1V48A

Calf spleen purine nucleoside phosphorylase (pnp) binary complex with 9-(5,5-difluoro-5-phosphonopenthyl)guanine
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
283
structure length
261
Chain Sequence
QNGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYEAAQKLEQFVSLLMASIPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Calf spleen purine-nucleoside phosphorylase: crystal structure of the binary complex with a potent multisubstrate analogue inhibitor.
pubmed doi rcsb
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
total genus 81
structure length 261
sequence length 283
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1v48A00
4NSNA 3UAWA 1Y6QA 2I8AA 5EPUA 5CXSA 1A9OA 3DDOA 4D8XA 1Y6RA 1VMKA 4M1EA 1V3QE 1PF7E 4TXLA 3UAZA 1PR6A 4PNPA 1PR2A 3DJFA 3GB9A 4X24A 1CG6A 1PWYE 1PR4A 1WTAA 2ISCA 4BMXA 1A9SA 4WKPA 4ECEA 1RXYA 1Z33A 2QTGA 2OECA 4TTIA 4NS1A 4DA8A 4MCHA 1Z5OA 4NY1A 4G8JA 1ECPA 3LBAA 2PGAA 3MB8A 4BMZA 5CXQA 1RR6A 4DABA 3E9ZA 4KN5A 3OZCA 2AI3A 1C3XA 1CB0A 1PK7A 3QPBA 4JP5A 3KVYA 3MMSA 4LNHA 1QE5A 5IFKA 4K6OA 4TXJA 1V2HE 4UC0A 3BGSA 1YQQA 3UAXA 1T8RA 4F1WA 2B94A 3BSFA 2H8GA 3EUFA 3TL6A 3IOMA 4DAOA 4R2XA 3KU4A 1SQ6A 1ULAA 3E9RA 3K8OE 5CYFA 3IEXA 5F7OA 1OTXA 5K1ZA 3OZBA 4TS9A 1PW7A 4BMYA 3OOEA 1T8YA 3KHSA 1Y1RA 2QTTA 4QATA 1A9PA 1YRYE 1N3IA 1Z5PA 2I4TA 5IU6A 1T8WA 1M73E 4GLJA 1JDZA 2QPLA 3NM4A 5ETJA 1K9SA 3OOHA 1TGYA 3ODGA 2P4SA 1V4NA 5B7QA 4RJ2A 1JDVA 1T8SA 5DK6A 4WKNA 3P0EA 1B8OA 1JDUA 5F7JA 4GKAA 4OJTA 3EMVA 5CYGA 4QEZA 4LKRA 1SD1A 1JDTA 1K3FA 1V48A 2OXFA 4MARA 1Y1SA 1T0UA 4LZWA 5CCEA 2HWUA 2RJ3A 4PR3A 2HN9A 3KUKA 1ODKA 3PHBE 2GUWA 1K27A 1LVUA 5I3CA 2A0WA 4QARA 1YR3A 3PHCA 2A0XA 1ODJA 4YMLA 3LA8A 1VHJA 1FXUA 1PBNA 2A8YA 4LDNA 1LX7A 4TTAA 4G89A 3OZDA 3FB1A 