK1A 4JYBA 1KXLA 1T0JB 1W47A 1KHIA 2GF9A 3EIHA 2J5XA 2GCNA 1Z6TA 3DKVA 1Z83A 2FZLA 4XIGS 1GKHA 5IT5A 2ZJBA 1TNDA 1GOTA 1Z29A 5DN6A 2YNMA 4H1UA 5CB6A 4G5RA 1EGAA 4ALPA 4N3NA 5LMUL 1JJGA 4JL5A 4C0HA 1HH2P 1AGRA 1A5TA 2BIFA 1AM4D 4JBXA 3SZRA 2HEIA 4PPQA 2ZRJA 3WMEA 4UY8C 3AP2A 4Q7JB 5TDHA 4D0LB 4E03A 4DDUA 4G3XA 2CCZA 1QG4A 4G7HC 1N9WA 3QE0A 4NCHA 1CTMA 1K8GA 1TF2A 2G6BA 1CULC 1F60A 2QORA 5FL7D 5KNCA 2QF7A 4JI6Q 1GRRA 1NJFA 4TYQA 3I4NG 1FGUA 4FMCF 4RD6A 3REFA 2DHRA 1MJEA 1ZNZA 1E9CA 1F48A 2GDJA 2Z83A 1S96A 3KKMA 4PZ7A 3LNNA 3JAMc 3CRQA 4D81A 1WCMG 4QGFA 1I2MA 3SFVA 3S1AB 1H8HA 4A3MH 1DAMA 2C9YA 4RFSB 1H95A 1XCGB 1X3SA 4GN5A 2LWIA 3U9SA 1IM2A 3GMTA 2BWJA 1ZCBA 4OHVA 1XXHE 1UF9A 2O8EB 5AJ3Q 3ERSX 2OCYC 3A1VA 3NVAA 4GOPB 3K9NA 4KBGA 2FXQA 1JAHA 1G21E 2OFXA 1S3GA 5J40A 3CR7A 5AJVB 1E9RA 3SJBA 1XCPA 3LNCA 5K8UA 4DUGD 2QA5A 4KYUA 1G291 3T1TA 1TWGH 4A3LG 1HR0W 2ZI5A 3HOZG 3ZVNA 3R8FA 2ZSDA 3HP1A 4BQSA 5A0FA 3TZUA 1NJGA 4W5HA 4DLRA 4LBVA 5JRJA 4HJ5A 4M1YA 2NTYC 2XTZA 2ZS7A 5FOSA 2VNUD 4P72A 1GUAA 1RKBA 3CLVA 2BEKA 3TW8B 3IUYA 1OLOA 3HKSA 2GCPA 4AD8A 1E3PA 2V6IA 2HIVA 1XP8A 2R6DA 1RL2A 4JLMA 4ESVA 1E2DA 1RZ3A 4Q1EA 2JA1A 1NE3A 3NDPA 5FR2A 2AD1A 2F55A 3OW7A 1VQDA 1FJGQ 4GLAC 3N2IA 4ZIRB 1ZD9A 5A35A 1XZPA 3RC3A 4AYBE 1VQPA 3AEVA 1FNMA 1K8RA 1XTSA 2F1HA 2F52A 2I1VB 1HCZA 3B5JA 3VKWA 4BLTA 1XTRA 1GL6A 4Z8YA 3TNFA 2VY3A 2IYTA 4D4KA 2AWNA 2JCSA 2V8OA 2ZS8A 1NY4A 3GTGH 2QBYA 2IF2A 3PEUA 1KJYA 3KF6A 4A2PA 4B3SQ 3RR5A 2PEYA 2ZSFA 4KI0A 2HCBA 1VQOA 4DDTA 1LF5A 2C8VA 3PR1A 3CRKC 3HOWG 4QRHA 4RVCA 1F2UB 3ZZ0A 1FQKA 1JJVA 1GFIA 2A5FA 5CM8B 1ZNYA 3MFYA 1XNJA 1YZUA 2ECKA 4CIDA 3RS7A 2BE5C 4PPNA 4M1KA 1ZD8A 2SHKA 3QBTA 4D4MA 1G5TA 1DGSA 2O5JC 4M1SA 3VDYA 2HJGA 4K0KL 3T35A 2A78A 2RGNC 2A30A 2C98A 3ZGXA 4GDFA 4LYFA 3LWNA 4M8NE 5FBRB 4A0HA 1XDBA 1TWHH 2HCJB 3NBXX 1E1OA 3MJRA 4DNIA 1FQJA 4F93B 1DELA 5TB5A 3EN2A 1OXTA 3ND9A 4OONA 3OW2A 1D2NA 3I55A 4DR6L 1OF1A 3BB1A 3B8HA 5AJXA 3AQQA 5DGXA 2QP4A 3SE0A 3T1HL 3HOVH 4B2LA 3S16H 5B64A 3CBQA 3EW9A 3QSYA 4US0R 5FPHA 3B1WA 3EAQA 3U4ZA 4RFVA 4TLBA 4AH6A 4I99A 1I94Q 1YJNA 2TMKA 3GTKH 4JLOA 4Q4AB 3T12A 3FHCB 1CF4A 2IWRA 3RLNA 3PQCA 5JJKA 1KDPA 2W2XA 1YR9A 2A68C 3UXMA 3IKJA 1RRGA 1YZKA 2QPTA 5DI3A 2JLXA 3ZJYA 4TYYA 3LVRE 2ODWA 1I3QH 2UU9Q 4QBIA 2Z4SA 4D4LA 2GESA 4DV0Q 2CW0C 4GOXA 4I1SA 4Q4JA 3TR5A 1UDXA 3UKDA 3EA0A 3IIKA 3U3RA 1H9KA 4KHPQ 4X6AH 5L3SB 4TKOB 1F2TB 2RMKA 4JI5Q 2H17A 4LUOA 5DH9A 2IF0A 2Z5FA 2C9OA 1CRQA 4W7SA 2FX3A 3SBDA 3DOFA 2LSSA 1Z0KA 2IYLD 1B70B 1IN5A 1WOCA 3GJXC 2NN6G 1X3GA 2FPMA 3IQXA 3WHLA 3DKPA 1KAWA 1KO1A 2GTPA 1YQTA 4IDOA 1M1KC 2VP9A 4LHWA 1YNXA 1DAFA 5FPYA 1HQMC 4QBGB 2LKCA 4MYHA 1CIPA 1HY3A 2QRZA 621PA 1ESMA 4FIDA 1BDOA 1DO2A 4LGMA 3W5JA 4EJSC 5GADl 1D8LA 2YYZA 2B8WA 5IYCH 1Z0FA 1UWVA 2JA6G 1H8EA 3SGIA 3VAAA 2MMCA 2Q6TA 3WYAA 4FN5A 4V03A 4A3DH 1N25A 3JZMA 5M3MG 4B3ML 3J7ZC 1OV4A 1TXYA 2V7QA 4CEHB 2DFTA 4EFMA 4EJSB 3VR4A 4CYMA 3VNVA 4HLUC 4MGYR 3QKRB 3X2SA 2CLSA 4B3RL 2VP0A 3DMNA 1NN5A 3GLHB 3K0FA 1G16A 4HDOB 1QHHA 4PAMA 4PO9A 4OHYA 3EC1A 2O8DA 1ZD1A 3PEVA 3PUZA 1E2FA 1UE6A 3A58B 3L0OA 3FMIA 3NXSA 4UQOA 5JWRA 5C0XH 1YZLA 2EDGA 5CJPA 3CRRA 3SEAA 4JLVA 2K5NA 4OWXB 4TL7A 1MABB 1U99A 2DFLA 4YCWA 1S40A 3PO3G 3TQYA 1OW3B 2H1LA 4OI4A 4JI3Q 4AYBG 4MKHA 4NPSA 3L8ZA 3CCLA 3EWAA 1CRPA 2EQBA 2BM0A 5BYKA 4O3MA 4AKGA 3G0HA 3BJUA 4EUNA 2BH8A 4HB3A 4NYMQ 2WBLC 1GKIA 1WP9A 3FE2A 3RABA 4DHEA 3CCRA 1NVXQ 4WA7A 3CC7A 1W36C 4RSGA 2K52A 4YY3Q 1N5KA 2YHSA 2GJSA 3EPJA 1RRCA 4QNMA 3H0KA 2ZJQA 1SRUA 2NZOA 1UKYA 1CKMA 2F4VL 2C99A 4G5OA 5GJBA 1JR3E 5FTKA 1YNNC 2OQKA 1JB7A 1G41A 3IO3A 1JXMA 2JAQA 3J7A5 4Q4LA 3CPJB 4B34A 5F9HA 3DLLA 4TN1A 1VYTA 2H16A 4RMFA 2ODEA 2B8FA 3N6RA 3CCMA 1KI2A 1KO5A 1W0KD 2O0HA 3AH8A 4R7ZA 4DRZA 2PZGA 1UAAA 2CVFA 3VKGA 4BA2I 2GAAA 1JR6A 1R10A 3RC8A 2ALYB 1PLKA 2IYZA 3B13B 4DIDA 2GXAA 4FXPA 2ZRAA 4TMTA 5ELNA 4W9MC 2QSZA 4JKIA 3J81j 3AFQA 3O8RA 4YMWA 2ZR7A 3LBNA 4QBHA 4C2TA 3A8KE 4I1VA 3SYNA 4CZ2A 1EYGA 2ASBA 2BCGY 2WMNB 4I1OA 5DYGA 5EE5B 4B43A 1KZ7B 2WP8J 1GL9B 3MCAA 3ZIAA 2RH5A 2VQFL 4NYJQ 1E2VA 3BOSA 4C7OA 2CL0X 3CW2A 2R6CA 2ONKA 1TF5A 3LA6A 3SR0A 4AQYQ 2NO6A 4HATA 5IYBG 1N6KA 3FFAA 1Z6HA 4Q66C 1SVSA 1TMKA 3QUSA 3J80c 4C3ZA 4IFBA 2W6JA 1XZQA 2WV9A 4TYNA 4DV4Q 2PX0A 4CT5A 2CVHA 3T56B 2EIFA 5DI9A 2ZTDA 4B47A 1ZM7A 3ZYCA 4JJZA 2O8BA 2MO1A 1XTJA 1QUQB 2ATXA 4DB2A 1X1RA 3RS0A 3KQKA 4HB0A 1Z06A 4FCWA 4A3GH 1W44A 2I5MX 2XTMA 1ZUIA 1XEFA 3F0TA 2J9RA 3OEHD 3V9PA 1IXZA 4TYPA 4JT4A 3V4FA 4PSKA 1P9RA 4DV3L 1SQ5A 2VBCA 3AKEA 3PITA 2HQLA 2D06A 1IN8A 1IN4A 1U0JA 2FH5B 2WIBA 3UMSA 5E3HA 3T51B 3DXJC 4Q1AA 3B9QA 2EW1A 4OI0A 5GVRA 1VKJA 1PFSA 4PSAA 4QFMA 4A8JA 2QE7A 3KDSE 4I7ZC 1M7BA 1VIYA 3M4QA 2IEYA 4YXWD 5IYDG 3BZCA 1A0IA 1QHGA 4LJ6A 3K1JA 4PXAA 4GKKQ 1CR1A 1VHTA 3M4PA 3D8BA 2QY9A 4YHHL 3IFTA 3M4YA 2NZJA 3DOEA 1AN0A 2F3TA 3G4SA 2Q9AA 4MYTA 3TW4A 3VR3A 3KUDA 1KDOA 3TR0A 