1V48A

Calf spleen purine nucleoside phosphorylase (pnp) binary complex with 9-(5,5-difluoro-5-phosphonopenthyl)guanine
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
283
structure length
261
Chain Sequence
QNGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYEAAQKLEQFVSLLMASIPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Calf spleen purine-nucleoside phosphorylase: crystal structure of the binary complex with a potent multisubstrate analogue inhibitor.
pubmed doi rcsb
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
total genus 81
structure length 261
sequence length 283
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1v48A00
1U1CA 1RXYA 3NM5A 3U40A 2AI2A 1PR2A 3T94A 1QE5A 5F77A 4BMZA 1PR4A 4P54A 4WKOA 3FUCA 3KHSA 1Y6QA 1A9PA 1Y1RA 2ON6A 4DA8A 4WKCA 3OZEA 1PW7A 1Z38A 4QFBA 1K9SA 3OZDA 4WKNA 4G8JA 1PR6A 3OOEA 1U1GA 2AI3A 3FNQA 4PR3A 2A0YA 3IEXA 3LA8A 3UAWA 3QPBA 2RJ3A 1LX7A 5EPUA 5B7NA 4TYMA 4ECEA 4MCIA 4UC0A 3D1VA 2Q7OE 1A69A 2HRDA 4F2PA 4U2KA 3EUFA 3PNSA 3P0FA 4H1TA 2HN9A 1Z33A 4LDNA 1PWYE 5CYFA 1YR3A 4OGLA 2QTTA 4I2VA 1Z36A 3BJEA 3OPVA 3P0EA 1V4NA 1FXUA 4G41A 3NBQA 3KUKA 1LV8A 4TXHA 3EMVA 3INYA 2I8AA 3F8WA 4TXMA 4DAOA 4YO8A 4RJ2A 4GLJA 1RSZA 1ODLA 4TXJA 1A9RA 3BSFA 5F7OA 4NSNA 3E0QA 3GGSA 1Z5PA 1Z37A 2AI1A 2OXFA 2PGAA 2A8YA 5JPCA 1OVGA 1T0UA 1Z5OA 3TL6A 4QAQA 1G2OA 1RYZA 4LZWA 5CCEA 1U1DA 4GLFA 5B7PA 1ZL2A 3NM6B 3ENZA 4QASA 1K3FA 4DABA 4TTAA 3OZBA 4D9HA 4DA7A 4NS1A 4OEHA 1RCTE 4D8YA 4TXLA 1A9OA 3EEIA 1A9QA 4LKRA 4TS9A 1JP7A 3IOMA 1JDUA 5CYGA 4DA0A 2QSUA 4F2WA 1V3QE 4DA6A 1T8YA 3KVVA 3O6VA 3OCCA 2HSWA 3DP9A 1JE0A 2BSXA 2OECA 1ZOSA 3E9ZA 3UAXA 1A9SA 4YMLA 1PR1A 2ISCA 1Z5NA 1JDZA 1RXSA 3GB9A 4BN0A 3OF3A 4X24A 2H8GA 4TXNA 1YQQA 1SD1A 4L5AA 3FAZA 4QATA 1VFNA 5F7JA 1SJ9A 4M7WA 1JE1A 5ETJA 1ULAA 3UAVA 1OU4A 4OJTA 1PR0A 3K8OE 1C3XA 1U1EA 1JPVA 3UAYA 2XRFA 4LNHA 1NW4A 2HWUA 2OC4A 3DDOA 3K8QA 5C80A 5I3CA 4G89A 3DPSA 4L5CA 3KVRA 4L6IA 4FFSA 1Z39A 4EARA 5EUBA 1Q1GA 4YJKA 1PK7A 3FOWA 4DANA 2I4TA 4EB8A 3LGSA 1Y1TA 1RXUA 5F78A 3PHBE 1N3IA 4K6OA 4OF4A 1RFGE 1JDTA 4NY1A 1Y6RA 2QDKA 1V48A 3SCZA 1TGVA 3DJFA 1A9TA 5IU6A 1YBFA 3E9RA 1Z34A 1B8OA 1K27A 4WKBA 5CCDA 1ULBA 4MCHA 1Y1SA 1RT9A 3PHCA 2P4SA 1YQUA 1VHWA 1TD1A 3FWPA 3MB8A 4OY3A 4F1WA 1PK9A 5B7QA 1T8WA 5DK6A 3NM4A 4JWTA 3LBAA 2B94A 1RR6A 4D8VA 5EFOA 1YRYE 4DARA 5F73A 1JYSA 4D98A 4F3KA 1V2HE 1CG6A 4JOSA 5CXQA 5KB3A 4YNBA 1PF7E 4LNAA 4GKAA 4M3NA 1OTXA 1SD2A 3KU4A 1U1FA 1T8SA 1PKEA 1TCUA 2AC7A 1OTYA 3O4VA 1TCVA 4TS3A 1VHJA 3BL6A 4JP5A 1V45E 1ECPA 5K1ZA 2IQ5A 4BMXA 4PNPA 4L0MA 5F7XA 1RXCA 1VMKA 3MMSA 1I80A 1JDSA 1WTAA 3OZCA 2OC9A 2GUWA 4M1EA 2QPLA 1B8NA 1ODKA 4IP0A 3UT6A 4D8XA 4GMHA 3UAZA 4BMYA 1M73E 5F7ZA 4R31A 1ODIA 3ONVA 2QTGA 3BGSA 4QEZA 1XE3A 1JDVA 3KVYA 3C74A 1Y1QA 3EUEA 4WKPA 4OGKA 4DAEA 4TTIA 1CB0A 5IFKA 3DF9A 1V41E 1LVUA 1T8RA 2A0WA 5F76A 4QARA 1OUMA 3ODGA 1NC3A 5CXSA 1TGYA 1OV6A 4F3CA 5FAKA 4MARA 1SQ6A 5B7GA 4R2XA 1ODJA 1Z35A 2A0XA 3OOHA 4KN5A 4R2WA 4L5YA 4TTJA 3FB1A 4E1VA 1PR5A 3PNPA 1NC1A 1PBNA
chains in the Genus database with same CATH superfamily
4F8EA 4UEKA 4RTNA 5F1KA 1EIZA 5EEHA 5K0SA 2GS9A 3C7CB 3R6WA 5A05A 1E99A 1G0OA 3TUZC 2PGIA 4X8OA 1YQXA 3RUDA 1J8DA 1BDIA 3G8BA 3OFJA 1TUIA 4O0MA 4DGSA 2VDPB 3ND8A 5DGCA 4KI0A 5ELMA 6REQB 5KIAA 3R0QA 1EUDA 2C0QA 4LECA 3KZVA 3T94A 1J8FA 2C3YA 4EA7A 5BQ5A 4DT1A 1OZGA 1J5PA 1E0JA 3DXXA 4UUNA 3RFVA 5CFQA 4IIVA 4C06A 3UOAB 2GBCA 1P1BA 1FFSA 3H8VA 1V11B 4NBLA 5AKEA 3WR5A 4EGAA 3DOHA 1NDHA 1VXOA 4AYWA 1Z4NA 3LCVB 4PZ0A 1CE8B 1Q91A 1F3OA 4QU5A 3FSGA 3RRMA 3E5HA 4GI5A 3F6YA 4OI4A 4OM8A 3R7DA 3VUEA 1F38A 5T64A 2QVGA 3F5QA 1J1IA 4RVOA 3V1YA 4L22A 2J41A 2XD4A 3F6BX 3ZBPA 4YYEA 4QG7A 3H9QA 5DPMA 1ZJYA 1G5HA 1Z4PX 1VG1A 3AETB 3W6OA 5IXJA 4FOOA 1UJCA 1KJJA 4KO4S 1HSZA 1QNLA 2FW7A 1M2HA 2VYVD 4BQRA 2X5XA 2CD9A 1NV9A 3UOGA 3IMKA 4QUHA 4JX8A 5G4KA 3IEIA 5FL3A 3THSA 1I2AA 2OCDA 3CIFA 4EH1A 4YO7A 3QOXA 2G1KA 1YE5A 1G1MA 2A1TS 1PQYA 2H17A 2I2CA 3ETHA 4NV1A 4RVSA 3PR3A 1RRPA 1ESMA 1RP7A 2HTFA 5L3VA 2VZ8A 4KQKA 4IH1A 5BYKA 5ED4A 4MCIA 1ZI6A 1P7PA 1W581 3KQMA 4KXVA 5LXTA 2D7CA 2YVQA 5J5AA 5KPJA 2IBTA 4XIFA 2ZB3A 1JLRA 4FUQA 4Z7OB 2QPTA 4BC0A 3SK0A 2QYSA 5H68A 1P1RA 2GXUA 5BW4A 3NHJA 2NADA 1UJ5A 6REQA 3ERCA 2B9VA 4U2KA 4F04A 2PRYA 4HDNA 4F3RA 3C15C 4HGYA 3STYA 3Q3HA 2ZAIA 3R7NA 4K9QA 3IE1A 1W93A 4RSGA 4Q7EA 5EIFA 2HPAA 3SDSA 1JEJA 3KKEA 5IARA 2ZULA 3NQ41 4L27A 4XEUA 1J8QA 3KJIA 3KG2A 4PIPA 3TD2A 1I4OA 1ORTA 3GK3A 3KR1A 1UM8A 3R23A 5JRDS 4Q39A 4L8VA 1QU3A 4Y9TA 3ZD6A 1ZW6A 4NS4A 1ECLA 2YICA 1ZUHA 4LJSA 1TYDE 2JRLA 4WXHA 2AGVA 4HG2A 3ENQA 1UPBA 2IVFA 1SCJA 2VRWA 4LOHA 4BVHA 4GXTA 3B7WA 4WD3A 2QI9F 4PPYA 4EL0A 1UXKA 3G9ZA 2WK1A 3M49A 4S2EA 3GLKA 1ZJ6A 4PRKA 1FXWF 2H59A 3P1JA 4NYMQ 1C0EA 1V47A 1N5KA 2HC9A 4LHYA 4R5HA 2XVMA 4XWYA 5IJ9B 3P5SA 1G6OA 4B0PA 3DTVD 3LQFA 4NBTA 4LMAA 1AMNA 1MGOA 1J7JA 4BAGA 5K4GA 2GJSA 3ZTTA 1VLVA 3F4BA 5AKIA 4WOCA 1EG2A 2ZRLA 4H4CA 4C22A 1Z4QA 1JXAA 1X7XB 4H1UA 4Q3EA 1PJ2A 4H0CA 1B0AA 4E03A 5ALNA 3KX2A 1ZN9A 2G1JA 4LYAA 3MTJA 4LSWA 