4F2PA 4QAQA 5F7XA 1NW4A 5F77A 3ENZA 4D98A 1RXCA 1B8NA 3ONVA 1JE1A 1PK9A 1PR5A 4OY3A 1OVGA 4OF4A 3OZEA 3DF9A 3P0FA 4EARA 4TXNA 1JYSA 3O6VA 1ODLA 1ULBA 1U1EA 5EFOA 4TXHA 1RFGE 4TTJA 4P54A 4OEHA 3F8WA 4M7WA 1I80A 4EB8A 1Q1GA 1PR1A 2A0YA 2OC4A 3BJEA 3GGSA 4BN0A 3DP9A 1TCVA 1RCTE 2AC7A 1ODIA 5B7NA 4JWTA 3OPVA 4QASA 5B7GA 4D8VA 4DA0A 2QSUA 1YBFA 2OC9A 2HRDA 2Q7OE 1ZL2A 4D8YA 1TD1A 3EUEA 1U1CA 5JPCA 1G2OA 4TS3A 1OV6A 5FAKA 5CCDA 4DARA 1U1FA 4M3NA 4GMHA 4IP0A 1OU4A 5KB3A 4E1VA 4DA6A 2HSWA 5C80A 1JDSA 1NC1A 1NC3A 3EEIA 1RXSA 3DPSA 4QFBA 1JPVA 4H1TA 1V41E 5B7PA 4WKCA 1SJ9A 3KVRA 3FOWA 1VHWA 3UT6A 3OF3A 4L5AA 4FFSA 3OCCA 1RYZA 3O4VA 1A69A 4YO8A 2XRFA 3LGSA 3SCZA 4MCIA 3U40A 3K8QA 5F7ZA 1XE3A 3C74A 4DA7A 4G41A 1PR0A 4L5CA 3FUCA 5F73A 1RT9A 1U1GA 1RSZA 3PNPA 4L5YA 4R2WA 1VFNA 1TGVA 4D9HA 1U1DA 1YQUA 1Z34A 4F3KA 1Z35A 4GLFA 4OGKA 4WKOA 3INYA 1JP7A 1PKEA 3NM5A 5F78A 1Z5NA 1Y1TA 1OUMA 5EUBA 3BL6A 3D1VA 1SD2A 3FAZA 3KVVA 4DANA 4U2KA 4F2WA 3UAVA 3FWPA 1LV8A 2IQ5A 1TCUA 1A9TA 2QDKA 3T94A 4LNAA 1Y1QA 1JE0A 4L6IA 4WKBA 1OTYA 4JOSA 3FNQA 4F3CA 4R31A 1A9QA 2ON6A 4TXMA 3NBQA 4YJKA 2BSXA 2AI2A 4TYMA 1A9RA 1Z39A 1RXUA 3PNSA 4L0MA 4OGLA 1Z38A 3UAYA 1ZOSA 3NM6B 1V45E 3E0QA 4I2VA 1Z36A 5F76A 4YNBA 2AI1A 1Z37A 4DAEA
chains in the Genus database with same CATH superfamily
4K81B 2O2HA 2NU8B 1T9AA 1Y6QA 4HDQB 4ZV7A 3UBMA 1GZDA 1D2AA 4GKVA 2R0QC 2AG8A 5E9JA 2QUKA 2VNHA 4X94A 3FN4A 2PTHA 1F48A 5KYXA 3IBSA 3LYAA 4M1EA 4MQMA 1ISJA 5FDFA 2ZJZA 3LY9A 4LHEA 1MORA 3GOHA 2V4ZA 4EIWA 1SQFA 1U7ZA 1WHTB 4UPDA 1OX6A 5TQVA 4FZ5A 2ZVDA 1CJUC 4N6OA 3RYHA 4IOKA 1WBDA 5GZ3A 3TXYA 1JALA 3I3SR 1HI9A 1ZD5A 3K0EA 3PYLA 4H7PA 4UHJA 2JJMA 1T3ZA 2HCTA 3HJAA 1IY0A 1O2DA 4I8XA 3H3JA 1NUSA 1U7PA 3IQIX 3KV3O 2BMJA 4FS3A 1O03A 4P4SA 4JLDA 3BVPA 2BEWB 