3WYGA 3LWUA 3HOYH 3REGA 2C5LA 4RJLA 4MNOA 2R7FA 4KXFB 5DIFA 1CXZA 3CB4A 2E5LL 3K9LA 4MUAA 5FI1B 4WW0A 3ZQJA 1TTTA 1E2LA 2F3IA 4XWOA 3W6OA 5JI2E 5KSZA 3VTKA 4QNRA 2NN6I 5M5XH 3CF2A 4G7ZC 1SVIA 1P60A 4V0KA 1E0JA 1US8B 2KSQA 1PYSB 3VU9B 3GEHA 2CHGA 2N42A 2VF7A 5HGQA 2FSIA 3QPUA 1Z0JA 2IT1A 3W1BA 1YR8A 1Z3IX 2ZRKA 3QF4B 3QG5A 4A3EG 1NNEA 1DBSA 3TQCA 1ZM3A 2IYXA 1YR6A 2X19A 3AVQA 1TU2B 2AUJD 4R2IA 5FTNA 1L2TA 2QGNA 4LCBA 3FP9A 4DUYQ 1P7CA 4B3XA 3TGPA 3T1YL 2ZM6L 2K5VA 3DMDA 1XD2A 2K4KA 1QZGA 3TIFA 1Q7YC 3LQQA 3P4XA 1X3FA 4JI7Q 2JIZD 4IPCA 2PCJA 3SI7A 1AA9A 1MOZA 1PVOA 1Z07A 4QHSA 3ZD7A 3W3AA 4YCVA 4QJ4A 3L2OB 1E2PA 4NDZA 2AK3A 1JBKA 3AVUA 5DLQE 4ZDKA 3J81i 3EZ9A 3PIOA 2R7ZH 1HZAA 4EFLA 3AVXA 1LABA 4ASUA 1Z0IA 2XOKA 5D3QA 3K0XA 3A74A 1A4RA 1MJCA 2KHIA 2ATWA 3M4OH 1HTWA 3LLMA 2KE5A 2E1RA 2AK2A 2A8VA 2ZRNA 1R9TH 3BC1A 1XMJA 2EWWA 1HNZL 3FYHA 3KQLA 3KZ1E 2JEAI 5J4YA 4M0LA 1NIJA 1K5GA 3Q5EA 1K8OA 4LFCQ 2WPDD 2F6RA 3OYYA 3QVUA 2VO1A 4FINA 2LCFA 4MKGA 3QG1A 1KI4A 3TS0A 4PQFA 2Z6KC 2IHYA 1G3IA 3KQHA 1AKEA 4BFVA 4C4PA 2H5XA 3STBC 221PA 4QGAA 1Z2CA 3PEYA 2ZJPA 4UXJA 2QQEA 2F9LA 4GNKA 4GMDA 3MWKA 3S24A 1TADA 3VHLB 2IYUA 1G3MA 3TRFA 3HFZB 1TQDA 5GAGC 1N3BA 3Q7QA 4BWYA 1BMFA 1G20E 1E79D 3KJHA 4UNPA 1E2EA 2YWHA 5BN3A 1T5IA 4YLGA 5JHHB 2ZRBA 3RWMB 2WSSA 2PQAB 3OE7A 2VYFA 4BY7G 2JA8G 1XWIA 2CCKA 3I8XA 1R8SA 3QKSA 1V5WA 4PX9A 4Q1FA 3TLXA 5HY6A 5BR8L 1GO3E 4DLZA 4BXXH 4IPDA 3GLIB 5HKKD 3KQUA 2G0TA 2Z4RA 1UEIA 2VL7A 4HEJA 3WNBA 2X77A 5C0XJ 2PNHA 1J6QA 2D5DA 1XPOA 2O8FA 3RNUA 1SMYC 4PO8A 1P72A 4MA4A 1SLJA 3WYFA 2UXDL 2OO7A 4A1FA 2AKWB 4DNTB 1PJRA 3ADBA 1Y1VH 2K33A 1FNNA 3IILA 3R8CA 3FOZA 1BKBA 2H18A 2VH5R 1RRPA 3ADDA 1I2DA 3BK7A 3X1DA 1K0RA 4DR4Q 1BOFA 4PAOA 1EIFA 1HV8A 2A7QA 1VTKA 1CBUA 3CCQA 1ZW6A 2YOGA 1VQ9A 3C16C 3EZ2A 4LOAA 4OQXA 2JLZA 1L7VC 1TQ4A 2AD5A 3L0IB 3U7FB 3PUWA 5FLMH 1Z22A 2GK7A 2A9KA 4G0NA 4XJXA 3F2BA 3A6PC 4RG1A 4A3FG 1TL7C 1J5EL 1GUSA 3PO2H 4JLDA 4Q7KA 3SJZA 4B76A 2PNRC 3OTOL 1DOAA 1KY3A 1RIFA 5CK5A 5J4KA 4A3BG 5J47A 1W2HA 1E1QA 3U44A 3K0AA 1L2FA 2PH1A 2ZYWX 4LBZA 4QHTA 4LJ5A 4PTLA 4DV7L 2A5DA 4MGIR 3DHWC 1KI6A 2FG5A 1U9IA 4IOJA 1K8AC 4JOIC 3PEWA 1Y1WG 2PT7A 1YIJA 5KNBA 1XMSA 3DPUA 3KF8B 3GFTA 2GZDA 3I8SA 3O8DA 4TMXA 3B78A 2B63H 1YR7A 2GVAA 2KWIA 2Q3FA 1E1RD 2WJGA 3K9GA 1R4AA 1KZGB 3H0GH 1WA5A 5FUWA 4LV5B 1Y8OB 3GEEA 5JEEA 2VA8A 4GN3B 4B6EA 3IDQA 2IHEA 4JI4Q 4UP7A 2D2EA 1G6OA 1N5JA 2IHBA 2D4HA 4UNQA 1SULA 2KCCA 3AM1A 1YE8A 4EDHA 3WHKA 3ZS9A 4L9WA 2VP4A 3SYKA 4P0TA 4TL6A 2J46A 4TQAA 3CP0A 1ZNXA 1W0JD 3I2ZA 2ASEA 2AHOB 1TUIA 3OF5A 1J7KA 2ZREA 4IDNA 2FFBA 3S15H 3LV8A 3BU2A 1W4CA 1EFWA 2G3YA 2V54A 4Q4HB 4C0AC 5FPKA 1ZIOA 5JCZA 4IFDI 4POAA 3P26A 1IBMQ 4BUJA 1SXJC 2O5IC 1EWIA 1NVVQ 2RGAA 4K8OA 3B6EA 3BJIC 1G5PA 3LQRA 3PIRA 4B44A 1E9DA 3H2YA 4XVUA 4LF4L 1KMHA 1W4RA 4LHZA 2QGZA 1KQSA 4OWWB 1TX4B 1KRTA 3AB3A 1SXJB 3I1FA 5AJWA 5UKDA 2ONJA 4MDFA 2K7VA 4GZMA 2J41A 3GJ5A 3MLEA 2ZQ5A 1G9XA 1IOZA 3OFND 5JSZA 1XRJA 1P2UA 1U98A 2CCGA 3QENA 4DK3C 1G8PA 3KKPA 4FMDB 3AVYA 1JQLB 1QVAA 1BH2A 5HZHA 4A3KG 1HNZQ 2F43B 3IBGA 4TT3D 3C8UA 4B3TQ 4M22A 2KJQA 3GJ0A 2V4DA 4V0MA 1R0YA 1N0WA 5CLLA 3U50C 4JZKA 4QBFA 1LB1B 4DPGA 1SVMA 2KHJA 2CL6X 3TVDA 2OTJA 4ZDJA 5EP1A 4YCUA 4JI6L 4DIEA 3GLHE 3WP0A 3HKZE 5M04A 4DV5Q 4DSNA 2ZI9A 2CBZA 3AF4A 1GNPA 3AV0B 1UBGA 3MMPA 3P32A 4BEJA 4NP6A 2AXNA 2JLUA 1O87A 3F5FA 5JEDA 1LF0A 2QRNA 1ZM9A 3H3VH 1IXRC 3ICEA 4XD7D 2BA0A 3NE5B 3T5DA 1G51A 2O0JA 1CJVC 2WJHA 2R93G 5DYIA 1Q82C 4AKIA 1QVCA 1W5TA 2GEVA 3KDFB 5LBIA 3H3VI 2HUPA 2MSCB 4QL5A 1ONBA 3B9PA 4GT1A 5J4HA 2EYQA 4PG3A 5E95A 5AJ3L 1G7TA 1HT1E 3S1NH 1Y63A 3PVSA 4Q9HA 3X1WA 1C1YA 1W4AA 1E1TA 1YVDA 4A3CG 2B7BA 1G8YA 4DUGA 4W5WA 1P62B 1XJ0A 3DO6A 3I56A 3QEJA 1ZAKA 5K36G 1HE1C 4QHYA 4TLDA 3NH6A 1YHQA 1BS1A 1I4TD 3BIFA 4L8GA 5GVSA 4LF8Q 2JJQA 3FMFA 1D6JA 2IS1A 1GVNB 1J8YF 4YDSA 4G5QA 2O8CB 5BQ5A 1T91A 1TPZA 5C1BA 4JI0L 2F1JA 4RKFA 4URWR 4JOIA 2QI9C 2ZAOA 1A6XA 3E0EA 3K09A 1P2VA 4N0EA 1SR3A 2V9PA 4DC9A 4KYIB 2D7DA 1FJGL 4BECA 2J0SA 1ZC3A 1L8QA 3TRZA 3HOXG 3ICQB 4X8MA 2FFHA 4BASA 1VQ8A 4LC1A 2Y8EA 1NMXA 1B8AA 2OSBA 4A2WA 3THWA 4A4IA 3QPWA 1B7YB 1VF5C 4IJLA 2DY1A 4NONA 1FTNA 3RS2A 3EPLA 1VPLA 5F3WB 1E96A 2DN8A 3L2PA 4B3SL 3NELA 2ZUCA 1KTVA 4OO1G 4JSYA 4FCVA 4AKEA 4Z54A 1IN7A 2YWEA 3FHTA 3IRBA 2GBLA 2RGDA 2A69D 1M90C 3M7NA 5GROA 1DS6A 3UWOA 3CQZH 2HYDA 1GRQA 4IOMA 4NB3A 2QAGA 1PH9A 1FX0A 2HF9A 2BCJQ 4D0NA 4TVAB 1OTCA 1RYFA 4NYIQ 4UPAA 2ZJAA 4BZPA 1VQ4A 2H7VA 2WVJA 4YONB 1EWHA 4ZO4A 3LVQE 4AG5A 1XEWX 5AJZA 1NBMD 4B2PA 3H84A 4HAUA 1H9JA 4EX5A 3Q8XB 4Q9JA 3THYB 2P5TB 1HQCA 4C0BA 3K7UC 3S1MH 4DCSA 1NSFA 4D6PA 2CXXA 3GPLA 2CL7X 5AWFC 3CCUA 4FWTA 4HAXA 4LHVA 2IC5A 4DUZQ 1EQQA 4KITB 2YC4C 5JI3E 3U2QA 1G8FA 3FPAA 4NXNQ 5C18A 1ZCAA 1VMAA 2EYUA 1EFHA 3AQ4A 4DR7Q 1NLYA 1E2HA 2EFEB 4R1JA 1A82A 2OCEA 1GHJA 1IQPA 2R6GA 1TF7A 3NWJA 4DSUA 1KY2A 4LYHA 1CTQA 2JJ2D 