1V45E

Crystal structure of human pnp complexed with 3-deoxyguanosine
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
288
structure length
288
Chain Sequence
ENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human PNP complexed with ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
total genus 85
structure length 288
sequence length 288
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1v45E00
1ODKA 4GLJA 1SQ6A 4KN5A 1U1CA 1Y1QA 5F7XA 1YR3A 1K27A 1V41E 4M1EA 2AI2A 1PK9A 4ECEA 4D98A 4F3KA 4K6OA 4TXJA 1A9RA 4WKOA 3ODGA 1PR5A 1SD1A 1SJ9A 2Q7OE 1A9TA 4MARA 1Z35A 4TXMA 1Y6RA 3P0FA 4DABA 3KU4A 1K3FA 3O6VA 4PR3A 4OGLA 4YO8A 4D8YA 2QTTA 4G41A 1Z36A 1JDZA 4P54A 1T8RA 5F7OA 4BN0A 1PR2A 1YRYE 2OECA 1VMKA 4JOSA 1ODJA 1PW7A 5EFOA 1RXSA 3DPSA 2HWUA 4OGKA 1U1FA 1Z33A 4NY1A 4F3CA 4R31A 4EARA 5IU6A 1XE3A 1A9OA 4TS3A 1JE1A 1PR4A 1T8WA 3BL6A 3OCCA 3E9RA 4L5YA 4QFBA 2A0XA 3FOWA 2A0YA 4QAQA 1NC1A 3DDOA 2PGAA 1OTXA 1ODIA 1OVGA 2OC9A 4DANA 1JYSA 4TXNA 4QASA 1JPVA 1NC3A 1JP7A 2I8AA 4FFSA 1FXUA 4NS1A 3IEXA 4BMYA 4PNPA 2HSWA 4L5CA 2OC4A 4F2WA 2RJ3A 4DAEA 1JDTA 1Y1TA 1YQUA 4TS9A 5CXSA 1ODLA 5B7PA 3C74A 3OZDA 1RXUA 1V3QE 5ETJA 1PR6A 4OY3A 5CXQA 1Z37A 4DAOA 3T94A 5EUBA 5CYFA 3K8QA 3FNQA 4DA8A 2A8YA 4QEZA 5B7NA 4MCHA 4QARA 1OU4A 4IP0A 4WKCA 3BSFA 1PBNA 1Z34A 4L5AA 4TTIA 5F77A 2HRDA 3NM6B 1V45E 3EUEA 3OZCA 1C3XA 4LNAA 1T0UA 4BMZA 5F7JA 1A69A 1Z5PA 4D8VA 5JPCA 1OTYA 4LDNA 4L0MA 4DARA 1SD2A 4GMHA 3INYA 2QTGA 3LA8A 3UAVA 3NM4A 2HN9A 3KHSA 3P0EA 4WKBA 4L6IA 1WTAA 3MMSA 1PR1A 3UAYA 1PKEA 1JDVA 4OJTA 4BMXA 4WKPA 1VHWA 5CCEA 4F2PA 2ON6A 1PF7E 1PR0A 1RFGE 2OXFA 3GB9A 1Z5NA 4TTAA 3E9ZA 4DA0A 4TTJA 1RXYA 3UAWA 3TL6A 4LZWA 4UC0A 3DF9A 3KVVA 1T8SA 3BJEA 3FAZA 4DA6A 3FUCA 3OF3A 3KVRA 4EB8A 1I80A 2QSUA 4G89A 1CB0A 1U1EA 2IQ5A 1Y1RA 1PK7A 2B94A 1A9QA 5EPUA 4TYMA 3KVYA 5CCDA 3K8OE 2I4TA 5DK6A 4YJKA 3D1VA 1NW4A 1N3IA 3BGSA 3EMVA 1ZOSA 3DJFA 1YQQA 1B8OA 5F7ZA 1Y6QA 3PHBE 4TXHA 2AI1A 2A0WA 4R2XA 2XRFA 1ULAA 4D9HA 1V4NA 1G2OA 1A9PA 3SCZA 5C80A 2QPLA 5B7QA 3OZEA 1JDUA 1B8NA 1U1GA 3KUKA 4I2VA 5F76A 3GGSA 4LKRA 3O4VA 1CG6A 1RT9A 3PNSA 5K1ZA 5CYGA 4WKNA 4X24A 1VFNA 3OPVA 5F73A 4GLFA 3UAXA 3QPBA 1OUMA 1ULBA 2AI3A 3UT6A 4LNHA 5F78A 4JP5A 1Z38A 4YNBA 3EEIA 4YMLA 5I3CA 1RR6A 1LX7A 2GUWA 4DA7A 4NSNA 3UAZA 1QE5A 1RXCA 1K9SA 3OOEA 1V48A 1TGVA 3LBAA 1PWYE 4M3NA 1JE0A 1Z39A 1RYZA 4QATA 5B7GA 3FWPA 1T8YA 2AC7A 1OV6A 2H8GA 3LGSA 3OOHA 1Q1GA 2BSXA 3E0QA 5IFKA 1TCUA 4D8XA 3OZBA 4M7WA 1U1DA 3IOMA 1ECPA 1ZL2A 4G8JA 1TGYA 3PHCA 4GKAA 1YBFA 3ENZA 1TCVA 1M73E 3F8WA 1LV8A 1RCTE 4RJ2A 4H1TA 1Y1SA 2QDKA 3DP9A 4OF4A 4OEHA 1LVUA 1RSZA 4F1WA 3NBQA 2P4SA 2ISCA 1V2HE 4JWTA 1A9SA 1JDSA 3MB8A 1Z5OA 4E1VA 4TXLA 1TD1A 3FB1A 5KB3A 3EUFA 5FAKA 1VHJA 4U2KA 3U40A 3NM5A 4MCIA 3PNPA 4R2WA 3ONVA
chains in the Genus database with same CATH superfamily
2VPWA 1XZNA 2CDCA 4JYPA 1C50A 3C6QA 3HN7A 5AM0A 2IXDA 1YNSA 4Z3OA 1F2VA 2OR3A 5JZSA 4W8HA 2Y0CA 1OB5A 2OV1A 2HQSA 2VYQA 3U16A 4BFVA 4OHUA 5D85A 5JNUA 3QOYA 2CXXA 5DLDA 3KWLA 4UCQA 4OKSA 1CT9A 2C42A 3THRA 4F3KA 5JLJA 1QGYA 5JNVA 4IUBS 3CXUA 2QBYB 3GWZA 2X2EA 2JI8A 3GLGA 5A9SB 3BIXA 1NBIA 3LC7O 1MGOA 1UBMS 4ZVQA 3WLNA 1QGAA 2GZ3A 2B7BA 1XJCA 4U0KA 4TWZA 5ALNA 2YWJA 5FTLA 3M1AA 3NMUF 4OGLA 1CZHA 4WLNA 4EQ6B 3SI7A 4JUAA 4QDJA 3ITKA 1YR7A 3DDHA 4ECAA 1YS2X 2EARA 4GX1A 3TXYA 2ZULA 1ECGA 1X1BA 1R9NA 1P7YA 4KO3S 1JEOA 4RK5A 2PRZA 4XDGA 1VGQA 1PR2A 2FZCA 3FCEA 4H59A 3M4NA 4N8EA 3FYSA 3Q3HA 4G5FA 3I04M 1X2BA 4FYVA 4JGIA 4MW4A 1PFQA 1VMKA 1YACA 3K20A 4GP7A 5FIUA 3VV3A 5EFOA 1CRWG 4IF4A 1KP3A 3ZHQA 3GJ7A 3DPSA 1EP9A 4MUGA 1YT5A 2Q29A 4Y9UA 3WA6A 3X3HA 4RX1A 3ZW8A 4MPJA 3IVAA 2Q2WA 2G1KA 4G4SO 4HGZA 3T9EA 3F3KA 5K3AA 1EK2A 3MQFA 3SHFA 5J4YA 2VQDA 4H7IA 1MJFA 2CYBA 2CE2X 4IOKA 2CDAA 5DM4A 2F55A 3BUSA 2FQYA 3ONNA 5JADA 2BMDA 3ABQB 3MLEA 1ZUWA 3SNHA 2QBYA 1XXHA 4ZYZA 2Z5FA 1MUUA 4Y1EA 3A2MA 1IEXA 2FNAA 1MZVA 2H2FA 3O9ZA 4IKOA 4TV8B 3S2ZA 3VNUA 2WF6A 1MAHA 4MW9A 2OPHA 4C04A 1DTWA 4LTNA 3V1TC 2PU7A 5DGDA 5J1SB 4B35A 1M8JA 2A0YA 2I6XA 4O4IB 2FSVC 5CW2A 3HN6A 5KCMA 3VZSA 3GVHA 2W6PA 3EDQA 2VHWA 3E9YA 3JQPA 3P2IA 4Y2GA 3LUFA 3AU8A 4PQEA 4DLTA 2RGGA 2VAXA 1EVQA 4FUQA 3AUXA 3OTQA 2QPOA 3RS5A 1TKRA 4YYZA 4PTLA 3ROGA 2O5CA 4RWEA 1D1QA 1ORHA 2DXIA 1AS2A 1WUKS 2YQ5A 1XZHA 4NS1A 2QRZA 4HSGA 4QGBA 3IB6A 3NH6A 3EFOB 4ZHSA 5JXIA 1KQ3A 2D2IA 2WPDA 1GQFA 3HM2A 4JV5B 1ZCAA 3EF3A 1GV1A 4C7VA 1EA5A 5TVKA 1K7EB 2PZEA 3TB4A 4IDCA 3PVCA 5BN4B 1QIFA 1WF6A 1XVIA 3PC6A 5U1PA 1DDGA 3RE1A 1Z82A 3GNQA 2YMLA 3VNBA 4BEBA 1JS1X 3USES 4YP0A 2X76A 3QOFA 1ODCA 2JEZA 1QH0A 4RE6A 3VPSA 3QJ5A 1QIEA 1XSEA 1DJQA 4D4HA 5H4HA 5C31A 3E3LA 5IAJA 3TG8A 4UEKA 2GZ1A 2YINC 3K8QA 3HGMA 1KO8A 4QTUB 3TCNA 3U4MA 1XGKA 4AUKA 3DO8A 4LHVA 1U28A 4R9VA 5EXTA 1KORA 5A5GA 4DBZA 1YRWA 1SB8A 3AOEC 5F1OA 4EG5A 5BP7A 3A14A 5CJPA 3OOWA 2W0MA 4B6OA 2PS1A 3ENQA 1UT5A 3BOSA 4DDHA 5CBPA 4XKJA 5ED0A 2I2FA 1AF4A 1OI2A 1SXJA 2BCGY 2PYDA 4KQCA 4YGYA 3UVEA 4AJIA 2ZIZA 2YS6A 4C4SA 2NYVA 3F0TA 1Q7EA 4U2BA 4ZRNA 2DUMA 1N2CB 1PBNA 