1V43A

Crystal structure of atpase subunit of abc sugar transporter
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
367
structure length
353
Chain Sequence
VIKMVEVKLENLTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYLPPKDRNISMVFQHMTVYENIAFPLKKFPKDEIDKRVRWAAELLQIEELLNRYPAQLSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKVTTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLRPNSVFVATFIGAPEMNILEVSVGDGYLEGRGFRIELPQMDLLKDYVGKTVLFGIRPEHMTVEGVHMKRTARLIGKVDFVEALGTDTILHVKFGDELVKVKLPGHIPIEPGREVKVIMDLDMIHVFDKDTEKAIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sugar-binding transport ATP-binding protein
publication title Crystal structure of the ATP-binding cassette of multisugar transporter from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transport protein
total genus 96
structure length 353
sequence length 367
ec nomenclature
pdb deposition date 2003-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1v43A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1v43A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1v43A01
2ZYWX 3FTQA 2F52A 4TQ9A 5EP4A 4G1UC 2HIXA 5C46F 221PA 4HLUA 2HIVA 1UADA 4Q1CA 2OLJA 3K8YA 3QVUA 3BK7A 4JI0Q 3F8TA 4Q9HA 3TAHA 1G4UR 4A3FH 1UBFA 5SZHB 1DAFA 3BB4A 1HH2P 5G53C 1IAQA 4YWKA 1JEEA 2DWQA 4X64Q 3STBC 4GFDA 2GVAA 1GTVA 2WWWA 2J59A 2AUJD 1WF3A 4MYTA 1S2MA 1M2OB 1GHKA 1D9XA 1DG1G 1OIVA 1W5SA 5BN5A 4DV7Q 4RCZA 4XTRA 5B58C 5KO2A 4LNQA 2WWGA 2ALYB 1E9SA 1HJPA 1G3QA 2ZE8A 2NVQH 4IDOA 3CH4B 2PI2A 1DAKA 3NHBA 4Q02A 4B34A 3OIVA 4HLUC 4X8OA 3HKSA 1VQ4A 4RMFA 1Z22A 2Q9BA 1HZAA 1CXZA 1E0KA 4MRNA 3KQNA 3BB1A 1QVAA 4LK2A 1R4AA 2AHOA 5FTMA 3SJBA 4DBLC 3M4YA 1W7AA 2O8FB 3HJNA 1Q82C 2ZRBA 1N5JA 4M1YA 4DLYA 4HB0A 2RF4A 1E98A 2F43B 2ZUBA 2WHXA 4BWYA 1SXJA 4NXNQ 3M0EA 4Q01A 1X8JA 1SFOH 1D2EA 4BPBA 5EUQB 1BH2A 2HF8A 2ORVA 2F3TA 1LF0A 5DISB 1Z0AA 2YWGA 4Q9LA 3ADBA 1F2TA 3H0GG 2UUCQ 3TSOA 2NQ2C 3ZVRA 2OT3B 3A8JE 2OAQ1 2K5VA 3PGZA 5AJYA 5FPTA 1D9ZA 1VQNA 1E2DA 3W5OA 3A4MA 2IYYA 1ZU5A 1NI3A 2AKWB 4C3JH 2WSSD 4TMTA 4BFXA 4B3BA 5B64A 1A5TA 1E4VA 1E0AA 4NE2A 2PX3A 4TTQA 4PV1C 3CIOA 4LF6L 3KKOA 5G3YA 4HJ5A 4KLKA 4JI8Q 1I94L 1E9CA 1BMFD 1NN0A 3M7NA 1J6QA 4PZ6A 1CKEA 1XD2A 4FI3C 3PR1A 1U0LA 2VS1A 4OO1I 5FTJA 1SXJC 3B1ZA 1BIFA 2ZSDA 2O5VA 1X8LA 3TE6A 2R7ZG 5DO9A 4BXXG 2GXQA 1E1QD 3ZYCA 1L4YA 3TUIC 2Z43A 1G6HA 3NELA 2VEDA 1AGPA 2QRNA 3RWOA 3BXZA 3FKQA 3W5IA 2RB4A 4CEHA 1G5PA 3AF3A 3ASYA 2A2ZA 1UBCA 2VHJA 3JAMi 2PZGA 4IOMA 2IEZA 4A3MH 4NCKA 3T12A 1Z6GA 1CR4A 4A6PA 3ZVLA 1II8A 2GNOA 5KNBA 2JLQA 3QPVA 3C5HA 2GZHA 1W44A 4JKIA 1NKTA 1G3RA 3NBZC 1LY1A 4JS0A 1N3BA 4TT3A 3W9YA 4C3ZA 1JMCA 1Z8FA 1Z06A 3CR8A 3H1TA 3U44A 1E2MA 4TZ0A 4UP9A 3I56A 1T0HB 1IW7C 1Q81C 1W47A 2D0PA 2QY9A 2WOOA 4Z8XA 1ZM3A 2F9MA 3EZ9A 3NH6A 1U0JA 4WIAA 4Q1FA 2O0KA 3PSIA 2B63H 3U4VA 2P5SA 5CITA 1CF4A 2C96A 1VG1A 2C5LA 2IWRA 2W6JD 4JSYA 4Q1DA 2A9KA 4CDGA 1AA9A 1X3GA 3S2DH 1EQQA 4HI0E 2F3IA 3W3ZB 2KA7A 1KI6A 2VF7A 1N6RA 1BKBA 1U0HC 4ESHA 2I1QA 4JI6Q 2JJ1D 3KUCA 3ZLJA 3FMOB 5G41A 4DAMA 2R8RA 1X3FA 1FW6A 1G19A 5IP9G 2C78A 4S35A 4HDOB 2IUTA 5JWRA 5K36H 1UFQA 2DFTA 2VP9A 3VKWA 4HAVA 5C2JB 4JLBA 5IHPA 2REOA 4TN1A 4FMCB 5JSZB 2ZI7A 1N6LA 1XU4A 2J0VA 2JIZA 4ZCLA 4DK3C 1D2MA 2VSOA 3BH0A 1QUQB 3GTGH 1XCGB 4LV5B 4MUAA 2YTYA 2K7VA 3A4LA 2L15A 1CJKC 1TTTA 1FZQA 1UM8A 1XBTA 4HZUB 1Z2CA 4JLDA 5C4GB 5FUXA 4B32A 1E9EA 1W36B 1TWFH 3SNHA 1CU1A 4AYWA 1H8HD 4WJ3M 3T53B 2XITA 4PTLA 1P8LA 3PO2G 4E22A 1KHIA 3S24A 1NIJA 1XZPA 1J7KA 2R6CA 4TTRA 3E2IA 1K9MC 3I1FA 4AIMA 4EIWA 3U61B 4BA2I 4B6FA 3P1JA 4PZ7A 1RRCA 2ODEA 4GI7A 2QT0A 4ME3A 1M1YE 2VLIA 2NIPA 1FL0A 1DAHA 2WB1E 2WKQA 621PA 3KFVA 3RZOH 3CWQA 4X8HA 1G8GA 3MJHA 3UDGA 4L5BA 4RSGA 4XD7D 4UP7A 4K81B 4M9XA 1OB2A 3EZ2A 1TQ2A 3BWDD 1E2HA 1P60A 3S2HH 3K0AA 1KGDA 1GNQA 1IXSB 1XPOA 1QHYA 1FP7A 4TMZA 5FJ8H 3AB3A 2GVZC 3GLGE 3AVXA 3CCUA 3AKDA 5IT9c 4JVSB 1GG2A 3CQZH 4L5QA 1IXZA 5CM8B 3GDEA 4Q7KA 3K8AA 1JPNA 4M9SA 2WKPA 4JBYA 3KJEA 1UE6A 3M4QA 2OBNA 2BH8A 3G6EA 1HNXQ 1G8PA 1A2KC 1SVOA 2ASBA 3AF2A 4KXFB 4QFMA 1SE8A 3QQ5A 2BM1A 5JEAH 1YQTA 2A68D 4PPGA 2HCBA 4PHFA 4I81A 2JCSA 4M1MA 3KLRA 2O52A 3VR6A 2B8GA 4IOLA 4CEIB 1IN5A 1QHXA 4A36A 1OYYA 2XTNA 3GD7A 1VIAA 2BKEA 1XMQQ 2C77A 3DOFA 4W5HA 4ZDWA 2W58A 2IX3A 2Z5FA 4DCVA 2QP9X 1W1WA 3NBYC 1QVRA 2IYWA 5AJZA 1S1CA 1U90A 2GF9A 4FD2A 1KI1A 2IX1A 4IFDJ 2IBMA 2ZUDA 4M9ZA 4PQFA 4KFUA 4DR7L 2XAUA 2ZR9A 2IYVA 4Q00A 1RL2A 1VHTA 1V5WA 3WRXC 4M4SA 2AX4A 3KKNA 4P72A 1DBSA 1VG9B 2OTLA 1R6BX 2DY1A 3THXA 3CONA 1Y8NB 1R10A 3N5CA 2PLRA 1XMOL 3WYGA 4GLVB 1IJEA 1N25A 1P7CA 1VQAA 2DGYA 2CJWB 3BB3A 4JZKA 4GS3A 4M1TA 4IXNA 2WV9A 4JI4L 4BFUA 3H4MA 3V4FA 3V9PA 3HR8A 3AVUA 2Q2TA 4Y52H 1E99A 2EWWA 4IFDI 2JA7G 5FBLB 3AVWA 4KKSA 3CMAA 3VHXA 4PO9A 1CTMA 3FKSA 2WMNB 5L3QA 1FVIA 1DO0A 3CRLC 3CKLA 4DV3L 3MSXA 3OEED 3ZZ0A 4X62L 1Z0FA 3HOUH 4FXPA 4DXAA 2IYQA 3KUDA 1E0JA 1DAEA 1XXHA 3U3KA 1ZINA 1VPLA 5HY6A 1W48A 5JRJA 1J8MF 2GAOA 3PUVA 2OFOA 4MKHA 3U60B 2F43A 5J40A 4OI4A 3J81k 4PC1A 1XF9A 2FNAA 2PL3A 5DN6A 1VQ6A 3W1GA 1Y1WH 1Q1ZA 4DR1L 4TMXA 4DIDA 4DR3Q 1IY2A 1AH9A 2GILA 4G5RA 