4ON9A 1HH4A 4CRWB 2GJKA 5IP7H 2GJ8A 5CIWA 1YJWA 1I94L 3BFVA 3STBD 2ZRCA 4DK1A 1FW6A 2NZ8A 5H70A 3CCEA 1YZNA 4TTQA 1C9OA 3K0CA 2UUBL 2QTVB 2XX3A 3T1VA 1H9RA 1JR3A 1IXRA 2NGRA 5FBLB 2NOAA 5JEAH 4H13C 3HKZG 2ZJRA 1MRSA 1UBCA 1WI5A 2QPAA 4L5TA 5KDDA 1Y8PB 2UU9L 2GXSA 4DV0L 2OAP1 3FKIH 2V6JA 2J87A 4NL4H 2E76C 5KNDA 3ER0A 3ECCA 4RD0A 4KHPL 4M9XA 4YWMA 2VQSA 1AE2A 4JI5L 2WKRA 1G4AE 3BH0A 2H57A 3TAHA 4CF7A 1IXSB 4AKHA 3WRXC 5FBVB 1EUJA 3D4RA 4BY1H 4Q9LA 4A4DA 4A6XA 3LW8A 3RRYA 2J0UB 2R2AA 4ABYA 4M1WA 2QPOA 5KSPA 2RGGA 1YKSA 1TUEA 1HYQA 1X8JA 4ZI2A 1GZSA 4PZLA 5L3QB 3QXCA 5G53C 5LD2C 4O25A 4P73A 3TJZA 4GOPC 1MRNA 4D2IA 1E94E 2RF4A 1R8QA 1VQJA 3B1VA 4OQFA 4DJTA 2D62A 1NF3A 3ULLA 1X8KA 2R6AA 1E2WA 1BBUA 3HYTA 2P67A 5LD2B 3KFVA 4M9QA 1VQGA 1P16A 4XTRA 2G0NA 3CO5A 4TLAA 3RLFA 4R4QA 2XSZD 1WYDA 4I4LA 1DTSA 2ZJOA 5KO2A 2BMEA 2NVQH 1D9XA 1IL2A 1NBME 4GRAA 1BBWA 4BBRG 3NHBA 1Z5ZA 3LFUA 3EWSA 1FZQA 4JBWA 1KOFA 2K32A 3THXA 4M2LA 1XFAA 2E9SA 2WWXA 1KSGA 1COWD 2CDNA 3LLUA 5GJVC 5B2ZA 4G01B 2E87A 3T06B 3FGNA 4A3DG 3CPEA 4G7OC 2RCNA 4TL9A 4JI3L 1F6BA 4HLQB 4LBWA 1G3RA 2Q9CA 2QM8A 4OX9Q 3CCVA 4LF6Q 2BKEA 2GRJA 2Q2IA 1PLLA 4JI0Q 3ZZTA 4BRWA 1LS6A 3A4LA 2GJ9A 1CKEA 4HUQB 1E3MA 2VSOA 1P9WA 2WWWA 3DVLA 1MKHA 3CCSA 2PZFA 3NENA 2RGXA 1PUIA 4YY3L 5LB4A 3CNNA 4BBSH 2C78A 1UADA 3EZFA 1OXXK 4MRRA 4KLNA 2ZU0C 4BFTA 2BMDA 4CEJB 3F2CA 1OHHD 1B0UA 2QG6A 3TSOA 3U3MA 4Z1MD 2OLKA 1KKLA 5P21A 1XTQA 4QC2A 4OJQA 4NYJR 2EVBA 2VUMH 1NBWA 1VQNA 4TWZA 1W0KA 3GLIE 2LXJA 2NVTH 1W48A 4BLSA 2ZVQX 1L4UA 4V0ME 2AXPA 1JAIA 2Q0HA 1XTDA 4ZKDA 2OG2A 2JK8A 1QHIA 1TU4A 2FWRA 2WICA 4R9UC 4ARZB 1E0KA 4PC7A 1CUKA 3WWVA 1UE5A 3W1GA 2JA7G 1E69A 1MO5A 3M6AA 5E7JA 4HUTA 4LJ9A 3WDNA 1SXJD 2ZUDA 2CNWD 3PUVA 4Q00A 4LFBQ 1FL0A 1ZYUA 3VA7A 3CCJA 1ZMXA 2DUDA 4H44C 2OZEA 2WWYA 2VTKA 5FUXA 2NMVA 3DM5A 4WJ3M 2RAPA 4OKSA 2ZSEA 1N32L 1OB5A 1S0UA 3AUYA 1VQ6A 4P75A 4QGGA 2O8DB 2HT1A 3LY5A 1IHUA 2OFOA 4AQYL 1XPUA 2Q3HA 3OEED 3BDOA 5B57C 1K83H 121PA 2IYQA 2VHJA 1QJOA 2W83A 2DR3A 2ODBA 4DV4L 4JV5Q 2NO9A 3WBJA 5F98A 2XXAB 2IL1A 4PAQA 4URZR 2RGEA 2AUKA 1MO3A 3UDGA 2GZHA 1CR2A 3A1TA 2ZJ2A 1PH7A 4YMSA 5JRZA 3AF1A 3PGZA 4PV1C 3RN5A 4D82A 2YWFA 4X8HA 1KAOA 1NKTA 3S1AA 1ZBDA 2K50A 4JLAA 3FKSD 1N6OA 1X6OA 5FJ8G 2X2EA 4RFSA 3ZVLA 3KKOA 3AFPA 2FPKA 4BFYA 1NLZA 3W5OA 2F9MA 5E7IA 2UUBQ 1VG9B 2OT3B 1Q90A 1CKOA 1DAIA 2AFIE 3EC2A 2D74A 4UKDA 4WVFA 1J2JA 1RJ9B 1VYUA 3RYTC 3VMFA 2ZT9C 2O8EA 3DM9B 5KHOC 1PH1A 3ND8A 2QP3A 1CI3M 4GOPA 2MNAA 4TMWA 3UE1A 3NBHB 1JQJC 4UXHA 1ASYA 1VF7A 3NDBB 4LX0A 2R62A 2DWPA 2RKOA 3ASZA 1IBLL 2YJTD 5K8TA 4Q1CA 1JALA 2ZRLA 5EE1A 4GKKL 1G8HA 2GAOA 1E32A 3F8TA 2ZU6A 3CNOA 3S14H 2EWVA 1E2IA 4DV6Q 4X62Q 3B1ZA 4AG6A 3I4NH 2QU8A 1X8LA 5LMNQ 4OWTB 1VDZA 4L5QA 2AWOA 1JJCB 3EASA 2XJ4A 2N78A 1Q1QA 1DADA 1SVLA 4JI1Q 2JLYA 1QHNA 4JT2A 3AYHB 3KXLA 1WCMH 1N6NA 2W00A 4Q19A 5JMTA 3GLFB 1IYJB 2PL3A 1G1MA 3HDTA 2B8TA 3FMCA 1PLJA 1UFQA 3GJ7A 1SXJE 4ZIRA 1KJWA 3OIYA 1YZGA 1ZKOA 1VQLA 1AGPA 3U61B 2OTLA 1FUKA 3A36A 2RHSB 3H94A 2K5HA 3K9HA 5K8LA 1YHBA 1RW4A 1E0AA 1G64A 3GO5A 3EIVA 1V9PA 3VFDA 2ANCA 3LRPA 4M21A 4DUYL 4GL2A 1KI7A 3I4OA 1HEIA 2K14A 4OK3A 1T8UA 4TZ6A 2O8BB 5SZHB 4AK9A 4RCZA 5KPJA 4CDGA 1KC8C 2FEOA 1ASZA 4JI7L 3I4MH 2DBYA 2JIZA 1YNJC 3KJPA 3NEYA 3VX3A 4PZZA 5AK0A 4A3LH 4DZZA 2X2FA 3HOZH 4RZUA 1F2UA 1UEBA 3B1YA 3JC66 2C95A 1F5NA 2W2TA 2ZROA 1U81A 1EOVA 4WZ6A 1XD8A 4JSTA 2JGNA 3G71A 2F1IA 3V00A 3WMGA 1OH8A 3FTQA 3CH5A 3OOCA 4A36A 1PYBA 2DNCA 4QJFA 1ZIPA 5JEAJ 2AR7A 3BFXA 3I3SR 1UE7A 3IPYA 3D0FA 5IHPA 1TWAH 4DV2Q 3ZLJA 4HJ9A 1UKVY 3CRVA 2JLVA 4OHXA 4ZKEA 2KBNA 4OHZA 721PA 4DK0A 5KPDA 1KI1A 1YHNA 5FOVA 5HPYB 4LFCL 2WPDA 5KSYA 3PUXA 521PA 4A75A 2RGNA 4IJHA 1OFUX 4L8JA 1UBEA 3DZ8A 4R4CA 3OESA 2VEDA 4PC3A 3RWOA 1S1MA 4IEEA 1AH9A 4HYYA 1Q1BA 2JEOA 1Z7TA 3LXRA 1E4VA 1Q3HA 1T4GA 4Q4AA 1D2MA 1WDTA 2XNSA 5EJEA 2ZTSA 2UUAQ 2PI2E 3MSXA 3MAAC 2HDNB 3HOWH 2DPXA 2JA9A 1E79A 1JI0A 1ZVQA 5IRCD 3P1JA 1K5DA 2OAQ1 4GFDA 3CXCA 1E2KA 4JLKA 2MSDB 1MR3F 2UXBQ 4NCIA 1N32Q 1CP2A 3BORA 1SKYE 1T3LA 5L3SA 4P4SB 5EXXA 1F2TA 1II0A 3EZ7A 5JZVA 3A5ZB 2ZE6A 5HKKA 2YKGA 1Z8FA 2ZI7A 3NC0C 3FVQA 2XZOA 1E9BA 4IDHA 1MIUA 2PJRA 1AS3A 1NTGA 4MKFA 5GAEC 1DPFA 3SHWA 2JLRA 3KKQA 1KJZA 1EESA 1T9HA 4PHHA 5IP9G 1KKMA 4JLNA 4Q02A 4HIKA 4JKYA 4ACBA 2QQ0A 3L8YA 5EZ5A 4WXRA 4OXPA 1BKDR 1CLUA 5FFMA 1JEEA 2A6EC 4DR4L 2PPBC 2MQHA 4V0NA 1NLFA 3AF2A 1HR0Q 4B3DA 3CKLA 3MXUA 1HZ9A 4TLEA 2NZHA 4F4CA 1ZYRC 2E2JH 2ZETA 4FWIB 4NCKA 5FTLA 2VQEQ 4IQZA 2O0KA 2YVUA 4EJSA 2A5JA 3KL4A 4RZXA 5J4VA 4IEIA 5HCNA 3CF0A 3VKHA 3JVVA 1VCOA 3GLHA 5BXQC 1ZUNB 2FOLA 3RSLA 1IBLQ 4AYTA 1VQMA 1NMFA 3AKYA 1OIXA 3Q7PA 4IFEA 4A0FA 1GSIA 3LBIA 3UK6A 3AVOA 1S3SA 4HLUA 3THOA 3B1XA 4BZQA 4E22A 4NHOA 1XNRQ 1G7CA 2JA5H 4O0AA 4YDHB 3EQLC 1EX7A 4DT1B 1UM8A 3LX8A 4EPRA 2NN6H 2NPIA 1S8FA 1X65A 3RANA 3GJ3A 1P61B 2JASA 2ERYA 1FR3A 5FL3A 4HZUB 3K0EA 4HLCA 