2H5EA 4Q02A 4UEWA 2DHCA 2BBSA 2CBXA 3MCTA 3DDZX 4F7WA 4YR9A 1AA6A 2X9VA 1M0EA 3PPYA 4GRIA 3I39X 4PIMA 5HS6A 1IFXA 3KOZA 5BW4A 1OI7A 1DG3A 2G76A 4PYIA 3I0MA 1DQPA 1A8QA 5JRJA 1IOLA 3COSA 2FGKA 3OWXA 5HRCA 3PC7A 1JG1A 3E58A 4TL7A 5JCJA 4UXJA 3EBOA 3D31A 3HS3A 3UATA 4LDNA 3O3CA 3EXHB 1BMFD 3IDSA 1W7AA 1L7AA 1N3BA 2K6GA 2G72A 3CVOA 5L3QA 4DLZA 3AFGA 2XDQA 4L76A 4ZAZA 3UB3A 6REQB 4CETA 5EL0A 4O0LA 1SXPA 5JXHA 3K72B 1U3WA 3QKTA 1XF9A 2ZQYA 4LSZA 5DNAA 3PE4A 4O2BF 2DCUA 1KDOA 2FJUA 3I4LA 3L7IA 2HD4A 3PD7A 5TQ0A 1DEKA 2ONKA 4GC9A 3NPMA 3P1JA 4UHHA 4MEBA 2E48A 3RNOA 1WZUA 3MGAA 4R0MA 1GSOA 4CTNA 4BP9A 3BJRA 3O82A 2Z95A 1RRFA 1NIPA 3LWNA 4XWWA 1G59A 3I6QA 5EHNA 4CT0A 3A3PA 2IUYA 4RPIA 2VDQB 3O9MA 4NYJQ 5C8YF 3U7JA 1H8HD 1HFKA 2PM8A 5K0LA 4UM8B 4WWHA 2AOTA 4ALNA 1E2JA 2RAVA 4JNKA 4FB4A 2GD6A 3BH7A 3CKYA 4ZKDA 4KUHA 1GSIA 5HZGA 3ZWQA 4ARAA 3FVRA 1Z5NA 3DEKA 1QZTA 1YBAA 1H2WA 4AXBA 1NJ2A 3K0HA 3WGUA 5HM6A 1T2UA 3OAAD 5F3DA 3F6RA 2C29D 3KV1A 3O3MB 5GZ1A 2JZNA 2ZW9A 3U3OA 1KYWA 1KFJB 2H9IA 4PE5B 4XX0A 3RHFA 4C6RA 3AVWA 5DBFA 3PCTA 4J6FA 4QDOA 5CLQA 1RD4A 1R4AA 1M6VB 1E9CA 3G9ZA 4RSGA 3ZVNA 1WQ1R 4BNTA 1Y89A 1Z8DA 3LDFA 2RC5A 1XLTC 3B6KA 5C3UA 5CNMA 4E12A 2OCLA 5LB2A 2ZRAA 4WZAA 4HN9A 4DSOA 3S81A 1T1SA 1HRKA 3VVCA 2AYYA 4QYTA 5BYJA 1EUYA 3A9SA 3G0HA 1ATIA 3K9NA 3ORRA 2FUKA 3OWHA 1DAEA 2ECPA 5BR4A 2W2PA 3EFBA 2TMDA 3BWEA 2YWHA 1TLFA 3C0KA 3OF3A 4LZJA 3OLZA 4KVZA 4O29A 2NPFA 5DASA 3M3DA 3KVRA 2P9JA 5JG7A 1Y8QA 1QP7A 4HG2A 1I80A 5KQLA 1FYXA 1AQIA 1H6CA 1L1RA 3EJ6A 5B3AA 1T4DA 1ESNA 3NP9A 2E4ZA 3ZDBA 1GRQA 4KXNA 4G1FA 3W1EA 5K8LA 5AKGA 2CLKB 3NYQA 1TF7A 4A2PA 3DFZA 1ZQ1A 4TM7A 5A6VA 3EWSA 4IIJF 2IUEA 3MCUA 2I4TA 4ANFA 1NMXA 2GZRA 3HSSA 1RE0A 1YCHA 5KO2A 3PDIB 1JL3A 1SCAA 2D2VA 2R6GA 3RYHB 1RI2A 2O52A 3H11A 3OHPA 2QLJA 4HWGA 4ICIA 4MH0R 3CUVA 1ZBDA 3OD5A 3V1UA 5DZSA 2WBLC 2XXBA 1VZ2A 2FMTA 4ZCTA 4ZI7F 3C24A 2XUKA 5JSZB 1J1IA 4TM8A 4P3XA 1A7KA 3OPXA 4Q7QA 3LNCA 1YE8A 4RA6A 4E31A 4OLJA 4B34A 1B8OA 3F8SA 2IVZA 4B7XA 4DNOA 5AIBA 1QYIA 3FIJA 3R41A 3W78A 3JD1A 3RRBA 1X70A 5CNJA 4X8MA 5C8XA 4WCFA 2D2XA 1OGYA 3F4BA 4F21A 1A76A 4AS1A 2G8NA 1ND6A 4M76B 2J7KA 2WTMA 2ZT8A 2N3ZA 5EZYA 2D1TA 1QORA 2MYPA 3TDKA 4LWOA 1P62B 3UWOA 1P19A 1Q0HA 4QBTA 1TI7A 4JLNA 1Y8QB 4Q3BA 4MWEA 2BDTA 2QYHA 4D9HA 4A8JB 2AYZA 3QY0A 5LQNA 4PZZA 5JISA 4H1HA 4C7BA 4F4FA 5C81A 3HKDA 1MORA 2ZI4A 1GPUA 3KPYA 2IEBA 2VI5A 3GT3A 3RAJA 1MX9A 3L0YA 3BK1A 3C98A 4NVRA 1DKPA 4A2WA 3LGXA 1F4LA 2YCBA 4QD3A 1SULA 3KDSE 1ZH8A 1U9JA 2O8DB 4J2HA 1D1SA 5IUKC 5K8IA 1W0KA 1I7DA 3KXLA 2PX2A 3BAFA 1RZVA 4EGQA 1D8AA 1XD2A 4G5RA 4Y1FA 2WFLB 2J85A 2Q1UA 1CUZA 1Q15A 3U4AA 4MR8A 4Z0NA 4ZEXA 1HE3A 1QOZA 3G9TA 3VYSB 3UHOA 4GLFA 1UBSB 5CDGA 1G6HA 1GLNA 2XQJA 3IQXA 3AEQB 1ESEA 4C7KA 2PUAA 4RESA 4Y6OA 4B2IA 3Q87B 4FYXA 1K7YA 2GSDA 3EEBA 5JMOA 1OR8A 2JGKA 2Q6TA 1FA9A 2L82A 1SC6A 5CLHA 2E6UX 1XT6A 1NTRA 2VYND 3KQUA 3OFND 1C9JA 4LCJA 2GEDA 1EUCA 2DFKB 3DMYA 2ID4A 3KXPA 1N5OX 1GCOA 3K9WA 1HI9A 4D9CA 4FFLA 2F9LA 2IEZA 4PSDA 3K96A 4WVLA 4HJXA 3HCEA 4KK4A 3WK7A 3NHYA 4UNSA 4LRQA 1CUHA 1ULHA 2P0AA 2WJYA 2FGJA 2GDJA 5IULC 1J2RA 4TV8F 5DHFA 3O21A 5CA0B 5KOHB 3O8QB 2O14A 3CF0A 3MCZA 4R9SA 5KHAA 4B6FA 5CITA 2IHVA 4FYWA 2N9UA 1MTZA 4FFPA 1HDGO 2IHKA 2WOOA 2ZJYA 3DTTA 2NXNA 4I50A 4MV8A 1EP2B 4NU0A 2HYIC 1NOIA 3Q8MA 3CRVA 3M1LA 2O2DA 4JYMA 3VYUB 2HLDA 1ELOA 1R4NA 4NSNA 5HA5A 1BZYA 3FCYA 1RYMA 1T4GA 4UMFA 4BX2A 5A2QA 4J16A 2K5UA 4BO8A 1OXKB 1RBYA 1HG1A 1MN6A 3GEGA 4XSGA 2O8EA 4ZODA 1DFGA 1DI0A 4PG7A 3R7BA 2W9XA 3I4CA 1TKBA 3QOWA 4JUDX 4TSKA 3O4IA 1XVLA 4MUYA 2WT9A 1P7VA 2GA8A 1TO1E 2DP4E 2ZYRA 4MVJD 3H5WA 5ERYA 2QAGC 4DWJA 4V1CB 2C2KA 2WV9A 1K98A 1RYZA 1BQ3A 1YJAA 2IC5A 2JANA 4PIVA 4RTPA 5EWLA 3A1FA 3FBTA 3VPDA 4IJVA 2F43B 4CM4B 1X86B 2JAWA 4XD7A 2OPBA 5CG2A 3BRSA 3OETA 2RJNA 4DIOA 1NVBA 1SC3A 4TT8A 4L85A 1N2CA 2O1WA 3ME5A 5FI5A 3IH5A 3C3XA 5IFKA 3H9CA 1T3LA 1YJXA 2AK2A 1Y42X 4DMGA 2MDTA 1E6UA 3DB2A 4P36A 2DBYA 2FWJA 3K0AB 3QMWA 1S2LA 4J0DA 3GMTA 2YZKA 4H1UA 3E7PA 4Y2UA 2DZDA 3IOMA 3MWGA 3H2YA 4OIFA 3AL2A 3Q0EA 4BNNA 4S1NA 4E5YA 3C3YA 2A86A 3EXIB 3CLSC 2JKYA 2H51A 1CQWA 5LC1A 3K2IA 3C1AA 3O1JC 1UBJS 1YB4A 1ZM7A 3LCRA 1BMTA 5BUCA 3A2KA 4PC3A 3DD5A 1Z68A 1PZEA 1QHSA 2IZ5A 2QRHA 4TLBA 3WOVA 1PZXA 4L8GA 1U1IA 1JECA 1SR8A 3WHIA 4HDMB 1RWOA 2FMXA 2WWIA 4IIEA 4MB0A 4B0OA 2UYCA 1B8VA 1E1DA 2LTAA 2N0SA 2WPNA 1J20A 4GO1A 5CNKA 1KOFA 3VPBA 2X4DA 1GEEA 3I01M 3ZDDA 1UKBA 4LOJA 1QHGA 3SIWA 3EQ8A 4PG8A 1U7HA 3OCVA 1W46A 5A9TA 3ZV5A 4DCTA 5AUQA 4BMSA 1S8AA 3RFVA 2NVOA 2GCOA 3TQIA 4LJYA 4YFVA 4L8FA 1G3RA 1NN3A 1O9GA 5JSZA 1JW9B 4KQ6A 1M1YB 3K32A 4Z9YA 3RH0A 5LU8A 4I3GA 16PKA 1RRPA 3UMGA 4BLVA 4DNFA 1YK1A 5B5SA 2E1RA 4BKOA 2IGTA 1X80B 2GFQA 4R3NA 5HQJA 4EHBA 2ZSBA 1JLLA 5A3RA 4PLPA 4HGQA 5U4XA 2C7GA 1CP3A 1CUFA 2JPDA 2R6ZA 2VZEA 3EY9A 4P53A 3BTUA 4X5OA 4JN6B 2KX7A 1Z0UA 4YMWA 4E1VA 3WJAA 3HKCB 2FRDC 2GNOA 4KQGA 2OBMA 5KEIA 1UEJA 2C1ZA 1DTWB 1YHZA 2VK4A 5GM2A 2ZSDA 4DTIA 1C7ZA 4XX1A 3VZCA 1GQRA 1UJNA 2O2ZA 1G7CA 1Y3FE 2QT0A 1Q84A 3WDSA 