1TF2A 3W9BA 3ZV4A 2ZBUA 4I08A 4W8GA 1ND5A 1TA9A 2BGGA 2L2QA 2OXFA 1NR7A 2HZBA 2C7VA 3DBHB 1JQKA 5TGTA 4QXAA 4Y0NA 3AZPA 1SXJC 1VPTA 4ARZB 3QYJA 1ZL0A 3RPEA 3GPBA 3LUBA 3I1YA 4LZWA 2RGRA 4S12A 3EGEA 3ISVA 2Y99A 3VU1A 4B71A 1U6IA 3PI7A 5KDLA 2VIIA 3B12A 1EWTA 4KE8A 4UD2A 1YULA 2DECA 2XUZA 4YJ2A 1RAGA 4AXBA 1FYVA 2MWMA 3RT1A 2JLBA 3FI9A 2A58A 2RH8A 1D2RA 2OAEA 2DKNA 4BU0A 4XPIA 4ALMA 2RGNA 5CK4A 4RGVA 3T7RA 5EG5A 4IDFA 1A9QA 2XYGA 2YXBA 5DRYA 4CL2A 2YYSA 1QIIA 5JYBA 4YACA 4PFQA 2H4JA 5JCPA 4CEIA 3GLFE 5A5VA 2M2IA 5HZGA 1ZKMA 1FC0A 3I6ZA 1QGYA 4QQKA 1KEWA 1T0BA 1K92A 2FPMA 3F5DA 3MMXA 5HDQA 4RJIA 3JQCA 4DYVA 4YCSA 4BMPB 4F46A 2F9MA 4ZI7A 1EJ2A 2O2ZA 3T1YB 1QHHB 4E2ZA 1KVTA 4N6OA 3VU8A 4P33A 1QRDA 1EFDN 2H18A 2Z5GA 4P3XA 1R1DA 2WFLA 3GZJA 2PX3A 5AQ1A 4ZYUA 2FPIA 3A9WA 1RKUA 2JIQA 1W5SA 4ROTA 4X1KA 4ZJZA 5EXDA 3L0CA 4P3OA 4HXGA 4C0KA 5I7FA 2BR3A 4IXTA 5DHTA 1HLGA 1NJ6A 1H23A 2A94A 4P82A 2PO7A 3T7CA 5B64A 2JK1A 1CPYA 1Z0JA 6ABPA 1O0CA 1EUCB 1UQRA 4Q02A 2H2WA 2O3QA 4J0GA 3MTDA 4Q9NA 4RLFA 2H0AA 2QN3A 2I7TA 3M2TA 3FVQA 3UB4A 3P2KA 2QUKA 2OENG 5DN6D 5IHXA 4BNMA 4ENWA 1ZLYA 4HAWA 1SNYA 3VR1A 1BEUB 4CEJB 3ZIAA 1BFKA 2E6KA 4N54A 5BSRA 4GFDA 2XQJA 5DYGA 2PKEA 1WOYA 1ZDMA 4UMDA 3UF0A 4UNRA 1JKXA 1DCMA 2QZJA 4F8JA 3QU7A 4FUTA 4JP2A 1YQQA 4MKGA 5E3JA 3TX2A 2A5FA 2QMOA 4M36A 2Q46A 2BJVA 3EYAA 3MAGA 4BEVA 4DMKA 4Z7NB 2Y4OA 1P0IA 4TS4A 4LOJA 1NQUA 3RSHA 3EISA 3HUFA 4HLQB 3N28A 2RK4A 2OZLA 1G8HA 4H18A 5I3ZA 3QI7A 4PWZA 2HIGA 4BO5A 5KEIA 1CLEA 1E2BA 3C43A 3P0HA 4QTXA 5IT9A 1Q6ZA 1VJDA 1W1WA 2XWQA 5KMGA 3REQA 3N3AC 4OU4A 5JAMA 5LXTB 1RWBA 3YASA 1NRIA 4B2PA 1MV5A 4LNUB 1MMFB 5KAMA 4Q0MA 3TW8B 3AB7A 5CNMA 1XVUA 5D6NA 4R8KA 4NDNE 3URMA 3LLSA 4D6YA 4K6KA 1YWGO 2E5WA 2WF5A 4C87A 1CVIA 4GX2A 2POCA 1SZJG 1QRAA 2DYKA 1L5LA 1SURA 4R54A 3ETDA 4A0HA 4R6WA 5TT0A 3SMQA 2FPWA 3S2IA 1F1JA 1J9EA 1GGVA 1P80A 4G89A 1K8ZB 4PLCA 2J48A 1ZESA 4Q4CA 6ADHA 1D1SA 2J7PA 2YNMC 4YT2A 1Y6GA 4E33A 3PQ8A 1XT6A 4PSVA 2BMVA 1M1YB 1NNSA 4EARA 5DVZA 3K9BA 5DNCA 2VFAA 5M5BA 4F85A 3COZA 3HGTA 1H2ZA 3P5BA 1K5GA 4J0CA 4IIFA 4LYGA 5CA0B 4URHA 2Q3MA 3LGSA 1M2EA 1Q16A 4K2HA 4QPPA 3X1YA 1GA1A 1BH2A 1G8PA 3P97A 4ZGBA 1NJFA 2V7EA 1K63A 1X14A 1IQRA 4M46A 5HR5A 1CZUA 1HFKA 3OM9A 2P1RA 4X60A 4CIVA 4CM1A 1NJ2A 4R3UC 2ZB7A 3PFBA 3S40A 3LH5A 3PIIA 2NPFA 1A96A 1TU4A 3RVDA 4NCAA 2Y92A 1NQVA 1ZD3A 3DJFA 1QKIA 3CCCA 3QITA 4L15A 3G17A 2EATA 1M8GA 3OPYB 4HLNA 1XKTA 4UVHA 1P5HA 1D6MA 1R88A 3BFJA 1SVNA 1Z7GA 3E3NA 1K8RA 3OU6A 5DH9A 5B1EA 3CBGA 2HZ7A 1H93A 5FPTA 3DVLA 1IPFA 3L9WA 2EG9A 4PC2A 5D3KA 1U3CA 4DIEA 3UMJA 4CL3A 2EEPA 1POXA 4UNPA 2NQ2C 3PLAE 2YHIB 3CW2A 4MO2A 2GH1A 4TN1A 3ZDCA 2P4EA 4J0IA 4EJSC 2HHHB 3DHWC 2R3SA 1CS0B 3K09A 4TQAA 5EKTA 1RYNA 5DWQA 3CNHA 4MYHA 2BY4A 1L4FA 5FI3A 2E18A 1UFRA 4DCTA 3RC3A 3MOGA 1VCNA 1UADA 3TSAA 4C7MA 1N8NA 5TPWA 3LHKA 2WHPA 2OLJA 5ADVA 4NZZA 3RFUA 4ZYWA 5LWHA 4A36A 1FQKA 3NPAA 4XDYA 2O0MA 3ZHSA 3VFDA 3U4QA 2E1RA 1GTMA 3CX3A 3HJUA 4OY3A 3JAKA 5EWMA 1E5LA 1W96A 2LCIA 1N2JA 2BHTA 1A1VA 1JAZA 2B8JA 3Q12A 3HKBB 3ZE8A 1DFIA 2MINA 3A4IA 5J4YA 4BY9E 1NVFA 3TSYA 3AP1A 1RHQA 2FLVA 2V3VA 2EWVA 2FR1A 2NZXA 3B5JA 3HSSA 4XM0A 3TLXA 3VR5D 4B80A 1DTEA 4C4PA 4BKOA 2G40A 3LOUA 5JC8A 3FDZB 1XKLA 1XRMA 2Q9UA 3A3PA 1QGUB 2R8OA 5CA1F 4OU5A 1K7CA 2HSGA 1WU7A 1R9NA 1YB6A 3BVPA 3PE6A 4G67A 1LQ2A 5IWAB 4HGPA 1WD7A 1WABA 1Z4KA 4WK0B 1Q14A 1GQ2A 5KVSA 4BV9A 3X2SA 2A57A 4QBGB 5AKLA 4P4LA 3HNRA 3PPWA 2Q62A 2XTJA 2X3YA 4JXKA 5CLQA 2FXVA 4ANFA 4CKBA 2V3CC 2OUKA 4F9EA 2C8JA 3KE9A 1AB6A 2ID4A 1IUOA 1YCFA 4WZBA 3LIIA 4WMLA 1G98A 2OYCA 2C88A 1J9GA 5I8ZA 4GUDA 2IOFK 1OC2A 4QXRA 3RFFA 3IHKA 4BO2A 5HCIA 4WBNF 2EDAA 1YFLA 3UQYS 4ISCA 4S1VA 5AI5A 3JQBA 3WJ1A 3OKCA 4C3OB 2WB2A 3LQRA 5DDIP 4BL5A 1FW6A 2ZK7A 1JHPA 3IGFA 2SHKA 2I78A 2Z8YA 4WZAE 3DFKA 4F92B 2HMTA 1WZNA 1CSEE 3BMQA 5LP6B 2ZANA 3F6RA 4Z86A 1Y3FE 5L7WA 2VT6A 1R5OA 1V1JA 4EQ6B 1G5QA 3EVBA 5BNIA 5KQLA 1YKFA 2DB3A 3IAM1 3NAMA 1NVTA 1U65A 2GZ1A 2AMYA 3EE6A 3LIPA 1Z6YA 5CFMA 1LSJA 1VGQA 3IQZA 4CTOA 2XOKA 4P98A 5ALJA 1QH9A 2H7XA 3MJHA 4OJQA 5LLSA 1U5BA 2OCBA 4MW4A 4A10A 3GPIA 1Q0TA 5F98A 1DWPA 2PV0A 3H9BA 5EJ2A 4UOZA 3ENWA 4HDKA 3JU3A 5I45A 1E6LA 1VG0B 3MT7A 2Y6VA 2IOHA 4KN9S 4ZT3A 1Y5MA 4XYBA 1X80B 5K20A 1U0TA 2R00C 4I8XA 4NMXB 2AN9A 3LZCA 1GQRA 5KHAA 3RVKA 2YZGA 3RIYA 1OHHA 3D7KA 3IIMA 1HQKA 1F7UA 3W5UA 2XXAB 4ZYZA 4QM7A 1J33A 1NTOA 4D9EA 3W5BA 4JQOA 3PNQA 2QSZA 2PDAA 1XBTA 4YAJA 1MW9X 1SOUA 3IDOA 4TM7A 2ZRMA 1AZWA 4YREA 1JDSA 4CUZA 4Z9XA 2GB4A 4UVDA 1BN7A 1KI3A 2WJGA 4GYJA 4BEBA 1REQA 2X0EA 3R5TA 4CKBB 5B36A 1MTOA 5TDHA 4JI4B 2JHCA 1B8NA 3MJCA 1FX0B 1KJZA 1ODKA 1T3ZA 1XEXB 4MV9A 3U7QB 4YUVA 3QVLA 4EO9A 2CD7A 3KS9A 3GBVA 3OEHD 3I05A 2DPXA 3KQWA 5AHXA 4X41A 2G7MC 1Y5IA 5EZQA 2R7MA 1Q2UA 1P45A 1PEKE 4XR4A 4ESOA 3ROGA 3RSGA 3H2ZA 2G17A 3GJ3A 4TMTA 4IV5A 5DT2A 2F4NA 1FX1A 3GFSA 4BEWA 5LD2C 4DLAA 1JZQA 2OCIA 2OESA 5DWDA 2GZ3A 1AT1A 2AN1A 5KVQA 3PRYA 4E31A 1MXFA 2X5KO 3B1KA 4O1IA 4XDHA 1IHUA 3DFMA 2RIRA 4GBJA 2BR4A 4JLSA 5IFKA 4J2HA 3QWIA 3DF9A 4XSGA 4GKBA 2HV9A 3TAHA 2FGJA 4CMHA 