2OFWA 3P4YA 3WY9A 4C3JH 2EVWX 4JI4L 1C9KA 1YZ6A 1XB2A 2KB0A 2OXRA 4LDJA 2OWOA 1Q8KA 1V1QA 1CS4C 5DNYB 5EE0A 4PANA 1XEWY 1FPMA 2CE7A 4EQ6B 4AI6A 1GNRA 4HIDA 1QZHA 4IOAA 1W0JA 5KYKA 4OQMA 2YV5A 2R6FA 3U6KA 1BYUA 1N6HA 3TBKA 4JMPA 4JVNA 5KSOA 5JJLA 3H0GG 1RIPA 3RLOA 2A69C 1N0UA 2UZIR 4HAZA 4Z51A 2ZI4A 1P8LA 4DKXA 3EPKA 1IBML 3HPQA 4A3JH 3KB1A 1ZINA 4MQBA 5GAHC 4CVNA 1LUZA 1VQIA 5IT9c 1GG2A 4LWZA 2R8RA 5G41A 4U7DA 4DLUA 2F3RA 1IY0A 3BERA 3X1YA 3T15A 4JLJA 4LJ8A 2DB3A 2QA4A 2XGJA 2ZE7A 3JAMi 3BBPA 4FMBB 3UWKA 4DAMA 2ZR9A 3RZDH 4EPYA 3GTJH 1D9ZA 1EWRA 3OFNA 1B23P 3CAMA 4NTZA 3V4RA 3SDZA 4IDQA 4YMVA 4LF5Q 3K0AB 4TT3A 1EWQA 2GCOB 4AWXA 3CC2A 4B3TL 2ZAMA 1OH6A 2HLDA 1R5NA 4BFXA 3AF3A 2A19A 5J3BA 3EG5A 4JL8A 5FOUA 5HTKA 2MFIA 3W34A 3KTAA 2ZTCA 1YU9A 2ZRPA 1AZSC 4MYCA 4PSVA 1PH8A 2N3SA 5SZJA 3F2DA 2QP9X 3QY0A 2CK3D 3A4MA 3H4MA 4QOSA 3AUXA 3AB9A 4DV5L 3D6TB 3GFOA 5G3YA 3PFIA 5TMPA 2BEJA 4GNXC 1QUQA 1XXHB 3AF0A 3Q85A 3PJRA 1GIAA 4GI7A 5A4JA 1Q20A 4LJAA 2CWPA 4CEIB 2QL6A 4M9ZA 4XD7A 4UNSA 2I4IA 1AQYA 1SKQA 1XBTA 1RPZA 1OYWA 4GNXB 4X8OA 2YOFA 2Z6VA 3OAAD 2QMOA 3AVPA 2OCBA 5TXGA 3EIEA 4KMUC 2OBNA 2EFDB 2DWQA 3HU3A 2BMJA 3EARA 5FPTA 1U2RA 2OUKA 1Z6YA 3LGJA 1M7GA 4FCTA 3KJGA 2WM9B 1Y8NB 4X64L 1CJUC 2YTYA 2G1JA 3LX5A 3PCOB 1Q46A 4QJ5A 4ZCLA 3SS8A 2ZVPX 2V4ZA 1Q44A 1S72A 2IYRA 4DR3Q 3E70C 4MYUA 4JYAQ 1DAEA 3QI2A 3FFBA 1Z9FA 5IYBH 2J59A 4PQYA 1E24A 5EZ6B 4FD2A 2MSEB 1IBRA 1LYLA 2AMCB 2BDTA 2CJWB 3I4LA 5IWAQ 1VIAA 4KFTA 4F4IA 1JECA 2VIIA 3QF7A 2IS4A 4DR1Q 1PMRA 3I5XA 4LF8L 1Z2AA 5KDLA 2E2HH 4DCNA 4OK5A 4CW7A 4Y0VA 5JWOA 5CYPA 2F1MA 1EFRD 1J8MF 1QDEA 4GZLA 1OIVA 4TMZA 3UANA 4BLQA 4D80A 5JCPA 4PMWA 1D2EA 1US8A 5D3MB 1IYVA 1ZM4A 3KLRA 3VU9A 4KKTA 5AUNB 4BRUA 3QF4A 2QTFA 2VHQA 5TV2A 2WAQE 3GLGB 3O8CA 1QHSA 3AVWA 3KYHC 1KD1C 4KO8A 4KV9A 4O2RA 4BZXA 4LI0A 5EUQB 1IYUA 5IY0A 1HTPA 2PCFB 2Q8IB 1T5EA 1A2KC 1JJ7A 3RN2A 3BB3A 3BGWA 3OZXA 5CITA 4Q9KA 1XEXB 4GP6A 2EFGA 5EUMA 3PUYA 2GJAA 5IYDH 4V0OA 1QVRA 2JJ1D 5TVKA 1N2CE 2AN9A 2BOVA 3EPHA 1CSQA 4JI2Q 4D4JA 1VG8A 1Q12A 3VR2A 2W6ID 1H9SB 4PC6A 1GILA 3IIJA 5AR1A 2Q2TA 2VLIA 2PMZE 4QIWE 4HIOA 3PF4A 1YRBA 1GRNA 2RHDA 4EPTA 1NN3A 4APVA 2ZE8A 3TQFA 3W9YA 3NBFA 5HE9A 1UKZA 1LS1A 1DEKA 2GXUA 1PH2A 4DR5Q 3F3YA 3T53B 2R65A 4B2IA 5DISB 1O3YA 3UMFA 3AGQA 3RRNA 1NSTA 1NBMA 2UUCL 3VNUA 2RB4A 1GM5A 2ATVA 3BE4A 1CKNB 2E2IH 1XNQQ 2A5YB 2HT6A 2F7SA 2VSFA 2ZSAA 3LD9A 4V0LA 1YEZA 1LFDB 5E7MA 3SOPA 1N36Q 4IFDH 4EQ5A 1VQ5A 1X9NA 4A3EH 2P6UA 2WKQA 4R4IA 3MJHA 4DUZL 4NXMQ 3QXHA 5AJYA 4NXNL 1MH1A 3QXJA 2I0QA 3C7KA 3OEEA 3BRWD 4DR7L 1M2OB 5ANRB 5FTMA 3K70C 1TKWB 1JNYA 2BV3A 4NZYA 3K81C 4DCUA 1VG1A 1N5LA 2Z6KA 1E2QA 1G6PA 3OIUA 4KSBA 5M3FH 4B75A 5IK2D 1HE8B 1QVFA 2V1XA 2ZJYA 4C0QC 1G19A 2PBRA 3K70B 1Z47A 4FDBA 1II8A 1WMSA 1NVUQ 5EE3A 1U90A 1G7SA 2P3SA 3UE0A 2IXEA 4HJ8A 2IUTA 2PQAA 1E2MA 2ORIA 2GA8A 2BDOA 1K3RA 4NBSA 4HLDA 4CEHA 3EBEA 2QSYA 1L1OC 3AVVA 1JPJA 1TU3A 1JMCA 4L9SA 2FGKA 5C4JH 3BD9A 3LH5A 3Q8DA 5FOXA 1SN8A 2B3GA 4PHTA 1PH3A 1EX6A 1G6HA 3GLIA 3KFUA 5IP7G 2CHVA 1X6VA 3LBHA 3W90A 2IYVA 1AKYA 2B29A 2DWOA 2QN6A 3H15A 1P5ZB 2NO1A 2AFHE 4JS0A 4TLCA 1ZUHA 3MWYW 1L1OB 5FL7A 3T34A 2C35B 3NH9A 2W58A 4WIAA 1A7JA 1YZTA 1Q0UA 1JEDA 1O78A 1FP6A 4P31A 2BJWA 3AKCA 5JEAG 4ASUD 2MMGA 3T1QA 4M53A 1OKKD 3TH5A 3CUEF 3FKIG 3NEMA 2DFKB 3P27A 2JLWA 2ZEJA 1M8PA 4UXIA 3VX4A 4O2DA 2B21A 3U7HB 1Q3TA 3H1TA 3CF5A 2XEXA 3RSOA 1E9FA 1GWNA 2HYIC 3BG3A 4QJ3A 1P2SA 1X54A 3KKNA 4BPBA 4KN7C 4BY1G 2ZM5A 3GP8A 3FMPB 2A6ED 2R44A 4QL3A 2CEAA 1GVPA 3PXGA 1VQEA 3R7WB 2WIAA 4X64Q 4BY7H 1JPNA 5F9FA 5C2JB 3KOJA 1LTQA 3HPRA 5J4LA 3B7GA 4MH0R 3R9IA 4A3MG 2L5TA 1E9EA 1GTVA 1HA3A 4TYWA 1R6BX 3GJ4A 1VQAA 2JATA 2J7KA 3K0SA 1COWA 3CD6A 1RE0A 3DDCA 3KX2A 2CKZB 1DCZA 4LF7Q 1NRJB 2FSFA 3GTPH 2JLQA 2OBMA 2NG1A 2WAQG 4BA1I 2G83A 2GK6A 2YTXA 4AIMA 2ZE5A 4LBYA 4OX9L 4LF6L 4IVPA 1HZBA 1S9HA 2RGCA 2VRWA 4EPWA 3IEVA 3R20A 2GVDC 3EIQA 2QNRA 3NG1A 5C44H 1W7AA 3L0SA 2OLJA 4ACAA 1W3SA 2FN4A 3HR7A 5CB8A 1ZRHA 2XB4A 3HGBA 2AHOA 1OHHA 1XJVA 1GITA 4Q4HA 4GKJQ 4IHQA 2IY5B 4DR2Q 2Q9BA 2J7PD 4DV1Q 5KDOA 1MKYA 2O5VA 1L0WA 4RCNA 2IYSA 1YJ5A 3A8TA 5DO9A 4BFSA 5AUQA 4A3IH 4A3BH 1OPXA 3BB4A 3J80i 1IW7D 2GEDA 4H9GA 1HNXQ 3MUFA 4LPKA 4X65Q 4C30A 2V3CC 2ZJ8A 3FB4A 4E07A 1Z0DA 5EP2A 2P65A 2ZSBA 1SHZA 1KSJA 2XZPA 4LRWA 3DL0A 3HOUH 1Y1WH 1SXJA 5K8IA 2CNWA 4LFBL 3TE6A 5AUPB 4D0GA 2JXMB 4OJKA 5C3EH 1N34Q 4ME3A 2VUMG 2WJYA 2ZPTX 4NCNA 5L8VA 2QT0A 4QM6A 4LJ7A 1U8ZA 2J0VA 2HHHQ 4DCVA 4PO1A 3SBEA 4Q7LA 3TAUA 2UUCQ 1OFTA 1P6XA 2FE4A 4AYXA 1DAGA 2F43A 2GXQA 4LUCA 3PF5A 5L3RA 4ZDIA 1P73A 1VS0A 4KAXA 4A15A 5JS7A 1A63A 1CJMA 5KOYA 4KKSA 2P5SA 3I32A 2YC2C 4G1UC 1D5CA 4P71A 2IXGA 4JV5L 1HJPA 1Q86C 5FOTA 2BBWA 1TWCH 1R2QA 2GETA 1N33Q 2HXSA 1M1YE 2FA9A 2UKDA 4PPFA 5GJCA 3UG6A 1GUNA 3S1QH 4IOLA 3IPXA 3FKSA 1Y69U 1YITA 2DNEA 1NMGA 3A0JA 1G3UA 2D2FA 1HT2E 1KNQA 2J1LA 2VP5A 5FUYA 2CQOA 