4KVGA 2GZAA 4PZ8A 4IO9A 4OX9L 4LV8B 5EUMA 1Z63A 3HOVG 2UUBQ 1DADA 1Q1BA 3GFPA 2ZAMA 2K5UA 2WFWA 4KMUC 1Z28A 1S4QA 3C15C 2QGQA 1X1RA 4JKYA 1TAGA 4M2LA 3TUZC 5AR1A 1Q12A 4XTCS 3HOZH 1MH1A 1XJ0A 3AF4A 1FQKA 2UXCL 1YR8A 2A5JA 1PUIA 3SQXA 4MH0R 2W6JA 3HOXG 2PQAA 5DE3A 4M22A 3T06B 4B3RQ 3NBHB 3TS2A 3RVBA 1P61B 2E2IH 3L8YA 3IEVA 2PEYA 4AIIA 1FNMA 1NVUQ 5LMUL 1EG7A 2GEVA 2J7PD 3IBYA 1EYGA 4LHYA 5JEDA 2CVHA 2YOGA 4DK1A 1ZKOA 2JA9A 1NBME 2QAJA 4NPHA 2IS2A 4MDFA 3I4OA 5FH9A 1HZBA 1LNZA 4JIMA 4DNRB 2P0EA 1SHKA 4YQFA 1P2TA 1TXYA 1XX6A 2ONJA 3HR7A 1JR3E 2PBRA 1KC8C 4DR6Q 4QQBX 1E1TA 5HTKA 4MGZR 5JRZA 4DV1L 2HXSA 3QXSA 1MJCA 4JLKA 4DSOA 4HSEA 3ER0A 2VP2A 3E70C 2Q3FA 2ZRCA 5FOVA 3DLLA 2DNCA 4Q19A 1WYDA 3UE1A 1H8HA 2FG5A 3LRPA 4YDHB 1XNQL 1GNRA 1G8HA 3VNUA 3KDFB 4JI3L 4A0GA 1UWVA 1WOCA 1EOVA 4L5RC 1R0XA 1ZCBA 2BMFA 3FB4A 4DR5L 1PH1A 2F1IA 3TMKA 4A2QA 3NEJA 4E09A 2K5NA 2ATVA 3A58B 1H9SB 2R7DA 1U5KA 1A63A 4PAQA 1QHHA 1S3GA 3AM1A 3G0HA 4TVAB 3G82C 3RRMA 4DZZA 3Q85A 4DB2A 1RJ9B 1RYHA 2FSFA 4LV6A 1AE2A 4XD7A 4AYBE 2ZI6A 5EE5B 4WA7A 1DS6A 2HT6A 2VTKA 5JLJA 4D4KA 4URXR 1NBMD 2RHDA 2WJYA 2OXCA 5F3WB 2FV8A 1Z3IX 2N1BA 4Z1MD 1E79D 5JSZA 4LF7L 3U4QA 1HZCA 1W4RA 3NC1C 2FMXA 4UNQA 1AQYA 1IBLL 3PXGA 5AJ3L 1U99A 3EIEA 1JR3D 5TB5A 4HIOA 3QKRB 4FWTA 2RGEA 3UDXA 4RVCA 2K52A 1NN5A 4Z8YA 4IPDA 1N33Q 3VAAA 3DM5A 2H8KA 4DT1A 1KNXA 4L15A 1Y1VH 1EXMA 1NMYA 2CEAA 4MNOA 4Q4JA 1WFQA 2MSCB 3UATA 2OCPA 4FMBB 3PEYA 1C1YA 4DKXA 4OO1H 1E2JA 1TUEA 2F7SA 4YMSA 1C9KA 4HIKA 2ASEA 2G1JA 3IUYA 4AG6A 4JYAL 2VHQA 5AUQA 1ASZA 5FOXA 1X8KA 4L5SA 1SVWA 3IHLA 1Z0IA 3ASZA 2BBOA 1CI3M 1JJ2A 1I2DA 2ODNA 2ZRKA 4YONB 3LLMA 4I7ZC 4A3KG 1GZSA 2L5TA 1S8FA 4PQRA 2ZRHA 5HZKA 2EQSA 2QENA 4JBWA 3ICEA 4HB2A 2GK7A 2CXXA 5H8WA 1JJ7A 5J4LA 1PFSA 1II0A 4UXJA 2G0TA 1SHZA 3X1WA 2UUAL 4QBHA 3NTUA 1W5TA 4HATA 1E24A 1Q22A 5BYKA 3O8CA 2ZRAA 3OFND 4KHPL 1VQ5A 2A68C 2N42A 3WNBA 1W3SA 5HGQA 1SVSA 1JBKA 2WM9B 3OPOA 4OBEA 4P0TA 4V0OA 4DSTA 1OH7A 5EE9A 4D4LA 3ZD6A 5JFGA 1CSPA 4A93G 2PMZE 1E4YA 3LFUA 1EFUA 2IL1A 4BLQA 4GOPB 3PEVA 3PVSA 1N6KA 2Z0MA 2MQHA 4KITB 4A3BG 3FMCA 4AYBG 5GADC 5M3FH 3PEUA 1NMFA 1DVRA 3NBFA 1XPUA 5GADl 3EWAA 3GMTA 3WHLA 1WJJA 2O5IC 3OEEA 3MFYA 1A8VA 1W0JD 2FJUA 3RRYA 1RFLA 4LJ4A 3TRFA 2CMKA 2GJAA 4JJZA 1Z83A 1XJVA 4AYXA 1DARA 4EJSB 3TH5A 2QNRA 2XJ9A 3S14H 3CR7A 1Z9FA 4QNRA 3W6NA 2V3CC 4TQUS 1GP2A 4MDEA 3GJ5A 1UE5A 5FBRB 5KNDA 5CB6A 1GOTA 3BFVA 1NSTA 1O7IA 3OOCA 1PH4A 2MMGA 2OE2A 2Z4SA 4UP8A 1RPZA 3UWKA 3X1DA 1F3OA 4ZDKA 1JJCB 4IHQA 3CCRA 3S17H 1L8QA 2QPTA 3RABA 5BR8Q 1KHTA 3GLHE 3EQLC 1JXOA 4F92B 1SKQA 4EFMA 4PPQA 2QRZA 3EPLA 1HQCA 1B9MA 4JI0L 3MRSA 3TNFA 2ZJQA 4ACBA 2P5TB 4E5UA 4PZYA 2ZRMA 4LGMA 1BOFA 5FI0B 3PFIA 2V1XA 1KI7A 2WWIA 1XTRA 4X64L 4LJ9A 4EPYA 4PC6A 4EAQA 3FKIH 3GJXC 1MO4A 1Z6YA 4M21A 5DYIA 4BY1G 1YNJC 2ZRNA 2VUMG 4CRWB 4BBRG 4DV7L 2OWOA 1R0WA 2WIAA 3M9BA 4MUBA 1WP9A 2R92G 3FP9A 3NVAA 1HZ9A 4RFSB 1P9NA 2JA8H 3QF4A 3L7ZC 1IY1A 2J7PA 2ZVQX 4HJ9A 1U8AA 3WP1B 5JZVA 4DDWA 4YLGA 5LDDC 3PUZA 1KDPA 2HV8A 1H9MA 3W90A 5A0FA 2E2JH 4NP6A 2CL6X 4ARZB 4GN5A 3EWSA 3S1AA 2R2AA 1G3MA 3P20A 4DNIA 2XEXA 1F2UA 4MKFA 3RS3A 4DV3Q 2YWEA 3LNCA 2NZHA 1KZ7B 2MO1A 4LUVA 4X62Q 1N0VC 5JECA 3KF6A 4N0EA 2PJRA 4K0KQ 3HKZE 2YU9H 4HLCA 3WYFA 4NXNL 1DXMA 4EPVA 4V0MA 3Q8DA 3OHMA 2HYIC 1FPMA 4QHTA 2UUCL 4A9AA 2V6IA 2ZIAA 1A62A 3AUYA 3LXRA 4DR1Q 3VR2A 3TK1A 3X1YA 1NY4A 2V4DA 5BWMA 2NZOA 5AUPB 1KK2A 2ZS8A 2BJVA 1Q46A 3H0KA 4DRZA 2GRJA 3OW2A 4TMVA 2AR7A 1TWHH 4EFNA 1LF5A 1MKYA 1ZCAA 4BRUA 2OUKA 1U8ZA 1XNRL 1P5ZB 4JVLA 4JI8L 4Q9KA 1JJVA 4TYQA 2VY3A 2I4IA 3LY5A 2WVJA 1ZJ6A 3L82B 4GL2A 3V4RA 4II7A 4A8JB 5AUOB 4OWWB 1S9DA 1NBMA 2UXCQ 2NVTH 4ZIRB 5FL3A 5KSYA 4Z1MA 1E79A 2J0SA 1MV5A 2EFGA 1GRNA 4C0JA 2ZRDA 4KU4A 4O25A 2O8EA 3I3SR 2HDNB 3K1JA 2WWYA 3CC2A 1JR3A 2ZANA 3UMFA 3EW9A 4M53A 1F5NA 1YZUA 3SEAA 4HR7B 2PNRC 4XVUA 2NO9A 5JS8A 1E69A 4PO1A 1EWHA 1UE1A 5F98A 1Z29A 3WXMA 2X2EA 1NF3A 2BMDA 2NN6H 4IFDH 4A6XA 1XPRA 1DO2A 2CDNA 2FPLA 4B3CA 4G5SA 2YYZA 4BA1I 1XD9A 2QU8A 4DSUA 2IYTA 1FP6A 1P3JA 4GMXA 4DV1Q 3BJUA 1G7SA 1PLJA 4AURA 1LFDB 4DHEA 1VIYA 2Q6TA 5IYBG 3J81c 5FR2A 2B8WA 2OHFA 1VG8A 1CEEA 1V9PA 1KJYA 3BC1A 1L7VC 3DZDA 5FBVB 2ZJRA 1MR3F 1R0YA 2ZR0A 2C35B 3PO3G 1LYLA 2CVFA 3ZD7A 4JI3Q 1M7BA 1FMLA 4X8LA 1SULA 2P2LA 3H84A 3CCLA 1TUIA 2GCOA 3OFNA 2AXPA 3QXCA 4QM6A 3FMIA 4NYMQ 2XTMA 2CCJA 4K8OA 3QG5A 3RSOA 1R9TH 1CS4C 1KD1C 3NH9A 1L2TA 3BAFA 3PCRB 4Q7LA 2PEZA 4CT4B 1Q1EA 3WWVA 2LXJA 1P72A 1UF9A 4YY3Q 2CHQA 3NXSA 4URWR 1NVVQ 2H7VA 2NPIA 3K9NA 4IOJA 2G83A 1YR6A 4IVQA 5GVSA 3P26A 3QEOA 2ZU0C 1W4BA 4YDSA 1G8YA 3C14C 4NCIA 4DUYQ 3THYB 3FPPA 5ELNA 5GAGC 4LF7Q 1LTQA 2GAAA 4WZ6A 4AY2A 3AVOA 3N6RA 1W0JA 1MABB 5AJ3Q 3KXIA 4TLAA 4IW3B 2F1RA 3TQCA 3GLFE 2JA6G 3KQUA 2QBYB 1SVMA 1ZM4A 3CRW1 2QGZA 1VQJA 3U50C 3RN2A 2D7CA 3IDQA 4NDZA 4CZ2A 4I1VA 1T5IA 2AD5A 2IXGA 2F1MA 2E2HH 2VP6A 1CUKA 3L0IB 4R71A 3B5JA 4N0DA 3SYLA 4XWKA 5IYDH 2DFNA 3BZCA 2VHUA 1KO7A 4GPTA 2ZI4A 1K8RA 1S1MA 5C0XG 4JYAQ 1P75A 1XCPA 3QJYA 5J3BA 2KJQA 3FHCB 1UPTA 4C4PA 1YZ6A 2PX0A 3MMPA 1TX4B 3QKSB 1G1MA 1DG3A 1SN8A 1AS3A 3VU9B 1KYIA 1TEXA 1A4RA 