2B4RO 4RPKA 2BHRA 4M4SA 1YASA 2LKDA 2VDUE 4EGQA 3S8EA 3V6MA 2IHUA 3NOOA 1XMQB 3NOVA 3R5JA 4XJTA 2O23A 3LUHA 3DNFA 1Q84A 1XA4A 4C7OB 1NT2A 1U0FA 4MGEA 2PSSA 4OLAA 4C14A 4PC3A 1GTJ1 3GFQA 4HKTA 3CH4B 1R66A 3DZBA 1E9FA 2XVYA 5AW0A 3GR6A 2Q2WA 5G0TA 2EP7A 3O3OB 2QTNA 3BM5A 3EDMA 3WYGA 4CQMD 4CI0B 1GO2A 3CRMA 5IKXA 3ND9A 1NBMD 3DFFA 4GAEA 5EVCA 2A59A 4LZAA 3RRZA 3LC7O 5FWNA 1CVRA 3E84A 1EK6A 2JANA 1JFSA 1YJXA 2VPTA 1XWWA 4QJIA 2Q9AA 1YH3A 3TDMA 1Z68A 3ITEA 2AG1A 3JQ9A 3S29A 1KXZA 4DZTA 4EY6A 1KIFA 2VAVA 1E64A 1TECE 4FMCB 1TVEA 1G7TA 2PJRA 3N7UA 4X7MA 4GH5A 1SAYA 1GFZA 1YVEI 3N8KA 5DGDA 5F23A 1TU3A 3IYLW 4QTZA 4EI7A 1JVSA 4U1RA 2Z08A 4JI7B 1EFVB 3D3JA 3IPXA 4PQFA 3U4IA 5T4BA 4XB2A 4EDHA 5ICGA 2Q5HA 4LYHA 5U4XA 3BMCA 1N6OA 1PR4A 2OHOA 3ZXSA 4B7XA 3TGPA 3AFOA 2FDXA 2BAGA 2ZJ8A 2DFVA 3B6MA 1KS9A 1BJKA 3OT1A 1DLJA 3PA8A 3DZIA 4G3XA 5K3BA 5BUQA 3CNBA 3ROMA 4DBLE 2C4WA 4ZT4A 1NQAO 3NDPA 1NLMA 2X41A 3DMFA 2Z98A 3DAHA 4Y7DA 1OQAA 3QH4A 3AHCA 2VZ9A 1FTWA 1PLJA 2X0NA 5HKKA 3TNJA 5JNRA 3R6GA 5EE5B 5TMDA 3LRTA 3AGPA 4WKNA 1PWZA 1X15A 2ZTSA 2R8PA 4XB1A 5U1PA 1XL1A 4MRSA 4JD5A 3MJ4A 1F48A 3WI7A 3WWOA 1P2DA 5D3ZA 4E14A 5CITA 1LI5A 5HP4A 1RTTA 2WKWA 4JIMA 3QPUA 1I9GA 3D4BA 5CDSA 2RJ3A 4AMVA 2G9UA 3DJYA 3RIMA 4LBYA 3JWGA 5AO9A 3HRKA 3RB8A 5G02A 1EK5A 1ADJA 5CNIA 3OY7A 1W88B 2E4ZA 2VHTA 4PSAA 4C0LA 5IH3A 2WINI 4MV8A 1H2YA 3H19A 4YV1A 1PFWA 2CDNA 2NYUA 3N53A 1A4RA 2Q0XA 2ZRHA 2XODA 4IWNA 4O2AA 3KR0A 1JG7A 5H80A 4LF9B 2BGNA 4TGLA 1C7IA 1L2TA 4QUBA 1XQ1A 5HK9A 3OA2A 4H2DA 2FP4A 5ITVA 1II0A 1ZRHA 2VR1A 4PSDA 5K3SA 1OFUX 2E4UA 2JFBA 2JGNA 3FF1A 2HK9A 1DBRA 3LK7A 3GEBA 1ES9A 1QG2A 2AMFA 3D6MA 4ND1A 2P2GA 2J3LA 3PU6A 5DCUA 4UM9D 4FVTA 4EZEA 1UXIA 3A2MA 3HR7A 3S2FA 4Q7MB 1VLHA 2A86A 2QHXA 3PJDA 3LVBA 1W34A 3UICA 3DOUA 4HGRA 5AW4A 5DM0A 3D6VA 1RYYA 4EK9A 4BV2A 4D3DA 3F46A 1PV1A 1E9VA 1L6IA 5H3CA 2GZDA 2QNRA 4F38A 5ALOA 4BLWA 2WC1A 3R6DA 2P9GA 4DNPA 1DCKA 1D2NA 3C1UA 1OXTA 2W2TA 1I7QB 2FPIB 2PK3A 2W37A 2GLXA 4DWJA 2R62A 2DU8A 3F49S 4KUHA 3OJWA 1OAOC 4OFXA 1JPNA 5AKJA 3E61A 4HC4A 1U7XA 4HDOB 5ALFA 4J7XA 5KOIA 3NANA 1XMJA 1YZVA 2JIOA 4HAOA 1IWPB 4L76A 5K2OA 2ZBDA 1XNQB 4YUZA 3C8MA 3G68A 2Z0MA 4KW7A 4QOFA 1G0NA 3BYZA 3FN4A 1W85B 3F8TA 1AGPA 4ND8B 5FOTA 5KNDD 1TW3A 1IXRC 1GQOA 1UBSB 2WM9B 1WXQA 4NWIA 5ERXA 1EM8A 1YI0A 2XDAA 5MN5A 3DFUA 1O0BA 2QTVA 2YX1A 3CC8A 5C8ZA 3KQYA 4EOGA 1UEIA 4HUQB 3WFJA 1KYTA 1D1PA 2FJPA 2QQFA 5M2QA 1TYAE 4LJYA 5FV7A 3HDQA 4C3UA 5J4VA 2BTQA 2QAJA 3JQ8A 3ROZA 3N7AA 1Y8ZA 1UKBA 3BF8A 2AI1A 5ENDA 4GIBA 3GU3A 1HRDA 4Q3CA 3ACBA 1QHGA 2IGTA 3RTBA 3D7RA 3PNYA 1OVGA 4NX2A 1NVBA 5C7OO 4Z1OA 1HE8B 3HUUA 1V7CA 4IJ6A 4MJ7A 2V58A 1ECFA 2G5CA 1XRSB 3FVTA 3SI7A 1CNMA 4KMSA 4D5EA 1GGNA 2JJQA 2A9PA 2C3UA 3BXEA 5TEWA 3GT7A 3TIFA 1ZL2A 1JHZA 1V4BA 1E89A 1FP4A 4IO1A 1IC6A 1NE7A 2QGFA 2QW0X 3BXPA 4KQ6A 1TIKA 2IH4A 3CV3A 3GJ7A 3CU5A 3L7NA 4DABA 4D9HA 1NURA 4ZYXA 4MI1A 2CXHA 2QLFA 5M3BA 3DZDA 5LU8A 3G1WA 4AC9A 1K7EB 1RCTE 3RADC 5CD1A 4L1KA 2WYWA 5L9AA 3D7SA 3GARA 3QUSA 4V38A 2PZKA 4MWTA 1X7XA 4DCVA 5FV4A 2A92A 1C1DA 4OHFA 1ESEA 4ZVVA 3UANA 2HBZA 5J59A 4P5DA 4QG3A 2Z9BA 4TV9B 5JAHA 5I8WA 4DA0A 2NACA 2X3FA 2QS9A 3KT6A 1ORDA 5JBIA 5KZMB 1KA9H 3CRZA 1I8TA 4Q9LA 1PGQA 3BWBA 3KZ1E 1CR6A 1QRTA 2PV7A 3GRUA 1GJRA 1NF8A 4X8HA 1HG0A 1CY1A 2Q50A 1E9RA 3GELA 2JPDA 3OZGA 3WFZA 3ZY3A 4YP9A 4A91A 4EX6A 5B57C 3QQPA 4EHJA 2Q3CA 1CW2B 3D5QA 3UJ9A 4CXMA 3IAS1 4RJJA 3RT9A 1QYCA 1UM9A 3EZ7A 4PBTA 3OP4A 1W2WB 4GXNA 4RA9A 4L51A 3K9CA 4IBOA 2RH4A 4CKEB 1ENPA 4CLHA 4NJEB 2UUOA 3WAJA 1L8AA 2W8BB 1LK0A 4UHJA 3T3PB 4KK4A 2C9CA 5JS6A 2OO5C 4KUGA 1JN0A 1REQB 4MDFA 3HVUA 1OYWA 2QRZA 3V8BA 5JAIA 2HPZA 3F1KA 1DZ3A 4AN0A 2ZUDA 1SXHA 4REOA 1L8XA 3AYZB 3AF6A 1UP7A 4AJPA 3CX7A 1PE0A 2RH5A 4A6PA 1HT1E 1BN6A 2QKYA 2XWSA 3OX3A 2C5LA 5LD2B 4CFYA 1GTL1 2FN8A 2VA9A 1K6IA 2PJDA 4XE5A 5KSPA 2B1GA 3W7AA 4BDSA 4C29A 1KJ8A 4G26A 1E4EA 1ULSA 3H5LA 3FPHA 3N0XA 2ZI6A 4Q3BA 3L7MA 4ZVMA 5J5CA 1O2DA 5IKOA 3KSRA 3WO1A 3ZIDA 5F3RA 5T41A 1PZXA 3RQSA 1BRMA 5GONF 5BNWA 1FFWA 121PA 1H4QA 1UBKS 3IUMA 3UA4A 4QHYA 1WZ2A 2JHGA 2YQ5A 1SJ9A 1J23A 3UJHA 1XDDA 3OQVA 3DEJA 4HAVA 4OQNA 3ZJYA 3G9UA 3LY9A 1X87A 2AJLI 2ZLBA 5DX1A 5I7VA 2EZ8A 1KDOA 3HRHA 3GEMA 1HE3A 1O94C 3TD9A 1JUDA 3E1GA 4HUQA 2X19A 1JKJA 3HP4A 1T3TA 2OBFA 1NU8A 2C2BA 1VIDA 1JT9A 1XXHA 2YWRA 2I3GA 3A0RB 2ZPUA 3PK0A 4NG4A 4RA6B 5AXDA 5LYYA 4ED9A 4EO7A 4OUDB 1O89A 1E6UA 2C2YA 2CHVA 2IYSA 3KPWA 1PG0A 3BJRA 1WNTA 4QHSA 8ATCA 2CJXA 4GP6A 3K8QA 2ZM5A 2VJQA 3RWBA 4I46A 1XAIA 1UL1X 5IT5A 3I1IA 5NLLA 4L6IA 3JYNA 3KKNA 3C3CA 3DTNA 2GOYA 3A1FA 4TV8A 2OGWA 3EVFA 3H6HA 1FFEA 2BIFA 3L05A 4LSGA 2I6QA 2G71A 1E8MA 3WLIA 2DX7A 3QKTA 3Q7SA 4R9RA 4EIWA 2VYNA 4J90A 3FJOA 1PW5A 1U8TA 3ABSB 3A4NA 1L7NA 2NAPA 4MVJE 3SBOA 1QG6A 1S9DA 4NE9A 4HPJB 3RUCA 2KW5A 1Z62A 4ZDKA 4BEJA 1IBMB 3HFSA 2YV1A 1ICEA 1OFHA 1DBIA 1CEXA 2AZMA 2E4XA 1N0HA 2C9YA 4Q1DA 2PGLA 2PX6A 2VOEA 2XQVA 1TUGA 2RHRA 3EH2A 4GLBA 5B1SA 5CX1A 1NXOA 4BP8A 4PAGA 3DLHA 1KRWA 5AUPB 4TL6A 1MLDA 4DNOA 3PUWA 4QZVA 1NAIA 5TQ2A 5CH3A 2KMLA 2DPLA 2MHCA 1ZNYA 