4B4UA 1B6RA 1WY7A 4NR0A 1DDOA 3EIEA 5HGJA 4EZIA 1EI9A 3UXEA 2QIPA 2QVCA 2XQGA 4R2WA 4F4UA 4IO1A 1ESMA 3H16A 1C2YA 3TZEA 5A05A 2JGRA 2NGRA 5P21A 1S3FA 3SIPA 3TSZA 3AI2A 3EY4A 3MCVA 1RLIA 2HLDD 4EITA 3NVKI 1ZD9A 2C83A 4FQ5A 4KAFA 5IASA 2KHZA 4EO4A 4PGAA 1VBFA 5JBNA 2O8DA 2O8CA 3GD7A 3U7QB 1SPBS 3GG2A 1I0LA 1E4YA 2JARA 2AI2A 4DLWA 5CDSA 4GR5A 3WMWA 3ZVMA 5ALRA 1YJ5A 2JLQA 5CDFE 2PDAA 3KQPA 1ZK1A 3FYUB 2QROA 4G5YA 2P9CA 3WLLA 1M2FA 3EB9A 4L75A 1A7AA 4R1SA 5E1OA 5JYCA 5A0VA 1MOSA 2QIOA 3A1DA 4KSCA 4WEQA 3ROXA 4B6SA 3FTQA 4QUGA 1J9ZA 1TQ4A 2POCA 1ZNZA 4I6JA 2ORIA 1KDVA 4ZYTA 1VDMA 5L3SA 2H07A 5I5GA 4QRDA 4HXGA 1RC8A 4A26A 3U3JA 4Z1OA 1EK1A 3PX3A 5IAKA 3S2EA 4HBZA 2X22A 3H9GA 1NXVA 3WTCA 4FMCF 1JDZA 3ISVA 5LMZA 3NB0A 1ISIA 4XD2A 2JDIA 2HFJA 1OASA 4BYMA 1QH8B 3OJCA 1SUWA 2GNPA 4BKUA 3BMCB 2AJCA 3IYLW 4RA6B 3RVKA 2B4RO 1XO1A 1ODJA 1YMQA 2C2WA 5A9RA 2GM4A 2QZJA 2ZI5A 1ISPA 1NW9B 2ZXEA 1VTKA 1S9HA 2AMLA 2X5NA 5HFAA 4DYHA 2C9DA 3CM0A 5B4TA 3AV3A 2Y0PA 5IK2A 5DLQC 4YCMA 4QPJC 5A1JA 2A0KA 4GBMA 1TTQB 1UBNA 2JLXA 3IUSA 3FPLA 4ND4A 3BF7A 5AHWA 1A4IA 5CDYA 3DOCA 3WX0A 2VF5X 4L0QA 4UZEA 4Q39A 1ZKMA 4RJKA 1BH2A 1VP9A 5IDYA 5L40A 4L16A 4UHDA 4RY2A 4MDEA 4KZPA 4YMTA 1T8WA 1BOFA 3INTA 1YDWA 4NBUA 5C18A 1FMLA 1W4ZA 1JF8A 1P5ZB 4DZZA 1ABBA 2E4YA 3GH3A 3OCCA 4TLEA 3NTRA 4DHEA 2BGWA 3DL4A 1OC2A 4JR1A 3IGFA 5K4HA 2BFBA 4GMFA 4IIUA 2X41A 5EJIA 2IOFA 5EWMA 4BNVA 5I48A 1LBIA 2BBWA 2VHEA 3B7WA 3DBLA 1MG5A 3OEWA 1VPVA 3RUHA 4ESOA 4WBNB 4JI1B 3F6SA 3R0IA 1UOEA 2Q5IA 3OX1A 4O2AB 3CLVA 4N6OA 1E1QA 1HC7A 3T5AA 1UKAA 2X9NA 3DOEA 4JOCA 3THWB 2X5JO 3EWAA 2O3UA 3T61A 1ZMXA 3D0QA 5EVJA 1T5SA 3AG5A 4WK0B 3IXMA 5LD2B 1O2DA 2YVQA 2W6NA 3OQPA 1NA5A 5C46F 4M8LA 4FYMA 5LP6C 3ESZA 3CSSA 1KC3A 2ZQZA 1T9BA 2NXEA 5DK4A 1YBHA 3MIZA 3DAHA 5KNCD 4GOMD 2HCFA 4RTJA 1LTQA 1RKBA 3VU9A 4OSEA 2GLTA 4YMSA 1E3EA 2XCLA 3F90A 3KR2A 2VDWA 4LYFA 3GI1A 1PJRA 1YHYA 2XUQA 2L2QA 5AK3A 3JYPA 1I14A 3PCXA 1AHHA 4QOSA 1NPDA 1JHVA 2Q6LA 2WJAA 2IHTA 3CNLA 3E7XA 3FDJA 5AI9A 4G5GA 3T94A 4ODIA 3ZYCA 2OBBA 3SJ7A 3TTSA 5JEEA 4OKIA 2RK4A 4HDKB 4X95A 1HDYA 1K8XB 3B82A 4WN9B 1W5EA 3Q8KA 1XTJA 3UNXA 4UHCA 1OX6A 1XRNA 2FP4B 1FBTA 2VOJA 3A1TA 3NT2A 3Q3GE 4R98A 3RUCA 3UG6A 2GHTA 4QOHA 1MAAA 2BKAA 2YYAA 3Q3EA 2HRQA 3RC7A 3EGXA 3RDPA 4DG5A 2WQ6A 1KYIA 2ZIFA 3VHRA 4TQAA 2D5LA 4J76A 1VIMA 2JIRA 1I0IA 3QLVC 3CLHA 5BY2A 5I7OA 3D4IA 1UK7A 2PFGA 4L5AA 5EMLA 4M8IA 4N3NA 4C2TA 4FFDA 1PGQA 4JC8A 3B5EA 4KFTA 4EAAA 2IJGX 3L1UA 4WOCA 4ENRA 1A8UA 3AVYA 2QLNA 3EH2A 1MC5A 3LV8A 3R6WA 3VSEA 2GN8A 3OX2A 1FVOA 1BA3A 4II7A 2JCYA 3CT6A 2NVUA 4RF5A 1HQCA 1K7FB 1N7IA 1ZD8A 1TYBE 1UK8A 4D9IA 3ZE9A 1OXBB 1N33B 1XP8A 4KQ2A 5GV8A 2GAJA 4ZZIA 2O05A 4L8LA 3DO6A 2C8VA 4DLSA 4X94A 2W8ZA 3L7DA 1I9GA 2WAAA 1H6AA 3FF1A 3L1KA 2D8AA 5I51A 2HN9A 4LFCB 1HT1E 1OLUA 3KHSA 2OHOA 4XWTA 3AEUB 1DZIA 1M9NA 1NQVA 5GMOA 4J8PA 2ACWA 1U7OA 1Y6JA 2C61A 2LP4Y 1N5RA 2V3VA 2VZ9A 1KEUA 3B12A 4WL0A 5ELMA 4C08A 4D8WA 5G3ZA 4Z7QB 1CJBA 3NYWA 1FVFA 4WXPA 2OHFA 3ZNPA 5KC8A 4K87A 4MVCA 5HUJA 2N75A 3FR8A 1KP2A 3OI7A 3Q2OA 3LPCA 1YL6A 2WSLA 3E3MA 1E1NA 3IOEA 1SURA 3ZHVA 4B3XA 3KCQA 1N5IA 4PZPA 4XSHA 4TS1A 3PC3A 3INRA 1FTSA 1XKLA 3FFBA 3ONWA 4JEIA 4RK0A 5JCOC 3SVLA 2C0CA 1W4BA 4LJ7A 4B7CA 3O31A 2Q4OA 5HZKA 1Y3DE 2IZOA 1EWYA 3HZRA 2Q3LA 4TOIA 3ZHOA 3RG2A 4B6QA 4O59O 4C4PA 4CT5A 4LI0A 2RGWA 4M6WA 2QRPA 2SKEA 4LHSA 2IS6A 2YASA 6ABPA 4GNKA 3DBLB 1SXQA 1T6BY 5BN4A 5EWMB 1N78A 4OI4A 3G5LA 1A9XB 1UDXA 2QVBA 2VT6A 5HR5A 3ZZNA 4K26A 3UAWA 1F6BA 3NC1C 3DKVA 4WCDA 4FM9A 1RQ2A 1TQ6A 2FYTA 4GRDA 3ZY5A 5E1DA 1JQLB 2JLYA 8ABPA 1QS0A 2QTVB 1GGKA 1UPFA 1EXNA 2WY2D 1VYHA 1P61B 4PBSA 3BDIA 5CD1A 1SU7A 3ONEA 2ONYA 3DMTC 4YAFA 1U5AA 2JHCA 1QFJA 5JNRA 2OZKA 1G4AE 1UUFA 3C5WP 3F9RA 4KI0A 4FMDF 5FL3A 3ETLA 1E6EA 4PFJA 1S2NA 5DTQA 3FPCA 4RDHA 1I3NA 1JKFA 1MH9A 4KXUA 4OXQA 3TQOA 5KNBD 1RBQA 2DH5A 1O6CA 3ZW7A 4MB6A 2B92A 2NTJA 2O2CA 3TRFA 4GE0A 1GXSA 3UA4A 5HRAA 4Z53A 1GTZA 1VL2A 3FWYA 2UXDB 2OXCA 5EGSA 3X43A 4I14A 4BVEA 1NRIA 1SC1A 1W48A 4WIAA 3SD7A 5IVKA 3TOVA 3QLJA 4NXNB 5AESA 2X5XA 1OYOA 1ZM3A 2WPDD 1Z16A 4YJKA 3TIIA 2H4HA 2V7EA 3QKUA 1XQYA 2CCGA 4HS9A 4I1UA 1ZGAA 4IFIA 1B16A 1E2FA 2QQ5A 4NBLA 4Z4IA 2AEMA 3CUSA 3IULA 4FR0A 4OA5A 1MD9A 4DIDA 1L7VC 5ALXA 1ULTA 3L4SO 1W1WA 1U8UA 4LBYA 3EISA 3UMCA 1MO2A 4TTQA 2HK6A 2NTVA 1GFWA 3L6RA 3ZHUA 3FHJA 1GN8A 5AI0A 4IZIA 4S2EA 2Y1FA 3T8YA 5JWRA 2W4MA 5KVAA 3TW0A 2PUDA 1DSSG 3TLCA 4W6QA 2GD1O 2Y27A 5DKFA 4BFZA 3EBLA 1ISJA 4MUBA 1C1XA 4P92A 2H9AA 2CVZA 1JG4A 3PWKA 4PQYA 2J5QA 2FUG1 4Z7NB 3DGFC 4A0FA 2O4CA 3VVMA 4KYUA 3CWZA 3LX4A 4MYUA 4L51A 1YIAA 4F2HA 1UM8A 1J5PA 5HIIA 4ZJYA 4OM8A 4QXPA 3K0SA 2WSSD 4U6SA 3A25A 1ACLA 3AP1A 4XQGA 3QPVA 3O93A 4MROA 3RU9A 4N03A 5HOEA 4P2BA 5B36A 1JQEA 3D3WA 4OFBA 1E2IA 3F73A 4HLQB 5A3SA 2XNCA 1C3OB 1REQB 4II2A 1X2EA 2HJRA 2XKJE 2J5RA 1OZAA 3UTCA 4JR0A 2AZMA 4TYPA 1VCNA 1LQTA 3L92A 3OPVA 4LSMA 1A8HA 1JLLB 1PT8A 2GF2A 4XA8A 5TQ2B 5D7BA 3W8FA 1B0AA 1RYEA 4Y98A 4FBMA 4U9UA 1L2TA 3I01A 4EJ6A 3MWEA 2WIFA 1A2BA 2RHTA 3JQ9A 1ENYA 