1RYFA 5LB4A 4Q18A 4BLPA 4B71A 2E87A 2DR3A 3PIPA 2FFHA 4TQAA 4LJYA 3CMEA 4G01B 2UUAQ 4C0AC 3RLNA 4DLTA 1S3SA 3DM9B 3MWLA 3K70B 3MG9A 4UJ5A 3RS5A 2I0QA 3R20A 4NL4H 1S0UA 1S40A 2JEBI 1Z7TA 2ZREA 2KENA 1HNXL 2LWIA 3OIUA 2CNWD 1UAAA 2QT1A 1N5IA 1T5EA 4UNPA 4GKKQ 3WBKA 3QKTA 4QBFA 3QKUA 1X65A 3T1QA 3QY0A 2E9SA 2JLVA 3PUWA 1XMQL 2WAXA 3ND9A 2KCCA 3P32A 4ZDIA 4Q9JA 2OESA 4UKDA 1WE2A 2MFIA 4XVQA 3R8CA 5J4KA 3LGJA 2A6ED 1HTWA 3M1IA 5M3MG 4B47A 1NSFA 4JT2A 5FUYA 3D31A 1CRPA 5BN4A 2B8FA 2F3RA 3WBJA 4G5GA 4P31A 2JXMB 1EWIA 2N8NA 4FDBA 3K0FB 4I99A 2O8CB 4C2TA 1QBKC 3Q5EA 3L0OA 3WHKA 2GJKA 4DB4A 3R8FA 1EQRA 1XTJA 5JJKA 2YOFA 3K70D 2JDID 2KBEA 4FCWA 4HB3A 4R2IA 4BLRA 3RLOA 1OT3A 1YR7A 1ZNYA 4KCGA 4WVFA 4ZI2A 2DBYA 5M5XH 5IP7G 4ON9A 5H68A 2LKCA 1IBML 1JB7A 3BS4A 4DR2L 1A7JA 4AKEA 1CR2A 4C0QC 2VBCA 1NVXQ 2AD1A 2IF2A 4A3LH 4HIMA 1OXVA 4YHHQ 2J0UA 1YZKA 1Q1QA 3W8RA 1I3QH 3PCOB 1B9NA 1J5EQ 2XZOA 1PH7A 1GKHA 1ZD8A 3A5UA 4QC2A 2BOVA 3ADCA 3ULJA 3TR0A 3CNNA 2JGNA 2NVXH 4WXPA 3J81j 3T51B 3E0EA 4HB4A 3SJZA 5JHGB 2FDCA 4KN4C 3PG5A 1IN7A 2BKUA 3I4NG 2GJ9A 2HT1A 4AI6A 1E94E 2V6JA 5IYCG 1JQJC 3I4MH 1NY5A 4A0FA 5L3SB 1FOEB 3MAAC 2X2FA 4DR3L 3DM3A 2A69D 1XXHE 1ZUIA 1N5LA 1ODFA 1PJRA 4QJ4A 3A37A 2VP4A 4XOIA 4UNRA 4TLCA 2B6HA 4LHWA 2ZAOA 4H1UA 821PA 1SVKA 1HURA 2ZRLA 4DV0Q 2UUBL 3IILA 4DCTA 2ZVPX 3T34A 4HZIA 3SHFA 1Y14B 3HOWG 3QNUA 1Q3HA 2PZFA 1X56A 1JB1A 2VHCA 1YHAA 1W0KD 2QL6A 2ZI5A 4US1R 2QMOA 4B44A 2CLDX 4KAXA 3RS2A 4JYCA 4B43A 2CL7X 3TKLA 4ZDJA 1XB2A 2WP8J 1PH9A 2W2TA 3OESA 2AUKA 4HAZA 3BFKA 4B3RL 4TKOB 1S3OA 2BA1A 4TL9A 1W36D 3EPHA 1YHNA 1EESA 2F1JA 1D8TA 3I72A 5B57C 3A6PC 2DFLA 4GBMA 2CWPA 3KDSE 4IDNA 1ZM2A 4JI2Q 4KBFA 3M85A 1FGUA 5D3QA 3J7ZC 2AKYA 5BXQC 3CRQA 4JLJA 1XNRQ 4E03A 1OF1A 4EPWA 3VX4A 1I50H 4A3IG 1WCMH 4RG1A 3FMFA 3L8ZA 4OK6A 3HU3A 4BQSA 4DR6L 2YJTD 2K75A 1H8EA 2Z4RA 4IKEA 2CLCX 2P65A 3RRNA 5TMPA 3GQBA 1KY2A 1A2BA 3TLXA 3G71A 1FL9A 3UKDA 1A82A 1DE0A 5H70A 5FBQB 2JLYA 3QVVA 1LS1A 3EA0A 4BEBA 3VA7A 1MO6A 5C18A 3TRZA 1MKHA 2OV2A 4A3CG 2WPDD 4MITA 3KTAB 2ONKA 3RHFA 4IOCA 5LD2B 1NE3A 4LFAQ 3VR4A 5GAHC 3B1XA 2YTXA 4JI1Q 2YWHA 2A5FA 3L0SA 3TZUA 3S1NH 4F38A 1E2GA 3W6PA 1AE3A 2C99A 1PA6A 4D81A 1YZQA 4NYJQ 3FFBA 2FEOA 1ZBDA 4YXWD 1G5RA 4A3EG 1C9OA 1K73C 2EVWX 3CF6R 5CYOA 2WICA 4TYNA 4PXAA 3F5FA 5C4JH 3CH5A 3SQWA 2KBNA 3AKCA 4LI0A 2KHIA 2GXAA 4LDJA 3EIQA 3KQKA 5LMNQ 2NZJA 1CJVC 1KK0A 4KSBA 3HDTA 4PMWA 5E4FA 2GCPA 4HUQB 3U2QA 2BHRA 3AVVA 3R7WB 121PA 4IRUB 1MO3A 3KKMA 3W8NA 1N33L 1E1RD 1FTNA 2HXYA 2CNWA 2QBYA 1KDRA 4NPSA 5EZ5A 4EKDA 1K0RA 2FE4A 2RAPA 3GLFA 3THWB 4DV2Q 3LQRA 2CKZB 3DEFA 2O8BA 1C7YA 1GIAA 3IPYA 1IOZA 1HY3A 2R93H 4DLVA 2ZJBA 3EA5A 1KO5A 4DLWA 2DWOA 4CT5A 4KFTA 3UDIA 1QF9A 3E9HA 4R1JA 4RKFA 4B6EA 2G6BA 3AF0A 1VQMA 2E5LQ 1GDDA 2DYKA 3QKSA 4NYIR 4WBSA 5FOUA 3NC0C 4KLZA 3RS0A 5C3EH 2K4KA 4PSKA 3A8KE 4JC0A 2WJVA 1HPCA 3CD6A 2FGKA 2OTJA 1GHJA 4D0NA 1NNEA 1SRUA 2W6ID 2DWPA 1QG2A 2J5XA 3BORA 4PX9A 1G51A 4XWOA 4F91B 1XDBA 2I5MX 5C4MA 2AWOA 1AM4D 1IN6A 4OXPA 1K5GA 2C9CA 2WBLC 3IGFA 3WYAA 3I73A 3A7LA 3RRZA 4A2WA 4LFBQ 4Y7NH 2JLRA 2F4VQ 2JDIA 2EVBA 4Z51A 1XEXB 4QL5A 1OYWA 2NO0A 2SHKA 2TMKA 4BY7H 3GFOA 4XSHA 3ZS8A 4GDFA 1AK2A 5HE8A 2EIFA 3PV0A 3ADDA 5DI9A 2OLKA 2WJGA 3CB4A 2A6EC 1Y3AA 4Q4LA 5JWOA 1CJTC 2D0OA 5BQ5A 5TARA 3M4OH 2JLXA 1GUAA 2W2XA 1CKNA 4NXML 4OGQC 1EUJA 2AWNA 1U8YA 2KCTA 2WMOB 4IOAA 8OHMA 2QORA 1GUSA 2D3WA 1E0SA 1P4SA 4RZXA 2WWFA 1LACA 1E2WA 1T9HA 4H0LC 2ZS7A 4LJ7A 3GPLA 4DV6Q 3K70C 3GLIB 1Z6HA 1BKDR 2X19A 4HUTA 3A1TA 5EJEA 3OYYA 1GNPA 3S15H 2K32A 1XJCA 1U9IA 1IQPA 3O8BA 4LOAA 3AEVA 1YU9A 3K0FA 2B3GA 5BR8L 1YJ5A 3QXJA 5HCIA 1DD2A 3LWNA 1E9DA 4OHZA 1LVGA 5C44G 1E2PA 1VHLA 4I4LA 4M8NE 3SHWA 2UU9Q 4HDCA 3VFDA 1TWCH 2R6AA 1W0KA 3KKPA 4AK9A 3GLGB 3I62A 2KB0A 5KU1A 2X77A 4Q5IA 2GK6A 3AGQA 3E5HA 1PH3A 3K9LA 1FMJA 3TBKA 4LJZC 3KOJA 3PIOA 1HE8B 4Q1AA 3T1OA 2VH5R 4GNXB 3SYKA 2AL7A 2WAYA 1LM0A 3LV8A 1W2BA 2FSIA 2RGAA 2QUZA 2K50A 1OW3B 1QHNA 4LJ6A 1T5LA 2N3SA 1E96A 1EGAA 1U9IC 2OBLA 2WSSA 2A69C 3T1TA 5AJVB 2Z0SA 1YJ9A 2QPOA 5DIFA 3SYNA 1OXXK 2WB1G 1W2HA 4MRVA 4B48A 1IBMQ 2C03A 1SGWA 4DR2Q 4U5XA 3CCMA 1Z08A 3W5JA 3CAMA 1NN3A 1BMFA 3GTJH 2EFCB 2NN6I 3BH6A 3EZ7A 4DK0A 4GZMA 4XSGA 4OWTB 4NKRA 4XVRA 4M1OA 1KI4A 1T3HA 5L3RA 3U3JA 3ZGXA 1E2ZA 1LS6A 2RHSB 1ZIPA 1T3SA 2C2HA 4L5TA 4ALPA 3LWUA 1KI2A 1E1QA 2O8FA 4K0KL 4LK1C 4Q66C 4B2PA 4A3FG 3R9XA 1SZPA 2OXRA 2QSZA 3A4NA 2HYDA 1M34E 1LABA 3SGIA 4L16A 3WNCA 5FLMH 1GL6A 5C1BA 3H3VI 1NJGA 3DO6A 4URVR 2WPDA 1D8LA 3RC8A 2XXAB 4GRAA 2NOAA 2BEKA 4E07A 1R2QA 3F3YA 2EFHB 1OJLA 4B74A 2A5GA 2GTPA 4OQMA 5KPDA 4LW1A 1OFTA 4B3XA 4HYYA 4A3JH 1KKMA 1WCV1 1YE8A 2ANBA 2IYSA 4PO8A 3RS4A 1HEIA 3M4PA 4QJ3A 4ZV4A 2A78A 4V0ME 3QPWA 3ZZTA 3RDPA 1NLYA 3Q7QA 4YXWA 1IM2A 4AQYQ 4A3GH 4IDPA 3EZFA 2ZROA 4X65Q 4BFSA 5IK2D 1PYSB 1H9RA 1YBYA 1YKSA 2ORIA 3IQXA 2FFBA 2VPPA 1GFIA 4KBGA 4BFTA 3NEMA 4Q47A 4UY8C 5DHFA 4DCSA 2DFKB 2ZRGA 3A8IE 4DV5Q 4GKJL 4Q4HB 1FX0B 2FFQA 2GEUA 5GJCA 2PT7A 2CE2X 3D6TB 4LPKA 1EFWA 2JJ1A 3U58A 2QG6A 4RZ3A 4TLDA 3X2SA 1K8MA 2ZR7A 4WAUA 5F9FA 2A5DA 1D2NA 1E1RA 2H5EA 3LD9A 4M0LA 2GETA 