4KGXA 5JXGA 5DEOA 5KYNA 4U6NA 4ND6A 1Y1LA 4YI5A 3V8RA 1TM1E 3FETA 1XCGB 3BE5A 4NBVA 5HG0A 3VBCA 4GWKA 4CETA 2MINB 3H86A 1XJWA 1G3RA 1JR3E 1U9YA 2R6AA 3D59A 3BHJA 2XCIA 4CM3A 3PRKE 3E15A 2XCRB 1IBSA 2LNDA 4D26A 4XGNA 1M0EA 2R68A 2FQ1A 5CLJA 1WHTB 2YINC 3PICA 2IPLA 3CUKA 3Q0IA 3O95A 4JT8A 4XLZA 1J8YF 5T6BA 3T95A 2GF2A 3KR9A 3MCUA 2F8LA 4L3WA 4NZOA 1VKNA 2VEDA 4FFBB 5FOWA 3NRJA 2YJ3A 2V4ZA 2UKDA 1WF3A 4NONA 3FIUA 3ROEA 2NNLD 3KOWA 3M83A 1TTQB 3M4NA 5A6SB 4M86A 3GMTA 2HUNA 4ZCRA 2O2EA 1C0LA 4Q37A 2X0JA 4IFEA 3SF8A 4ARUA 3IXQA 1G4AE 1T9HA 3EG9B 2C4VA 3N75A 2X2PA 3HUTA 2Q3FA 2XQIA 2I8LA 3FCEA 2WKQA 4XCQA 2BKUA 2FMTA 2G76A 4BUJA 1OLXB 4DR2B 5A1TA 4BRZA 5BUCA 4JWTA 1GZVA 4ZQHA 2WNHA 4H35A 5F35A 1E94E 3HXTA 4JI0B 5JYCA 5GZ6A 4DDHA 2FQQA 1DXOA 5EESA 1JHUA 2R5WA 3AHIA 3O1JC 1NG9A 3TDNA 4E5VA 2QN8A 3N76A 5B4VA 3ZE1B 4XIIA 1ABFA 4H1HA 4UJ5A 2V8OA 1M66A 3ZLVA 4GZ5A 4QFMA 3K31A 3RUFA 4BBAA 821PA 4IV8A 1N7GA 2ZYDA 3DDSA 4IOJA 4NJMB 3VYSB 1XTZA 2HF8A 4PAQA 4RJKA 3ICOA 5CHYA 2FW9A 4DVJA 1X70A 1VE9A 1N8SA 3FCYA 4X90A 4BNJA 4F3YA 1NN0A 3T5BA 4BLRA 4YT5A 2SKCA 3L92A 4QX6A 5DYIA 3WZMA 4BNKA 3IQEA 2ZT7A 4NEGA 2EJWA 3BZUA 2QRMA 4JJFA 4JL8A 4RNDB 3ESZA 5CXQA 1PX0A 1QIMA 2GUGA 2LDBA 2ZW9A 4MIKA 3K6SB 5AXAA 5GIPE 1Q1QA 1WXGA 3M4XA 4R2HA 1QGDA 1KEVA 5E9WA 4V0QA 4Y6SA 5J1TB 1Z6GA 2QZPA 3OIWA 1SKMA 4XDGA 5CH8A 4MR7A 2VJPA 1SD2A 4J49A 5LMNB 1DIHA 4PLYA 4OQMA 5T8KA 5AVZA 3H1BA 1VJ0A 3KYJB 4QE3A 2WJYA 3QA3E 2QTRA 3KXKA 3O3CA 4HXYA 3WKBA 1JDBB 1ZM4A 4Y2GA 4BQIA 1YMVA 2NTEA 4TS3A 4AG6A 4UFPA 3P4UA 3O7WA 3LO5A 5TJ9A 2NZ2A 5FR1A 2TMDA 3O9ZA 1L5SA 2C5HA 3FUUA 3ZHBA 3IKJA 3WLTA 2HRCA 1P7YA 1QVVA 2JHFA 4IFIA 1CEQA 3KL2A 2FG5A 5BYAA 4HL6A 4JVSB 1E4OA 5A7GA 3AK4A 1DEKA 4I14A 3G9TA 2WMOB 5BOVA 1T1GA 1P77A 3RFTA 1VXRA 4MQEB 4BMXA 4HR7A 4CW7A 2J3IA 3FGOA 3KT8A 1QDUA 5LP6A 3CVUA 2QT0A 5LZ8A 4EPXA 5I48A 1J2TA 5F7XA 4JU8A 2ISSD 1ATZA 1T36A 3GRVA 2AW3A 4MRPA 3B2NA 4YRSA 3GN1A 1JG3A 2G6BA 4X0EA 1FVFA 2QBYA 3M1LA 4AZ3A 2GVDC 4HQRA 4JT2A 4RM3A 4D2IA 5ALUA 1M34B 3SFTA 2R85A 3CTPA 4CE6A 3BULA 2LD4A 3KO8A 4IICA 3SFZA 1G38A 2VQ3A 3KXDA 1N2SA 1BMFA 3IQXA 3TTSA 1MOQA 2Q5CA 3RUPA 1EKXA 1DWOA 3DVAA 1N5JA 1N8KA 1E3MA 3U26A 1LBSA 1PJ3A 2GZMA 2MYTA 2JCVA 4WXRA 1TX4B 1HTBA 3MAAC 3QMMA 5DB4A 1G5RA 3VR2D 3ABQB 4F5ZA 4KLRA 4D8XA 3PKJA 1C3JA 4HH1A 4YPOA 5I7EA 1BG6A 3HCCA 4YIKA 2RCNA 3FBTA 2A5DA 3ZV6A 5SV2A 4JLPA 1DNPA 2F1IA 4CDGA 4OYLA 1VG8A 5B3KA 2YR0A 5EHIA 4IX1A 2ERYA 1NMXA 2QAGC 1Z8DA 2GEKA 3E4DA 2R1UA 3HPRA 3PITA 4IJVA 5FFMA 1E3EA 3ZWCA 1MA0A 4AIIA 1EGQA 4OCZA 5F4ZA 5LDGA 4YUYA 4FXPA 2C2XA 4KUEA 2FYTA 1MABB 3FR8A 1D8AA 1PJ8A 3A58B 3I9OA 2ZU6A 4GQIA 4JC4A 5DSTA 5EQFA 3RAPR 3KDSE 3T7JA 4MNTA 2AQHA 3FSRA 2K2QB 5LOVB 3UFXA 3SZ3A 1H65A 1RYMA 2BMDA 2HFJA 4N3BA 2QP9X 5F76A 3AHGA 1TYBE 2DFKB 2Q4EA 3JXEA 4KSCA 4BNWA 2DEUA 4OGWA 1H3NA 4UBOA 1B6GA 1FP7A 5HUHA 3KSAC 5BN3B 1E7WA 1U5BB 1K6JA 2PMDA 5EMKA 4XVQA 4B3DA 1XF9A 1U0BB 2QLJA 4YMIA 4BE4A 2XLBA 5B1DA 1HURA 2J1LA 1JH9A 1UZUA 1G8SA 2XTNA 1EBUA 5E0KB 1YSCA 3M81A 4DXDA 2WWTA 1JLLB 5DNUA 3AL2A 2VF4X 3PLNA 1J21A 2NZ8A 3HCNA 4URFA 2QSJA 1J25A 1DEAA 3OEYA 3OJLA 1BWPA 1FEZA 1IHOA 2HIAA 4H0NA 1IFXA 3QKRB 1JALA 4KAFA 1KAGA 3OFKA 3OZFA 2P9CA 3QUBA 5DCLA 4UKDA 4ZO8A 5G3YA 2P3LA 5A2QA 5JBQA 3P32A 4LI0A 3AX6A 3RWMB 4E1VA 2PSHA 4NC9A 4HBZA 1AK1A 1GWNA 1NLFA 4NTZA 5JMTA 3S8YA 1H2EA 3PNPA 4OBXA 4AF7A 4B3TB 2CL0X 2PRZA 1GAWA 3LXMA 4XWWA 1KOFA 1N9GA 3ES9A 3GDHA 4K7JA 4K9LA 1WY7A 1BE6A 3JQQA 2OD9A 4C3ZA 4RGYA 5ITZA 5BY2A 2DPYA 2ZAYA 3KSDO 3NM5A 4BVJA 3FB4A 1WB5A 4EW1A 5KC8A 3COPA 2DTEA 2JH3A 2NUBA 2ZWIA 3DULA 3KVNA 4N6GA 4ZVPA 3RJTA 4CM9A 1AHPA 4P08A 1I01A 1GCOA 4NOJA 3U3XA 4D3ZA 3N8NA 1F2UA 3W79A 2HFKA 2Q8NA 3HVRA 4GICA 3UJ8A 3FDXA 2A9KA 4ZODA 2WWYA 2IYNA 3DTYA 2JLWA 4C4TA 5EZ6B 2CYAA 3BIFA 3L7JA 4ZT6A 4YRQA 4MRAA 2BFPA 2J45A 3WMEA 2XMQA 2HLPA 5CVJA 2PRSA 2HQBA 3SMVA 4ZI2A 2XOEA 4NXNB 5E1DA 2IPOA 4IOMA 4ZCMA 5IDYA 5K8VA 2F1HA 3EQ8A 3JV7A 1QIKA 3MT0A 5EAIA 1GFSA 3QKWA 2PR2A 3LP5A 1UC4B 3H4IA 4QFDA 3P71T 1BGVA 1H85A 4AKGA 3B9QA 5E6RA 3RJ5A 4RD2A 1RM3A 4F4UA 5T3YA 2YWDA 3ELDA 1AF4A 2VXYA 4XD7D 5E4JA 4EGFA 2D06A 3S44A 4D9IA 3B8EA 4C7OA 2P41A 4JB3A 5GONA 3OQIA 3PDUA 3QHQA 3WP0A 2W98A 3D0RA 4DQVA 1MAVA 3LQQA 4GI7A 2YUTA 1G21E 4OTZA 1L1FA 4JVNA 1W0KA 2YHIA 2AZXA 5DGXA 2QR2A 1G6Q1 1M6VB 1XNHA 2QVCA 3JZAA 4CQLB 4EABA 5JOQA 1O54A 1VRWA 2RAVA 4ZOAA 3GZNA 1G3IA 3CTMA 3H11B 4GPD1 5COBA 4MYCA 4L8LA 1KBZA 4DDWA 4A8PA 1GR0A 2ZT8A 3U61B 1YZQA 3P0FA 5I6DA 1G64A 1HE2A 5BV0A 4KPUA 2JVIA 4HO1X 1DLIA 1XELA 3O8DA 1YR3A 2II6A 3OU2A 2PZFA 1KVSA 4QFCA 1UBEA 4UEOA 3IX7A 4QBKA 3ABOB 5GM1A 3HDVA 4BU1A 1LF0A 4D81A 1A71A 3SR0A 3MTQA 4BNVA 3PDIB 4PQRA 3CKYA 5GINE 1J4AA 1XAJA 4HNQA 1G8JA 1DE0A 1V5EA 2CDRA 3F78A 3KSMA 3OKPA 1JU3A 3ONWA 5EWJA 4A2QA 1NFRA 3HJCA 5HMLA 5JVDF 4B34A 3THRA 4HAZA 4FDAA 4Z3DA 1G59A 1EXDA 5LVAA 1WXXA 2C4NA 3PRHA 3ZIUA 2I5PO 3HQ4O 2GLTA 2Q41A 4OIFA 3WKCA 4QUKA 2J6BA 3VVMA 2ZBVA 1GPAA 1NVWQ 3LU1A 4HPWA 5FBZA 3SYNA 4DOMA 1AXRA 5TGDA 3HBNA 2FW0A 4HYQA 3IDSA 1AKTA 3L6CA 4P7JA 2JGAA 1GXSA 3JRWA 