3GX1A 4RIHA 3WGQA 6LDHA 5KC8A 2ZATA 3EIWA 3JATB 4LZZA 2W0SA 4B45A 3ESCA 1HV8A 3QH4A 4ECEA 4HUQA 4PAGA 1VCOA 4TS4A 3PA8A 1WBBA 1JFRA 4AF8A 5HILA 2Y0EA 1ZH4A 2JK1A 3KU1A 4H3KB 4NBKA 5MN4A 1TAQA 2GFHA 2UZIR 1SPBS 1L5ZA 4M1OA 1SAYA 3RADC 4UTRA 2NUPB 4CHTA 5BV2P 3B3GA 1XK6A 5I5EA 1ISHA 4KQ9A 5SY9A 2BFDA 1RHUA 4Z4IA 4ASUA 1U3CA 3II6X 4Q4LA 4I66A 4MSUA 4BMZA 1L5NA 2I54A 3OFVA 2AV6A 3K5WA 2KHZA 4N12A 4JQYA 5AICA 1OWOA 4RFSA 4HH1A 2BUBA 3IVAA 3LYHA 4FI3F 3ETGA 5BSTA 3SLRA 1QF7A 1GAXA 3KFVA 3RSHA 3HG7A 2VDWA 4MOWA 3BZUA 5GPBA 5IK2A 4BFXA 3R0ZA 3HRHA 4RULA 2I9KA 2QD2A 5BMVB 1NOJA 2WJZB 3A6JA 4QOIA 2Y6VA 1M5TA 2WFLA 3ASYA 3DO8A 3ENVA 3OTIA 4MUJA 1KEVA 1E62A 2HXGA 2ZIXA 3MLEA 4MS3A 2AN4A 3B13B 3EH1A 2Z1DA 5AVQA 1NVKA 2JGKA 5JG7A 3DKIA 4C4XA 3OZFA 4AJ4A 3ZGOA 2FYTA 4RD2A 3PQ2A 4MHTA 4HGYA 3NYRA 4IXWA 3RFUA 1T2NA 4GICA 4JQZA 1E2UA 4CEIB 4DCCA 3EFHA 2V7XA 4X3OA 3L8YA 1F12A 1KA9H 3FGOA 5F5LA 4MVYA 5GADl 1OB5A 5CIWA 4CR8A 2HD4A 2IXFA 4ZCSA 2OXTA 1IZ9A 3U37A 2CMFA 2JI8A 5DP2A 1DKLA 1JNXX 3L84A 3BFPA 3RH0A 1QMGA 1OHHA 2JFQA 3GRFA 4Q3CA 1ZHHA 2OBXA 1U7WA 5E7MA 2QUAA 3U0BA 3PYMA 4CCYA 4OQNA 5IJWA 4PZZA 4UUAA 3KB1A 3K7EA 3E9RA 3LL7A 1GPBA 1PT7A 4U2DA 1OTXA 2ZRJA 4C2AA 4G5GA 3HMQA 5FWXB 3NH9A 5KX5A 3V42A 2E21A 2OCPA 2V6JA 4FC6A 4WCDA 3SMQA 3M34A 3RCBA 4KN8A 4BQSA 3FUTA 2WOOA 3GD5A 1AB6A 4JMPA 5TVKA 1JHOA 3B5IA 4M9CA 3UGTA 3WOVA 2FWNA 4CGYA 4MLDA 4EHAA 1NVWQ 4GPBA 4RQAA 1H4SA 4NU0A 1T8WA 1DG3A 3H5RA 3TI7A 5JWOA 2BLNA 2ZB4A 4H6WA 3CT6A 1Y48E 2GCOA 4GLJA 2QGZA 4HXYA 3NM4A 1CVLA 2HTFA 3T5BA 3HDGA 1IQ0A 2WIFA 1L8XA 5CM9C 3DOFA 3LO8A 4G1MB 3ZV5A 4DJJA 1UAGA 3P2EA 4YQZA 4EGCB 1SWWA 2QN3A 3DHYA 1M1NB 2OBNA 2JFOA 2I3BA 2FZGA 1KVQA 4BX0A 1G6OA 5K45A 1KKUA 1NGSA 1RJGA 3G2LA 5K99A 1Q2UA 1D3AA 1NPYA 4G67A 1G8HA 4GKJB 4EL5A 