5GJWC 4QY7A 2VQFQ 1G3UA 1FJGQ 2FSGA 3B1WA 4JLVA 5G40A 5SZIA 2QAGB 1O7LA 3TQYA 2BC9A 2ZTCA 4US0R 2JLWA 2JATA 2GCNA 4CGZA 1VQCA 2ES2A 5JJLA 2OEPA 3MJRA 5SZKB 4A1FA 4DUGD 1KOFA 1V8QA 4NU0A 4LUZA 3ZJYA 5JBQA 2AN9A 1M7GA 3SE0A 5L3VA 3K81C 1W4CA 4JI5Q 4DCNA 2ZITA 4IXMA 2WAQE 4NCHA 4B35A 2FZLA 1VG0B 2B7CA 1FUUA 4MRRA 1MT0A 4LF9Q 3L0PA 4POGA 1ZNZA 4ABYA 4RZ2A 4MRSA 3VMFA 2JLUA 1QJOA 2W6IA 2KBFA 4OHVA 4IJLA 5LMNW 1BYIA 4F4CA 4GP6A 4C7OB 4Q1EA 1WMSA 4CVNA 4KYIB 5UKDA 5M04A 1NN1A 3Q3JB 3IRBA 3KL4A 1Y69U 4OI0A 1VQFA 2YC4C 1E9AA 4LYFA 3CM0A 2LSSA 1W4AA 4A3MG 3EG5A 3F1ZA 3R7WA 3ZJYC 5KYKA 4H44C 1ZYRC 4YY3L 2WJJA 1ASYA 4R4QA 4QOSA 4RD4A 3GTQH 3U6BA 3P4YA 3NBXX 4DUYL 4LBZA 1OH6A 4IJHA 1JEDA 6Q21A 2NGRA 2EJGC 1NVVR 4LF5Q 3W34A 1QRAA 1RW4A 2F6RA 1QUQA 2AMCB 3TS0A 4RJLA 3B60A 1XNJA 4DNTB 4OK3A 4C0BA 3T56B 2B63G 1US8B 1XTSA 3IIKA 3TSZA 4DLXA 2JAQA 2GN5A 4HZUA 3H15A 4JT4A 4JVMA 1SKYB 1HUQA 5HE9A 1UBGA 3EAQA 3U4ZA 1T91A 4LZZA 2CWAA 3BRWD 4JBJA 2EJFC 5C4XH 2CK3D 4NBSA 4YCWA 5P21A 4LJAA 3VNVA 4D2IA 3MLEA 1F48A 3PENA 1GITA 5K8UA 5K36G 4KI0A 1VQ8A 2B7BA 3KB1A 5FBWB 1KL9A 1T0JB 2CHVA 3BDOA 3VDYA 1AIPA 3NEYA 2WAQG 1YZNA 1D6JA 4N3NA 5K8IA 4D4JA 4P75A 5M5WH 4HJ8A 3H94A 1W36C 2FPMA 1MIUA 4JV5Q 2OCAA 4BRWA 2A3RA 1YNNC 2K14A 2IWHA 5J4YA 4QGFA 3T5GA 1TNDA 2BWJA 5F9HA 3KFXA 1PLKA 5GAEC 5IT5A 3KJHA 1Q7YC 2UXDQ 1Z0JA 2BBSA 2OO7A 2ZYVX 4GKKL 1YRAA 4IDHA 4RZUA 5J5CA 2NMVA 3EIHA 4J0QA 2RGBA 1I2MA 1VKJA 1L4UA 4QGHA 1X6OA 1GSIA 3VR1A 2ZRFA 2XGJA 3EIVA 2ZSFA 4IFEA 4PQYA 4CEIA 1L2FA 3MXUA 3KFUA 1IL2A 3HOYH 2ZJ5A 3LBHA 4DC9A 4NXMQ 1I6HH 4D25A 2I5HA 2JA5H 1Z0KA 1ZRHA 1OPXA 2IF0A 4PC2A 4R9UC 4O0AA 1LTLA 5FJ8G 1H65A 5CK5A 4X66L 4A3DH 3PUYA 3F2CA 2OG2A 5M5YH 2EWVA 2J1LA 2DCUA 3CW2A 4X8MA 2G0NA 4CYMA 4B3MQ 4BBSH 4EQ6B 3K9HA 2ZJOA 5FUVA 2IHEA 1VF7A 1P9RA 2ATXA 3CCEA 2G3YA 3UMRA 4Q7JB 3W3AA 2B29A 2OCYC 3ETLA 5JEAG 1G4AE 2O0JA 4KLNA 4DCUA 2CJWA 5DSZA 4CEJB 1WI5A 2H1LA 2HCJB 3RC3A 1VQ7A 1ZM7A 3UG6A 1UKZA 3VX3A 3LW8A 1G9XA 1OV4A 3HPQA 1KMHB 4YHHL 1BBWA 3K7AH 4LJ8A 4JL8A 5IK2A 2QQ0A 2ODWA 1RIPA 3C4JA 1I6VC 1SQ5A 1VQPA 1KI3A 2OILA 3LBIA 4GNKA 4QBIA 4PPNA 1RE0A 4HAYA 2JJQA 1J5EL 1OSNA 1TKWB 3CW2C 1P62B 2L0XA 3FE2A 1CJUC 3K53A 3OE7D 4KV9A 2GHIA 1GRRA 3T15A 2IS1A 2A6HD 1EFRD 3A36A 4GNXC 1N0WA 4V0KA 5TXGA 1J90A 1U94A 5DHAA 2NO6A 4AWXA 1X1SA 2Y0SE 2G77B 3DVLA 5GVRA 4DEXA 2GVBA 4TL7A 2VNUD 2Y8EA 2XXAA 1DAMA 4FCTA 1E9FA 5EE0A 1VDZA 4LFCL 4DUGA 2Q9AA 4TWZA 1QZHA 2X1VA 3VR5A 1VYUA 3NENA 4DV0L 2IS6A 3CCJA 1PLLA 2QE7D 2A30A 3SZRA 4HDQB 1ZD9A 2B8TA 5IY0A 2CE7A 4G7ZC 1VQLA 1JAHA 1NRJB 2Q21A 3CNOA 3DOEA 1J99A 4JBKA 4I1SA 2Q2UA 2IEYA 2PCFB 3VR3A 2YTVA 4LBYA 1COWD 3RWMB 1KDTA 2PZEA 3HOUG 2QA4A 4BZPA 4C3IH 3AVPA 2HHHQ 1E2NA 2XZLA 1M74A 1RIFA 1B70B 3QSYA 2GZDA 1V43A 3GCGA 1VYVA 4EFLA 2ZTDA 4JI2L 1HNZL 1OIXA 2QTVB 4AC9A 2YWFA 1EWRA 3H0GH 4OI1A 1Y1WG 4NB3A 2OZEA 3CF0A 4FINA 3AVYA 2D2FA 2IYUA 4YMWA 5FOTA 3FHWA 3T1HQ 1YHQA 4IVPA 4C30A 3TR5A 3A74A 1KZGB 2KE5A 4PHGA 1GAJA 2CW0C 4TTPA 1JALA 2QAGA 1P2UA 4UNNA 4R4TA 1VQKA 2ZM6Q 4JI7L 2AHOB 4GKJQ 2B92A 3ECCA 2VA8A 1OE0A 1QHSA 1F6BA 1QHIA 4GLXA 2NO7A 3HOZG 2GA8A 4BGDA 2OM2A 2UKDA 3CX6A 1XP8A 2D74A 4BLSA 3A0JA 4EPTA 4V0LA 3CX7A 1NL3A 4W9MC 1XTDA 1J2JA 1SXJB 4LFAL 2ECKA 2R7ZH 3D3QA 4BXXH 5JWHA 4TMWA 4JI1L 1O87A 3GTPH 4WJ4A 1SLJA 4JL5A 3KDFA 2CK3A 1F2TB 4C2UA 3QBTA 1VCNA 3J81i 1A0IA 2E74C 4D26A 3PF5A 2O8DA 3LBNA 2QAGC 4G5QA 1H9SA 4MYCA 4QGGA 2VZAA 1S96A 1ESNA 2HJVA 5GJVC 3N2EA 4NYJR 4AH6A 1RJ9A 3H3VH 4G7HC 3HKZG 4GMDA 4KFRA 1H95A 4JJKA 2ZJ8A 4D80A 2XNSA 2J41A 2I1VB 4URYR 3M3YH 5LMNL 4HAXA 1XD2B 2WSMA 2VW9A 1TL7C 3AF1A 5EXPA 1X55A 4CW7A 4DDVA 1Q8KA 4GN3B 1XZQA 3T1VA 3CPFA 3A1UA 1I4DD 4LYHA 3CZQA 4LY6A 1II9A 4W5JA 5AJXA 1GUTA 3HFZB 3OF5A 3QKRA 4O3MA 3WMFA 4PC3A 3UE0A 4P32A 1ZVQA 4DV2L 3KB2A 1YZLA 5DNYB 2ZSBA 4OHWA 1BDOA 1YZGA 2FH5B 2K33A 4CEHB 3Q8XB 3V00A 4LUOA 1ONBA 2XOKD 2ORWA 4YCUA 2EFDB 4DV4Q 4RY2A 1JR6A 3JVVA 1II8B 5JMTA 3S16H 3CWZA 2OCBA 5IP9H 2QQEA 1QVFA 5JI3E 3FVQA 1EX6A 3D8BA 2CCZA 2E5LL 2BE5D 4EDHA 3SJAA 1OFUX 3CRKC 3U44B 1A1VA 1EFHA 3QENA 3KLWA 1AS2A 5KDDA 1VQBA 2AKAB 1KAWA 2UZIR 3H2YA 1KNQA 4APVA 3H86A 4ZCMA 3L2PA 1E22A 1KJZA 1VCMA 1E1OA 2FWRA 2VQSA 2PT5A 3RANA 2J7KA 2EJMA 3RR5A 3C7KA 3J80c 1RKBA 4AD8A 3ZVMA 2IYZA 1M90C 2ZJPA 4LFBL 2F4VL 5D3MB 4FMDB 3AP3A 3PO2H 4D0LB 3LW7A 1KI6B 1Y1VG 2QMEA 2EFEB 1Z6AA 2R7FA 2IY5B 4TYPA 1NP6A 3ADKA 4OO1G 1KIXA 2Q3MA 2XTZA 3IO3A 1BBUA 4GOPA 2ZT9C 4ZI3A 2E76C 2AK3A 4F4IA 3KKQA 4MZ9A 4G3XA 3I8SA 5BW8A 2XB2A 4YCVA 2W83A 4PSAA 3BERA 4MQBA 3OE7A 4H02A 4AKIA 4D0GA 4URUR 1I5FA 1Q44A 3QXHA 4I1UA 2GJSA 2H18A 2XGTA 4Q03A 1H9JA 1PV4A 5FTNA 1EFRA 1HQMC 3BJIC 4JLPA 3EBEA 4C0LA 1K3RA 2ERYA 3S1RH 3S1MH 4FCVA 4DV6L 4EJSA 1ZUNB 4KFSA 2ZJAA 4KYUA 4R4IA 2WJHA 4LBWA 1AKEA 4QM7A 3Q9LA 1W49A 2BBWA 2V8OA 3FMPB 1S9HA 2BIFA 4R98A 2MO0A 4RCNA 3PUXA 2C9YA 4IVRA 5LBIA 3OAAD 4GOPC 3RNLA 2V1CC 1HR0Q 1JXMA 3U9SA 3G5UA 3T5DA 1NG1A 3P4XA 2QE7A 2UU9L 3HP1A 2UXBQ 1OHHD 2VQEQ 3EPJA 1XWIA 5M3FG 3T1YL 2G1KA 3LX8A 3QUSA 5FTKA 1G17A 2CCKA 4X66Q 2J87A 4R4OA 2V7QD 2A6HC 1VQGA 1Z2AA 3SOPA 1CULC 4QNMA 3K0AB 3B2EA 1HCZA 3M6AA 