1NUAA 1V1RA 2AX4A 3G2QA 3CEMA 3GFTA 3QPAA 4LY0A 1AU9A 2IDZA 1J5EB 3ZXIA 2XGJA 2DY0A 3WVNA 1UT8A 1MRSA 2CYBA 2MMCA 3ADBA 3WLOA 5J63A 1ZEMA 1NXXA 4ZCTA 2UYGA 1ILWA 2O06A 4A6XA 2EU8A 4C21A 5HKOA 1H42A 2ZSFA 5AVRA 5K8CA 4NHOA 2UXDB 4MKHA 5JV5A 4IHJA 2VVTA 3QMWA 4MUBA 2NPIA 4U7GA 2ADFA 1Z0IA 4Y7CA 3UHPA 3V8NA 4ZMBA 2Z6AA 1KL7A 5IC5A 3WJAA 4LCEA 2J09A 4ZU6X 2CB9A 2OTCA 2QORA 3TPZA 1C3OB 1RYZA 4L4UA 4QGGA 3AH8A 3RARA 4AW9A 1HYEA 3MSXA 4P32A 2X0FA 2G1UA 4HQNA 4XVUA 1IATA 2IF0A 1NBOA 3GUZA 5ERYA 4A7PA 1ULZA 3BICA 3PCXA 1GHTA 1OE0A 2ZQYA 1JQBA 4RFSA 5A9SB 2MT9A 2GEFA 3O31A 3UY4A 3ME5A 1X9GA 4R0MA 1Y8CA 2DWPA 3N86A 4HX5A 3S28A 1SC6A 1UWCA 3IBFA 4AKEA 4J7AA 1EXNA 1J1ZA 3L4BA 3Q6IA 3K4HA 4ZYLA 2ARKA 3VH4A 1AA6A 2BI7A 2ZRBA 1K88A 1H5UA 5KYTA 2AR0A 2VNSA 4L4SA 1TAGA 4IDOA 4C4SA 3EPRA 3R75A 5HILA 5KNBA 3OX1A 2OFFA 4FGWA 1GP2A 3GMIA 5SZKB 3AEKB 2QTMA 3EQ9A 3MJEA 4ZO4A 4TLLB 5G41A 2WTXA 2XSZD 2QM7A 3TLJA 3PC6A 1T8YA 1FYXA 2R7AA 3AV3A 4XASA 2UXBB 1L4YA 2YWFA 1YO6A 3FWNA 4DLBA 5EJAA 4HNUA 1K2VN 3IQIX 3T7AA 5T3UA 5JPDA 4O4JF 5CB0A 3ADOA 2CHUA 2P40A 5KCZA 4RENA 1ZNZA 3B2EA 5DCYA 3NBZC 1ZC3A 1GZHB 4M37A 2A9JA 1XLUA 3OIGA 4JFAA 5B1YA 4F4IA 5LNK1 2BSXA 3AFIA 2J7PD 5AJYA 1IM2A 1FS6A 3EXAA 4IW3B 1OB2A 4AY5A 5L51A 1HOTA 2YMMA 3VKVA 2CZQA 3WGZA 4R2JA 1MJGM 3OJXA 2X6QA 3CFYA 4AU1A 2VDVE 3GFPA 3WYBA 2A9RA 5CVDA 3PA6A 5ERGB 1V1MB 1KZHA 4PC7A 4P83A 4KX3A 4CV0A 1NGSA 3A6EA 1GU7A 4AULA 4ZO9A 4BN5A 1UC5B 4O2AF 4BJ3A 1CFZA 2Y2UA 2DFPA 1FQOA 1RXSA 3JZFA 3VISA 3KJFA 4J76A 4J0JA 3S0JA 4NNJA 1BKYA 4MPRA 1Z0ZA 2H8GA 4AB1A 4LF5B 3OJ0A 4MVJG 4L8WB 4K6CA 1MABA 3L6RA 1N2GA 1E3LA 3GWZA 2YJ5A 3OQ6A 4IHQA 4R51A 1Q22A 2YHSA 4GX1A 1EFRA 3L1VA 5JG7A 4BMNA 4YHHB 3VPSA 2HMYB 5EXEA 3UNXA 3WXMA 1UBMS 4WLNA 1IDOA 4BKRA 3H8WA 4Q1FA 5J4HA 4E5PA 4ZEXA 1VIAA 3FJYA 3PBKA 1GSOA 3LUDA 5ER6A 3W5CA 4INAA 5FWXA 1XGKA 2QE6A 1G42A 5LXTF 3CGGA 2H4YA 2ZRPA 4LJAA 3QF4A 4RKEA 3M89A 1SG0A 1U4OA 3K8OE 4AP9A 3U44A 3K9NA 4HBGA 5BSUA 4LTDA 3VC3A 4LXGA 3W3AD 5F2NA 2GAJA 4NEHB 1BKDR 1KK1A 3C3KA 3SBXA 1M1XB 4JKIA 3RYIA 2JAUA 4FD2A 5JMWA 1DQNA 1RWKA 3Q7EA 1Z29A 2W4IA 2HRRA 5L6MB 3AUKA 4QVGA 4EJ6A 4U2EA 1X2EA 1WAMA 1BHO1 3E82A 3LL4A 4FNGA 1FPQA 1L8OA 4YR9A 5LQMA 1PFGA 1L5OA 3D4PA 1B43A 1I0IA 3NUQA 3O8BA 2N42A 4FQ5A 4E5YA 1FLAA 1GUYA 1I0LA 2HUPA 4MH0R 2VLIA 1V8PA 2Z9CA 2W83A 1UC8A 2HM7A 4BC1A 2OBYA 2J59A 3SSAA 4F21A 2WZDA 2FG6C 3L0OA 3LKVA 3R3VA 4ZAYA 1W94A 2KE5A 3HXKA 2QN7A 2NP7A 1AMUA 3FY4A 3OZRA 5EZYF 2XB6A 3DEFA 2NUAB 5JZVA 1TTTA 2JKVA 3AR5A 3U9SA 1UDCA 4MV0A 4ZYVA 4WCFA 5CW1A 2GJAA 4N12A 4DG9A 1VECA 4RFLA 1LF5A 1GZ5A 2O3RA 3WQSB 5TMPA 3KUUA 3N8HA 2C29D 1X3SA 1DJOA 1WZCA 2NSYA 1CY8A 3PSAA 4DJJA 3GF4A 1YJQA 3HO1A 1JHYA 2F1KA 1BMDA 3A05A 4HATA 4W6ZA 1EWYA 5FTWA 1K27A 1W0CA 4B6SA 1Q11A 2B34A 1G17A 2H16A 2R8YA 3OCXA 2FU5C 2UZ3A 5EGNA 4BFTA 2WJPA 1KI2A 1RJ9A 1IRXA 2DERA 2GA8A 3BGVA 2JFUA 3OVMA 2WSMA 3DQZA 4RVDA 1E3SA 4L7VA 1VA5A 4I7EA 2YMQA 2V7TA 3OD1A 2GILA 2VRCA 3RNLA 3GLUA 3LUCA 2H1SA 3RS8A 3TTXA 2I91A 1WV0A 3GD7A 5FOXA 3QKIA 1KH2A 4FYMA 4J91A 3N87A 3WO0A 3QF7A 3O8QB 2P4SA 3RABA 4MWDA 1TM5E 1P3Y1 1AXEA 2VP9A 1ZVJA 2V3WA 4OB6A 3A1EA 1FRNA 2OVBA 3LY5A 1FF9A 3W2EA 5BWBA 1PL7A 2BUBA 5AXBA 4QYIB 1EUCA 1T8WA 4UDNA 3SD7A 1EP2B 4NJMA 1CS4C 4OQDA 2X4GA 2QMHA 1CR2A 4BDTA 3HP1A 4MVJP 1PD1A 1L4EA 1CIVA 4KX5A 4ZAXA 5JAUA 2ES4A 3LO8A 3L06A 5BP7A 2XOXA 4X00A 4OAPA 1A5AB 4F9TA 3W2TA 1GARA 1ZLXA 1DBVO 1SZCA 2K7ZA 2N1MA 1TZ2A 4DARA 3UVEA 4NULA 4Z53A 5J1SB 3LV8A 1G20B 3AXTA 3BRWD 3N9IA 2GFHA 2HU8A 2IXBA 5HBRA 3ZVKA 4S0XA 4RKFA 1SXJE 2G4CA 1X13A 2CVFA 4Y2YA 1UEJA 2OXTA 3Q41A 3PC8A 1QF9A 2GYUA 4BFLA 1MZPA 2OAP1 1N5IA 1XDZA 3ELUA 3IMGA 3NV9A 3ZHVA 1SUDA 4MIYA 1FU7A 2UYOA 1SOMA 2CXQA 2XY4A 1M1NA 1KFJB 2EKDA 2GM3A 4KH0A 1IOZA 3BZBA 2ZBPA 1EYZA 3VZCA 1DT5A 2BEVB 3HDHA 5TF0A 1CZLA 3G8YA 1RC0A 3TUIC 3OJEA 4EKIA 3TI7A 2Z9DA 1YK0A 5TX7A 3OUUA 4G4SP 3RVSA 4AT1A 9MHTA 1YRQA 1Y4ZA 2I34A 2ZDHA 5LJLA 4L0DA 4GKAA 4QEDA 3VR3A 5IFLA 1O96A 1OTXA 1RAAA 2ZSEA 1SVWA 1U1FA 3DUFB 4L72A 5HZHA 3ZEAA 4WLOA 1L5FA 4HWRA 5TPZD 1FPMA 1VA4A 3GHYA 3QJYA 4JYCA 1RJGA 2COUA 1TT5B 1JX6A 2YNMA 3GY0A 4LJKA 3MFYA 4M1SA 5LZ7A 3V80A 4DSOA 4EA8A 2O14A 1U0JA 5LYJA 1YZGA 5AW9A 1CEEA 3SPXA 3B38A 1CQIA 3BL6A 3E7DA 3WNQA 4Z4CA 2H85A 2WFZA 4U9IS 4TLMB 5K3CA 1U2TA 2VRBA 3ORYA 4JR2A 5K1ZA 1LNQA 2IQ5A 1JR3A 2Q07A 5AW7A 2HD4A 3F6SA 4PPNA 3TPCA 2I6SA 5AVQA 1T0PA 4JS0A 3WA6A 5JQGB 3BA1A 2OZPA 3ORQA 4HNGA 1LJUA 4KGDA 3GFVA 3QXJA 1WHSA 3ASZA 2IH5A 1CZHA 5EEGA 3V8EA 2J07A 2YVUA 3BTOA 3WDKA 1QYXA 2EZUA 2MYNA 2PPVA 2ZIGA 2AFHE 1P9OA 5DRTA 4A0RA 1RXCA 3USES 1AD2A 1KMHA 4C9BA 1G66A 1IZYA 1C0KA 1RYBA 3MIZA 3UW3A 5KKNB 2CKMA 2FUNB 1U80A 1Z07A 2QEQA 4UMEA 3UMRA 5LL6P 3COSA 4LJLA 1P74A 1XD8A 2A7XA 2HB6A 3DVQX 4FMDB 4INZA 4PCVA 5E4YA 3UZUA 3EA4A 2RHTA 1E0KA 1DHTA 3NATA 4IS2A 1LPSA 3HKDB 3OZCA 5C37A 4NLLA 4EPVA 2EWWA 3VOTA 5KTRA 4WY5A 1XNJA 1Q20A 2P9ZA 3L01A 4NK5A 2V7BA 2DR0A 1IXYA 1UH5A 4ASUA 4YMVA 3MVEA 3EGXA 4HQOA 4EB6A 1S3FA 4IP0A 4NPAA 4R2IA 3O8QA 4N1AA 3RIGA 1L9XA 2HSJA 3VMFA 2I29A 1TU0A 2QF7A 3QTLA 1CUZA 