3CEMA 3NTXA 5CRIA 4G5XA 2DKFA 3SEQA 3RTEA 4UUAA 4AF8A 3NHLA 3AWDA 2CEAA 4HPXB 5ER9A 4AMVA 1U3DA 2R60A 4MCAA 2XAAA 3TG2A 1JTEA 2R7KA 4PANA 1IN5A 3CG0A 4JS0A 4V39A 3MTQA 2P2NA 2Q50A 1ISRA 1XVVA 3BMQB 4P33A 3P8ZA 5DCWA 1Q77A 1JWBB 3NTVA 5A03A 2I9KA 1CHNA 1USGA 3A9WA 1JHMA 1IMJA 1HH4A 1HMPA 1YZYA 2VUSA 1XWFA 4RKRA 7REQA 1ZIDA 5K8CA 5CXUA 3R7NA 2JLCA 1R8JA 3K9QO 1NUTA 1DCMA 2IITA 3LBHA 4O4LB 5AJYA 3ZEIA 4D7AA 5KWIA 1E1CB 1I1NA 1GZHB 3PC2A 3ZHXA 4F04A 2YZMA 1MENA 3VC7A 4LECA 4CM3A 1TZ2A 3GPCA 2UXCB 3R3XA 3WBJA 4D5EA 3G9UA 1ZD3A 1PNOA 2DE0X 5KTTA 3UJAA 1E96A 4C29A 1N0IA 1DU4A 2H29A 2MSDB 1UDWA 2JGNA 3BD8A 2FLVA 1K4MA 4CMGA 2C3PA 5CB6A 1T43A 1VSTA 2JBAA 2P7HA 3AR3A 2FKAA 3LBAA 3NIFB 4FD3A 3UA3A 3QBEA 3KQLA 4PGGA 2QF7A 4J0IA 4JLSA 3ZH2A 5HIAA 1XCMA 1ZIXA 1GGHA 5CM8B 1BJRE 2FWIA 2IY9A 3DTVB 4W5RA 4L74A 2R62A 3D8SA 2BJVA 3WMGA 3T1TA 1G6KA 4REQA 2F67A 1SCIA 3ADDA 2GHQA 4BVLA 3JQAB 3T3IA 2VK1A 1UF9A 2R8BA 3CX3A 2DQSA 1WP9A 1UPTA 1GPKA 3DKRA 2UUOA 1CJVC 3P20A 4I55A 3T9FA 4NFLA 4CF3A 3OC6A 1SG0A 2XT6A 1EHIA 1S1MA 2VRCA 3HO8A 1ZD1A 5DCYA 4QDUA 4XPZA 2WTUA 4JITA 2Q1WA 3G2QA 1U2ZA 2WWHA 4GGOA 3ROFA 4HDNB 4BLUA 4ZHQA 3EZYA 4DSTA 3K6SA 1CDZA 3QEMA 3COPA 1Q5PA 2ZITA 4LV6A 4MDHA 5JYBA 2LR0A 2ETXA 2Q4EA 3M6IA 4V1CI 1TKCA 3L4BC 2IXAA 3B6IA 4BWGA 2Z5LA 4FK8A 5THKA 5AKYA 2EX1A 2I03A 2ECKA 4P98A 1A8SA 1O95C 4YJFB 4I50B 5AJUA 3MMPA 3A70A 1J2UA 1YZ3A 2P5UA 3EC1A 1CVIA 3JPYA 4B9EA 1FMFA 1XEXB 4MGHA 5CA0A 4MIEA 2R4UA 3H42B 5IDVA 1Q6ZA 2H4XA 2QU8A 2Z1MA 1FE8A 2FCAA 3BIWA 3KLNA 4XJSA 4YQEA 5AVSA 5MN5A 3PLAE 2BGTA 5ITSA 2W2MA 4UHJA 3VDMA 1O95A 3MYYA 1U4OA 1FSFA 5CK5A 1B8PA 3AIOA 3BXEA 3KZMA 2B4QA 4MWSA 4TROA 1JUDA 3U1TA 2ATXA 3TTVA 3KJZA 2XNSA 4JSRA 4OF4A 5GJBA 4OQNA 5BN5A 3JTMA 3Q1KA 1P75A 4V0KA 1LVUA 3FSEA 4FFBB 3JQQA 4FU0A 4Z4QA 3MJ4A 3C15C 1F8FA 2CL6X 2Z2JA 4I4TA 4HAZA 1IXYA 2GCPA 3EX7C 3TTXA 4N54A 3A6KA 2VNSA 9ATCA 2DY1A 1VL5A 2H17A 4JQYA 4WXHA 3IQDB 1K06A 1ZK2A 1UPCA 2DFNA 1EUDA 3L8ZA 2YWFA 4OA8A 5H7XA 4TXLA 1TM7E 3ID6C 4E1AA 2FK8A 2WB2A 2ZT5A 1TM2A 4BO2A 1BU5A 1J2YA 2XMSA 1ZJJA 2VQ3A 2XWBF 2I4MA 3NASA 4U2KA 2BP7B 2FMUA 4XXHA 2BUAA 5T4BA 3OM9A 2YV3A 2GPSA 3JATB 3PQ4A 3S7TA 2PNFA 1A95A 4BWFB 4OQLA 1GGEA 2CN1A 3IUPA 1JXQA 3KVOA 2XIQA 3PUJA 3QE2A 5AW5A 3V32A 3DMFA 4XJXA 3STXA 1TC2A 5CA0F 4KH0A 1U8AA 2N47A 1QMPA 4RY9A 5CR9A 3VPXA 3ROMA 3A1NA 5DH9A 3TEFA 2R3SA 3HXPA 1AV7A 4FHEA 2YFHA 1T2VA 4R41A 3ZQJA 1V41E 4D92A 4CEHA 3ZXYA 5KYWA 1E2MA 4I50F 1P5FA 4ML3A 5CFMA 2C88A 4I1OA 4R69A 3OZFA 2GM3A 1UJBA 3QFRA 3N7TA 3PLNA 4ZT6A 4F1KA 1NW6A 3E5RA 1GTVA 3HU3A 4ZCQA 3TINA 2OGZA 3DLPX 4NU6A 3VAYA 3CGGA 3JD3A 4AZSA 4PR3A 5I7WA 5T5QA 2W58A 3H8WA 2PT9A 3GEEA 1LB1B 3U7HB 2ONJA 3CBGA 4LMRA 1MRSA 1ZM9A 3ECSA 3R7FA 2P62A 4D8YA 4DSZA 4EHKA 4AQ7A 3ZGVA 4IL5A 1EIWA 3K73O 4G4JA 3ED1A 1ONSA 5D3MA 2GKSA 5KYGA 1OT3A 1I9CA 3WK6A 5L3ZA 1SKYB 2AZ4A 2GAOA 1G21E 4WFQA 2CWDA 4NBRA 3BJZA 2CJFA 1S0UA 1CZKA 3NCTA 2UUAB 2I2AA 5AK5A 2XBUA 3C3DA 4EJSA 2FR8C 1U8TA 2ZUWA 3RR2A 4HNGA 2I3AA 1O1YA 1PJQA 3COWA 1OA1A 3JS5A 1X92A 3FCOA 5JS7A 3A1EA 2AKYA 2WIBA 1J2JA 3SR3A 4A9AA 3R8CA 3H5TA 2YJ4A 4AO6A 5KNDH 3RYIA 4HFJA 4LMBA 3I9OA 2VTVA 3ILVA 3LWBA 2BFCA 3LCUA 5DW0A 1HMYA 1GPDG 3VAZA 2UVPB 4MKZA 2Y1WA 2EBHX 3IIEA 3HVKA 3M3PA 5FPHA 1TO6A 3I5UA 1ZYUA 1DE0A 5DCUA 3BMOB 1JTFA 3OFSA 3I5XA 3OPMA 1SHZA 4MVXA 3ZIAD 3FUTA 1BU8A 1CNMA 4WHMA 1X7YB 4CMKA 3A27A 2F3SA 4AG5A 1SG6A 1I3LA 2ZVDA 3B48A 2PKXA 2Y3IA 2PY6A 3K9BA 3WK8A 4I4TF 4KE8A 1R37A 1VBMA 3DCJA 3FR7A 4ZVNA 4C6SA 1IOVA 1MNAA 2IK8A 3P2JA 4GZ5A 2B4YA 1KDTA 4MLDA 4MV1A 5CVDA 3WJ1A 3KOUA 1QHNA 2R7MA 1E9AA 2PRYA 5I9BA 4C78A 3LF1A 3DWGA 1HDRA 2C31A 3B36A 3KEGA 2NVBA 3MLAA 4TN1A 1VG8A 4A2QA 3K15A 1PE0A 2I8AA 1I3CA 1AKQA 1QLWA 1XHFA 4NMXB 4AY6A 2RI0A 2O2XA 2V54A 3A4YA 3AR8A 3ZOKA 3D7RA 3WV5A 4X45A 1F2UB 3SDBA 4M0FA 1XNJA 2F4VB 2XODA 1F9EA 2B3TA 2H00A 3ZJ4A 5JZ9A 2QX8A 3U4CA 1YQUA 5LXTF 4E22A 1S4QA 4AU1A 2TMGA 3S8EA 1GNSA 3P2MA 4ND8B 5G3YA 2J3MA 2ZR0A 1FS5A 4FDAA 4WVFA 2OOKA 4WZAE 4BFTA 3WNZA 1KMMA 3ZQ6A 2CYCA 1CU1A 2W00A 4M21A 4RZSA 1TQ2A 2WJVA 3GDWA 4N5HX 3QH4A 2MSKA 3FPEA 2VEDA 3KQTA 3VTFA 5BV1A 2X1HA 3KL4A 3GRUA 1HUQA 3H9BA 1YIDA 2D0PB 4GVPA 4HUJA 1S7CA 4WY5A 2O7SA 4NCNA 3ETEA 4PXSA 5IT4A 3QA3E 2JIZA 4EFMA 4IDQA 1XCOA 1SBHA 3I53A 4M1TA 4RH0A 3QSYA 4PZLA 3P0HA 1H3NA 1QTIA 3E70C 5REQA 3TS1A 2Y66A 4BTEA 4CMAA 2IUFA 2A9JA 3PFNA 2JLBA 1OU4A 2WLTA 4UHEA 5FTWA 2QE6A 3AJEA 3CLRC 3WADA 3ZUPA 1YC5A 3ADBA 5TPZD 1GUFA 1N8TA 2I34A 2FFBA 2X8BA 3PYXA 1QR2A 4NDAA 4TTIA 3W3AD 1WRBA 2WTXA 4GX2A 5AVRA 4MHTA 4I55B 2HRDA 5BYAA 4H16A 3NC4A 1ABEA 1IHYA 2VNIA 1QHEA 4GH5A 3EN0A 5FXMA 3SIRA 1GNLA 2ZSHA 1E77A 4UHKA 3WK4A 1L8AA 1ULUA 4R8LA 2IYFA 1SEPA 2IGBA 2Q9AA 1A69A 4L22A 3J81k 1WO8A 4M87A 5TT1A 1MAVA 4RPHA 4AX8A 1T29A 4XDZA 1T35A 2WNIA 2WYHA 3T5MA 1DEHA 4TTSA 1FY2A 1YZVA 1Z06A 2E85A 3EIFA 1TPZA 4HAYA 4TSFA 1TQHA 3SYKA 5LUBA 5K0GA 4Z0PA 4OQPA 2PR2A 1IH8A 1T0HB 3GA7A 1QRSA 2ZTVA 1COZA 4NF2A 1NTOA 2O0KA 5DSXA 4JJ8A 3UC9A 4YXWA 1SU8A 2PT6A 4ZZ1A 2Y77A 5GY7A 2RHDA 2I8CA 3VNRA 