4B3GA 4EJSC 1IN8A 4NTZA 3SU8A 1L1OB 4ASUD 4IPHA 1R5BA 4WZAE 3B1VA 1YEZA 3MEFA 3GTOH 1GO3E 3Q72A 4R4CA 2CL0X 5FPSA 1S72A 4B3TL 4V02A 3K9GA 1XEWY 4DJTA 4RFSA 2X8AA 2ZM5A 1UBEA 1EX7A 3CF5A 3B9PA 1TQ6A 1GKIA 1YVCA 1AN0A 2JJ2D 2RGXA 1ZU4A 3DL0A 1M1KC 3ZQJA 4DDUA 1IBKL 3RYTC 2B21A 4KKTA 4NCNA 1O3YA 2FU5C 4O2RA 1T8UA 1GRQA 4NCJA 1UKEA 4DUZQ 2C95A 1KIMA 2RGGA 4ARZA 2WTUA 3U7GA 2IYXA 4TSFD 2RGNA 5JS7A 1UEIA 3KQLA 5BYJA 2LMCB 4OK5A 1E9RA 4ILEA 1K8AC 3ZH9B 4LF4L 5B30A 4BZQA 1DAIA 1SMYC 2JA7H 2ZTSA 3HPRA 4EUNA 2J9RA 5KPJA 3MXNB 1ZYUA 3FKIG 2FA9A 1G16A 3KJGA 1UEJA 1OTCA 4MGYR 1GL7A 4PFSA 4PR0A 3OTOL 3QEJA 1CR1A 2PCLA 4QG7A 4PHTA 1Q3TA 4URZR 3BE4A 4QRHA 2IK8A 4LFCQ 3GJ8A 2JA8G 3RS7A 2QEXA 3AQ4A 3GP8A 1HH4A 5SZJA 2QGNA 4F4JA 1Y8OB 3LVRE 4TL6A 2D06A 2Q2HA 2VSFA 2R9VA 4MKIA 3THXB 3QG1A 4AQYL 4HLDA 5E3HA 1XTKA 2RGNC 3GO5A 1Q57A 4P74A 1JECA 4N1AA 4X65L 5L8VA 2MSEB 2PMKA 5EAYA 1SMXA 2GXSA 1KI8A 2NVYH 4XWAA 3I5YA 5CJPA 3DHWC 5DYGA 1PHJA 3HOVH 2HJGA 2FOLA 4A8JA 1ETUA 4DV5L 4ZIRA 1E32A 4OQXA 5L3QB 1KKLA 3GEEA 1V1QA 3CBQA 3NDPA 4TZ6A 1OH8A 1IYVA 1VQEA 1WBDA 3BZKA 4FMCF 1XXHB 2D4HA 1XD8A 3A1VA 5C0XJ 1HNZQ 2FSHA 1DPFA 2VO1A 2XX3A 2VQFL 3PQCA 4IJMA 1FJGL 3LQQA 3HOXH 1TQ4A 1VQDA 3B13B 1WQ1R 3FHOA 4LYAA 4BFZA 4F7WA 4LRWA 3CRVA 4P3YA 1AQUA 3E9IA 4V0NA 2XOKA 3BIFA 1KSGA 3SC3A 1R5NA 1VCIA 1X3EA 2GJ8A 5E7IA 2BDTA 1YHBA 2XZPA 1NMZA 4NH0A 3U3RA 4GT1A 4ZCIA 1B7YB 2OQ0A 4DLZA 3WNDA 4JI5L 4RD6A 4JI7Q 3R9WA 4C0HA 4LPSA 4A8JC 5FL7D 1CBUA 5DI3B 2V4ZA 3BG3A 4LF9L 1UDXA 3N70A 4YWLA 1E2FA 3ZIAD 4U02A 2IC5A 3EX7C 3IHWA 3AP2A 1PYBA 3K7UC 4B73A 4HJ7A 1Q90A 5C0XI 3CPJB 3GJ7A 1TWGH 2D2CC 3B82A 4U00A 3TVDA 4BFWA 4LX0A 1NLZA 1CSQA 4JYBA 4JLAA 5F2EA 4ERNA 2FF7A 3AGPA 2YINC 2Z6VA 3K0XA 3EXAA 2E8GA 2HQLA 3PITA 4P33A 2PQAB 4DK6C 3FKSD 4J15A 4L4UA 5EXSA 5K8TA 5CK4A 1X6VA 2ZSAA 5TV2A 2ZUCA 2IA5A 4QKQA 1CR0A 2NN6G 4IFDG 2ZRPA 2BDOA 2DHRA 3GJ6A 1RZ3A 3TQFA 4FN5A 3QOFA 2BE5C 1P2SA 3LX5A 2CFMA 1TU2B 1NJIC 1TADA 1VYTA 2GXUA 1ZMXA 1RVDA 4LF5L 2FEMA 2ZSEA 4IOKA 5DN6D 4KO8A 1HQYE 1GKYA 5ELXA 4A82A 2IW3A 3U3MA 3THYA 4ACAA 2XNDD 2FZ4A 4O2DA 2ZRIA 3JAMc 3AYHB 1MABA 1Z6TA 2UZ3A 1AZTA 4KJZA 1QDEA 4UXHA 3G48A 4XH9B 2QSYA 1N5KA 2KHJA 1Q20A 4F93B 1BO6A 3I4LA 2PJZA 3EASA 2HF9A 4TYYA 3W6OA 3SS8A 2ZRJA 4IDQA 3DXJC 1BS1A 3T61A 4Y0VA 1MJEA 3B7GA 4HAUA 4TLBA 3EARA 3KJPA 2EW1A 1YVDA 2WOJA 1KSJA 2XJ4A 3OAAA 4H13C 1TQDA 2P67A 4G5OA 4UJ3A 1M8PA 1GUGA 3NWJA 1E6CA 3CPHA 2KSQA 4RKEA 5D3MA 3WY9A 3D4RA 1OHHA 1QHHB 5J47A 3AVTA 4DR4L 4PSVA 5JEEA 1TU4A 4KODA 5JCPA 3VU9A 3B9QA 4AG5A 3B78A 3GEHA 3AKYA 3WMEA 1VTKA 3HWSA 1RC8A 4HEJA 2V7QA 1SROA 1QZGA 4JV5L 3SDZA 1VQHA 5H1YA 2YVUA 3ERSX 5FPYA 1IYUA 5DH9A 4A3KH 2OFXA 4Z54A 4JLMA 4ASUA 3AFQA 3U4QB 5AJWA 5IWAQ 2YKGA 2JLSA 4DAYB 3OZXA 3WRYC 1OLOA 4G7OC 3PJRA 2A1AA 3IPXA 4RD0A 2IHYA 1VQOA 1QHGA 2QMUA 2UXDL 1KY3A 2VP5A 5E7JA 5K8LA 2JE6I 5IYDG 3CO5A 1GVNB 3ZVNA 2H16A 2JJ2A 2CBZA 2C98A 1NLFA 2RCNA 4L9WA 1ZC4A 4DT1B 2QM7A 4Q4JB 3FOZA 2GBLA 4GSYA 1HNWQ 1HR0W 2A5YB 1F60A 4A93H 1VMAA 4DLRA 1E2QA 1P6XA 3DMDA 4TSFA 4A15A 3RZDH 4QBGB 2FXQA 2J45A 2DB3A 1G3IA 4A3BH 1HT1E 1T6NA 1KAOA 1GWNA 2ZS9A 3BU2A 3L43A 3GLIE 4O2LA 3KZ1E 2OFWA 2BM0A 3FYHA 1UKYA 1G7TA 3DMNA 3FFAA 4CF7A 2A8VA 1XMVA 4B3ML 2OBMA 3AUXA 1G64A 2GKSA 4RD3A 3IIJA 4ITRC 4BFVA 2O8CA 3RLFA 1X54A 1GUOA 4FW9A 5CYPA 1L1OA 4LUCA 1PH8A 4IEEA 2NPFA 5FOWA 1J8YF 1CLUA 2GBLC 1B8AA 3ND8A 3DZ8A 4OL0A 1PH6A 2ZPTX 4DIEA 3T1YQ 5JJIA 2EYUA 4BLTA 3GFTA 3VQTA 1N32L 1JPJA 4KN7C 3UG7A 3ULPA 1DEKA 2F1HA 3DDCA 5E7MA 4OJKA 1ZUHA 2NG1A 4QGAA 1P73A 3KXLA 1NY6A 2JEOA 4QIWE 2JEAI 2V9PA 4BUJA 1N36Q 1OXUA 2V54A 2VP0A 4OYHA 3SBDA 3ZZUA 4ESVA 1XTIA 2H92A 3ONWA 2ZXUA 1N6OA 3E1SA 4A92A 1GJXA 1T3LA 2W0SA 3HYTA 1E2IA 1XMJA 4B3TQ 1NBWA 1TF2A 1L1OC 3SBEA 4B3SL 4IPCA 2DPXA 1HE1C 1QVGA 1KXLA 1JE5A 2FN4A 4BY1H 1RRGA 2GEDA 2IYRA 1IXRA 2VUMH 2YZ2A 4BBRH 5FTLA 5GQOA 3QE0A 4ZPXA 1IBKQ 4Q7MB 2ZETA 4O0MA 3A1WA 2R92H 2Q8IB 5KSOA 1O78A 5L3SA 1GD7A 4YMUA 4OQLA 1E3MA 5HCNA 2YV5A 5IDVA 2VIIA 4Q4AB 1HYQA 5CIWA 3UANA 1E2KA 1CP2A 1VCOA 2G9NA 3TGPA 5FL7A 4LF4Q 1PVOA 1E2LA 1BVSA 4V03A 4A3LG 1U98A 1KQSA 2H17A 1FFHA 4MYHA 4BEJA 3A8TA 3ZIAA 4GLAC 1NIPA 1T4GA 1TMKA 3I61A 1IZ6A 4GOXA 1TPZA 2I5LX 2CLSA 1RRPA 3QIAA 1PMRA 3OTOQ 1Q0UA 4QJFA 2HHHL 1JNYA 3UWOA 1Q21A 1G5TA 1G7RA 3ULLA 3B85A 2Q2IA 1IXRC 5CLQA 2JK8A 4PAMA 3I92A 4C0KA 3RNUA 2OCEA 1CJMA 1E3PA 1G21E 1K6MA 1LW7A 3FGNA 2V55B 2Q9CA 2VL7A 4JL6A 3I4MG 3QF7A 5FLXc 4LF8L 421PA 3FHTA 2Q3HA 2EDGA 3QF4B 3T1HL 4M1WA 1GUNA 2ZYTX 2D2EA 2FX3A 3B6EA 5TVKA 3IKJA 1AZSC 2CCGA 4DLUA 3GTKH 4B2IA 2WIBA 1DELA 4MYUA 1YIJA 1X3SA 3OEHD 3KF8B 5HR5A 2ZM6L 3IEUA 3U7EB 2QPAA 4LYJA 1ZM9A 3QI2A 3S1AB 4OQFA 1F2UB 1YNXA 2XNDA 2V1UA 1KRTA 1DCZA 5J4VA 3AB9A 3KF6B 3CP0A 2WZQA 5FPKA 3EC2A 1E9BA 5DI3A 2N46A 1OIWA 1JT8A 1E2EA 1P9WA 3AEZA 4Q21A 1XMIA 3KTAA 4JLOA 2A19A 4OHXA 1LV7A 3AQQA 1CIPA 2HUPA 4OQNA 5CM9C 5ANRB 4DPGA 4IPGA 3U6KA 3HU2A 4PG3A 5TY0A 4AKHA 1KDOA 4LCBA 3UIEA 4KHZA 2PNHA 2BCGY 5EE3A 2H5XA 3IO5A 1ZC3A 3AV0B 4W5WA 4IQZA 3BD9A 1FNNA 3K09A 4PC7A 4GZYC 1WCMG 3TW4A 1G6OA 1D7QA 4QJ5A 1XEWX 4EPRA 5KSPA 2J46A 3GTMH 4MGIR 