3DAOA 3E9DA 4UCQA 3UJ7A 2NSLA 2GBIA 4B4UA 5HK9A 3CRQA 5ALZA 2CVFA 1ZK4A 3OG9A 2D5CA 3N07A 4LMBA 1O08A 2WJHA 3GIDA 1G4UR 3IT1A 3W3AD 2Z43A 1YA4A 1IU9A 2JGNA 3GG9A 3SVZA 2IS2A 1NRWA 1XPRA 3DEKA 2J1LA 3HKEB 3KT6A 2E2WA 1SHZA 2YHIA 1Z7BA 1FMLA 1TKCA 4G81A 4WESA 1O5TA 2FW0A 4JB8A 4YHBA 3RVRA 4KXQA 4I1IA 1JDTA 1RLMA 5CTJA 3TF5A 1RIFA 4X6LA 1MV8A 3VMMA 2VA9A 2X9VA 3LP6A 4WY2A 3O03A 2C7PA 4FGWA 5ALSA 4LBZA 3ICWA 2IXGA 2IEAA 4JU8A 1KJNA 2YBDA 4QC2A 4QBIA 3WLAA 3E6AA 4Y2VA 2H1IA 2VPQA 3L1UA 3QMMA 4G0OA 5FPQA 3ZQ4A 1T6XA 4QQRA 2DQKA 1C8KA 1FMJA 3I01A 4BRSA 4ZDJA 4H7FA 1IN8A 1GUYA 3TQOA 4HYEA 1MAUA 1XAJA 2BJVA 2E89A 2XWSA 2D4AA 2OUKA 2AEFA 2DHDA 3VC1A 5LU8A 3G8YA 1KHTA 5U4XA 5IKXA 4F60A 2X8BA 3ZDFA 2D5LA 2VNJA 2QIOA 3X3HA 1T36B 1TKAA 1XTSA 3ANMA 4LSWA 3PJEA 4GVLA 1WY5A 4PLFA 5H8WA 5LZ8A 3F49S 4K6GA 4YMVA 2VIIA 4F4CA 1NG9A 3M83A 4H16A 2MHCA 4B3CA 1XA0A 3WVNA 4MS3B 2YIJA 4IWNA 2FPSA 2GBFA 2BFEB 4B43A 4BFSA 4Q4DA 3D2LA 4RLHA 4HX9A 3EDYA 3RIMA 2HTEA 4WCVA 3MS7A 5B1SA 3AEXA 1GQFA 2QTVB 2VK4A 3IDQA 3CU5A 3ZCTA 4BV3A 5F7XA 5BQPA 2QJOA 2P91A 2I2DA 1TB4A 4LRTB 1GNRA 3GEPA 3L8GA 5IDXA 5EZ5A 5ILOA 1EJ0A 5D1HA 2H4HA 4G9EA 1E77A 4QL3A 3ZDEA 2QX4A 5IVHA 3O1LA 4MUIA 2KJQA 1TYCA 2Q2VA 3Q9UA 1E79D 4QTUB 3I1YA 4RFLA 2WIAA 1IXYA 1RXCA 4XLLA 1J00A 1YDEA 4OJKA 5AOBA 3W6ZA 2C8VA 2NNLD 3OPMA 3ICEA 1M2HA 2JAQA 2Q1YA 2O8CA 2SCUB 4EQ6B 1FRNA 3FKSA 2QTCA 8AT1A 3JR7A 1TTHA 2VDPB 2E1RA 4HDNA 2A78A 1X80A 4O4JF 2C54A 4M99A 4PAMA 4UUOA 2P2LA 2PQ0A 3PGJA 3PXDA 3NDIA 3EVAA 5H02A 2XZOA 2B69A 2KI5A 3O6VA 4GI1A 3DAFA 3FROA 1NL3A 4B40A 3T6KA 4N3GA 3NWOA 1NI4B 2RH8A 1HZZA 1O77A 3B8HA 3HR8A 4LJ4A 3R5HA 5DM4A 1JWBB 1I4WA 4GSKA 2FTKE 5M5BA 4LF8B 2EC5A 2R85A 1GXSB 3VH4A 1U1EA 4FQ7A 5TQ0A 5EFOA 3D3WA 1KOJA 3NATA 3S55A 1X3SA 3D02A 4GR4A 3D6HA 