2BCEA 4Q3AA 2G1UA 1VZ3A 2J6CA 4GG1A 1TK9A 1DOHA 1YH3A 4A91A 4ZZ0A 2VPIA 5HUQA 1TT5A 1AMOA 3R7AA 1YJCA 1SAYA 2OORA 2QZ9A 5CGQB 3RD5A 3HB4X 4A5SA 3GCGA 4BV8A 7REQB 4M1MA 1ZSNA 2VK8A 1YR9A 1XB2A 3D8RA 1VE3A 3H0EA 4YDRA 4NU8X 4JLMA 3SNKA 4Q16A 3T1NA 4ESEA 4JFAA 1B42A 2C2YA 3BGWA 1JSXA 5TMBA 3WIBA 1KI9A 1YZQA 1KEVA 3IVCA 4RKEA 4WKPA 3UV6A 4FCCA 3E84A 1O5OA 3K0EA 4QPPA 4NCIA 4TMXA 1LDEA 2O3TA 4ZO7A 3ORSA 4CHGA 4DSAA 4TSFD 3LHIA 4PY2A 3EFOA 1PR0A 4YRZA 5J2UF 1SKMA 2WU4A 3PNMA 3PT9A 3VO1A 3WS7A 3P4UA 5HVNA 2V9CA 3DVSX 1HY3A 1AT1A 5D51S 2Y4OA 5JATA 1M1NB 5JVDF 3RVLA 2EWWA 2WVHA 1BIFA 5TQ2A 2EIHA 2X58A 1GNRA 4QX6A 3TIVA 2GH1A 5FOWA 4CUJA 5KNCA 2B3DA 2CUKA 1FNNA 3EVAA 3VGPA 2AB0A 1NLUA 4W5QA 2ZRGA 3CB4A 4LSGA 3PENA 1WVGA 4Z7JA 1DEOA 1M2VA 3DR5A 1X87A 2HIGA 3D4OA 1U0BB 3E1KA 4Q93A 1AHIA 4OIMA 3QXHA 3UXHA 2Z6UA 1DIHA 3F71A 4NFSA 1R5BA 1YOVB 3GJRA 2NPIA 2OCBA 1L8QA 4GFDA 3I4FA 4HL6A 1NW5A 2A94A 4XOIA 3LDAA 1P1KA 2J32A 2OCPA 2DLNA 2PEYA 3DCIA 1QJCA 3K0FB 4GUDA 4PYKA 2D0DA 4QUEA 4U7JA 3VU3A 5KIAA 1NT2A 1O5TA 4N5DA 3PQFA 4RO0A 1WMSA 4QG3A 4NQRA 2C20A 3L8HA 4JGGA 1DARA 2OFOA 2DF8A 2W6CX 2NU7B 3DR3A 1N6KA 3I45A 1NLMA 2XYPA 4X62B 3P9RA 2J3DA 4CKZA 5I9LA 4U8HA 1J0AA 2AFHA 4D0GA 1R5JA 2Y8EA 2JGAA 1PJTA 1SHJA 1OZGA 2UVDA 1AQYA 3HV0A 3IV7A 3WQSB 3L5OA 1JQJC 4D80A 4F8YA 3QVXA 3L6UA 3HLTA 4H0FA 4IM7A 4JJFA 3ZE0B 4DV1B 2UVQA 4NL4H 5F2EA 4K9LA 2FW9A 4KWHA 5EGNA 4CM6A 4CKCA 1PK8A 3SJAA 3NVMB 3NIBA 4KCGA 4Q18A 1ZVKA 3AYZB 4WLUA 2WDPA 2XTNA 5COBA 4D74A 1MVLA 5HIJA 1FVHA 4AZ0A 2VO1A 3DL7A 4L1KA 1FXWA 5K5EA 5GINE 1JEYA 9LDBA 3Q11A 3JQFA 5JD4A 3O4FA 2GI4A 3AM5A 2ZG6A 1W6RA 1WSBA 2WTBA 2HPVA 1QAQA 2EZUA 4AJ9A 4EQ6A 1J97A 4YRFA 5LZ9A 1MHTA 2JD2A 1NDHA 1GGNA 2VJMB 3RROA 2HMAA 4C3OB 1XMXA 3TZLA 4AF6A 2CLIB 1VL6A 3PR3A 3RFXA 3UCEA 2PBZA 5AM5A 2AFIB 3KVNA 4NMHA 4OXNA 2AI1A 2QVGA 3A6LA 2DWQA 3ZR4B 1EG7A 4EY8A 2V1XA 1WPRA 5DLPA 4M8KA 2FHSA 3GLQA 2OBFA 1K6EA 2OBYA 1ZH0A 3OTHA 5BVGB 1GTRA 1F20A 2W2LD 3DUFB 2XXAB 3O90A 2DGDA 5GZ6A 1XZEA 3IUMA 1VSVA 4G36A 4YMHA 4OO3A 2RB5A 3PITA 4JNCA 3MHPA 5DTEA 2ZSIA 1RYYA 1CUXA 1L4LA 1GLGA 2QRMA 2KYRA 2RBEA 3EUAA 3KKLA 1CVLA 2Y99A 4U7HA 4UPDA 1TVKA 1CRQA 1EK6A 3P0RA 4K03A 1J8YF 1PFVA 3ILYA 3WAGA 3BA1A 1ENOA 3BN3A 2Z2ZA 1H6DA 1XDGA 3AXTA 5ICSA 1XU4A 4E7PA 3DV0A 1AV6A 1PEKE 1QZUA 3IEKA 4MUAA 1CF9A 3TKAA 4QWWA 3CW2A 4PQGA 4LBVA 1RT9A 2HJSA 2ZAIA 1CBUA 4WKNA 4CLRB 4E15A 3I23A 3VKUA 1C3LA 1JI0A 1LLCA 2W4QA 2IV2X 4CPDA 2G77B 3QKWA 4M6WB 2YY7A 2XT9A 1Y6FA 2VF4X 3NHWA 4JUBA 2AX3A 1YD7A 1NW8A 1ZC4A 2CD7A 2VJPA 3G5UA 1W5TA 4PEVA 1W49A 2ZJ6A 1U94A 3AFNA 4G26A 5DO9A 2YOGA 4DA4A 5KYKA 1NYTA 2ECOA 3CW8X 3R6DA 1TCAA 1EFPB 2EGGA 1QK3A 2HSJA 3EIHA 3IVRA 4GGPA 4Y2QA 3GDHA 3KTAA 1CE8B 3TQCA 5M29A 2QMZA 4TLDA 3TDMA 1CC1S 1H4SA 4J7XA 3E61A 5FYDA 1XD8A 4BQQA 1KK2A 1G0NA 5HMMA 4EHHA 3QW4B 4KHPB 2XJ9A 1S8FA 4CTMA 1SNYA 2YOHA 4K9NA 4B74A 2O5EA 4I9GA 2PX5A 5EJGA 5K3DA 3VKVA 4PVCA 2GUWA 1GPBA 2P5YA 5E3JA 5FLYA 5F5NA 2QD3A 1O54A 3P9QA 4WFKA 5HK8A 2ALJA 3EPPA 4UUPA 3V8QA 5K01A 2WZQA 4DWOA 1BHSA 5FUXA 2PXXA 3IAM1 4UDNA 2V03A 2KQUA 4GPZA 4DJ5X 1MP0A 2NWQA 1I6WA 1YASA 1WNFA 4UCWA 1TU4A 1YULA 1CUCA 1XALA 2CLSA 3C6BA 4HR7A 1RPNA 1GA1A 1SUIA 4B0PA 2H1CA 3UAZA 2VPZA 3KPVA 3WK9A 5JRDS 1WB9A 1GNPA 1CPYA 3LS2A 4NZNA 2RC6A 2XLCA 3EGOA 3PFGA 2YWCA 1P2BA 1DAPA 1EJ6A 3CO5A 3HEBA 3OCWA 3PGKA 1B23P 2FJPA 3WWZA 5JC8A 1CQIB 2R25B 4PYRA 3I0ZA 1U0EA 4RSMA 4MIKA 2KJQA 1WPXA 2HMTA 2RGDA 4AJ4A 4DIFA 2DEUA 1N1EA 3L93A 1JHYA 1P18A 2EP8A 3WP0A 3HXOA 2BI7A 2NSYA 2EFHB 2ZPUA 3PQ8A 3EZ6A 1ZUD1 4HB4A 3T5DA 3QTTA 3VNAA 3WKEA 1YFLA 1V7PC 4AW9A 4GR4A 2OQIA 3PUYA 3PHLA 4XW2A 1QG2A 3T3PB 5I4IA 1JFLA 5ITVA 2WTEA 4YS6A 5LXTB 4MP3A 2IZ7A 1J9GA 4K5QA 1H0KA 1LD3A 1JQBA 3HB7A 4WXMA 4YYEA 4D4JA 4EYQA 1K7CA 3VGJA 3G1TA 1MV8A 2QLBA 1CS4C 3SHQA 1BVHA 5IJ0A 2HEIA 4HF7A 4J0CA 3RUFA 1GFZA 2PLNA 3L5KA 4A0RA 1JQDA 1ZGGA 3W9SA 1N5JA 2BLLA 4NV1A 4PQFA 3ZDRA 1RE1A 4TKZA 1J49A 2V9PA 1JXOA 2LV8A 1TM5E 4OQMA 3VU8A 3ZJVA 1DEXA 1O95D 2F8MA 2WZCA 3F2VA 3ZZUA 4C4TA 3HYCA 2FG5A 2VH5R 3FNIA 5KQMA 1SO8A 2ZUVA 3QVVA 3D64A 1FUEA 4TKLA 1A8PA 4G8BA 1H1DA 4RGQA 4D26A 4YX9A 2BR4A 5GONA 2EHDA 3GCZA 4UMVA 1SU6A 2B34A 3A7EA 1XTQA 2PGNA 4C0LA 1EFCA 4JYBA 3OQVA 4O2RA 4PFSA 1R12A 1CYDA 1QIMA 2UUBB 4OQEA 2WHYA 1LZLA 2QAGB 3RS8A 2O59A 5H68A 3TLEA 2GXQA 4I9UA 1QO7A 2C2MA 3Q7PA 3ZGLA 2REBA 1MC4A 1OLXA 1PTJA 3ANSA 4CWAA 1KVQA 3C3JA 1S01A 3K5IA 1ZCZA 2PGJA 2P4SA 2KBEA 4YDQA 2BVNA 3NEYA 4MTLA 5FADA 5AW0A 2ZRLA 3MB5A 4TL8A 4D6PA 4DR2B 4I5DA 2FR1A 2X7HA 1V39A 3DVAA 5J4HA 1GUBA 1YRBA 5KJ1A 1GJRA 5FNVB 2ESRA 2II6A 3IE0A 3R1IA 4FKBA 5AXBA 1KEPA 1T5LA 3GFRA 1BDJA 1XZIA 1SCNE 3A31A 3OUZA 5BNTA 1Z6AA 5BPFA 1Z0KA 2CHEA 5K3FA 1KQGA 1TD1A 2INGX 4HX5A 5G02A 3BL5A 3G5TA 1B93A 2H0AA 3WRWA 5C8DA 3SU8A 1Q19A 4CF7A 5L6LB 1ZRHA 3EIWA 3GA0A 1FP1D 1ZIOA 2PCJA 2XCOA 4OG2A 1FEZA 4XIGS 4MX8A 4PSVA 1D0SA 3ZWXA 3RJ9A 2DQ4A 3CLTD 3PNPA 4DRYA 2TYSB 1LSUA 4W5NA 3VHQA 3ONVA 2JJ1A 2B8EA 1ZM2A 1MQSA 4GLJA 1QF7A 3L01A 1E2NA 5AKZA 2IX9A 4NS4A 2VG8A 5TMEA 5KYXA 2O3SA 