1ZNWA 5CDFE 1GVPA 1DGSA 1ZP6A 4LF6Q 2QEQA 4PANA 2DNEA 2IHBA 1FTSA 4H1VA 1N6HA 5IYBH 1I94Q 1N0UA 1J70A 1UDWA 2BA0A 1ESMA 721PA 3EN2A 1OXSC 5LD2C 2O8EB 4B75A 3HGBA 1E7ZA 4P73A 5BN3A 2KI5A 3PO3H 2FPKA 4HUQA 4LWZA 5IF9A 2QI9C 2P6RA 5HPYB 4NYMR 2MSDB 2R62A 5JHHB 5KDLA 3A1SA 1B0UA 3SJCA 3UK6A 1G6PA 2DN8A 5H1SE 3LDAA 3THWA 3K09C 4DV4L 4JBMA 2QTFA 4EX5A 5DLQE 5GROA 1EIYB 2O5JC 4I1OA 3OIYA 1T8TA 1KJWA 1TEVA 1EWQA 1SKYE 3D0FA 4QHSA 2ZE5A 4P71A 3C5CA 1Z07A 2BCJQ 3JVUA 3U5ZB 1Z47A 4LC1A 2R6GA 3LH5A 1OB5A 2D5DA 1YI2A 3DKVA 3KQHA 1XFAA 1OXTA 4QGUA 2JA6H 1TF5A 3C16C 4R7ZA 5FPHA 4DDTA 3F2DA 5E95A 1UKVY 2BJWA 3TIFA 1WA5A 3AVQA 2MNAA 5EP2A 2BVNA 2GCOB 1U2RA 1CFMA 3CZPA 4M1SA 3K0SA 1RRFA 1DTSA 4IEIA 3IIMA 1KO1A 4OONA 1G8FA 4DR4Q 2R93G 1XEXA 2HEIA 4TYWA 4B33A 2WKRA 3LA6A 4P4TA 1NVWQ 1P16A 2VF8A 5C0XH 4A4IA 2ZJ2A 3LAWA 1DAGA 3IQWA 5IE8A 3KJIA 3UDFA 5CJ2A 1C0AA 3SI7A 1XEFA 1WB9A 4JCVE 1IN4A 1G7CA 5KTYA 3O8DA 1N6PA 4UXIA 3U3OA 5C3EG 2C04A 2QROA 3OIWA 1KSHA 5G3ZA 4IFBA 3EZ6A 1W46A 1N34L 2ATWA 4P4SB 5DGXA 1EFTA 1OFIA 2J0QA 1ANKA 4UQOA 2QF7A 4NYIQ 2ZJZA 4DLSA 4X6AH 3GEIA 2XTIA 4UNSA 3VTKA 3R9IA 5KSZA 4U7DA 3REFA 5FR1A 4MTNA 1MOZA 3MCAA 4OI2A 4DVGA 3GLIA 1KTVA 3MGCA 5EXTA 1K8GA 1MO5A 2IYLD 1HR0L 2QTHA 4A0HA 2EYQA 5JI2E 4BY7G 1N6IA 2W00A 2UXBL 3HYRA 2VQEL 2WWXA 3MD0A 4NZYA 1VQIA 3JC66 4US2R 2LCFA 4WW0A 4LWCA 3W1BA 1GM5A 4BASA 3GLGA 1R0ZA 3NE5B 2PMDA 3OW7A 2BMJA 1NJFA 3IBGA 1K83H 3F0TA 3RAPR 3TVTA 4BZXA 4JLNA 1DOAA 1FUKA 3B1YA 4JOIA 2PLFA 3K80C 4LSGA 1VECA 1P2VA 1GL9B 3KXKA 1KO8A 4GOKA 2R44A 4GNXA 4DKAC 5M3MH 3A5ZB 1WBBA 3AH8A 4MA4A 1KMQA 2O0HA 5EP3A 1IONA 1LUZA 1NMGA 2K5HA 1IYJB 1G291 1MRSA 1M6NA 4YMTA 1KK3A 1OKKD 3QPUA 2RHMA 4JG2A 3THOA 1XTQA 2IXEA 2F9LA 1Z5ZA 4POAA 3QXXA 1QZXA 1I4TD 1PH5A 1YRBA 2RH5A 3FWYA 4JK1C 1N32Q 1Q86C 1LB1B 3OEHA 4A76A 4DUZL 4JSTA 5FFMA 1R5OA 2P6UA 4A75A 5IP7H 1XMSA 5HKKD 4KKUA 1KK1A 4JOIC 3CF2A 4DEYA 2ANCA 1FR3A 2IXFA 1BYUA 1K8OA 3CX8A 4Q4AA 3CCVA 2ZEJA 3DKPA 4YMVA 1B23P 2JQOA 3KYHC 5AK0A 5EQTA 4K46A 2QP3A 3GLHB 1KO4A 4B3SQ 1AS0A 4R2HA 5HZHA 2IS4A 4C2MH 3IFTA 2C9OA 3AKEA 3SFZA 4D82A 1TF7A 2REBA 1YITA 2BH2A 4Q48A 2AFHE 4DR7Q 3GTLH 2EQBA 2XSZD 3I7FA 3K0CA 3CC4A 2JLZA 3CC7A 2YC2C 3I4NH 4HAWA 3MWKA 4A2PA 3UXMA 2E1RA 3CLVA 2Z6KA 5IYCH 4PAOA 4QHYA 1NTGA 4KVAA 1ZAKA 4KSCA 3BGWA 1XMOQ 1G41A 1KSFX 4BECA 1HA3A 3EC1A 4POFA 3Q5DA 1YJNA 1KI9A 2JJ8A 4Q9IA 2OAP1 4JI4Q 4ZO4A 2RGDA 1UEBA 1OFHA 5FI1B 4H9GA 2YNMA 4HJAA 1A6XA 2IHFA 3RN5A 1Y8PB 3HOWH 3U7FB 1VS0A 2LXKA 2J0UB 4MKGA 2IUUA 1NG9A 3ZS9A 5FLMG 3O47A 4LHVA 2BEJA 4S2EA 3NDBB 3BH7A 4Q4HA 1EK0A 1FX0A 1N9WA 2QP4A 4WZBE 3K0CC 2WWHA 4LF8Q 2PI2E 2ZJYA 5A35A 1AKYA 1K5DA 2HLDD 1WDTA 3I8XA 4EQ5A 4A4DA 2Z6KC 2IT1A 1QVCA 2C8VA 2GESA 2QN6A 3STBD 2GDJA 4L8JA 4A3JG 3LO5A 3J7A5 2MMCA 3BBPA 5A4JA 4CIDA 4BFYA 1IBRA 4LC0A 3O8RA 4A3GG 1UJ2A 4XJXA 2Q0HA 4YWMA 3BFXA 5EE1A 4MGKR 5EP1A 5AWFC 4Y0AA 3X1ZA 4ZKDA 3RSLA 3CPWA 3G4SA 1HV8A 2R6FA 4LHXA 4AYTA 4A3IH 4JBXA 1SXJE 4OX9Q 4B3FX 1SR3A 1CTQA 2OQKA 5EZ6B 2VSXA 5IRCD 1R7RA 5LPNA 2VRWA 2P3SA 1FQJA 4FMDF 4NMMA 1D5CA 2DUDA 1R8SA 2P6NA 2PPBC 2Y0SG 4TMKA 5ELOA 2ZTEA 4QL3A 3I5XA 3D7MA 3N2IA 3K0EA 5EXXA 5CDFA 4C7OA 1I4LD 4A3CH 1HT2E 3FDIA 3B6YA 3EPKA 1NMXA 1VQ9A 3TEHB 3PIRA 3GJ0A 3VKHA 2I3BA 2F55A 3CXCA 4W7SA 3MUFA 2AK2A 1AJEA 2RHQB 2JASA 5LMUQ 1ZW6A 2OSBA 5AUNB 1IHUA 5GJBA 3SN6A 2D7DA 1R8QA 4LBVA 2RKOA 3TAUA 3VHLB 5KNCA 2IUSA 4A3EH 1U81A 1GILA 4L8GA 4M1KA 5J4HA 3TUJC 2BBTA 4GZLA 3PEWA 5A5GA 4OWXB 1US8A 2PH1A 4L9SA 1N8RC 3CUEF 4DWJA 1XCMA 5JEAJ 3KX2A 4RFVA 4JMPA 3LLUA 1SVLA 2ZI9A 1SXJD 4G0NA 4LJ5A 4C0SA 1G20E 1NKSA 3BOSA 4RCYA 4EPXA 5KDOA 1KAGA 4FIDA 1JI0A 2NO1A 1XNQQ 1QG4A 4QXAA 2RMKA 5CLLA 3WDNA 2ZI3A 1UE7A 3NG1A 3ZQ6A 3TSWA 4AKGA 2E75C 4P4UA 1E2VA 2UVQA 2ZU6A 4B3DA 2JA1A 4DR5Q 4OHYA 4JI6L 1Y63A 2QZ4A 5JCZA 3MWYW 3SR0A 2VHTA 3AP1A 3TJZA 3WMGA 5DLQC 2KCMA 3B8HA 1Z0DA 2NTYC 3CPEA 4GN4B 2A7QA 3J80i 2EXDA 2AFIE 3I32A 3SFVA 3KJOA 2ZQ5A 3VKGA 1YJWA 3F2BA 2R6DA 2VYFA 2ZE6A 4FWIB 5KHOC 5KUTA 1GKUB 1JJGA 1XJQA 1X9NA 5FUWA 5IWAL 4BLOA 4YC7A 3CCSA 3FPAA 1OH5A 3JZAA 4OJQA 1H8ED 4XIGS 1IW7D 1ONLA 2EU8A 1L0WA 5CIQA 4RD2A 3L2OB 4P4SA 1G18A 2GF0A 4PHHA 1EFCA 4WXRA 5LB2A 2BMEA 1IBLQ 1OKKA 2N78A 1FYCA 5C4XG 3CNLA 2YOHA 1EIFA 5B2ZA 5E7NA 1ZIOA 3GLFB 4TL8A 3LVQE 1KRSA 2REXB 2O8BB 1HNWL 3WP0A 1JQLB 3TREA 1TU3A 1WRBA 2RGCA 3UMSA 4RD1A 4C9BA 3GJ3A 2J3EA 1JAIA 2NZ8A 4A0RA 5HKKA 5KOYA 1CRQA 2FGJA 3REGA 2G88A 4TT3D 1N34Q 1ELOA 2VL6A 2ID0A 3PF4A 4D6PA 2QM8A 3P27A 4JVNA 4LHZA 2O8DB 1N2CE 3TW8B 4NONA 5TDHA 4DSNA 3X1XA 4B2LA 3MWJA 4PPFA 1YR9A 3C8UA 2YHSA 1PUJA 1SVIA 3CRMA 3NHAA 3QBVA 3LXXA 521PA 3C41J 3NIBA 3ICQB 4PZZA 2ERXA 4EQ6A 2CHGA 4MRPA 2XSZA 3I2ZA 3CCQA 2H57A 4BE7B 2CQOA 2GVDC 1M7HA 2IX0A 3CRRA 3JZMA 4KHPQ 1HTPA 2R65A 1MRNA 4CEJA 4TLEA 3AFPA 3S1QH 2QMHA 1H9KA 2Z83A 1XRJA 2ZYUX 1IJFA 1COWA 4ZKEA 1PH2A 4HLQB 4Q1BA 1AGRA 2D62A 1KMHA 2KWIA 3HOYG 2WJIA 1ZNXA 5CB8A 5C44H 4GOJA 2JA5G 2QA5A 1CKMA 3ZDQA 1N36L 3I55A 3U7HB 4GP7A 2W0MA 1TWAH 2JIZD 1Z6XA 3T35A 1WXQA 4A3DG 1IY0A 2ODBA 1N6NA 1CKNB 1W2GA 2W2VA 4UPAA 1CKOA 4M9QA 4BBSG 2ZE7A 4WOPA 2N49A 2HLDA 1YZTA 2AXNA 4C3HH 4OKSA 3GLHA 2PCJA 3DPUA 3Q7PA 2XB4A 3UPUA 3LNNA 4B76A 1PZNA 2GWHA 3GJ4A 3A7AB 1VF5C 2LKDA 4HIDA 1X86B 1ZD1A 5FOSA 4D4MA 1C4OA 3HU1A 4NHOA 4PZLA 3NKVA 2BV3A 2FFAA