2HEGA 3SP1A 1US8A 5TLSA 4OB8A 4H16A 4KYUA 2H9IA 2YUIA 4ZGGA 3PGLA 4R31A 1Z2OX 4C0AC 5C46F 2B7LA 1UBGA 3K4QA 3OEHA 5M7EA 1RAIA 3GFOA 4IKPA 2ZITA 3OI7A 3MT9A 4PSKA 1U7TA 5I9NA 1XYVA 3FYDA 3HO6A 4ND5A 5CDHA 1ZC4A 3FWZA 5AM4A 5L4SA 1JJIA 3C3BA 5JS1A 3T61A 3EXFA 4X1IB 3CMMA 3QFTA 1XIVA 1E2UA 3IDQA 5IJ0B 1NBWB 3AEUA 2YJ6A 2XOKD 3IC5A 4EYOA 5MN4A 3HN2A 4YR7A 1VSTA 5LZ9A 4Q7QA 1VTKA 1R16A 1LX6A 2P3SA 3OTHA 4K87A 4L2IA 1KY5A 3SFVA 2Z2KA 2C9BA 4N0QA 2HNKA 5C8YF 4ME6A 3LGAA 2W2NA 2BGWA 4JLOA 4BNZA 5JISA 3H65A 3EPLA 1PT9A 3PR2B 1DOHA 2I33A 3PRJA 4KLZA 4NBSA 1KOLA 2GN6A 1N57A 4RHXA 3ROXA 3FDFA 4B48A 5JHHB 2BEKA 3PQ4A 5JH7B 3NFYA 1ZD4A 1JFFA 1TMOA 2G4LA 2W8BA 3KOZA 4D4HA 4Q15A 1QOQB 2A1UB 2QL9A 1I3NA 2QJRA 2YVLA 4KMMA 5AK3A 5IEJA 3V2HA 3R0XA 2QP3A 3EVTA 1DARA 5IUNC 1O97D 1LTKA 3A26A 5CR9A 2FH5B 3R7BA 5HZKA 2TMGA 1DG1G 2VJBA 1B2LA 2CFRA 3CINA 2GM5A 3LY7A 3NNNA 4LYFA 1WPQA 4P34A 3CE9A 5IN5A 3AL0C 3F47A 1U98A 3UH1A 1T1EA 1EVYA 5COQA 3WFIA 3PUZA 4OXIA 3KFXA 5EVJA 5LBIA 2YVKA 4CKWB 1E6EA 3TTYA 2JD2A 1FSGA 3HNOA 4FNAA 1NC1A 1O58A 3TR6A 1U3DA 2R1TB 3KLBA 3ESBA 4EUKA 1GSIA 1E0SA 2G0TA 2HCFA 3KTAA 2FNAA 5HTKA 3VHRA 5I9LA 4O2RA 3TQIA 1YR6A 1XKXA 2A4KA 4KIGA 1GAQA 4LWPA 3UV6A 3Q6NA 1L8LA 3RCBA 5FOQA 1M1YE 1U8CB 1ZH0A 4GPIB 5E9AA 2WBLC 4M76B 3LK6A 2BDEA 1AUQA 1GN9A 3OECA 1YJBA 3BDAA 3LQYA 3HB0A 2IYQA 1GG2A 1OU0A 2J87A 2X9VA 1FSPA 3K5WA 3DL2A 1M6YA 4PLHA 3ADPA 3LSYA 3VZBA 4JOQA 4TVBA 2HDHA 1ZJ5A 2PYIA 3I32A 3IAFA 3DOCA 3MWGA 2WWVD 3L93A 1P0FA 5KSYA 2F8SA 5I7OA 2O59A 5KQSA 4D9MA 2ZWVA 5A4KA 4GRIA 2BKXA 2G07A 3DB2A 1YOBA 3LP6A 4Y67A 1Y6QA 4AMYA 4GR4A 1PGJA 5AJUA 3NBUA 2REBA 1W5FA 3WP1B 4Q6BA 3QU4A 3FZGA 3U1TA 5EN4A 4QFBA 5FB3A 5CG1A 4WI1A 3HUEA 3SF8B 4CQMA 1F6BA 1P9RA 2Y1GA 4FEYA 1V6SA 1PR6A 1D5WA 3B1ZA 3ZDFA 5KJEA 4PR3A 2A0YA 1A0OA 1VLQA 2GEJA 2WPDA 3G0DA 1D2CA 3NWEA 4Q6WA 3SQOA 3TOXA 1WCIA 1V8ZA 3UAWA 4HNVA 5JNUA 3PEWA 1AV6A 1LFDB 2TRSB 4PTLA 1WBDA 2I2BA 3HR4A 4CCAA 2AT1A 3DOOA 4DEXA 4UFNA 1YQGA 1G8AA 3AVXA 3O2NA 2WJ6A 1N5LA 2AVDA 4PXYA 4D92A 2OGZA 5BN5B 4ZEMA 1N0WA 5GTDA 1Y1PA 5LMUB 5A0TA 3DBOB 3W04A 4G4IA 5E2IA 5AVOA 3TLAA 3VSAA 3UUGA 4D02A 2EXXA 1DKLA 2Z4RA 4EFMA 3U39A 4DQKA 4BV8A 4RK5A 1E62A 1H2XA 4POAA 2GTHA 3RSSA 5EP4A 1BJTA 2CF5A 1IN5A 3RHSA 5H5JA 3RRJA 1DKQA 3B53X 1XQVA 1P3JA 3E9YA 4LMRA 4O4LF 2GBGA 3A2LA 4Y6PA 1DP4A 3CLRC 2AE2A 3OA0A 1ODSA 3Q3GE 3RS0A 3TTTA 4G65A 1RRGA 2IC5A 3OKAA 3IAUA 3SQNA 4ZJUA 2PVSA 2OD2A 3QIAA 4EX7A 3IT1A 3WL7A 4KXWA 1KFBB 4N5LA 4Z8YA 3KOOA 2VH2A 4BNDB 1QPZA 3I5YA 4N3CA 2KI5A 4M1ZA 1L8QA 4A23A 4E1BA 3RVNA 3HKBA 3CY6A 3OO1A 3KM0A 2NMVA 3INYA 2QMZA 3GRPA 4MUGA 3EDOA 3G7NA 1MF7A 3ADDA 4EUHA 1XZCA 2QQ5A 1YA4A 1U2DA 2VCHA 2Z1MA 1T4MA 2O3TA 1RHKA 3E3OA 3STVA 4Q1VA 5DN6A 3SZUA 5IH7A 4LJRA 1D0IA 5FEMA 2OORA 1M9NA 1YVRA 3FAKA 3KWLA 4X91A 4HV4A 1IM5A 1FFGA 5EJIA 4UPDA 1OLSB 2P9EA 3I4FA 2FCRA 4DV0B 1W4RA 1JEAA 3SJBA 4XQ9A 1LTHR 3T7KA 1FIUA 3SY8A 3V7WA 3T1OA 4Y18A 2AOXA 3N6RA 4BOYA 3EBPA 2GBFA 4NP6A 1U02A 2GKOA 4WTOA 1U2RA 2BGMA 2CE2X 3QVMA 1MNAA 4PHHA 2NVUB 1DPFA 2OT3B 1BQ3A 2A8YA 3TJMA 1W4CA 3W6UA 3V33A 3RRFA 4DV3B 5JXJA 1JR4A 1STOA 3BEOA 5K0FA 2ONZA 5IXYA 3OJOA 1Z8HA 2ZBRA 2E9SA 1C8KA 1KJ9A 3T15A 2PYZA 3OEWA 5FRDA 2GFIA 3WSWA 1WWKA 4KQ2A 3UG6A 1OILA 2EARA 3A6FA 3L7AA 3D4NA 3AM4A 3IEKA 3WV4A 1MHTA 2HQRA 3UMGA 2GI4A 2HJHA 2WYHA 1HUQA 1R0XA 1R6UA 2PZ8A 1U2QA 5HF6A 2FWIA 1DUVG 2AD5A 4OAQA 2IEBA 2JHAA 2X9NA 1IN6A 1LNZA 1F2TB 3PC3A 4Y2PA 1ZD1A 2BFNA 1Q7EA 2H1WA 2ZBEA 3ONEA 3RF7A 3WWZA 1R8JA 5A2GA 4UFOA 2C54A 4HP8A 1IY9A 3O9MA 3VU9B 3ZKWA 3BQNB 3Q7PA 4L4XA 3A7EA 4E32A 1A5ZA 1ZH6A 5IU6A 4L0QA 4LFBB 4GDMA 1S1MA 1ZK2A 1KYZA 3TKYA 3UTDA 3T3IA 4ZEVA 2JGLA 1ZH8A 4LS3A 1I3LA 1E3WA 5BMVB 3NH9A 3GJSA 4JB0A 1HI9A 4RZQA 1OGJA 2H31A 4Q03A 3UENA 3ETLA 3OZTA 3R5HA 5GGYA 3K53A 5C34B 2XCTB 3Q8LA 1S5PA 1QHEA 1YR7A 3NHZA 5IKMA 1QQ5A 2LTAA 2IUTA 4JGBA 4EW2A 5L3ZA 4UPVA 1GZUA 1C14A 2HSWA 1LLDA 4XLLA 3PL1A 2FSHA 2Q0HA 4DWOA 1JSCA 1L7PA 2Y1CA 3TZ6A 1OT5A 1BU5A 2YWGA 1NR5A 3L8CA 3ZI0A 2QM8A 1L4UA 2QN6A 2EVWX 3AFGA 4FMBB 4GU5A 4ZP1A 4BNTA 4BMCA 4X97A 2BC9A 2QGNA 2VRNA 1X1SA 1B3BA 5A6SA 4I1OA 3WMGA 4B8YA 2OO5A 3OBIA 3PXGA 1IOVA 3AY6A 1HFWA 3TD6A 3IAS6 2D59A 4DMFA 1T2FA 4OBWA 3P9XA 1P44A 4WOBA 2IKSA 2HQSA 2Z2YA 2ISCA 3C3XA 3EAQA 3RHTA 1T43A 1X7YA 4PHTA 1C9NA 1TT7A 4FFDA 1FB5A 1GRRA 2FJ0A 4EEKA 5E4TA 1U6KA 1KEKA 4B3SB 5EIBC 2PBFA 5B2FA 3EWAA 4FYVA 4Q4HA 1QSGA 5G1OA 2IDJA 1BGWA 5KU1A 1AV7A 2WZQA 5DULA 1ZUIA 2RHLA 1US8B 4MV3A 5D5QA 1Y9ZA 4A1FA 3NOXA 4IG9A 3S2ZA 4DLSA 2FPXA 1YIOA 4EG3A 4BLTA 2X8JB 1L5YA 3FTCA 4JNKA 1O08A 1VE1A 1OBFO 4M7WA 2DULA 2I2FA 2CXOA 2BF7A 2W70A 3RK4A 2J5RA 1WP9A 2FUEA 5DOZA 5EE3A 2PZJA 5ETJA 3K6JA 3EGIA 3PJFA 4HVTA 2GZ2A 3IP9A 1KK3A 3F3SA 5CLFA 5IM4F 3A1NA 2REXB 1ACLA 1I3OA 2XYVA 2YJNA 1VZ3A 4NXMB 4PQYA 2CJWA 4O2BA 4O5OA 1LD3A 1O5OA 3FNBA 4W8HA 3VO9A 4DJ5X 3DE3X 4ZHQB 2OC4A 4GEGA 5BWLA 1B76A 1KP3A 2CT8A 4IINA 3AIKA 2G8LA 2DPGA 4OP2A 2XB4A 3L49A 1OXVA 4X3OA 3KAQA 4N0DA 3NTOA 5BSVA 3F97A 2I4MA 1YBVA 4IZHA 4GLOA 3I8OA 1PK7A 1ZOLA 4EUFA 3CVOA 3WK9A 3S3TA 5JQGA 2X0KA 