2NVYH 3M9BA 1IY1A 2I3BA 4GS3A 3KDFA 1HNWL 1ZP6A 2WOJA 2ZYTX 3VR6A 4Q18A 4XVRA 5TY0A 1N6LA 1S9DA 2CE2X 5FLXc 1X86B 1U94A 2LKDA 3CX7A 1VECA 2V55B 4S2EA 5EQTA 4NH0A 2Z0SA 3HOVG 2JLSA 5CM9C 3A8IE 3CMAA 3QOFA 2HJVA 3E5HA 3SU8A 4JVMA 1BO6A 1U8YA 2ORVA 2QMEA 1ODFA 4A92A 5H1SE 2QBYB 3KF6B 5GJWC 3A8JE 4A3KH 4KLZA 5EE9A 4NKRA 5HE8A 4HR7B 1N8RC 5DE3A 3WMFA 4KLKA 3TUZC 3JVUA 4IXNA 1KO8A 1UE1A 2PI2A 2P6RA 2E74C 3KB2A 5JFGA 2ZS9A 1W1WA 4DV6L 4X62L 1CJKC 1RYHA 2D7CA 4A9AA 4DDVA 4JK1C 4WXPA 5DSZA 5LMNL 2O8CA 4XOIA 4QM7A 1SFOH 1IJEA 1VQCA 4JI1L 3VR5A 3U58A 6Q21A 1SHKA 2A5GA 3NIBA 4C0JA 2W2VA 1NY5A 4TMKA 4LZZA 2VS1A 2UXCQ 3CPWA 2GVBA 3A4NA 5DLQC 1NG9A 2R93H 3QIAA 2XITA 4I1UA 3MEFA 4TMVA 4XVQA 3TMKA 4BLRA 3UDXA 1UPTA 2GN5A 4NYMR 3GQBA 4IFDJ 1TQ6A 4Q9IA 3G6EA 4RD2A 4XTCS 5CLQA 4LF9Q 1KMQA 4LW1A 1W5SA 3KFXA 5CIQA 4YC7A 2PJZA 3T61A 2FSGA 3J81c 2P2LA 3TUIC 1OFIA 1IN6A 2R92H 1VHLA 1GL7A 4X66Q 3ZJYC 4A3CH 5IYCG 5CDFA 2W0MA 4A93H 1YRAA 1A62A 2CMKA 2DFNA 2PX3A 1E2NA 4U00A 3MWLA 1CJTC 5K36H 1EFUA 1KRSA 3CWQA 4UNNA 1AJEA 5DI3B 5C4XH 1YZQA 4LPSA 3EX7C 3EA5A 1GUTA 4QGUA 2CCJA 1R0ZA 5EXTA 1KO4A 1OB2A 5JLJA 1K6MA 2VPPA 3OHMA 4Q4JB 4A6PA 4HJ7A 4DV2L 1Z0AA 1XMQQ 3IEUA 4UNRA 1QZXA 2GZAA 3CPFA 3THYA 3I4MG 4DCTA 5C0XG 4POGA 5M5YH 1DE0A 3NKVA 3E9HA 5GQOA 2VP2A 4L16A 3U3OA 3PV0A 4LUVA 3HOXH 2O52A 2AKYA 1DXMA 4PC1A 4RCYA 3QBVA 1E0SA 2XNDD 3RHFA 3ZVRA 1WBBA 3F1ZA 5J5CA 3Q72A 4JCVE 5CJ2A 3FKQA 1FMJA 2ZIAA 3C5CA 3U6BA 4HZIA 1KI8A 2K5UA 2JDID 3L0PA 4JI8Q 2FDCA 4P4TA 2DGYA 3ASYA 1GD7A 3RVBA 2ZXUA 3RZOH 4OO1H 2C03A 2UUAL 4Y0AA 2D0PA 1VG0B 3QQ5A 4ZV4A 2WWFA 2MO0A 3K70D 2IUSA 4EFNA 5EAYA 4E09A 2XTIA 1WFQA 1XMOQ 1WE2A 2IK8A 1OXSC 1SMXA 4OO1I 1MO6A 2ZI3A 4F91B 3VQTA 2FMXA 5BWMA 2KBFA 2ID0A 3ZD6A 1GKUB 3K0FB 1IBKL 2UXBL 1QHHB 4MRVA 4KFUA 5JS8A 1OIWA 1Q81C 1G8GA 4RZ2A 4KFRA 4IOCA 1P4SA 1F3OA 3NBZC 2J0QA 3RS4A 1DG3A 3GLGE 1PV4A 1W49A 5CK4A 2PCLA 4RD3A 4OGQC 4GOJA 3RRMA 4IOKA 1KK2A 4JBYA 4QY7A 4N1AA 2J0UA 3LDAA 4MGZR 1JB1A 5FTJA 4X8LA 2YOHA 4AYWA 3KJEA 2PLFA 3L82B 5C4GB 1PH4A 4WZBE 5L3QA 3VR1A 2IUUA 4TSFD 3QVVA 2VW9A 1T3HA 2CLDX 3CX8A 4LK2A 4FMDF 4MRNA 2Q2HA 2KBEA 1HNWQ 1HR0L 3ADCA 4C2MH 2EJFC 3OEHA 1P2TA 4NU0A 1TEVA 1Q1ZA 1CSPA 4YWKA 1UBFA 2Z43A 4LSGA 4TQ9A 3KUCA 1G4UR 1G5RA 4US2R 3J81k 1TWFH 3GJ6A 4ILEA 3ZQ6A 2VQEL 2Y0SE 2N49A 5FPSA 3KTAB 4Q21A 4C0LA 1OH7A 2XGTA 1JJ2A 2IX3A 2BJVA 1DARA 3TSWA 1E98A 2JEBI 2N8NA 3BXZA 3CIOA 4R2HA 4YXWA 3D3QA 2ZITA 1LW7A 2XZLA 4A3GG 5SZKB 4J0QA 2I5HA 2BC9A 4BLOA 4TTRA 1KL9A 1IONA 4PHFA 4A8JC 2ODNA 1Q1EA 3PCRB 2FEMA 1XNRL 4BLPA 4QGHA 1A2BA 1JE5A 1V43A 3CW2C 2PMKA 1J90A 1JR3D 5FUVA 1SZPA 1DG1G 1CEEA 5DN6D 2BKUA 4O0MA 5LDDC 4KSCA 4HUQA 1FMLA 2ZUBA 5LMUQ 4Q1DA 4IPGA 1I6HH 5JWHA 4C7OB 1GHKA 3ZDQA 4OK6A 1WQ1R 2EFCB 2EU8A 3U60B 2E75C 5H1YA 4H0LC 4CEJA 2GILA 3A5UA 2JA5G 2QROA 4IRUB 4UJ5A 3OIVA 5JBQA 4O2LA 4JJKA 2CLCX 3HOYG 3BH6A 1II9A 2GWHA 5BYJA 3TK1A 2IWHA 2WAYA 2B8GA 1B9MA 1FUUA 1XD9A 2OHFA 1KAGA 4GOKA 4AURA 1JXOA 4BBRH 4HIMA 1C7YA 1O7LA 3HU2A 1H8HD 4ARZA 4EPVA 3OIWA 1TQ2A 1N0VC 1SVOA 3FDIA 1Z28A 4IKEA 4DAYB 1XPRA 3GTMH 2K75A 4C9BA 1YI2A 4DB4A 3K80C 1KIMA 2DCUA 3CPHA 4MKIA 1G3QA 3IGFA 3IQWA 4PZ6A 421PA 4DBLC 4F7WA 3K7AH 3ONWA 1BYIA 3ULJA 2HF8A 3U5ZB 3SQWA 1MV5A 1VCIA 3HU1A 3WRYC 3K8YA 5B58C 1J70A 2YZ2A 3EXAA 2IYYA 1X56A 4A76A 4A8JB 4A3JG 3W3ZB 3N5CA 4LF5L 1EK0A 2V1CC 1SROA 4KJZA 1SVKA 5H8WA 5HZKA 1HQYE 1LTLA 3WNDA 2CFMA 4R4TA 2XXAA 2R7ZG 3MXNB 1E6CA 2DYKA 2ZRIA 2OQ0A 2AL7A 4KVAA 2CK3A 4V02A 5G40A 5C0XI 4LC0A 1A8VA 2ZTEA 4LNQA 2ZRFA 4FI3C 4IDPA 2FJUA 3UDFA 2PZEA 3GCGA 1OSNA 2PLRA 4BGDA 4HAYA 4B73A 3DEFA 2WJJA 4LK1C 2JA7H 4WJ4A 4AC9A 1J99A 1LY1A 1X3EA 1AS0A 1AS2A 1E22A 1RJ9A 3OAAA 3O47A 1A1VA 1SGWA 2VF8A 5EXSA 1OYYA 4KHZA 1KHTA 2NQ2C 4NCJA 3C41J 2GF0A 3D7MA 1IBKQ 2KA7A 3CR8A 1KK3A 1W46A 4LV6A 4M4SA 4ZDWA 2XB2A 2VZAA 2X1VA 1XD2B 2QT1A 5IE8A 2QMHA 4PPGA 3CM0A 4HB2A 3TKLA 1W4BA 1GDDA 1VQFA 1B9NA 5E7NA 4DR3L 4JYAL 2EJGC 4BEBA 4GLXA 5A5GA 4YMTA 1T3SA 2OCPA 2OESA 5ELXA 4B32A 1QHYA 1UKEA 4NE2A 3L7ZC 4C0SA 4DEXA 1VQBA 5IWAL 1NI3A 1QF9A 4GLVB 4DR1L 2BVNA 5HCIA 1M6NA 1R0XA 2Y0SG 3KXIA 2XTNA 3SQXA 4Y52H 3U3JA 5CDFE 2WFWA 3GLFA 4N0DA 3U7GA 4K0KQ 4BXXG 1NIPA 4LWCA 3TREA 2FU5C 1EFRA 2ZRMA 2EJMA 5HR5A 5FJ8H 2L0XA 4URUR 3AKDA 5DHFA 4GPTA 4ZPXA 4KKUA 4HJAA 3TS2A 2JE6I 1E2JA 4Q7MB 3ZZUA 4IO9A 1QG2A 1EG7A 4DR6Q 3WP1B 3NC1C 2WSMA 3UATA 5SZIA 2A2ZA 1LM0A 3T1HQ 3M1IA 3QKRA 3GTLH 4W5JA 2KCMA 2BMFA 3X1ZA 5M5WH 3G48A 1Y1VG 1QVGA 2FF7A 2REBA 2C9CA 3TUJC 3SFZA 5EXPA 1HPCA 1UEJA 2WHXA 5TARA 3CWZA 3S17H 2C77A 3MWJA 4DLWA 4L5SA 2JJ1A 3M85A 1HZCA 3PENA 1Z63A 4AIIA 4JI2L 1MABA 4KFSA 3U4QA 1WXQA 4JC0A 2W6IA 4XWKA 4BFZA 5FLMG 2YU9H 2G77B 2WWIA 1NVVR 1NN0A 1E1RA 4PFSA 2ZJZA 3PO2G 2A6HC 3WBKA 1FYCA 2FSHA 4OI1A 1E7ZA 821PA 5KUTA 3QKSB 2G88A 2REXB 3IIMA 1NL3A 4RD4A 4B6FA 1T0HB 1DO0A 3R9XA 4DR5L 2GNOA 4LUZA 4KN4C 4M1MA 1DAKA 3IHWA 2JA6H 1OXUA 