chains in the Genus database with same CATH superfamily
1XLUA 2V6FA 5E6SA 1PZHA 1SOVA 4JHLA 3JQ9A 2JLBA 4HPJB 2Z95A 4A3FH 5SZHB 3BB4A 4G0PA 2QPLA 1WSBA 3KKLA 3OQMA 1PVDA 4IUPA 3VJRA 4B34A 3UJ7A 3NP8A 1MJGA 3VR6D 3KQNA 4ZU3A 3PHGA 1Z5NA 3L7CA 3BG5A 1SA0B 1E98A 4EY6A 1D2EA 2A9OA 4XDHA 1UOQA 5IT9L 1P4HA 2K5VA 4OQPA 4MQMA 5CFRA 4BX3A 4ENTA 1C9DB 1JQDA 1CP3A 4LF6L 3W2TA 3LC0A 4PGMA 1CKEA 2F3VA 1U80A 4Z4QA 5IFKA 3HZZA 1R9MA 4EG1A 4NJOA 2VHZA 3BXZA 2RB4A 5JNRA 2A2ZA 3IUPA 2IEZA 3IAS6 2Q46A 2NYAA 3DWIA 1W52X 4M0MA 3CHBD 2QW0X 1W47A 1FLVA 2M00A 3BWBA 4J3JA 1CF4A 1ZAYA 3B9BA 2A9KA 1FE8A 2OXTA 3FMOB 1CQXA 3B1JA 1UFQA 1GPBA 3HVJA 5JD5A 4ZMSA 4JI2B 4ZCLA 4DA6A 2LBPA 2F3SA 1TUGA 1Q19A 3EA4A 4YA6A 4LMQD 1ZUNA 2OECA 3S24A 3NIGB 4EIWA 3ZWOA 3SHVA 1F8YA 1KYZA 2ODEA 3S5UA 1F9RA 1L4GA 3TIIA 3PICA 2WYIA 2Q8TA 4K81B 1JIIA 3S2HH 1NR4A 4PYIA 3GCXA 1NF2A 1UPXA 4Q7KA 1NXTA 3CJRA 4LRYA 1CFZA 2F0TA 3N0VA 1I9GA 1VLMA 4BWVA 4CEIB 1VIAA 2BKEA 4FFBA 3Q11A 2H11A 1DM0B 1I1HA 4EITA 3NBYC 2G9ZA 3IOYA 3NI2A 2AG1A 1DTWA 3RC3A 4XDZA 1VHTA 4OL9A 3A6EA 4L1KA 2OTLA 1R6BX 3AYZB 4GS3A 2ALJA 4N9QA 3UVEA 1S6YA 3EE6A 1EUCA 1VPLA 1SHTX 1W48A 5HTOA 5TJ9A 4BVJA 4CV0A 4GOOD 4PTZA 3CQ9A 3OM9A 1REQB 1T1SA 4WJKB 4Q7QA 2G08A 1T8RA 4IRXA 2H2AA 5I2XA 3U3ZA 2JFYA 3AI3A 2HQOA 3EZYA 3L8YA 3NALA 3IBYA 3QFHA 1JLRA 2JFBA 4YQFA 4Y2VA 1KC8C 5T57A 3WB9A 1ZMRA 3WLOA 2O20A 2Q4EA 4HSEA 1CY4A 3QPBA 3BRQA 4XW2A 1WYDA 3JQAD 4I50F 4J4BA 1MOQA 2MR6A 5DTJA 3FB4A 1KWKA 1MF7A 2Z1MA 2QX6A 3MUEA 1PZFA 3JVDA 1RJ9B 1F8XA 2RHDA 2A5HA 2XDQB 4LVNA 3NC1C 5B6JA 2E48A 3GMDA 4MOWA 4M99A 4E4TA 2K52A 3FCCA 5H16A 4IPDA 2Z30A 3PUJA 4GE3A 1MJHA 4JJGA 1QPBA 4ER0A 4LRQA 1NMEA 4MMZB 2GK7A 3U1VA 4U7FA 4UXJA 3ZNPA 1HZJA 5C9ZA 1W3SA 2WM9B 3JX9A 1LDGA 1O6BA 2PMZE 1VKZA 3PVSA 2V7PA 5FQNA 1ZJWA 1WWKA 1U3GA 3BGDA 3ZWYA 4BCCA 1L5GB 5F77A 1KC1A 5CV5A 3BPSA 3J81L 5ECDA 3O5AA 5BNWA 2D8MA 2V3CC 4BNVA 3SMQA 1PK8A 3WIOA 3MTEA 3VPSA 3TLBA 1IUOA 3SR1A 4OV6B 3MBKA 4PYKA 4F04A 1C7QA 2ZJQA 4GVLA 4TXLA 1IVNA 2FWAA 1ZMBA 3ZTWA 3M9BA 1WP9A 2H1IA 3P9YA 3T7CA 4JV5B 4DDWA 5IDYA 2MHVA 1H0HA 2Y0SB 1P74A 1PV2A 2QVYX 1GA4A 4GXRA 1QCDA 4ZCKA 2NZHA 5JECA 4FF2A 5CVJA 1N2IA 2OV1A 1DXMA 4EPVA 1BH6A 2WUEA 4QTTB 4P4GA 3DXXA 2V6IA 3LXMA 3TK1A 3NHHA 3OHPA 4RK1A 2P6PA 3BEDA 3IPRA 1V26A 2CGEA 1BZYA 3BL5A 4D3YA 2X8LA 1X7XA 3T9EA 3HDYA 1YO6A 1MZVA 5DYTA 3V4ZA 2VYCA 4XVUA 1QFJA 1NF3A 3G02A 4DSUA 3OJEA 4QQNA 3SC2A 1TS5A 3W5UA 4I19A 1MR3F 3BFPA 4W5RA 2HLPA 5BOSA 1MIOB 1SULA 3CCLA 3OFNA 2P79A 3MJEA 1JL3A 1PS9A 5JARA 2C54A 1DJQA 3RSOA 3HHPA 2OSVA 5AM2A 1EU4A 2LVBA 3JYPA 3GAAA 5K6AC 3QEOA 2ZU0C 5LOVA 2GAAA 1R37A 1NVKA 2YR0A 4TLAA 3PDHA 1ZM4A 3OPVA 3GRFA 2Z8YA 2IXGA 5AOCA 4ETIA 3OEYA 3B53X 1XCPA 5EJMA 3NNDA 2Q5QA 3OQNA 4DCPA 2C9MA 4WY5A 5CEEA 4YPFA 3NPPA 1NUSA 2SCUA 1PWHA 4FDMA 3TCKA 1S40A 4EMUA 1YS9A 3UJAA 1NCVA 2XPCA 4UNPA 3VVBA 2Y4NA 5IZCC 4BRSA 4NMHA 5M34A 4MJLA 3ND9A 4Q9JA 4JAVC 1VBMA 1KPGA 5J4KA 1PR4A 2CZQA 3A14A 4RHTA 4G5GA 4JJIA 2PRYA 1EWIA 3C3DA 4I99A 4B81A 3ED5A 5SV2A 4WVFA 2B2UC 4AKEA 4K03A 3ED1A 1A9OA 4NSNA 4HN4B 4A3LH 4S1WA 4EQZA 2FW8A 3GGOA 2PY6A 3A6KA 2D1TA 1I3KA 3J81j 2FDCA 4ZQGA 2V6JA 5BSWA 1NY5A 4A0FA 1SQ6A 3D4OA 4D46A 1IMJA 4WECA 3RHSA 3E3OA 2UUBL 2SOBA 3HOWG 2YJ6A 1A7AA 2GZRA 1PTJA 1AO0A 2I1LA 1R74A 4XDXA 3B36A 1BFUA 4IDNA 1JB3A 1LZKA 1OI4A 1C0PA 2RGYA 1WCMH 4RG1A 2GKOA 4BP1A 5BNTA 1QBGA 5CVTA 1NXWA 4GH5A 3M70A 1X32A 4WLFA 1A82A 1DE0A 4AIRA 4NE7A 5DKFA 3SJUA 1ZK0A 1A8UA 5ICSA 1LQ2A 3HKCA 3EOAI 1LT3D 4PS0A 4PU0A 5LM3A 3WSVA 2FMUA 1K73C 3CF6R 4RHRA 4B7UA 4HRVA 4LI0A 2KHIA 4KIGA 1WTHA 2BHRA 1SN7A 3BGSA 3I04A 5EZ5A 2AEFA 2WLTA 1PRYA 3PKJA 4Q3OA 4CLOB 2ENWA 4DLVA 2YWRA 3RWBA 3T9CA 3DZJA 1HUNA 4N5IX 2DWPA 2HEGA 1G51A 2I03A 1ZSYA 4J0IA 4XLZA 2XNHA 4KN6A 3RRZA 4LFBQ 4C0XA 3RG2A 2EVBA 4RFLA 4RKQA 1EUQA 2RE8A 1WHTA 4WT7A 3PQEA 1P4AA 5FUBA 4RVDA 1J9ZA 1ULSA 2X19A 4U7JA 5DBHX 3W5SA 4NU6A 3KQOA 4C07A 2AZDA 4OHZA 1VHLA 4GLFA 4UOZA 4RSHA 9GPBA 3I01M 3WXBA 1PTOB 4J6EA 4OSOA 1ZRSA 2AL7A 2FSIA 2G17A 1KY5A 3G7LA 4LJ6A 4TKZA 4YUXA 3TTVA 2N3SA 4ENSA 5FBKA 2NU9A 1BMFA 3SQNA 3PC8C 3O3OB 3LYHA 3MFQA 4EAAA 4L16A 1BCRA 2J3JA 3WG9A 5B4TA 1Q7TA 1D8LA 3H09A 4R54A 2CLEB 3F3YA 4I4TF 3FYUA 4FKMA 4MQ4A 3CF4G 2PFGA 4NJMB 5EWJB 1WTOA 4X6UA 4IDPA 2G5PA 2Y66A 5BWCA 3D81A 4GKJL 3ABIA 1KJ9A 5GJCA 5A9RA 2FY8A 2WKSA 3S7ZA 1K8MA 3SZUA 3TQYA 1KH3A 4ZEXA 1M7GA 2J08A 4MRRA 4X6LA 3VR3D 4FDAA 4RK0A 1ZNZA 4MV8A 4MEJA 4KYIB 3OD1A 2G28A 3NUGA 2Z9HA 1T6ZA 1D7OA 3AEKB 1BKSB 2PU7A 2WJJA 2QD5A 1OH6A 1SJHD 2YJ3A 1P3Y1 4P3PA 1US8B 2Q50A 2CFCA 2ZIFA 4HZUA 4D8UA 1X38A 2C3MA 3QVJA 1QAQA 4JBJA 4JT8A 2YCLA 3PB3A 1GITA 4K86A 2AN3A 5AD1A 3VDYA 3NEYA 1YZNA 2Y1WA 4F84A 1WR8A 2NWQA 4KQHA 4V1CI 3RVLA 2H4YA 1DOLA 1E60A 4F3CA 4UAIA 1OX5A 1Z0JA 4IDHA 3ROFA 2AG6A 4QGSA 5FHQA 2AX3A 4R51A 4KUEA 3KFUA 1E3WB 3P9RA 4GXNA 2P77A 4X66L 1KFBB 1EBFA 4B3MQ 4G41A 5FUVA 3ORYA 1VF7A 3CCEA 4XASA 1NXQA 4CEJB 1N8KA 2HCJB 4E13A 2Q2OA 