1C3OB 2C5FA 1X7ZB 4DV3B 3QVVA 2RGRA 2Q1WA 2UVDA 3IDFA 4E5UA 3F2VA 4DF3A 3FETA 1HNNA 4QXPA 3P0RA 4I9GA 4DWOA 2BKUA 1HOXA 1Q3KA 1U7TA 4HRVA 1OOEA 1Z25A 5EWLA 3LE8A 3CBQA 4C22A 1INLA 4O4LA 3GBVA 5FOVA 4YO7A 3RV3A 5IC6A 1G0OA 1UM9B 3ZHVA 2ZSFA 2PYDA 4AMYA 2G9NA 1J23A 1SKYB 4AC9A 3VO9A 2BUCA 1GA6A 1ZM9A 3L07A 4Q9AA 1O54A 3OEED 3LCJA 2DPYA 4LHWA 2FEXA 1VECA 2C96A 4JWTA 3COWA 4ZHSA 5KYNA 1SBQA 2PH3A 3ZDQA 3RGGA 3IQDB 3PTAA 4Y18A 1FMFA 3HL4A 2X0IA 4BQNA 4OK3A 3E0XA 2JLUA 1AB5A 1G3RA 4K3VA 5JC1A 2Z1NA 3H4MA 3T4PA 1XWWA 2IEGA 4UXIA 4RY2A 1DQYA 3GJSA 3X1DA 1E3JA 3GDWA 1D1PA 1G38A 1Q1NA 1A2OA 1EE9A 1ZGHA 1YRQA 2AJCA 4U7FA 1P31A 1ZX1A 4AYTA 2FP4A 2IEIA 3V4RA 2UXDB 1WQ3A 4UPVA 1RAEA 3RWBA 2H2AA 4ZU1X 3ZWDA 4BNLA 3ML1A 2AN3A 4AY6A 5EESA 5CW2A 5JDCC 1K98A 5LD2B 3PDJA 2JLQA 3KDAA 3KDSE 3OD5A 2FJPA 2PUTA 4BU0A 1KZ7B 4ZYUA 1XZMA 1FVXA 1VCIA 3QW2A 2F8TA 1O8CA 4F1JA 3RVKA 3T5DA 1OASA 3AJ9A 1M75A 1THGA 2FPMA 5THKA 1Z4MA 3W5DA 1NQVA 3I9MA 1KJ8A 1G6Q1 4XVCA 2DGDA 3GZTB 4MRVA 4CKXA 1VFPA 5LVAA 2ZUUA 4I4TF 1OU4A 4JSYA 3CVJA 2GXAA 4CEHA 1UJCA 1JHAA 1L8LA 2B1GA 4G97A 2QM3A 5GONB 2BFFA 3FNHA 4B7UA 1W35A 3SR3A 4C21A 3ER6A 2ZS9A 3F5QA 1B00A 1Z4OA 4UATA 2IHJA 2WAMA 1T9HA 3CLKA 1EQ2A 4ZIRA 1QK4A 2FEKA 3EQ9A 1SH7A 2QMYA 2RH5A 3KJEA 4EW1A 1YAHA 3SIRA 5H4HA 4D0SA 3P32A 5HVNA 4RUKA 3HWRA 4YCBA 1RYHA 1BE6A 1GUDA 3ZV4A 4EY5A 1XPOA 1UQTA 1Q15A 1BU8A 2BKAA 3E3NA 4DIDA 4DRZA 5CG2A 4BGDA 3V34A 4CL0A 7AT1A 1NAHA 3FOFC 5DSTA 1W75A 4XYMA 3SYNA 1L4YA 3HYLA 3IQGX 4M21A 1OWMA 3DHWC 4NJMB 1SRRA 1EP1B 3PLNA 5TVGA 1LTQA 2E4YA 1LF0A 1Y5NA 4XB1A 4RD1A 4RMIA 5EY5B 1ZW1A 5KTRA 1GLNA 1U3DA 4XWTA 1C0EA 1SHKA 3FZEA 2P4EA 2Q41A 3ADBA 1UKVY 4N39A 3OT5A 1EFUA 3ISTA 4Z54A 2F17A 5L4SA 4BNGA 5HYVA 1OXMA 2B37A 2VNIA 3CSDA 3D8HA 4AJHA 4J1QA 3WISA 1HEUA 