1UDWA 1XNQL 2OXCA 3K53A 3C14C 3U4VA 1W36B 4MTNA 1N36L 4LFAL 1DAHA 5M3MH 1IW7C 3OPOA 3JZAA 4P32A 2O8FB 2B63G 2UZ3A 1C0AA 4Q1BA 4NXML 4U02A 5KU1A 2LMCB 2WZQA 1KI3A 4F92B 3BH7A 1ELOA 2QENA 3W8NA 4IJMA 2IX1A 4HDQB 4II7A 4D26A 4DKAC 1U8AA 1VCNA 2QMUA 3CH4B 4RZ3A 1H8ED 3ZS8A 1E2ZA 4A82A 4DSOA 1XMIA 2QEXA 4DLTA 4YWLA 5IK2A 1GNQA 4IFDG 3S2DH 3PO3H 4B3MQ 1TEXA 2QEQA 2V7QD 4JBMA 3C15C 3LO5A 4MRPA 4DSTA 1RC8A 3M0EA 4LYAA 4HDCA 1ESNA 4IW3B 3M3YH 1XJCA 4B3RQ 3KQNA 2WTUA 1U9IC 1QBKC 2OV2A 2UVQA 1NG1A 3AP1A 4YMUA 1OH5A 4P4SA 4OHWA 3A37A 4M1TA 5G3ZA 4IPHA 1I5FA 4URVR 3Q9LA 2GKSA 5H68A 2FZ4A 2ZYVX 4MUBA 3BWDD 5M3FG 1KI6B 2QAJA 3ZH9B 1NY6A 1Z6GA 3HYRA 1N6PA 2ZRGA 1V8QA 2GEUA 1IZ6A 1K73C 1R0WA 2N1BA 3TSZA 3U44B 2P0EA 3I5YA 1OJLA 1RVDA 3QNUA 3SNHA 4PZ8A 3QXXA 3EZ6A 2Q3MA 3CRMA 3W6NA 4DLSA 4H02A 1OKKA 2OE2A 1K9MC 2ANBA 2IBMA 3G82C 2OCAA 2QGQA 1FP7A 1RRFA 4ERNA 1WBDA 1XU4A 4TTPA 2VHTA 4B48A 4ZCMA 1SVWA 2IS6A 2F4VQ 3QEOA 2BE5D 1E99A 3QKTA 3A1UA 1GUOA 4DNRB 1HUQA 2WMOB 1WB9A 5FBWB 2N46A 1OE0A 3FHOA 2BBSA 4DEYA 3ZVMA 3S1RH 4C0KA 2W0SA 3S2HH 3CF6R 1G7RA 2IA5A 4LJYA 4MRSA 4F4JA 1S1CA 4PZYA 2HXYA 3I62A 1E4YA 2CHQA 3ULPA 2BBOA 3QPVA 3WXMA 4DK6C 4TL8A 3QKUA 3AVTA 2WJVA 4POFA 2J3EA 4CGZA 2IEZA 4FMCB 1P9NA 4B3FX 3IO5A 1PUJA 4GN4B 4A0RA 1ZM2A 1KMHB 4L5BA 1KGDA 4Q01A 4DT1A 4B3GA 4LF7L 1XF9A 1YVCA 4G5GA 3NEJA 1II8B 2I5LX 1VCMA 4P33A 4GZYC 1S2MA 1XJQA 2OILA 3GD7A 3CZQA 5JSZB 4HZUA 4K46A 3ZIAD 5IP9H 1R5BA 4NPHA 4JBJA 2VQFQ 2D0OA 2A68D 2OEPA 4JLPA 3BS4A 3U3KA 2IXFA 4C3IH 1FVIA 4DLXA 4OI2A 1ETUA 4RKEA 4JG2A 3UDIA 1ZNWA 2OBLA 2ZJ5A 4NYIR 4KCGA 3NBYC 2ZYUX 2H92A 1MO4A 4RD1A 3I7FA 2W6JD 4EQ6A 2FGJA 4B35A 3IBYA 4JL6A 2QM7A 4H1VA 1E9SA 2C04A 1AE3A 2BHRA 3N2EA 4GKJL 4R4OA 4DR2L 2FPLA 4DV1L 2J7PA 3SJCA 4HSEA 3BZKA 1ZJ6A 1N6IA 5IF9A 1S4QA 3O8BA 1KDRA 5ELOA 4GMXA 5DHAA 4D25A 4P4UA 1HNXL 1LV7A 2F1RA 4X65L 5C44G 2WWGA 5JECA 2L15A 2FFQA 3FHWA 1DVRA 1P3JA 4US1R 4MDEA 2ES2A 1FTSA 1M74A 2NO7A 3C5HA 1GUGA 1O7IA 4DV3Q 3HR8A 5FR1A 2G9NA 4DWJA 4DXAA 1ZU5A 4LJZC 2P6NA 3FMOB 2PEZA 3HJNA 4DVGA 3U4QB 5BW8A 2D2CC 1Y14B 1N34L 1NP6A 4A2QA 3D31A 4B33A 1U0LA 1EFCA 2HHHL 2QE7D 1I50H 2R9VA 4PQRA 4A3IG 3ADKA 4JVLA 1LACA 1GJXA 4MITA 2WB1E 4BFUA 2GCOA 1CFMA 2Q21A 1VYVA 4YHHQ 2C2HA 3GDEA 4LFAQ 2WKPA 1G18A 4URYR 1EIYB 3T1OA 3CZPA 3HOUG 1PZNA 2GHIA 3K09C 2H5EA 1UJ2A 2OM2A 5C3EG 2LXKA 3RS5A 3AP3A 2E5LQ 4OYHA 1XXHA 4U5XA 3RDPA 1N33L 2PT5A 3KXKA 4B71A 3I72A 2JJ2A 4I81A 4CEIA 4EKDA 1I6VC 3KLWA 3L43A 4XSGA 3CNLA 1M7HA 2VSXA 2VHUA 2X8AA 3IHLA 5FI0B 1OT3A 4GBMA 4C2UA 2QTHA 4GNXA 1FOEB 4HAWA 5BN4A 3HWSA 4QXAA 1KSHA 2VP6A 5EP3A 2NPFA 2C96A 2HV8A 2QZ4A 2NO0A 2REOA 3GLFE 5F2EA 3T1YQ 2ZM6Q 3THWB 2GBLC 5FOWA 1N5IA 2J45A 4GP7A 3N70A 1L4YA 4QQBX 4UJ3A 1KIXA 4XSHA 3KJIA 3T5GA 2QAGC 3SC3A 1EFTA 1Z6AA 1ZU4A 2ZANA 4EAQA 5KTYA 4TQUS 1KDTA 4DLVA 1NJIC 3B2EA 4WOPA 3CC4A 2Q2UA 2B92A 4P3YA 2WWHA 3TVTA 1M34E 2CJWA 4BFWA 2BM1A 3NTUA 2V1UA 5LPNA 1LVGA 1FX0B 2QAGB 2XOKD 3MD0A 3VHXA 5GADC 1IJFA 1IY2A 1I4LD 4IXMA 1T5LA 4KU4A 3SYLA 1KK0A 2Z0MA 4G5SA 4WBSA 4KVGA 3RNLA 2IX0A 1Q57A 1GKYA 1AIPA 2IHFA 1MT0A 3BAFA 4R98A 1YJ9A 3I61A 2AX4A 5FH9A 1PA6A 1PH6A 1NN1A 2XJ9A 3KJOA 4MZ9A 5D3MA 5FBQB 2UXCL 2HLDD 1BIFA 2ERXA 3PG5A 2FNAA 1CR0A 3B82A 3GLGA 4PR0A 4A0GA 4FW9A 1Y3AA 2RHQB 1PH5A 2ZR0A 3X1XA 2IYWA 3GEIA 4ESHA 3GJ8A 4Q03A 2XSZA 1AK2A 2JA8H 1VQ7A 2E8GA 4LF9L 1XMVA 2D3WA 1XEXA 1AZTA 4AY2A 4TZ0A 3FWYA 1KO7A 3K0CC 2IS2A 1VQKA 1LNZA 1E9AA 4L4UA 8OHMA 4X66L 4HB4A 4OBEA 3UMRA 1H9SA 1X55A 1BMFD 1NVWQ 4JVSB 4B3CA 2H8KA 4RY2A 1CU1A 1S3OA 2EQSA 1QRAA 4KODA 1C4OA 1KI9A 1AQUA 4JLBA 4Y7NH 2AKAB 2YINC 3CRW1 2WSSD 1FFHA 1D8TA 4IVRA 3OE7D 5CYOA 4QKQA 2G1KA 3Q5DA 1XTKA 4GSYA 1U0HC 2EXDA 2NVXH 1W2GA 4HI0E 4Z8XA 4JYCA 1EXMA 5BR8Q 4LY6A 3DM3A 3DZDA 2R92G 1XMQL 2A1AA 2HIXA 4MGKR 2ZRHA 2A6HD 1CKNA 3P20A 1ANKA 1WF3A 2QUZA 1Z6XA 4A93G 3RRZA 3W5IA 1W36D 2RHMA 4J15A 2VL6A 4LYJA 3K8AA 4DLYA 1KYIA 2ZRDA 3NHAA 1GAJA 4Z1MA 5AUOB 3AGPA 4P74A 1WRBA 2UXDQ 5C4XG 2I1QA 4A3FH 2XNDA 1HURA 4S35A 1ZC4A 4YQFA 2JJ8A 1H65A 3RAPR 1WCV1 4L15A 1W2BA 3MRSA 3SN6A 4JIMA 2JDIA 4JI8L 3ETLA 3UG7A 2KCTA 3I73A 2BH2A 4EIWA 4BBSG 4PC2A 4WAUA 2WB1G 4B3BA 2CWAA 1SKYB 4UP8A 1ONLA 5BN5A 1VQHA 4L5RC 2EFHB 2KI5A 3WNCA 5LB2A 1GP2A 4F38A 3MGCA 3UIEA 1XMOL 4Q5IA 5LMNW 4C3HH 1U5KA 1J5EQ 1K8MA 1NMYA 1KNXA 1NMZA 2PMDA 2WOOA 3LAWA 3QXSA 4E5UA 3OTOQ 1I4DD 1R5OA 2ZI6A 4OL0A 3SJAA 1E1QD 3AEZA 3TEHB 1FL9A 3CX6A 4QG7A 1SE8A 3GTQH 4M1OA 4DV7Q 2YWGA 1X1SA 3UPUA 2XAUA 3THXB 2VHCA 5IDVA 4LV8B 2RGBA 1OFHA 1L1OA 3I92A 4IVQA 5E4FA 2IW3A 2WAXA 5C4MA 2BBTA 3FPPA 1BVSA 2KENA 3R9WA 1E2GA 1QHXA 3B60A 3CRLC 4LJ4A 1R7RA 2WJIA
chains in the Genus database with same CATH superfamily