1FB5A 3EEQA 1KI3A 3AJ9A 2O50A 3CW2C 3E9DA 1ITZA 3DMTC 4BP9A 4X6YA 5JC1A 4NV1A 5IZ4A 2ZYDA 3I6YA 4OAQA 4D3DA 1QZHA 4FX2A 2QE7D 3R0QA 4G7ZC 2JBWA 4C03A 1EUYA 4K8JA 2PUJA 1J8QA 5BN5B 3IAYA 2YWFA 4OI1A 1Y1WG 2KE5A 3FOEC 2ZM6Q 2XUAA 4JI7L 4J1NA 4GLXA 1ZSNA 2D74A 2TMGA 4W9MC 3N39C 4BXXH 3GUCA 4YCJA 2Y2VA 5KYYA 3QBTA 2FZWA 3H4TA 1A0IA 3BDCA 5ALDA 4R8KA 5GJVC 1S96A 4DR7B 4L8VA 3THSA 1XMOB 1X55A 4AECA 2QVLA 3KAKA 3W5CA 5IEJA 4QA9A 4O3MA 3KB2A 2ORWA 3JVVA 1IZ7A 5JMTA 1G20B 2GZ2A 3MINA 2QR5A 2VF4X 4WUTA 3P9XA 2Z08A 1KJZA 3A9VA 3RANA 3D4LA 2JA5B 4J76A 3AZOA 3MTGA 1RKBA 3TWOA 4S24A 4HQKA 3OCJA 1FDUA 3LP6A 4GLBA 3A1DA 3CN7A 1FLNA 3WGQA 2NX2A 2W83A 2R60A 1G5IA 2M6RA 2OQVA 4I1UA 3PC4A 1HQMC 1U2EA 2ECPA 4MVJE 3R93A 3FMPB 5COBA 1TA4A 5EVJA 3CRZA 4C2MB 5EPEA 1XNQB 1RJGA 3H2KA 2K28A 5FLXA 4WHMA 5I9SA 3F8WA 4XT1B 3KOZA 1KDVA 1T9GR 4HTFB 3B9PA 4PZEA 1T1EA 5KMGB 3RADC 2KHSA 3PSHA 2C95A 1KIMA 2IYXA 3IJ5A 3FPSA 1PHPA 4BX2A 4BZQA 4I9HA 2VPYA 1W9HA 4PR0A 5LQUA 3CTMA 2XUOA 4GO1A 2OCGA 4QRHA 1PTOH 1RCFA 4AN4A 3JQCA 1P7WA 3GO5A 2COKA 2ZZKA 3HBLA 4J43A 2HK7A 4KHPB 1I8TA 5EXEA 4OQXA 1QS0A 3PRKE 3CBQA 3CX4A 1XXHB 3UW1A 5C0XJ 3DMPA 2I71A 3E7FA 3NBAA 4QELA 3E9IA 5PNTA 1MEOA 4JI5L 3LKVA 4ZUIA 5T1GA 1JEQB 1WD5A 2CXNA 3WB2A 2HF2A 4MI1A 4FBMA 4J3FA 3B6IA 3QLVA 4XQCA 1Y8QB 4EVSA 2WWTA 2GXUA 1T43A 2FPUA 4D96A 4G4SO 4D9KA 3LPNA 4CDEC 3NORA 1MABA 1RLMA 1B8OA 1LJLA 2HMUA 3UHJA 2J9FB 3CZMA 3ZEAA 1BS1A 4Y0VA 4HQLA 3EDRA 4FSDA 1YVDA 2P67A 1EJ6A 3D4RA 1QHHB 5BWNA 2V03A 3TTXA 3F1LA 3LX0A 2C1XA 5K0TA 4ASUA 4F8JA 3EVBA 3VU3A 2D00A 2JE6I 1BVHA 1E8NA 3CO5A 1GVNB 1Z4PX 1TWAB 4L9WA 4Q4JB 2R1TA 2C31A 2RDFA 1PBTA 2QZ9A 3GRAA 2GT1A 3FFAA 3EUAA 1GQ2A 3RLFA 4PHCA 5A4DA 1UZAA 1J8YF 2NVUB 4EG7A 4UEOA 4ESOA 3DE3X 5IOCA 1LVUA 4M49A 4FN4A 5E7MA 3EGVA 2Q4DA 1SCIA 3ONWA 4REQA 3N0TA 2C7RA 3M4XA 1JAYA 5EFZA 4K6FA 3HFJA 1PKEA 3G89A 5IKXA 2IIPA 3PQIA 1P81A 2PO4A 2O23A 2Y0BA 4MR7B 4R81A 5TMBA 4J6FA 1Q0UA 4QJFA 3PTAA 1GGVA 3EGXB 4U6NA 1IXRC 1BEEA 2BFAA 3FGNA 5J63A 3LDUA 4HFJA 3IKJA 4CQJA 1LK0A 1F2UB 4MCJA 3JPWA 3CP0A 2FPSA 3DLCA 1TTTA 2SKDA 2JRLA 2IPAB 3I9OA 1DT5A 2H5XA 1KXZA 4DW8A 3B89A 4ZYZA 4PC7A 2C4WA 1T4DA 5LZ4A 4X1YB 1ZNWA 2B6NA 3H8JA 4EMTA 2BJHA 4F9FA 2H59A 3NHYA 2JBHA 3BWVA 2QI9C 4TVKA 4UC0A 4OIFA 1CY2A 3DL2A 3NCTA 5LQAA 1AE1A 2HPZA 2AR0A 5GROA 2AZ4A 2C7BA 3VR2D 4MP3A 3ZY2A 5K3FB 5GZ3A 4P71A 3C5CA 3U5ZB 2R6GA 5I7UA 2FWBA 3KIPA 4BB5A 2O2YA 3KQYA 2HJWA 1G8FA 2IH5A 4EI7A 1Y6ZA 3RFCA 1WB9A 2UZ0A 5KWVA 3CZCA 1GYRA 1K4KA 3OJXA 5KNBH 2ZJZA 4PVCA 1PE0A 2FN8A 2Z6AA 4IXDA 3M3HA 1X70A 1V1PA 3EHDA 3DFFA 1ZN9A 3FZGA 5D3IB 2IYLD 1HR0L 3FPHA 1MQSA 4K5QA 4HWGA 2UXBL 3UJPA 1VQIA 4BASA 4LWCA 3ZKWA 4GQBA 1U7PA 3KXKA 4QEZA 1IYJB 1G291 1KK3A 1NASA 2IXEA 8ADHA 1YC5A 4RTSA 1XRMA 2F0UA 3QXXA 4H6XA 4A76A 3UCXA 1V1RA 2QB5A 1Z37A 3DQQA 4Q4AA 1D07A 4C2MH 3I4CA 2A1TR 3ZXUB 5KWSA 4O2BB 1O6ZA 1LSJA 3UXMA 3CLVA 4MQLA 2ZUSA 3RYHB 3PHCA 4B6SA 5B37A 1OFHA 2OGSA 1Y8PB 3DHVA 1VS0A 1C8LA 2ZIGA 3SR4A 1UP6A 4U673 4WZBE 1YJ8A 3RBAA 2A59A 4FJ1A 2GDJA 5JCOC 2RAVA 4M38A 3X1ZA 1RBMA 4HEQA 2Q6KA 2R6FA 5EZ6B 1VE1A 4NMMA 2P6NA 1WO8A 4C7OA 2C97A 4BVLA 4NS1A 4LRSB 2G71A 5KCZA 3D6JA 3G0CA 1QVWA 3PQDA 3D64A 3P96A 3AL0C 4MINA 4MRMA 3MTJA 2K05A 3AUTA 4F2WA 1PR0A 3CUEF 4FDLA 5BUQA 2UDPA 2DBQA 1S02A 1CUSA 1UE7A 3HA5A 4IGFA 4N5MA 3L7AA 5CVUA 2UVQA 3FG9A 1ULTA 3TW0A 3I32A 4D42A 4QFBA 1PI3A 3NHZA 3DTVB 4EQNA 5FEMA 3D6WA 4A0RA 1X1QA 3DE0X 4JVNA 4U7TB 4E3WA 4I4NA 3S17B 4CF5A 1Y4SA 4ZYLA 3SF8B 4BDTA 5I7WA 1YB1A 2VQ6A 4NQRA 5KTKA 3TLMA 4JI3B 1BCPF 3S6JA 4MB6A 4B7ZA 1A7KA 1OA1A 7MHTA 1TWAH 4EO4A 1ESRA 3A9CA 2E2JB 4DUYB 1KKUA 1CD5A 3RSSA 2FMIA 5EKXA 3QUBA 1RHQA 4D4MA 4JK3A 1IM8A 4KXVA 1I32A 1JH8A 5C46F 4FR5A 4RL4A 3L7OA 1UADA 2O05A 5HVNA 1EXVA 1JTFA 2WAAA 3ESZA 3UOAB 1T4MA 4KN5A 4JXXA 1S2MA 1OIVA 1MX5A 2QTVA 1ICWA 2NVTB 4P7KA 3OIVA 4X8OA 3F78A 3SJBA 3HJNA 2ZRBA 2J30A 2R61A 2NZ2A 2W42A 1QP8A 4DJAA 4R2LA 5AJYA 3NTXA 3CNHA 2IYYA 1ZU5A 4DCMA 1W25A 4FI3C 1YCFA 3PR1A 2GOYA 1A97A 2O5VA 2FMKA 5DYNA 2R7ZG 1FD7D 2NZ1D 1YVRA 3FKQA 4ZPJA 3QTTA 2X5NA 1WPQA 1LY1A 3UAGA 1P1IA 1LSUA 1P39A 4TZ0A 1VE3A 4DFAA 3PWZA 2NLOA 4N7BA 4KV7A 4K9MA 1JV2B 5JD6A 2AMJA 2JD1A 4FUTA 3GDWA 4NLLA 4KN9S 3W3ZB 2VF7A 4EW2A 5BMOA 4HY3A 2DHCA 2O7VA 2REOA 1JIXA 1N6LA 3RVNA 1W88A 3KM0A 3DCNA 1WXWA 2QYTA 4CM6A 1V8FA 3I1FA 4CF4A 4ME3A 3ZZMA 2C9DA 1TJ4A 1MDBA 5TPZA 3KFVA 4X8HA 3OZGA 1O5OA 3SBXA 1TQ2A 2IXAA 3M7IA 1FP4A 2BGTA 5BQPA 2J09A 3B8EA 1YQTA 4H7HA 1K5PA 3JRXA 2QVCA 3JWHA 2Z5FA 4DCVA 2HXGA 5AJZA 1Z39A 1QO7A 4FD2A 2GF9A 4KWCA 2XAUA 1DXYA 1UC8A 2JD0A 1H69A 2XVSA 1P7CA 1L0YB 4PYMA 1EA5A 3IEMA 4RL6A 2F4VB 2DY0A 3ZOKA 2A7XA 5K2OA 2WMNB 4O4IF 1BFKA 1ORHA 4RLHA 1XMXA 1DG9A 4RGOS 4FIZA 4KNYA 2ZTMA 1VQ6A 2GRAA 2X5JO 1MV8A 1X77A 4CMEC 1Q1BA 1MSHA 2AOVA 3PT9A 3C15C 3EQ9A 2FP3A 4NRDA 2PQAA 5DE3A 1NVUQ 2GEVA 2JA9A 4DK1A 4UUOA 4NPHA 2VYNA 1K9VF 1W0CA 3EVGA 4N9TA 3DBRB 4JLKA 4EFKA 2DNCA 4IJVA 3P0RA 3LRPA 5HQJA 3ZV7A 4R7GA 5AHXA 1UC4B 3W5AA 1A63A 4C2AA 2JAHA 2F0SA 4LV6A 5JLJA 2P1ZA 1N5MA 3PXGA 2AOTB 3PZRA 4K5VA 4WMLA 5FWAA 4MQEA 1Z38A 2XNAC 4Q6BA 4OO1H 2ASEA 5HMLA 2PR7A