2XGJA 4RV5A 3B6ZA 2GYUA 4W5JA 3ZUGA 3EG9B 1LS1A 3TNLA 1L4YA 2DBVO 2PGOA 2YICA 5GJCA 1IHPA 4FLMA 6YASA 1ETHA 4NK4A 3WGGA 1E18A 1E5TA 3DD1A 1DRKA 2WI8A 3HJHA 2QUAA 2VT7A 4MJ3A 1T26A 2ZXUA 3OHMA 3G0OA 4QU5A 4EI2A 1Z35A 3QYFA 4PHFA 4PF1A 3DNMA 4N01A 4X1YB 4H0CA 1KFBB 4C87A 1CNFA 1Q21A 5BR8B 3MUOA 5DTRA 1YAJA 3KETA 4O4HF 4LE0A 3ZWVA 2GD0A 1R8SA 4PGHA 1LX6A 1U02A 2KWIA 4QL3A 5IS2A 2QTTA 3GPIA 1O58A 4H7KA 3KD2A 5AW8A 1V9SA 1Z4NA 2FPXA 4N18A 3LOPA 3ITNA 1Q12A 4GI5A 4N7RA 2PUEA 4QODA 3AIMA 4MS1A 4YCSA 1G20B 4OXYA 4PHHA 1PZNA 2C97A 2H7CA 4ZO6A 3UK1A 2C2BA 5H5JA 3RSLA 3CZQA 4MV9A 1E3LA 4KRGA 3O3NB 4A7PA 4C0SA 4TMTA 3BAZA 2I55A 4FB5A 4F1JA 1U2GC 4GZ6A 3OBIA 3SQWA 4X3OA 1PUJA 4MW7A 5JNSA 1JH9A 2DPGA 1XMOB 4F96A 3ESAA 3KLOA 1PCXA 1JV2B 4BNHA 4UAUA 5DHSA 2RK3A 4DXHA 4QJ4A 4ZGWA 3L05A 5LP6F 3MHTA 1R66A 2I3GA 3IEVA 3RPEA 3KQSA 4MV5A 3DP7A 2JFFA 3ZV3A 3AHCA 2O1EA 2HJHA 4M7PA 4QREA 1W85A 4URZR 4DUYB 1X1QA 3QX3A 4P6VF 1M6YA 4MWCA 2UKDA 3HDHA 3WLEA 1ISHA 1QC5A 5C7YA 3QP9A 1GTSA 4C0QC 1J39A 4EGCB 3DDNA 1GA4A 3ADPA 3QHPA 4LJ5A 5KYUA 2I71A 1H1LA 2EJTA 3DV2A 3VOBA 4ZEVA 5DXAA 1AKEA 3U4DA 1ST2A 2BSAA 3LQRA 3GW8A 5FR1A 3CE9A 4L50A 4DDWA 4YCLA 3H4VA 4N40A 4KRFA 4DV4B 1W4RA 4WLEA 2A0XA 1VMEA 1O0BA 4KWTA 1KQPA 3KKEA 4KSYA 1X1CA 1DC7A 1OTXA 3FSGA 1ODIA 1FRNA 2XKAA 3TLBA 4KXYA 3H5IA 5CM2Z 1GO2A 2ZZKA 4QTYA 1P3DA 4TXNA 3RV3A 4QASA 2XH8A 4HLNA 4X1KB 2ENUA 2PUWA 3IP3A 3GGPA 2W4IA 2I1WA 4RGBA 1TPYA 4TTVA 4L5CA 2IYSA 3I8OA 4NJMB 4F2WA 2NOAA 2HK9A 1A82A 2GHRA 2JFXA 1JG3A 1HRDA 2MHCA 3TVDA 1ZN9A 2IXBA 1ZPDA 4MKHA 5BPHA 4M54A 4ZKEA 3T7AA 4WECA 1A5SB 3C4QA 2FSUA 2BEVA 5CK4A 3AVPA 4LYAA 3ZBUA 2RCYA 2FWMX 1QIJA 2QG4A 3C74A 5LP1A 1SQ5A 2G80A 3GCXA 2B83A 1NXSA 2QD1A 5HILA 3GJ8A 1M2GA 3GJZA 3DKPA 1I3OA 3S2SA 3BTVA 1M2OA 1RI3A 2H1HA 3CE6A 3OTWA 3AOGA 4ZYXA 5ADWA 1QHXA 1QKKA 4XE5A 2M6LA 1U63A 3TZHA 4DRXA 3JVVA 3CRZA 5CDFA 2LE0A 3TUIC 5A4FS 4DMMA 3N53A 4KP7A 5J2TB 3CMCO 2PLFA 4J1QA 4NE9A 3B78A 4QEZA 5GIPE 2XBLA 3GCWA 3MS2A 4KGVA 3O38A 4CLHA 2VDRB 3UW1A 1PGNA 2HQRA 2P65A 3O94A 2B9VA 5FOUA 3ZD6A 4M86A 4LY0A 1KS2A 1LNZA 3I2KA 2DHRA 5DTJA 1IEWA 5HKLA 1QRRA 3R7LA 4JMLA 5HTOA 1IQPA 1NVGA 1ZJYA 5BVGA 3IURA 4DR3B 3GPBA 5IH7A 3C2QA 1HT0A 2TRSB 1UL1X 4JVOA 2NYAA 4Y6QA 1NULA 2HT6A 1N77A 4WZZA 3KXDA 2B0JA 1F9AA 3LLCA 1NM5C 4KE7A 4NBKA 4MDYA 1ESZA 5GWXA 4IINA 1UZUA 4LJKA 3RREA 5BMVF 2QVYX 3A32A 5EINA 2F1OA 5FBQB 4G84A 4FEEA 1C3XA 3N8GA 2ICAA 4C4YA 4LISA 3G2LA 3GFTA 1Z73A 3IR6A 4PONA 4YUZA 2ZQ5A 4IOJA 1F5SA 2OHGA 1Z5PA 2XUIA 3BULA 4TWJA 4DMLA 1N8NA 3UG7A 5BWCA 3BS4A 5JASA 2XSZD 3WYDA 2PBLA 1AUXA 4WOBA 1IBMB 1S96A 3FD8A 3MQ2A 3RTAA 2WWYA 1Y5MA 3ABRB 3DE5X 3K1AB 2OCYC 5DWDA 2E5WA 5CH8A 3R9IA 4YV0A 2BF7A 4Y1RB 3W5JA 4AYTA 1RJEA 2Q3HA 1BHJA 4DVJA 3ACDA 4BNUA 4PPNA 2V55B 4JZYA 4DLXA 5EKXA 4BN4A 2PEZA 1E4EA 1RWQA 2EP5A 3HVRA 2VQFB 2X6TA 4LBWA 3PJEA 2CXPA 2ONCA 3GC6A 3L40A 2Z56A 3N28A 3SKVA 4MDFA 4BQSA 2JNWA 4BUJA 4RPLA 2A5YB 3KEOA 4KIFA 3T0IA 2C9YA 4C20A 4U2CA 3ASZA 3PXCX 4B8ZA 1OAOA 3HE3A 3MFYA 3I04A 1XWIA 4MQLA 4AZ3A 4BMDA 3UWDA 1NVVR 4F7DA 4KQFA 2VTKA 2X0NA 4F11A 2QI9C 1CUGA 1US8A 2P8JA 4PO1A 5EP4A 2B1IA 3SF8A 1ZUNB 2ZOSA 5CCBA 4N3BA 1N6IA 1QRTA 2DCMA 3DV9A 5JXJA 2A6PA 9ABPA 3KPJA 1O96B 1FFGA 3TL3A 3UV7A 3V2HA 1RBZA 3GIDA 2ZK7A 1I2BA 4XFKA 3GAZA 3AHFA 4KR6A 3VA7A 4BB9A 4R2LA 4AJPA 5LP6A 1Q7GA 4NECA 3WWEA 3W6NA 1W4CA 3IQEA 3IQFA 3NUGA 4RK1A 2FEMA 1FFDA 3VZQA 3RARA 4B17A 4BO9A 2CFIA 3UOGA 3EODA 3O1HB 4EBFA 1N5MA 5BURA 1GITA 2ZVJA 4B3TB 1Z12A 3FNEA 1DB3A 1XYGA 3WK5A 5KREA 1YFJA 2EYQA 2NV6A 3F7NA 4ZOLB 2P9BA 3GPDG 3QE4A 1TF5A 3PA8A 3IUJA 4Y6LA 3UMSA 3DHEA 3CVXA 2VDJA 4FCTA 3GXOA 4QYXA 1UMBB 3EMBA 4K0RA 3G17A 4NPCA 4QPCA 4YP9A 5HMLA 1T8SA 4L57A 1SXJC 1T3TA 4GXTA 4CLDA 5K6AA 1Z4QA 1PAUA 1WXQA 1OAAA 4FOTA 4MQ5A 2Z58A 3SX0A 2GYVA 3C1TA 1IY8A 1U9YA 5FA6A 4UBLA 1QFMA 1OIWA 3ICVA 3OX3A 4GNRA 5CFLA 4YROA 5FJIA 1FP7A 3KEMA 3NUQA 4P58A 1J0EA 5EYPA 1OB2A 1OVMA 3ENKA 4IHAA 5BNIA 1H65A 3G7NA 4W99A 1NP3A 1AY0A 1OFVA 1ZKDA 2QMQA 4XYEA 2PTGA 5DW3A 4WN3A 3BQNB 5EPUA 3UGJA 1U7UA 2IPNA 3SM9A 1KEKA 4B2YA 2CFTA 4HDQB 1G291 5C4GB 1VYTA 2I62A 4EHDA 5C32A 3AKCA 4MVJM 2A5LA 4JASB 1BS1A 2RHMA 2YZGA 4G85A 3UK6A 4ALKA 4YJ3A 1XVTA 3B89A 1PD0A 2C4KA 1XCPA 2XAUA 3K53A 2QY9A 2R66A 3LUJA 1KVUA 2V5AA 3R7SA 3RVSA 3UC5A 3ZWMA 4ENPA 1NSTA 2QL5A 3KYDB 1WZCA 1KAMA 2DM6A 3CRNA 2GJ4A 2GFHA 1E1QD 1HZZC 3HNRA 4DQLA 3I9V6 4EX7A 3CIFA 3VTZA 2JIOA 1YQQA 3QPWA 1KI2A 1LBHA 4FDUA 4XUDA 5DBGA 4EVIA 5FLXA 3PRKE 4B3FX 3GP3A 3TBHA 5KJFA 1EFDN 1DG9A 4EJ2A 3JAKA 1NUQA 1UMDA 2NUBA 2WM2A 2YRXA 3HKBB 4M9SA 2C4MA 2CBZA 3IMFA 3ND7A 1P4GA 4JP8A 4RZXA 1XZCA 1R6VA 3V46A 2BV3A 3EPKA 2VJYA 4OREX 1DUIA 3B6MA 2GF9A 2QWXA 3ZIUA 2OZLA 2CC2A 2XLBA 1JX6A 2B20A 5EE3A 1FLVA 2QTCA 1E3DA 1WOYA 2AYXA 2MOKA 3I9NA 3NEPX 4U39A 2VSNA 3M6XA 1ZUHA 3S0JA 3TOXA 5C80A 3K2EA 1Q3HA 1GG9A 3OZEA 1GZ7A 1URPA 2WU3A 1E3TA 2YFYA 3HFSA 5KNDA 2OK8A 4KC0A 3FZQA 2I2CA 1YNOA 3QBJA 2E49A 2P90A 3MELA 4RKYA 3O8LA 2Q5HA 1BWQA 1PT9A 2ISQA 3RRNA 4OHOA 3PD1A 5K0CA 2XF2A 2BT4A 3NV7A 