5E0OA 4TL9A 5ALWA 1Z7EA 4FJ1A 3PDWA 1GADO 2Q29A 3GBPA 3Q15C 1VE6A 1WCYA 4GYWA 2QJOA 3HYLA 4BNYA 4DLNA 3IPRA 4RTPA 4K6OA 1N3IA 1SPBS 5TF4A 2GTIA 5BXYA 5EJ5A 1LA2A 3QFHA 1QB8A 2FEXA 3PTAA 5A5GA 5IF9A 1MIOB 2WW8A 2W43A 4GWGA 2G1AA 2V9PA 4NFSA 3G49A 4JA0A 1TZBA 4O6VA 5LLDA 3HL0A 3JVVA 4ZARA 3D3KA 2HIMA 4OP1A 1RI3A 3I1JA 1KIMA 2VJNA 5DYNA 3N8IA 5C7YA 5DOVA 1VIMA 1O96B 4HDMB 5FADA 3W5HA 2WLTA 2C20A 2QD1A 2FEKA 2Y67A 3U4MA 4CLRB 4QO8A 4E4YA 2ZXFA 3JR7A 3P0JA 3HK2A 3RSZA 2YFHA 5IABA 1EFHA 3QMVA 4L8YA 5AVVA 3DXYA 4MQFB 3H2HA 4WKBA 2IEDA 2SECE 3GNTA 4BJ6A 1GPBA 1QFYA 1RZUA 3TAXA 2J31A 3DC7A 5EJEA 4WASA 2NZJA 3SYKA 1GD1O 3RYFB 2F7SA 3I0NA 1T9GR 4IRUB 1PYOA 3W90A 2E4VA 2P79A 2XGGA 3WRYA 2ZTLA 1KEUA 2J4CA 2BFCA 1IPEA 2ATXA 3VX4A 1ZSYA 5TY0A 5CIQA 2QR5A 3CVVA 2QLTA 1MVNA 3CLTD 2JVKA 4YA6A 1VHWA 3QYAA 4DCOA 1E8NA 1B16A 5TIIA 3AR7A 4MYRA 4HUTA 2F59A 2ECFA 3JW8A 3ISTA 5H0IA 4GC9A 1R27A 2WMYA 1P9NA 4IIUA 5IW8A 2R79A 1QANA 1Z6XA 1GT6A 1N92A 2QU7A 3S55A 3MLAA 1S01A 5LZ5A 4KH1A 4B3JA 5FHRA 1TO1E 5KYGA 3DZ8A 3X1ZA 1ULHA 3VJLA 3GP3A 1E58A 521PA 5K0ZA 1XTRA 5HF9A 1GNLA 4RWZA 4YAFA 3TOVA 4D8VA 4LBWA 2HX1A 1MC8A 5EFOA 3T7SA 4W5HA 5M34A 1XL0A 4KI7A 5LM3A 1M2NA 3RRNA 2A5LA 2PS9A 4JJ6A 1DXQA 2HREA 4ZZ2A 3W6ZA 5CHEA 4JLAA 2ZYHA 1NI4A 3Q6MA 1E20A 5EJMA 1HDYA 2HHCA 1P1KA 2WTMA 3JAKB 3RT7A 3QVGA 1DUIA 3ZQKA 4YFVA 2X1LA 1ST3A 1RIFA 3AIIA 3I2YX 2PZMA 5EIHA 4Z0PA 2E48A 1EP1B 3OSZA 4RU1A 1Q0SA 1YJ5A 3N59A 3U17A 3MS7A 4GMGA 2L0XA 4BO8A 2XMZA 1YS7A 4DXHA 3RF6A 3NW9A 1XLVA 2ZRJA 4URXR 4RLHA 1KYQA 2W48A 4ID3A 4KEAA 5DGTA 5DSXA 3LKDA 2YDXA 3E3LA 5EUMA 4OL9A 1Y6ZA 4KPUB 3H5RA 4P5EA 2KHZA 1J7KA 4J8PA 4P35A 4I4IA 1JG2A 1L7EA 3O1LA 5IASA 2GYVA 2CVZA 2WG2A 2OZKA 3K5IA 2PNFA 3W7BA 2CFCA 1FMJA 2G88A 4HXFB 1VCHA 2B8EA 2QTFA 2HGZA 2OR3A 1OTYA 3GRAA 2DKOA 4FHGA 4JSTA 2O9JA 3FYCA 1KBQA 1TKAA 3CNNA 2ZRNA 2ZJ7A 3PX3A 4IDEA 5CLHA 4CKZA 2CNDA 1JHVA 3G7SA 3AV0B 3HSKA 3D6AA 1K4MA 1ORIA 3KELA 3CX4A 1ZQ1A 2JLZA 2HL6A 4R8RA 3VZRA 2QTVB 1OLUA 1ECPA 3CEHA 3WGQA 1XU9A 3TQHA 4A2PA 3CE6A 2JJ1A 1T9KA 4BFVA 5K09A 1MORA 5FOUA 1W0JA 2YZ2A 3VGJA 2CMDA 3WTBA 4N9QA 1DC5A 2VP0A 4C6HA 1SA0A 5G0WA 1PL0A 2BUCA 4NR0A 2KX7A 2VPPA 1MQSA 3I61A 1X7GA 2NT3A 4TSFA 2B5VA 4IH9A 3UUEA 4AF6A 4TUYB 2E3JA 1G55A 2ZI7A 3VVCA 2XUJA 1OY1A 1VMEA 1EGMB 3RSQA 3JASA 4E21A 2X1HA 1IHDA 4Z5XA 4AQYB 4DV1B 3UMSA 1Z18A 1DQYA 3M1IA 1O8BA 3T1NA 1EFKA 1RU3A 1PHPA 2ZBFA 3GBSA 1EDBA 1GPLA 1UKYA 3E18A 4WVLA 4W7SA 3N5CA 2O3UA 3G8DA 1Q0UA 2NUTB 4HB0A 2VDMB 1SG9A 2QPAA 2ZYSA 5KKAA 3LRPA 4DSNA 3CCFA 4ZVUA 3INNA 4KLCA 5LIRA 3P2YA 5EL0A 1N0UA 1LVHA 3GROA 2ST1A 4K28A 1JZTA 2O0KA 3CISA 2XUHA 4WA7A 3SVTA 3GP8A 2PKCA 2WWXA 4XCVA 1SCUB 2AK2A 4ZN6A 5G4LA 5B37A 1NXTA 3SKYA 5BQ3A 3CUTA 3S68A 3TBKA 2VTEA 3UC9A 1HZZA 4HY3A 2YOFA 6YASA 2X9GA 4C1NA 4J1SA 1D4OA 1MX9A 1WKVA 3FVWA 1MC1A 4KQJA 1D04A 2OYSA 2AW5A 4PZUA 3ZK9A 2C83A 2PR7A 3AU8A 5LNK6 1XEWY 3FGNA 1JQDA 1O6FA 3K0FA 4X1YA 1PZEA 2PGXA 4H9GA 1T1SA 4MGKR 5ICSA 4GZMA 1NXSA 1Z75A 3SDZA 2YFKA 3THOA 5GY7A 5TMEA 3VZSA 1OUMA 4QKQA 1UDWA 4JJZA 5EJ4A 3SJAA 3THXB 4P38A 5EC8A 1AZLA 2NSDA 2YJGA 4TN5A 1AGYA 2B61A 3C6BA 3C4JA 2NSHA 5E7MA 4I3FA 4D57A 1A50B 1WCIB 7ABPA 3D3QA 3NGMA 3ZS9A 5JJ5A 4LCBA 4AN1A 3W4KA 3P0IA 2QAIA 1QVWA 4MJLA 4PONA 4PZYA 4RSRA 3I42A 3VSDA 1ZO8A 2VAPA 1ODJA 4DSAA 1RHRA 3P2OA 2I3AA 3GJXC 1XK6A 5KWSA 2OWDA 3F7OA 1P6QA 2PSDA 4OKSA 1YHYA 4FB5A 3RAFC 3OOHA 1UJ6A 2VPYA 3EXEA 1U2DC 1YU9A 1SUSA 2BM1A 4OQQA 2HRQA 1JQ5A 4P6VF 1EFVA 1RPTA 1NQWA 4O4IB 2Q6IA 4WBSA 3S81A 2CL6X 2D2VA 3U7IA 5LZ4A 3VYUB 1KE2A 4AZWA 1I6KA 4H7IA 4OQXA 1QIEA 5FFNA 4XGKA 4DF3A 4KQIA 4BCDA 3G6KA 3SIPA 4JNCA 4ER0A 1HDEA 1ITZA 3QBTA 3NTQA 4MICA 3G5LA 1ETHA 3DA8A 3E9EA 1TYEB 1V9CA 2IYZA 3KVOA 4TMWA 1FFXB 3QE9Y 2PUBA 4EJ0A 1A7UA 3NNSA 1TJ4A 5KOYA 3BMXA 3Q5GA 4KU4A 1EXMA 4P4UA 3NRCA 3DOJA 4M8SA 3SKVA 1XMIA 5KYWB 3Q9NA 1YCDA 2N3ZA 2ZWPA 5SZJA 4JBXA 3TSWA 3ZJ5A 2XBUA 2R1TA 3T9AA 2HSEA 2LV8A 2J4DA 3I4LA 3L7IA 4YJ2B 5BNZA 1QAMA 3MEQA 3K9GA 2G3YA 2YS7A 3NETA 4S3MA 3QVWA 1XZJA 3KJEA 1P0MA 1SQSA 3IUYA 3BWVA 5JMPA 1F5SA 4GYKA 3K35A 1B00A 1DAPA 2AEEA 2XGMA 1R8XA 2JCSA 2WLSA 3QXHA 2DQKA 4EP1A 3RSFA 4A8HA 3LECA 1UDBA 2VBGA 1UKZA 4OJKA 3RANA 4AZ3B 4DPKA 5KHOC 4LE1A 2C2WA 3UUFA 1CNEA 3D6UA 4LZOA 1XDGA 3PCTA 1J2EA 1YUBA 1E77A 2GRAA 2I2DA 2P8JA 1DXYA 1P1JA 3BORA 3HB1A 4URZR 3MUOA 4MUHA 1CEYA 4WFKA 2UZ1A 3WBBA 3PWZA 4BKPA 3W5SA 3A1UA 1TI7A 3AIMA 4J2TA 1N6HA 1TW2A 3IEXA 3D4LA 3FFBA 4TKUB 4MQBA 3V7UA 3LPLA 3MWFA 1BFDA 1XRNA 3D7LA 3M6IA 2PH7A 3GEDA 2W0MA 4LGCA 4ZV9A 5G1NA 4RA9B 3T54A 2JARA 1LX7A 1OIXA 3UK7A 2BEWA 2RI0A 3ER9A 3PXUA 3LC0A 5DCWA 2RJNA 2PS3A 3II6X 1QHIA 5BPHA 1FYFA 2EERA 3G2LA 1ELOA 6PFKA 4RTRA 1BD4A 4IMPA 2RJOA 5BQPA 2JIZA 5ICMA 2C5SA 2BSQA 5ILQA 5IG2A 1VL5A 1QX4A 4KVGA 1P4SA 1IU9A 1QIHA 4OHYA 3FH0A 5AI6A 1RTKA 2QN9A 3H3JA 4WCFC 3VR5A 1AKUA 1S4QA 1SIBE 2EIXA 4IUYA 4KZPA 3F8SA 3HBAA 1RI1A 4WUVA 3SHTA 3T9BA 4D0GA 4GKKB 2AQ8A 4IAOA 4CU2A 4FYIA 1CXZA 4UCWA 3AKEA 5FUYA 1A8SA 5C81A 1BJRE 4FBGA 4TVKA 3NV7A 3C70A 1SHZA 2ORYA 5DTMA 1IXSB 1EWVA 1I7NA 1KJYA 2H5JA 1AQUA 