3W6PA 4K81B 4G85A 2YY7A 1WXGA 3RIHA 3ZHXA 5IVDA 3WBBA 5DM70 3CNQS 2EFJA 3K4HA 4HAVA 4WOCA 4ZI3A 3KLPX 2B6HA 1TYAE 1Q0PA 1KHIA 2GF9A 2NXWA 1Z74A 4D7AA 1WV1A 3K4PA 5AIBA 2RBEA 5JANA 7MDHA 3GARA 5TDHA 3SYMA 1Y3DE 3DYBA 1B00A 1E8DA 3REFA 5GZ3A 2H1EA 2JBAB 2WNHA 4RVOA 2LWIA 3FMVA 3MQ4A 1XXHE 1V8ZA 1PRTC 1SC6A 4KBGA 4N9WA 4M7OA 1RDPD 3DVSX 1DHTA 2ET6A 1LK7A 3WDSA 5E8JA 1F0KA 4A3LG 1S8AA 3MAQA 3L49A 5JRJA 4JEUA 2B2TA 1G20B 2GCPA 2I2FA 1PT5A 1HBJA 4WKCA 3AEVA 3RTBA 1O5TA 2CJFA 4OHJA 2PD3A 3CVWA 1ZOPA 3VKWA 3WO0A 2HK9A 1JFTA 3IS3A 2QN7A 3R5HA 2VBIA 3D3JA 1F2UB 1YGPA 1FQKA 2QRGA 3E1GA 1XNJA 3VA5A 1JIXA 1IZ9A 4D4MA 4CQLA 4O2BB 4RNCA 1OXTA 1OF1A 5JD3A 3CBQA 4BKUA 4MUGA 4AH6A 4ZHQF 1CF4A 4DVJA 1USIA 1M6HA 2GH1A 3GRFA 1ZMRA 2C4KA 4JU9A 4RLHA 3R2IA 5FWAA 5F77A 2VJOA 2IYPA 1X3GA 2J9FA 1C8KA 4FLMA 4YP7A 3SF0A 5CH8A 3SDBA 3NPAA 3IAS1 4KK3A 1DFGA 1JP7A 3LL4A 4O2AB 2JA6G 2I5PO 3A4VA 5M3MG 1BHQ1 4CYMA 1JDBC 1GG5A 3PPVA 1G16A 3ESQA 3EEOA 5I3CA 3WTCA 3N76A 3FY4A 3RD5A 2PRIA 1K89A 1XTBA 2DFLA 5B4UA 4N76A 4AKGA 2BM0A 2D6FA 2GPJA 4HB3A 2CXOA 3IOCA 3RADC 3OF3A 4DJ5X 1UKYA 4ZT7A 3K6SB 1BDIA 1JSXA 3N6RA 1N7HA 1W0KD 3OPYI 1DIHA 1SK8A 2ZRAA 1SPXA 4RV5A 1Z6ZA 3UPDA 6REQB 3IPLA 4F4UA 4ALNA 2PS1A 5EE5B 6CHYA 1FNSA 2WD7A 1XRQA 4J4HA 2VUSA 2QUKA 2J6CA 1SUAA 1SCDA 3TN2A 4KRGA 4RZSA 1ECPA 4JOQA 1YQXA 2PANA 2BHTA 4FCWA 3ZK9A 4ZVKA 3FTFA 4QEKA 2YRWA 1ZJWA 4GYWA 3R09A 1NU8A 5E3HA 4OHBA 2H2HA 5DGHA 1F12A 2C7OA 1UBOS 4LCEA 2BFWA 3UFXB 2QY9A 4LHEA 4ZVOA 3FLMA 1UWKA 2F3TA 4HWTA 1YNOA 4G0WA 1RWXA 1E18A 3TZEA 1QQAA 4R3NA 1ZRNA 3ZZNA 4I2VA 2EYJA 4V0KA 1LK5A 3GEHA 3O3CA 4H16A 4ZZ2A 1Z3IX 3VHQA 3DMFA 2QGNA 1CS0A 2JFWA 5DCYA 1L7XA 1WXDA 3SE7A 2YXBA 2P78A 3ZXXA 1TIKA 2B34A 2PRZA 3ESYA 1NTRA 5JCJD 4MQEB 1R9TH 2W2LA 3P9KA 2X40A 4GKVA 2F6RA 4H18A 4EKYA 4KZPA 3TXYA 5A7FA 4M49A 3OZRA 3ROQA 2EKQA 2QQEA 2YFQA 1U3GA 3BXPA 4RX1A 2XE4A 3S24A 2IYUA 2Z09A 4O2BF 4DQKA 2MHCA 4DFDA 4IRXA 2B2CA 3DWPA 1E79D 5PGMA 1A9QA 1C0IA 4HAOA 1XWIA 3TLXA 4LF8B 1GO3E 4PSUA 3K35A 2XGSA 4D42A 3EH1A 3D8HA 1I3CA 3BQMB 4PO8A 2Q5IA 1V1RB 5DX8A 3ZWKA 4ZCQA 4W1QA 5HTOA 2QGFA 5IARA 3FOZA 1T5TA 1VBKA 4LZJA 4X3TA 2AMVA 1SVNA 1VQ9A 2Q41A 2MGSA 1RIFA 2FRXA 4OLHA 4A3BG 5EPJA 3K0AA 3RYIA 1ZGBA 4NZPA 1YIJA 4O2AF 4H7FA 3FN4A 1H9AA 4EDFA 1R4AA 1Y8OB 1MDBA 4NXNB 3EE6A 5CV4A 3CC8A 3EVCA 5D87A 5EERA 1C7QA 3PLRA 3AM1A 1DNPA 5C3XA 2PZJA 2RAFA 3BU2A 2G3YA 3E3OA 1I0LA 1NVVQ 3NOXA 3PIRA 3T7KA 2VDLB 4ZAFA 5B6JA 1RLTA 1SXJB 3MCVA 1T5SA 2ZJ7A 1XRJA 3OMWA 4GPBA 3A9WA 4IUYA 2V4DA 1Q6ZA 2J6IA 1TT2A 1LB1B 2CL6X 4QSMA 4AZ3B 2PUGA 3KEOA 4RQAA 2QRNA 1WSAA 5EWLB 1CDEA 4GVLA 1Y7TA 2PRKA 4XLTA 4JSRA 1UMCA 2ES4A 1P62B 5JFOA 4YUXA 4TLDA 2P2CA 4C1NA 1QVWA 4L8GA 4D9HA 3FMFA 1ECCA 5BQ5A 2ZAOA 3BD8A 3ZX5A 1P2VA 5TIIA 3GRKA 3SVMA 4OSEA 1JIQA 3GFBA 1CUGA 3FHTA 1B3BA 2YWEA 2Z8YA 5G0SA 4MUYA 1PH9A 3WOHA 2D9UA 1DJRD 1R6TA 4MPPA 3ZJUA 4C0BA 4PN7A 1GUFA 1RXIA 4FFSA 2YC4C 4BNLA 5KYLA 2EFEB 1WBBA 1BN7A 3RYFA 3T5MA 2D0PB 1FW6A 2Q29A 1IXRA 4F3RA 1AFPA 2VF2A 3GGOA 4M0KA 3JAWA 1CUXA 3U19A 1YKSA 5JCOA 2FLWA 5LD2C 2V7TA 1MO2A 1FJXA 2G40A 1IQRA 3L7AA 4ETNA 3STHA 5IKMA 3H5OA 5REQB 4BNUA 4B4OA 3WRVA 1N5RA 4EG1A 3F1KA 1B8OA 3THXA 1X2EA 3URMA 1S5FD 3IP1A 1FU7A 1YA8A 2EPBA 1F6BA 2GJ9A 3I83A 1CUJA 2NU8B 2P69A 1DBPA 4U673 4HH0A 3H2HA 2QG6A 5EHZA 1VQNA 3RH0A 4GZ5A 3G8YA 5HYVA 1W48A 4J16C 1BKYA 4V0ME 1WULS 3OO1A 3WWVA 1XZBA 1V11A 1UMDA 5DULA 2CNWD 2NXEA 1DEHA 4O3FA 4QGGA 1ECJA 1OAKA 2OFOA 4BVJA 2VHJA 2W83A 3W4IA 2NO9A 2YZMA 1MO3A 4GLOA 1CR2A 3PGZA 1XLWA 3S1AA 2AQ1B 3ZLUA 1DCKA 3W2TA 4JLAA 1YIDA 1N6OA 1ISSA 2ZTLA 4Y2YA 1XNRB 1BCPF 2MNAA 1DCMA 2WG2A 4TMWA 1LEHA 2BN4A 3ZNQA 1EX9A 1Y8ZA 4D98A 3I4NH 2QU8A 2CXQA 1IEVA 2R1TA 2ZB7A 1SVLA 1IHYA 2JLYA 1X7YB 1Q2XA 1O95A 5E6UB 3D5QA 1KJWA 4H2DA 4LQ4A 1X7DA 1KYYA 2CHUA 1M34B 3OHXC 2XMDA 1KC8C 1ASZA 1GKKA 3E6ZX 3NEYA 4YRZA 4PW0A 2PW5A 3O31A 4ND6A 2BGTA 4A36A 1RP7A 1TWAH 4HQLA 1YHNA 3WXBA 2V03A 2Y1KA 4PC3A 3I4NB 5CDHA 2Z6QA 4IEEA 3BS1A 3TGWA 1D2MA 1CK4A 4RSHA 2XWJI 5EWMB 3MSXA 3AUKA 4TX1A 1UM9A 3OC6A 3U1VA 3WL3A 4UCQA 1F2ZA 1VB5A 2GOYA 5HKKA 4TRJA 2ZI7A 2VDQB 3GLKA 4CJXA 1PD1A 3ZI0A 4MJLA 4QVKA 2RHLA 5D00A 5AICA 1EESA 4PHHA 1T34A 5HF8A 1NGSA 1TWAB 1JEEA 4DR4L 2FVXA 1HR0Q 1NBIA 1E3EA 4TS4A 3H99A 4QICA 1PU2A 4MVJA 2VPIA 1DC8A 3GEPA 4JR2A 5LA6F 3THOA 2VPTA 2ABWA 1SXGA 5AKGA 3LTNC 1RM0A 4GSLA 3ROZA 4MKXA 1S8FA 3WQQA 4LFAB 1A0OA 3Q3CA 3DC7A 4MWZA 1HZZC 1I6MA 1JSLA 1SD1A 1GNRA 3RYHA 4ZZIA 5HIKA 4OQMA 1MI2A 3ET4A 2PBLA 4A3JH 4U7DA 4DLUA 1RXCA 3X1YA 1E1KA 4B5LA 4GGOA 1AV6A 1KPIA 1AN8A 4Q9DA 5HG0A 1Q19A 2EYFA 5EIAA 5D3ZA 5KJEA 3AILA 3L05A 2GBGA 3PJRA 1PS8A 5ELDA 1ISFA 4CDEC 3REQA 1ONOA 2OBNA 4DNXA 4IZIA 3P94A 1VA5A 2F0FA 5LWQA 4BLVA 5K5PA 3SS8A 3OMLA 4OGLA 2EZ9A 1R50A 2HFKA 1EXWA 1YOBA 4CCAA 3DVAA 4HRXA 3TIGA 4RKYA 1FS6A 4K9PA 2A35A 2IUFA 4TMZA 5LXTB 4I7EA 4BLQA 1OIVA 5HEKA 5E0OA 1LI4A 4R2KA 3I64A 2WAQE 2HGSA 4IMJB 4QPZA 4BZXA 1I1NA 2PCFB 2VPXA 4M0EA 1H9SB 1GILA 4MPDA 2Q2TA 1OT5A 4JLWA 1UKZA 2UUOA 5ITSA 1U4NA 3NTVA 5E7MA 4IQFA 5T5QA 4IFDH 2I4MA 2LCQA 3DKIA 3FG9A 4UUPA 1C3JA 2ID8A 3QXJA 2C8LA 4N9PA 