3F97A 1U0LA 2Q6OA 3KB8A 2XZPA 5CXUA 2O6LA 3W9YA 2WYHA 2W48A 4FZRA 5JCJD 5B53A 2YHAA 1DFHA 3LOQA 4LDRA 5EKSA 3HUTA 5BR7A 2CE7A 3AUTA 4M8NE 5I9BA 4KR7A 3HJHA 3A4VA 2R1TB 3A1FA 3HKCA 1C4KA 2DR0A 3N8IA 4J7CA 4JIGA 4KBYA 3WNCA 3A0RB 4KMRA 1I4TD 4C6TB 4Z0PA 2R65A 1C1YA 5LMZA 4WFIA 4ZI7A 1E9EA 2JIZD 4CM6A 3DVAA 2RHMA 3CWCA 5FPHA 4B35A 1ZVQA 2E55A 1U3FA 1UKCA 1XQYA 2BFCB 2QUHA 3MCVA 4MR9A 1RM5A 1Q14A 3OF2A 3EOAI 2RK3A 1EI9A 1QV6A 1GSAA 1M0WA 1TM5E 2NTYC 2B3DA 4GYYA 4MAAA 1U5BA 4TL6A 4BO0A 1WM1A 4K9PA 1Z5NA 3Q3GE 2PRIA 4HNQA 4M1SA 7GPBA 4CGZA 1P0MA 2XCLA 4YT2A 1BC5A 1IB6A 1T4MA 3PFGA 4KFUA 4HGRA 5C8VA 5HPYB 2OCXA 3OEYA 1H9AA 3ORYA 4MW1A 3ZH9B 5CP8A 4R5MA 2Q4RA 2FSPA 4FOTA 1Y9ZA 5LXTF 2J3EA 2RH9B 1MO6A 1YVRA 3B6JA 3G7NA 4Y0NA 5TGDA 3CW9A 3CYFA 1UPAA 2GF0A 5FQOA 1VQ1A 1DQSA 3CHYA 3V9AA 5BWCA 1XCOA 1L5KA 4PX5A 2EKQA 4ZAXA 3FWPA 4N41A 4EO4A 2VHUA 5AM2A 2WAXA 1F8GA 1BG6A 3CG4A 5JSFA 1Y1QA 2XUFA 4ZVUA 4GUAA 1JG2A 1WZCA 1Q95A 221PA 2IX9A 2J3QA 3KZKA 4DG5A 4CV3A 1E0JA 4RCYA 2X3FA 4MQ4A 2TSYB 5FLEX 1PT8A 1JIKA 4I55B 3KG2A 3OIVA 5AJXA 4HVCA 5KYYA 5MF6A 2P0EA 2PXAA 4RGYA 3UW1A 1G20E 1V71A 3ZS9A 3IV9A 1IEWA 4ONEA 4QO7A 4RXUA 3AK4A 5E2AA 3UCFA 3FOZA 2FRVA 1ENPA 1GHTA 5BN4A 4TXMA 2KQUA 3FSEA 5CB4A 1UKEA 3BMCA 5CX4A 1X7DA 4YT5A 3ZDCA 2ERXA 4WBSA 3TRKA 4Z4EA 3BSYA 3GI1A 4RS4A 5GJCA 1L5YA 1QVRA 3E05A 4R0NA 1TJ5A 2G6BA 2B5WA 1C7ZA 1YJ5A 2Z4TA 4C7XA 2YYAA 1JQLB 4DMCA 4RDIA 1K5HA 4R05A 1H6BA 5TT1A 1G2PA 2SKDA 2I6TA 1R8XA 3SJZA 4MPTA 2ZI4A 1CRZA 3LFUA 3PD0A 4QUIA 4M87A 4TTRA 5AW5A 4BNTA 5AW6A 1Y4DE 2JKZA 3NKVA 4CDRA 2AX4A 3DLBA 1TUBB 3TFWA 1EK2A 1TPZA 2HSDA 4LJYA 3ECSA 4JFRA 4TKVA 4KPFC 4BFTA 1A77A 4YXFA 1NRIA 2JFVA 1M83A 2CGEA 2AWOA 3CLVA 3OFKA 4KC0A 4QVGA 5FA5A 3CKYA 4JXJA 2W2NA 3AESB 4WNCA 3A1EA 3DE5X 2YHBA 2L19A 