4YJFA 4A2WA 2HPVA 4J94A 2IYVA 3M6MD 2EX1A 4OQ4A 2W8ZA 2AFIA 4LXYA 1KYXA 2EKBA 3IUSA 4DIBA 5ICCA 2R8BA 3HPQA 3GRKA 3L3BA 2G9QA 4IKEA 4N7MA 2QV0A 2VJMA 3AJDA 3M8KA 1WY5A 3WSVA 3C48A 3LSTA 4J0KA 2BYTA 3WWCA 4CF5A 2QM3A 2ECKA 4ID9A 1YFZA 2NZWA 2YWJA 1OX4B 1D4FA 1N5DA 1RWMA 1XRPA 3ELWA 4KV7A 3DZCA 4JKOA 5JJIA 3QU2A 1QGZA 2AC4A 2HPHA 2B98A 1ISFA 3HRIA 2OK7A 1RBQA 4RELA 3QENA 1HNXB 5KYVA 3C5HA 4RZ3A 2Q7DA 2EQ5A 2JEOA 4IM7A 3TNYA 1CF4A 3O4GA 4MX8A 1FNMA 3DQQA 4NU6A 3T3GA 3ZR4B 3I53A 4XAQA 4EF4A 2FFBA 5MHTA 4WJZA 1OBHA 3D2BA 2FF7A 4DDMA 3EMBA 3O83A 3BAZA 4E2XA 3SZGA 2CV1A 4DZRA 2XECA 1KAOA 2WA1A 3F6PA 4JJ7A 3ZU5A 3SR3A 4MINA 3B20A 4AX8A 4YC7A 2XSZA 2X42A 1E6KA 1TT5A 5E8JA 3F4KA 4X61A 2Z8XA 4E5DA 1DKMA 4HGOA 1GRQA 2HJSA 3IR7A 2F4VB 1M2FA 3AHJA 3GPCA 2X3UA 4JYPA 1K3FA 1V5FA 2R6JA 3D8RA 4E0BA 1QO9A 1OBCA 1W5BA 2C84A 2Q1YA 4KWHA 1EG7A 4NZYA 1LUAA 3FFXA 5LYJF 5KTSA 1RC8A 3D6JA 1GN8A 5TQ0B 5KYUB 2F48A 3HB4X 4FTWA 4LKRA 3CRW1 3BGOS 4H3VA 2QLBA 4IGEA 3R9KA 4JELA 3FYUA 1J0XO 1PZGA 2H92A 4EG0A 4TZKA 1Q1EA 4GECA 3QM1A 3TVDA 1LDMA 2HT6A 3SNKA 3K1TA 2XUQA 3C8ZA 3CM0A 4X95A 1NUTA 5D1HA 5AW3A 5KUTA 2XUIA 3ASYA 4JEMA 2QRJA 1HM5A 3O6VA 4KWCA 3UGQA 4GOKA 4RCVA 2WR8A 2ZQ5A 3GLFB 3Q2OA 3C7TA 3ZW9A 3RU7A 4DNQA 5BR1A 1VJTA 1HZJA 3M6UA 1DTWA 2C07A 2WSSA 1MOSA 5HJ2A 2JGMA 3PFGA 4RGQA 2LR0A 1SKUA 3G3EA 1GQFA 2CMHA 5BVGB 3TLKA 2ATIA 4PLZA 1FDTA 3PWTA 3VPAA 3JQPA 2FK8A 2HOQA 5L3QA 2O8FB 3FMIA 3Q1LA 1I6MA 1FDIA 1NBAA 3K2BA 4YMHA 1U7OA 1CJMA 1RYEA 3OQBA 4CWAA 4YMLA 2QNIA 3T1TA 4Q01A 2VPXA 4WERA 5BMVF 3VU0A 3AF5A 2ODEA 4WVFA 3TQQA 3COWA 4Q7JB 4ZANA 5DHQA 2HRZA 3H75A 1USVA 3LT0A 1YE8A 2K87A 4OGGA 3N0RA 3PNLA 5A3VA 2HHLA 1LPNA 4WPGA 3K0FB 1O1YA 2IIQA 2Y66A 1FYEA 1TRKA 3NEJA 3UT0A 1PUXA 4HDCA 1GIAA 4JR0A 3ROFA 3UK1A 3EGDB 2ZAGA 4E94A 3SIRA 1RQGA 4FT2A 3T3OA 4QOJA 3TQOA 2W7TA 2OD7A 2XV1A 2EV9A 3GFGA 1L3IA 4Z9AA 2BWJA 3O4JA 5THKA 3OIFA 1QZ3A 1FYWA 1BQ4A 2GWRA 4GSYA 1PR0A 4WCFB 2R6HA 4TYYA 1RE1A 4BQNA 4BP9A 4HDQB 3A2KA 1YUMA 2ZJ3A 2BKVA 3EXG1 4QBIA 4XIJA 4UUQA 1S6YA 3TK1A 3R0VA 3HEMA 1S2OA 1DQRA 1DSSG 3DO6A 1HE1C 3ID6C 3PNMA 1H1DA 4RW0A 4YRJA 1DC6A 4ER3A 1BA2A 5F52A 1KQPA 1V35A 2ORVA 2GTPA 4I9HA 1EESA 4BX2A 1E79A 1TD9A 2FWMX 2ADMA 3H7IA 4ZXFA 1ZIYA 1X42A 5DM60 3CX8A 4RNCA 3WMFA 2I4TA 3WYNA 4YCLA 1B42A 1TZJA 2YW2A 3FMVA 1DKRA 5PGMA 3DR5A 3JAMA 3HCRA 1F0NA 5FPQA 2XE6A 2IPXA 4II3A 4LKOA 2W5UA 1JDTA 4BRUA 3HXLA 1WUYA 2JKZA 4WL0A 2ZYUX 4XIGS 4PYIA 1TQ4A 5CFRA 5CT5A 1TJPB 4MQ5A 5GAJA 3EF3A 3PFKA 4IOKA 2P27A 3BCUA 4GGPA 4MA4A 4OLJA 1EI9A 1U2SA 2VDWB 1A2KC 5ARCA 3RBZA 5CB4A 3KZKA 1JQ3A 3PUXA 3DL4A 3QK7A 1UKAA 2R6DA 3OTWA 2ZXUA 1LWOA 4MR7B 1E4VA 3BMOB 4LZLA 5EHGA 3R8XA 3QY0A 3R20A 3ZE9A 1CZNA 1ZZGA 1T9DA 1UPTA 3NVKI 2O50A 1DQZA 3SEQA 4V0MA 3MW8A 1MX5A 4RD3A 4W9NC 1UBUS 2O8EA 1O77A 4QDUA 3L1IA 3PXXA 4F2GA 3BFKA 1WUTA 1E2FA 4B4OA 4KJZA 4XEHA 1JL3A 2J3QA 3GJ0A 3JYPA 4TL7A 1ZXBA 4N03A 3NBFA 1OYOA 2QU8A 4AP6A 5B3AA 3GMDA 5AJXA 4D6PA 1O9GA 1NE2A 2Y1FA 3V4PB 3PL5A 2C8LA 1M7GA 5FR2A 3TRFA 1UXJA 3M6LA 3RIXA 4KSBA 2FZKA 1MDFA 1QDLB 1BRTA 1TMGE 1ZFNA 5H83A 1VPDA 3NT4A 2UZ4A 3B6KA 5FO0A 2OV4A 3ZJVA 1CZOA 3PV0A 4Q19A 3ZV5A 1H3EA 1D2AA 1G2IA 2JH9A 4FYJA 3W5DA 2HLHA 2IHJA 4P84A 3K1YA 2OQIA 1N7JA 5LR6A 3CX6A 3AFHA 4V1CB 1VJ1A 5CD9A 1FY2A 3BG5A 4K2AA 3VR0A 2H5EA 4IKOA 4AUMA 3ZHUA 4MVJD 2JFXA 3AQ4A 3H9JA 3ET5A 4I3GA 1E7MA 3DEIA 1JDPA 2PANA 2Q4BA 3BQMB 4B2LA 1W73A 5EHQA 1RPZA 1KPIA 2LIPA 1UBHS 2ZZKA 4UTOA 4EJMA 2GBLC 2JJYA 1MX1A 3BRCA 5J2TA 1HDRA 2WDPA 2PBLA 4MQUA 4D4IA 1XQYA 1KRHA 1PUJA 3BHMA 2QNBA 4D6XA 3FXAA 1Z0SA 5JDCA 1CQIB 1UWVA 4MUYA 3PD1A 1JIUA 4IDPA 3D31A 1XTTA 5FA8A 5BRJA 2NVOA 2QK4A 3CN7A 2FK7A 4Q48A 4KRYA 3KQUA 4O08A 3FCSB 1PO7A 2C3OA 1JLSA 1IN1A 1XTQA 4EQ6A 3AHFA 1C1XB 4M1KA 4RYLA 1C9JA 4B9AA 2CDCA 5LQUA 3FM9A 3L8MA 3V9PA 3VDRA 1UWLA 1USWA 1L5HB 1PF7E 1RLUA 3OLQA 1K0UA 3Q8XB 1IONA 3TH5A 3N8DA 3VR6D 3H4TA 3LW7A 4G25A 4QDJA 1Y3HA 2P2DA 2XF8A 2IU0A 3S6JA 1N7IA 3I01M 2X5OA 3RV3A 4AZSA 2CSXA 2F55A 5G40A 3C6XA 1NVDA 1TEXA 4JYAB 5JUWA 3D4IA 2OBMA 1XJ0A 3UM9A 3UMCA 4BTEA 1EQUA 4NCIA 5FPKA 2HA5A 4KXYA 5TXGA 3VR5H 5BWNA 3QOWA 5KTYA 5LIPA 4CF3A 3QJ5A 2MCFA 4JN6B 2LKCA 1VSVA 5F64A 2O2HA 4BX0A 1WTCA 4F1KA 1WD5A 1YZHA 4MPPA 4X20B 3ZH9B 3H5AA 3KTDA 3OG9A 4TWRA 2ZR7A 4ZPJA 5REQA 5FUVA 1S0UA 1U8UA 1VBNA 5CVTA 4NMHA 3VUFA 5J2TB 4UZFA 2O5RA 2OHGA 2B8NA 1HSOA 1WO8A 3EARA 3KWMA 4B6FA 4EITA 1I5EA 1QH8B 4NAVA 1OA0A 1SXJB 5AYVA 4Z54A 1Q6YA 1P91A 1Z25A 3AF1A 3Q0EA 5ALLA 3URKA 2D0DA 1JHAA 4D9NA 3FYUC 3RYHA 2DKFA 2OV1A 3FVVA 4I9NA 2VHUA 4YP7A 5KX5F 1AURA 1XXHB 1SC9A 1B8UA 1JKJB 3KQNA 4FLFA 1UDRA 4ZJYA 4G5HA 4M8KA 2GUWA 1D2HA 3TFOA 1ORRA 2H11A 1JI3A 4O2BB 2M98A 3B85A 5EWJB 1BMQA 4P4SB 1KQFA 1P5FA 4WNCA 2H2FA 4JMLA 4NRDA 5TPWB 4FSDA 5K4AA 2HJRA 3KLNA 2UUPA 2ZAMA 2DXIA 1EB8A 4LUCA 3I9LA 3ZDDA 1YA8A 2XYRA 2LGJA 3AF0A 4M0CA 3SQDA 3DEZA 4RIFA 3T7IA 2QTGA 1JJFA 2Z09A 4HWPA 1C7RA 4MSUA 3TZKA 1TK2A 3W9YA 5JS7A 4QT0A 4FX2A 2H1FA 5IZCA 3QUAA 2AK3A 5AFSA 3UXHA 4MLZA 2ALJA 1ZRSA 2WF6A 2YV3A 1PSDA 2IRWA 3IDFA 4MUAA 4RQTA 4YB8A 5EHZA 4DAEA 3N05A