2XN9C 1QVFA 4BE9A 4GI2A 1Z47A 2P3SA 4UQPA 2EC5A 1SRRA 5C4JH 3DHQA 5IP7G 2ACVA 2DWOA 2O50A 2VH2A 2W58A 1RHPA 4IGFA 2HMSA 3BWCA 5EKDA 2XRQD 1T15A 4Q3NA 1XTVA 3KKNA 3MTSA 4NFSA 3PXGA 3HE3A 3PJGA 3LCCA 3MHPA 4LDQA 4XX0B 2XUAA 2Z2YA 2YNMC 4YACA 1NRJB 1EFVB 3PX2A 4OX9L 4LF6L 5C4JB 3UH1A 1ZA2A 3QU2A 3R6LA 1ZJJA 3WS7A 2IOHA 2QVZX 3DBLA 4DV1Q 3A8TA 2V3CC 2ZSBA 1KSJA 2WM2A 4MVYA 4LRWA 4ARAA 4RL6A 3DP9A 1DDGA 2QT0A 1QONA 4DQUA 4UVIA 3ROGA 3PXXA 1OBOA 1LVHA 2F43A 3PF5A 2IOFK 2YJZA 2YC2C 3CA8A 4RMIA 2MYUA 4DABA 4E5MA 4JXZA 3FKSA 1W4LA 2VP5A 1M2WA 5DHAA 5BV8A 4JPBW 1M6YA 1K0SA 1N7GA 4MARA 2H2IA 4N3CA 4BY9E 1XAHA 3IFDA 3KF6B 5DFAA 5KHLB 2FZEA 4Y1RB 3A6DA 2CLFB 4RQTA 1W35A 3JVUA 5IGGA 2R8EA 3OOSA 2D7CA 5I48A 1VJGA 1O08A 1AK1A 3AKZA 5CB4F 4LS3A 2AYZA 5AXDA 3EBOA 4I1UA 5FCDA 1L7NA 5CURA 4UEQA 1YL6A 3CMMA 1FP2A 5CCXA 1GL7A 4KGDA 2PX3A 1TUGA 4BMNA 1DFHA 4AJNA 4XDYA 2EY6A 5L4SA 4FYIA 1QZXA 3CPFA 4DCTA 4POGA 2J0TD 3MJFA 5IT9L 1DQNA 1T5HX 3U6BA 1E62A 2AQIA 1TMGE 1AKMA 5TMBA 1M5TA 4HGNA 3U0VA 2CZCA 2OHXA 1RQ2A 2EIXA 2H7YA 1Q0HA 2X4GA 3GLGE 3MYRA 1RD9D 4YCDA 5LQSA 1STYA 2FZGA 5A4DA 3U5TA 4X1IB 1BQQT 4LK2A 1GGNA 3W0LB 4E6IA 4DCGA 4NU0A 1NR2A 1J0DA 1BNCA 4K2HA 1CT9A 3ND6A 5CA1B 1NJ6A 4WESB 3QEBZ 1Q1EA 2AJCA 1EE9A 5L3ZA 1JE5A 3AXTA 4PBRA 1IDOA 5AKIA 1CEEA 5K6AC 4UPDA 2B8EA 4IPGA 2C2OA 5JR3A 1UPAA 4CI0B 4KO1S 2QG4A 3ITNA 3R0VA 1B9MA 5F64A 3TTWA 4IF6A 4AJ9A 4GOKA 4XYLA 4C3VA 1KVQA 2HPZA 3UK0A 5CD9A 4MR9B 4IKEA 4DAYB 1B7GO 3CPHA 1G3QA 1WD7A 3IGFA 3EVAA 3GT4A 1JEOA 6GPBA 4JAVC 3HP3A 1TZBA 3K6JA 4YV2A 1L4EA 3V2IA 3NNDA 1U2DA 1D2GA 3U31A 2W48A 1FXSA 3BK2A 3O47A 1OYYA 4FDAA 2GF0A 4ZDWA 5CV5A 5IE8A 2VJMA 3GT7A 2JFUA 3A0UA 1QHYA 1YR3A 3L7ZC 4Q0FA 1VQBA 4O5OA 1R0XA 2HC9A 5DTEA 1EFRA 1RKVA 1WXEA 1ZLYA 3CVVA 2L0XA 5EHGA 2BKVA 3CPSA 2AFHA 3SKVA 2A2ZA 2AG1A 2REBA 5ILQA 4FEEA 3OCJA 3C7DB 2FJPA 1QF6A 1Z0SA 4R4JA 2ROQA 2DQZA 5EMHA 1KDAA 2IYNA 3HYLA 1CV2A 4OI1A 2FSHA 4ECAA 4LXHA 5JNUA 4HRAA 4BUCA 4HX2A 4IXDA 1GGKA 1XNQL 1H2XA 3U4VA 2HCIA 4MTNA 3AI3A 4RHYA 1U5BB 2ECOA 4HSGA 3ZDDA 4NXML 2NUAA 4NG4A 4HDQB 4II7A 3A04A 1H8ED 4DSAA 1YE3A 1GNQA 2HA0A 3M0EA 4LYAA 2FWBA 4JFRA 3M3YH 3VC2A 4V3CA 1AKTA 2OV2A 1G6Q1 4PNEA 1TS5A 2ZYVX 4J94A 3C3JA 3TSZA 1OJLA 2P7IA 4D3DA 4L95C 3BMOB 4WXHA 4UUMA 1ES9A 1GFZA 2F0TA 2VHXA 4J7CA 2O1EA 4CKZA 1H5QA 3N74A 5A5DA 2XVXA 2RC6A 4PZYA 3UJNA 3Q9UA 2BBOA 4Q82A 4DK6C 4XE5A 4O4HF 2B94A 3IO5A 3UBTA 3WGKA 3DKKA 3GD7A 4C05A 3M3YB 2BSAA 1R5BA 2UXDB 3KUPA 1EU3A 2B2YC 3N59A 3SSNA 3ZV7A 1FFGA 2CW0D 1CJSA 3GR6A 1O0BA 2YS6A 4DXHA 1KLUD 4II3A 1LPSA 1B2LA 1J5EB 3H11B 4XM0A 2W6OA 2ES2A 3ESBA 3KQPA 4NG5A 5K0NA 1LSOA 1N34L 1ORWA 1PFVA 5AVXA 4JVLA 4NOKA 3GDEA 1G18A 1JOKA 3CZPA 4YRSA 4O4IA 4B8WA 1YF3A 5C3EG 3NOVA 2CHEA 1FTGA 2JJ2A 4IUUA 4EKDA 3L43A 2X8AA 4GNXA 1TYZA 4U63A 4IV8A 4QXAA 4F72A 4Z5XA 5FOWA 4AY4A 2G09A 4QQBX 5I4BA 4F87A 2R00A 4RNDB 4M6WA 3PGJA 4CG0A 3UAWA 4TQUS 4QJBA 3DDWA 1MFZA 1WWKA 3NPMA 5ALRA 5B53A 3QFTA 3JQBA 1ULAA 3MK31 3U81A 4NDAA 3KPJA 5JC1A 3Q40A 3OPXA 4M98A 4ESHA 3HVHA 1Y4AE 1KO7A 1VQKA 8OHMA 3FAZA 2VDNB 1MXHA 4HB4A 1OI2A 4OFZA 4Z9FA 4MWTA 3RUIA 4LCJA 1SQFA 3P0RA 3GROA 5BT8A 2O4CA 1S89A 1WF3A 1W36D 2VRCD 2C2ZA 3BZUA 5AUOB 1ZRSA 2H7CA 4J3NA 1GPBA 4L15A 3ONVA 4WAUA 1VLMA 1RSZA 1GP2A 4Q5IA 2CWWA 4FGUA 4QYSA 3NM5A 4C5CA 4ER0A 1E1QD 1X1SA 1KVUA 1L1OA 3BXFA 2Q0QA 1NYLA 4E7PA 4NNPA 1C1HA 4N8X1 3BFKA 4TSFA 3EVBA 1AURA 1LT3D 4CT4B 3CONA 3SX4A 5EPKA 2I3ZA 1Q0QA 1PTOD 4URXR 3EUAA 3H05A 4DE5A 1H0SA 3LI2A 5DAUA 3EIXA 3EIHA 1E89A 4JB8A 1T26A 4A91A 2HEIA 4GGMX 3VKVA 3CVJA 1DJOA 2DHRA 1EP9A 4O42A 2I4OA 1V4NA 3DG9A 3QHAA 2M6RA 2BISA 4QA9A 2CVRA 1XZIA 3GQVA 2XCQA 2GPBA 4GOPB 3CLHA 4QDZA 3IEKA 5J40A 3LNCA 1FRQA 1F8UA 1WTHA 3G5MA 1Q92A 3T1TA 4AMBA 5IN4A 1SUWA 2IIQA 1CZUA 4CV2A 4QE3A 4JXKA 1OLOA 4F8YA 3MCWA 2HIVA 5K4AA 3OW7A 5ERXA 1VQPA 4XJSA 3U4IA 5B5SA 4KUEA 3B5JA 1GL6A 4EFKA 4ILKA 3GTGH 3RR5A 5AM1A 4RVCA 3HB1A 3D81A 5J9FA 1PJTA 1ZNYA 1G5QA 4PPNA 1FRVA 2NN3C 3NBXX 3R5XA 3NW9A 1GAQA 4F93B 5FBQB 4DCOA 5IAOA 3T1HL 1NVTA 2R86A 1MRZA 3QVSA 3CVOA 4RFVA 4D3FA 3S1SA 3T12A 4FCCA 4DA4A 5EL0A 2DJ5A 3H2IA 1VP9A 5DI3A 4TYYA 5KVCA 2XRZA 3MCTA 4Q3DA 4GOXA 1J42A 3LC0A 1JTEA 3PWZA 2B4YA 4GS5A 5J59A 1RPJA 1YNXA 2HD3A 4J6HA 3R40A 1C8CA 1EG2A 3PL1A 5DPMA 3C8ZA 3KC2A 2FPXA 3MCZA 3RQIA 3K05A 4A3DH 1N25A 4DDKA 1KTKA 3X2SA 3DMNA 1UJCA 2P4UA 1YZLA 3ROXA 4A15A 1JLLA 4IBOA 4EUNA 3QVLA 4NYMQ 2WBLC 5EI5A 4DHEA 2P6RA 4NPAA 3F9IA 1YNNC 1HUNA 2ODEA 1KO5A 1KI2A 2RSNA 4LDZA 1B6SA 4YLEA 4Z4EA 1HUMA 4U7HA 4YMWA 2HSDA 1QHFA 1U7ZA 3B6KA 4A3DB 2V7BA 4E11A 3ABRB 4MDYA 4JVZA 1TI7A 4A26A 4FDUA 2DERA 1EDBA 1N6KA 4C3ZA 5IDQA 4H7PA 4O8ZA 2ZSKA 4AJHA 1VE7A 5I5EA 4OFXA 4KP7A 1QUQB 1FSFA 4X1YB 4NF2A 3GAZA 2GARA 4NI5A 1PNTA 1WG8A 2JIPA 1W8IA 1XKQA 5EJ7A 5IEBA 1PXUA 1QK4A 3WQHA 4GLJA 4OIKA 3M4QA 4ARBA 4REQB 3C39A 2DCMA 4MYTA 1O54A 4FHCA 2R7FA 4KXFB 4KXQA 3AI7A 1E2LA 3EZYA