4FYIA 4QHSA 2QEQA 2FPMA 1XDSA 1W94A 2YXDA 1MXHA 3I2JA 2P6RA 2XD9A 2NG1A 4F5WA 2GS9A 4IDDA 1CJTC 2X5KO 1SBIA 2LIPA 3H18A 4MUIA 4PCLA 1E1RA 4JJIA 5JYDA 2V3CC 3E8XA 3MS4A 5BQOA 4QGHA 1JQ5A 4F92B 1EE2A 1XNGA 1NAHA 3UAXA 4HAOA 2NADA 4C4AA 2WE8A 5L9AA 3KQHA 3QPBA 3KJFA 4HRAA 2B1GA 2HRBA 4JBNA 1XRSB 4XWKA 3PJDA 5K3BA 3CZCA 4AWXA 4QNRA 5AVWA 1GZVA 3VSAA 2Q3MA 2FPPB 1PJ3A 4K6GA 1HEUA 2ODBA 5J4VA 2JBWA 2GERA 4MWDA 4YP5A 1OQAA 3AEKA 5EIBD 5FBWB 1RCUA 3V4FA 4HNTA 1WDTA 4I3FA 1AN9A 1R10A 1N8SA 1R5OA 3O1LA 2DQYA 4QFDA 4C1NA 2DT8A 5DSZA 5MFZA 1IN7A 2V7QD 4DXDA 3W90A 5JC1A 3TLYA 3C41J 1NNEA 4PZDA 3RWMB 4AYWA 2W98A 5ICGA 5HJ7A 1QVWA 5I9NA 5KX5B 3RC1A 2ZT6A 3FKSD 2VWHA 5F4BA 5AVJA 4H3HB 4TLAA 2IYXA 1FDWA 2HJVA 2JIBA 3BL8A 3CEHA 4UVHA 1BXGB 4RENA 4TUYB 2AZXA 4HWRA 1QTQA 1YR1A 5L53A 4DPLA 1KMHB 3OA2A 2QNBA 3WB1A 5CURA 3GRCA 1IMOA 3WGLA 3D4BA 4BQEA 2FEPA 4B6EA 3QKSB 1YQTA 4R1NA 3OZVA 3VU1A 4EI7A 2A35A 4NICA 2V6FA 3VISA 1JE0A 1Q1ZA 3WI7A 1MJHA 2Z9DA 1Z39A 4UNPA 4B3HA 3FPGA 4PC7A 2L17A 3T12A 4C0HA 3L8DA 3JRNA 3RG8A 3P2EA 4Z49A 4E21A 1DGQA 1RZRD 1LBQA 2O6LA 4AM8A 3RRFA 4DMUB 1TYAE 3B1VA 2WKSA 3RS4A 1GRCA 5DIFA 4KGXA 1EFHA 2BFDB 5JMTA 4EP1A 4H7DA 2X19A 1KPHA 5AT1A 2BSXA 2ZI6A 3R0ZA 2XHZA 4GS5A 4H31A 4PLHA 4LXGA 4BWYA 4WE3A 4ZPJA 4N3CA 4R3UC 1L7DA 5JDIA 1DKNA 1R6XA 2V98A 1J99A 5CBPB 4ZAGA 4AF7A 2IU3A 3DC7A 1C1DA 1F48A 4RMHA 4RVDA 4PFKA 3DHVA 2QJOA 2X8JB 4UREA 4ZI3A 5KTSA 2LPMA 1IRXA 4NAUA 4E5PA 2AKAB 1JFRA 4Q1DA 2D4HA 4MP8A 4UUOA 3QJYA 1PR9A 2PR7A 4C0BA 4PXAA 5BSWA 5GTDA 5G0SA 2FMHA 2DPYA 1RC1A 3AG6A 4YCDA 3USCS 1WX1A 3OSUA 1FTWA 2PL1A 1XQ1A 3AF6A 4Y2YA 3PVSA 4LXHA 2BMAA 2XXJA 1NFRA 1FFXB 2EQBA 3D3KA 3TI7A 1KEEA 2RONA 4X1IB 5AWFC 4JXJA 5EHQA 1DXYA 5KTMA 3I5YA 2RD2A 4X7RA 1H0HA 2IYNA 3R3YA 6ADHA 2BMFA 1GPLA 1RSZA 4ARZB 2P1DA 4C14A 3N76A 1BX1A 1JNYA 2JAXA 2G6BA 4Q3OA 2H5LA 4RPKA 5TPWA 5BVHB 4UOZA 2WG1A 3JQDA 3UK2A 2P2CA 4OGWA 2IXGA 6AT1A 4RABA 4M9XA 1CUEA 1X1TA 2XB4A 3DDWA 3NKVA 4XD7D 1OCEA 1J9EA 3GAFA 4CQMB 3CNNA 3K30A 1BW9A 3AJDA 2YIDA 4RD6A 2IEDA 4BN5A 3LP6A 1RLUA 3IA7A 4OSPA 4QOGA 5KTKA 5AQ1A 4I4NA 2DWUA 4QICA 3GJSA 2X4GA 3LZDA 4MVJA 1H4QA 3DLBA 2HCTA 5KB3A 4WAUA 1I4TD 2QJRA 2YRWA 3QQ5A 1ZMOA 4MO2A 3TB6A 5FAKA 1CJUC 1T9GR 1ZSVA 2I87A 3X1WA 4FYYA 2JGMA 1PQWA 1CIJA 1GCAA 1CFJA 3GLVA 3MJRA 3PTZA 3BILA 1K5GA 1SOWA 3K16A 4FYPA 4HCJA 5LYYA 2DTEA 1P4JA 5JJKA 3PL1A 3QXXA 4JVMA 2XDYA 3SZUA 3V7FA 2C95A 4J0QA 1CEEA 3NTOA 2P9YA 2XITA 2BH9A 3ELYA 3RLFA 5DBOA 2OE2A 2Z83A 1JWLA 2FF7A 3K3PA 4IKEA 2XE7A 1U2DA 4Q4AA 4EH1A 4BPBA 4P31A 4PINA 2HO5A 3WWYA 4F4JA 2ZIXA 4DDUA 3TPCA 1SVNA 1XCGB 2LVBA 4JB8A 5EPOA 4OUDA 1K0UA 1QGUA 1SJ9A 2R1VA 4Z5XA 1A4RA 2AK3A 2IBSA 3L9XA 4JLBA 4W8OA 3BRWA 3KLBA 4FFNA 3D6JA 4QUKA 5HG0A 2PPLA 1D2NA 2Z57A 2Y1GA 3OFNA 5E3HA 4A36A 1IN4A 4V03A 1G21B 5E4YA 3WV4A 2IVFA 1PYOA 2BEWA 4YO8A 1SKAA 1YQDA 3T1OA 4ES6A 5LR6A 2X3FA 3F98A 3WLKX 3FVQA 1UMCB 2XB9A 5BRNA 2B4AA 2JF0A 3EDRA 1UDAA 4H6VA 5DLYA 4H77A 1P45A 1P3Y1 3ZE1B 3DLCA 5F7OA 1T8RA 3O4GA 5A5EA 5J43A 1WB6A 1IN1A 3MOIA 2R5WA 4K6HA 3OG9A 4J6EA 1YCFA 1YRYE 4OX9Y 1APBA 2B8WA 5CFOA 4PPFA 2XZDA 2ZB3A 4OFXA 1E9VA 1Y3IA 1ZI6A 2IEIA 3PNBA 4PZAA 3FTNA 5FUMA 1T0BA 4RFSA 2VCEA 4B5LA 4ITRC 5DSTA 5C8YA 1MA3A 2PFKA 2SCUB 3G2MA 4GI3A 1BEUB 4IIJA 5AW2A 3HJFA 2FXIA 3H1EA 1NONA 2QTWB 4XIFA 1RZ3A 3CIOA 4Z7OB 2ECQA 3AHHA 4X93A 3HUEA 2V7BA 5G40A 1XLVA 4NY1A 5HBGA 3ZK7A 3T1HB 4FYHA 4QTTB 3CH7A 1S7GA 2XTJA 3H1TA 4OATA 1V1MA 3H6KA 3HZZA 4KYTA 1YZGA 3CTMA 2XMDA 4QXAA 4F56A 1BCSB 4PCUA 1SEVA 2C9MA 4XM0A 5FWXA 1OW3B 1IM8A 2P3LA 3MMZA 4TS3A 4BFUA 3O8OA 5I7FA 4FGUA 2JGDA 2NN3C 3LY7A 5E6UA 4UUBA 4S0ZA 2XGOA 4KXWA 5FFMA 1LLQA 3BL6A 3AVTA 1T24A 2WJ4A 4L3OA 1K75A 3B9PA 3P0JA 3VKHA 1CJCA 4X92A 4MR7B 3TPZA 1C14A 1KI3A 2AGVA 4JJKA 4BMPB 3O7MA 4XQEA 3EGCA 1RRMA 1G7RA 4PLWA 3O84A 3RIHA 5CH5A 2O1XA 2JH9A 4JZKA 5EOVA 2PQ6A 2NSDA 4D6XA 4LRSB 4MLZA 2ADFA 2NT3A 4IUDS 1GZDA 4N3AA 1P80A 4EJFA 3EMDA 1JP7A 3OPNA 4J7UA 1HLGA 4GEKA 5BSHA 4KUEA 1VL8A 2IHUA 2ZRQA 3JRWA 3HR7A 4UCXA 4WOJA 3PF9A 2FQWA 4HXEB 3TLXA 3PUZA 2Y2UA 4TS9A 4B83A 1JU9A 1T9GS 3DT9A 5CHEA 3NUZA 4RIIA 1R4MA 5CLGA 5KDOA 4QE3A 2J9YB 5E4FA 4L2IA 1ID8A 1W1UA 2DWCA 2R6CA 1VLHA 2ZE7A 4B5KA 2YC4C 4IZOA 4HLUC 4I6EA 3TRDA 4BBAA 1PR6A 3SFTA 4E6EA 1GCUA 3GARA 1J33A 1QCDA 4CCAA 8GPBA 4MRMB 1EU1A 1CQJA 4CEIA 4AG3A 1FU8A 2OMKA 2A57A 4IUCS 2VTBA 5EIOA 2HWWA 3K1YA 1Q7CA 1IJBA 2GBPA 3HO6A 1V8ZA 2FVYA 3RHSA 4BDTA 4D0NA 2NU6A 1YRHA 1OIVA 1IG0A 3K6KA 3D5EA 1Z56C 3Q4GA 4GOXA 4WADA 1U9IA 1EGQA 4GSYA 1QVAA 4K88A 2K7FA 1G18A 1RHRA 1ONOA 4K9QA 1GPWB 2IE8A 1VLJA 2G82A 1E1LA 1QHHA 4IDBA 3JVEA 4LNUB 4G65A 1YVPA 3ND9A 1IQ0A 2ECFA 4NMMA 4X91A 2V3WA 5C7OO 1Q6YA 2YS7A 4WUTA 4X97A 3WBFA 1ZA2A 5DHQA 1DT3A 2BM1A 3T9DA 5M3BA 1C30A 5HGXA 4D9GA 3ZZTA 3UT5A 3GP8A 1GAWA 1KAEA 1P4AA 4N6GA 3VZPA 4ENVA 2DBZA 4JYCA 1K2VN 2Q8NA 4A2CA 2JJQA 3W2HA 4YAOA 1ICEA 3VR3D 4O5OA 2QR5A 2AWNA 4DV3B 2I2WA 1YRQA 3AF4A 4JLJA 5CDUA 1O77A 3A4IA 3OEHA 1DVRA 9LDTA 3W5UA 4JLKA 4K1XA 4L0MA 4AL4A 4KPGA 1D2EA 1OJLA 1Z5WA 4G4IA 4JLUA 1AKNA 5FLEX 4KL8S 3RS9A 4AKSA 3C8MA 5DHAA 4BNMA 4BUCA 4G01B 3WLMA 1RMTA 2IPXA 2X7XA 1SHKA 2Q2VA 4W6ZA 3LA8A 4P22A 3HP1A 4AQDA 2QUJA 5F52A 3ZG6A 4XVCA 2HCRA 4R16A 3IO5A 4R40A 5JSFA 2IHYA 2A14A 3AESA 1SQ0A 4GX0A 5HTKA 5CLFA 4M7RA 2NU8A 1S8NA 2BH2A 1KK1A 1D6SA 3D0OA 2JLZA 3DMNA 2W70A 3V7UA 4BNKA 4MW2A 4ZCRA 2WG0A 3Q72A 5WRFA 4W9NA 4E4TA 3K70D 2IS1A 1QFXA 4ZVUA 3RIYA 2QTLA 2O5RA 3CH4B 1JDVA 3MXOA 1G4HA 1HEIA 1NRJB 5KVVA 2TECE 4PN3A 4G1BA 1WZNA 3LFTA 5L4LA 1PZFA 4TYYA 2IV7A 1PJ2A 1SBNE 5CPFA 3ICQB 2I6QA 4EO7A 4EYGA 1HDZA 2CV0A 4HB2A 1UANA 4TVOA 1Z9BA 4FMPA 5AHKA 4LJAA 1GL9B 1WMEA 4DYVA 1OD6A 1JAXA 3BFVA 1EQ2A 1NVKA 2CHFA 4YV1A 3H3FA 2OXFA 3SQNA 4GE3A 2UUPA 3LZCA 1VPLA 3G0GA 4TTAA 1YR8A 2B1JA 1NQOA 4G56A 2ORWA 4J9UE 5THXA 3G9XA 4CUKA 5ICCA 4S05A 4RJJA 4EMBA 1I7QB 1YOBA 2SHKA 3U5TA 3U6BA 3W6OA 2HLNA 2WNSA 2RAFA 3GLFB 2O54A 3TBFA 5A3VA 1K8RA 4KJXA 1RXYA 2IYRA 2OZPA 3N7UA 4DIUA 5IHXA 1CZOA 4M9ZA 5A4AA 3NI2A 2WOJA 3FUUA 3IP1A 3W79A 2EX4A 1HTTA 1KBQA 4CKEB 3GJ5A 4KAAA 4LV8B 4O02B 5CVEA 4RA9A 4RGYA 4ZANA 3BJEA 4B4VA 3FAZA 4MGKR 4NMWA 1ZOOA 2YNMC 3BRWD 2PQ2A 2IZ0A 1SY7A 3UQZA 4PZEA 4DW8A 5JJLA 2H85A 4LW8A 5CM9C 1EP1B 4EB8A 5T3YA 3WRYC 3WYEA 2H08A 2HA5A 5FQOA 1CB0A 1HNNA 1VE1A 2JLRA 3K9HA 3B1JA 4GLLA 5J23A 3CWCA 1E92A 4H3VA 3P97A 3ZU5A 2IH2A 1JQ3A 2G9VA 1PVDA 1UBTS 2OGSA 3OU6A 3O7WA 3GRFA 5C8ZA 2I66A 1U2DC 2YWGA 5FWNA 2B94A 1V35A 2E4AA 1SIOA 1G0OA 4KR0A 4ED9A 2X13A 2FSSA 5ALVA 2BI8A 1QAOA 3AFOA 3P9SA 4YIHA 4D97A 3P26A 1HM5A 2I99A 2Y68A 3OKFA 4MJ7A 1T1IA 1FNSA 1UDBA 2JRCA 2O8FA 4MQUA 3QKRB 3AP2A 4XDYA 2ZBDA 3KG2A 4D44A 3U3KA 5J4LA 4LF4B 5LBIA 1AKMA 2VF2A 2ZRFA 4MQEB 2OBXA 4RD3A 1Y81A 3DBRA 3PNVA 3EMVA 3RNLA 3UAGA 2DJ5A 4OB8A 3DZDA 4MTCA 2NU9B 3TZQA 1IAQA 4IV5A 5FO1A 3D8BA 1XMVA 3LGAA 1KRXA 2CVHA 4I8IA 2CXQA 2G1JA 1YKSA 3VJKA 3O8RA 4YECA 3E22A 4GECA 4N82A 1M54A 2CW5A 4FZ3A 4F97A 2XE8A 3NJRA 4QNNA 1VE5A 3ZW9A 4ZMBA 4MI9A 3T7RA 1PEAA 1WV0A 1H2HA 4BRWA 4E51A 1M72A 2OD2A 4Z8XA 5KOJB 1NW3A 2XMPA 4CCSA 4YP7A 3I61A 1WCIA 2YHSA 4RW0A 1BVUA 3Q0IA 3EUWA 3PHJA 2J41A 3P7MA 2V74B 1NFFA 4QOJA 3IMKA 3LDUA 4RCYA 4ZMRA 4HNVA 2C82A 1E9RA 5D00A 1QM5A 1DAHA 2CDBA 5EUCA 5EJ5A 3LQFA 1U6KA 1JHOA 4V2UA 5HF8A 1P4SA 1UBRS 2BMEA 3UM9A 3P9CA 1UH5A 1B8NA 1FYWA 1P73A 1CZNA 2XWJI 3L7BA 2IF2A 4C0XA 2YNMD 3LBFA 3R6TA 3PEEA 2ZSJA 4RD2A 3AVVA 1E9SA 3MW8A 2KPOA 1V7QA 2VXBA 3KOOA 2HA7A 2IP4A 2AUTA 2I2DA 4MQ4A 3RGWS 4A6PA 1M7BA 4LF9B 4I1VA 1JDJA 2QJWA 5EZ6B 3S2FA 5K1ZA 4JLDA 1BO6A 4MHOA 2XHEA 4C6TA 3QF4A 1C9EA 2ZSEA 2DSTA 3OQMA 1UP6A 1W88B 1Z6QA 2AN3A 2UYOA 3OIDA 5EQDA 1XPUA 4GPD1 1II8A 4B31A 4JXKA 5AFSA 2BHTA 5KDDA 1XMQB 1XXLA 2A5GA 1P72A 4DV0B 4QU8A 3N2ZB 1Z4MA 4E5SA 4CTOA 5IN4A 3MFQA 1Q2UA 4JDUA 1ZAKA 3FVWA 4Y6RA 5DEIA 1N2JA 2XMZA 2OP1A 3DVRX 5EIHA 1PFUA 2QN7A 2R47A 3LO5A 5EZYF 3WGMA 3PA6A 2LW7A 3NHKA 2DVMA 5B4VA 3KT3A 3N59A 1RZRA 3GNLA 1LBTA 3K5WA 4TYQA 1F51E 1WA5A 2YJTD 1N9GB 1NLYA 1T9ZA 1NG1A 2DPXA 1W75A 1X7GA 2AW3A 2Q6OA 3FA2A 3JQ8B 4FBGA 2WUWE 4MYTA 3S4YA 3IERA 4KE6A 3M33A 4YRSA 3UXMA 1Y7HA 1D1PA 3BKXA 3Q12A 4D42A 3IDQA 3JRXA 1HBJA 1UJ2A 4QULA 3H2IA 4RAQA 1KDZA 4KWIA 1U99A 1FRVA 3L8GA 3F7TA 4L4YA 3JVIA 4GD3Q 5HF5A 5KKNB 2WQZA 5H3HA 3EQZA 3OQ1A 4I1IA 5IDWA 3SSNA 1UOQA 4FKZA 5T67A 5AW1A 1LWNA 2Y6VA 3WSTA 3TGLA 2PIAA 1BFDA 1P2DA 4J94A 2WD7B 3K0CA 3TW8B 1TGVA 5HKBA 4V02A 3A36A 2JFVA 1WL8A 2CNWD 3QUSA 4M1KA 3PI7A 1OKKD 3PQ2A 5IBRA 1DNPA 5CB0A 1PNRA 1LDGA 3KTOA 4M8NE 1P0MA 3H8JA 3OQIB 4QQRA 1V7ZA 2SKDA 4CM8A 1NP7A 2JAOA 4Y0VA 2ZZMA 1T2CA 2PUCA 3TBKA 1NRWA 2FPIB 2B35A 1RWKA 1NR1A 1NYRA 1T13A 1T0JB 4HP8A 1PT6A 1VI2A 4QPDA 4U2GA 4X9XA 1B2LA 4D02A 5JJIA 3DZCA 1CUAA 3IIKA 1OT5A 2FDXA 3QXCA 2C4UA 4Q03A 2QY6A 4G0UA 2WUDA 4GYJA 4JQCA 1N4AA 3EWIA 3OIYA 1ADBA 3F5SA 3PIRA 2F1IA 4OMUA 1TCUA 4R68A 4XI9A 3FDIA 2GHIA 4P93A 2CJYA 5C2JB 5SY6A 3H5LA 2DBRA 1FS6A 3D8TA 3M7IA 5EIFA 3ENWA 2P3OA 3JZFA 1JAHA 1JALA 1E1RD 3KHTA 2ZRHA 2ZDQA 2IEGA 2B30A 4N0DA 1I5EA 3N2KB 2GRJA 3ZI0A 5KWSA 1KY3A 5LLDA 1OSNA 2MINA 4F86A 1HE1C 1W44A 3QNWA 1USVA 4N49A 2YHBA 3NRJA 3WNDA 3AR5A 3ROTA 2Y1KA 2HSEA 3ENZA 1TCVA 4YUYA 3HRHA 3I8SA 2PXCA 2R5NA 5KINB 5ELXA 1R64A 3EE6A 1UC9A 2RMKA 2AXNA 4YAGA 5KNDD 1YZLA 1IXZA 1DINA 1PQ4A 4PNEA 2G67A 1EVYA 2WV7A 4ZAVA 4RJ2A 4ZTUB 4G0YA 1VLLA 2AT1A 5EN4A 1TJYA 3H5VA 3L0DA 1Y98A 3KAJA 3IR7A 2YHIA 3MGKA 1ZNQO 4KQWA 4B8WA 4BO0A 4EUHA 3KQVA 4RM2A 3EBPA 4EMSA 2JLWA 3DZIA 1OZHA 4YTEA 3UJHA 2VA8A 1JH8A 3OICA 5BOSA 1YSCA 3JQGA 3ZCQA 3NBQA 1IHXA 1CUIA 3AWIA 3FZNA 3IJPA 7ADHA 1OPRA 2V0CA 2GVNA 3ABSB 4NFHA 4XCQA 4LY9A 1H0RA 1VKRA 4F2DA 5TX7A 4BZXA 2A7XA 1P5HA 1D4AA 1A9SA 3BB1A 4ACAA 1Z0DA 1EFVA 3BZUA 4XM2A 3CF4A 1NMYA 5LCXA 4DL9A 1XJQA 4EGFA 2UZ0A 4DCCA 5KWJA 4D8UA 3MINA 3C43A 2G06A 4YLEA 1IK4A 1ZVMA 4XEHA 2GRUA 2ZTLA 5CJJA 3M34A 1WXEA 3NDIA 1RMQA 2O0MA 4K86A 4EJSC 4GOLD 4FCVA 1YTUA 3KWMA 4X41A 2Q9BA 2XNKA 4RJIA 1G8SA 1KO5A 3L7MA 4M0LA 3OT4A 5K0SA 1DX4A 2CK3A 3GRZA 1CR6A 1Y34E 3VUFA 3ZDFA 1Z0IA 1AG9A 2PA3A 2AKEA 4TMVA 1VLVA 1IY2A 3MGBA 4W4TA 5FPQA 1NWHA 3L0BA 3A28A 4JR2A 1V9CA 4NK5A 3VDQA