1IDOA 3JWJA 3KYIB 1NHWA 3L0BA 3OZIA 3U26A 3V55A 1SUWA 5KNDD 3PUJA 2RHWA 3DDZX 1W59A 4CLDA 4RGQA 4YB8A 4IEIA 3RYFB 2EBWA 3KXKA 4Z6KA 3E4DA 1BXRB 2KMLA 2EZ4A 3GDOA 5K0ZA 2HA2A 4K1LA 2W2MA 3CLTD 1XMQB 4L27A 1MOZA 2M98A 3AWDA 5GOTA 1HTBA 1K92A 1HYEA 4FBLA 1N1MA 4EY4A 1FSGA 3VO8A 1GL9B 4MUEA 2J3KA 3SPXA 3H1BA 3EBPA 4I5EA 4WQMA 2ACVA 3ROZA 3GLGB 4TV8B 1DRWA 3AR8A 1IEVA 5ILGA 3CCBA 4BVEA 2QN8A 3UVEA 2FN8A 1G8MA 1NPDA 1Z75A 4BB9A 3W8FA 3CY6A 3DUWA 4Y1GA 3TN7A 1RVV1 3ZW8A 4XLZA 3RBXA 1EUCB 3PEUA 2IKSA 1C9EA 4WNAA 5EN4A 1YS9A 1E1RA 2FPLA 4V39A 3RABA 1GPLA 3GLFE 1YJXA 2VPTA 1C3JA 2OK7A 3BH0A 5U1PA 4E46A 3I62A 1UKAA 3W5BA 4BDSA 5KSWB 4NATA 4YJFA 2V6GA 2B9VA 2ERYA 3H11A 2MINB 4CF5A 3J81A 3FR8A 1SXJA 2DU8A 2W00A 3Q41A 4P0TA 5CXQA 3C48A 4F9TA 1SVWA 4HNVA 4JNCA 1LBHA 1NVGA 3QEAZ 1JVSA 2XA9A 1G21B 4DXAA 4UAVA 2F4NA 3AM5A 1W4RA 3E9ZA 4MMXB 3BT7A 3P71T 3LY7A 3LUHA 3C3MA 1F9EA 2NX2A 3RKUA 2OAP1 3M4NA 5CLJA 4UXHA 3N7UA 1OBOA 1RMQA 3DBOB 4PR0A 3TFQA 1CUVA 1W4BA 4DLUA 5DN6A 2JARA 5JVDB 4FW8A 4BX3A 2Q4TA 1A4XA 2ATCA 1ISGA 2NZ8A 1VGVA 4ZPJA 3EVNA 2HNKA 3WZ2A 1G7TA 2AZTA 2XBLA 5K0SA 2PL9A 4RH1A 4N8DA 4Y2QA 3EIEA 1ADJA 3SG0A 1XZPA 1UBNA 3KJGA 2AZMA 3NHWA 4UNRA 1CYEA 4Q1AA 1YQQA 1E4EA 1XDDA 3F9IA 3W8EA 5LLTA 5H80A 3CEAA 3ICQB 4G1FA 2G1KA 3HACA 3HHEA 3CNOA 3C6XA 1BYIA 3JQRA 4IDCA 4PRYA 4R8VA 5CVEA 3TIIA 2PT9A 2X86A 3BXOA 1SQ6A 4OQYA 5C7OO 1ULAA 3COZA 4Y2UA 3UK2A 2IYXA 2IIVA 4K26A 4UQOA 4AZSA 1KYTA 2B8NA 1KPGA 2ATEA 3TDMA 5F7OA 1EQAA 1QZ3A 3H13A 2OAGA 2WYIA 4V0RA 1O0BA 2UUBB 2IVFA 3OLWA 1JMVA 4CKWB 4LS3A 4JLWA 3W7AA 4ARUA 4KR2A 1G8PA 5FI5A 1WPXA 1JNYA 1WZIA 2CUZA 1RKBA 3OQIB 1U4OA 1F2UB 5JD6A 2ZSAA 4LGYA 1CY0A 2Q9BA 1N3IA 1AH2A 4EHDA 4NK5A 4MGKR 4IIFA 4P9NA 1P1CA 2F7SA 1C9NA 1XWFA 5K0CA 4FHGA 2V1UA 4NCKA 1ZJZA 4W1RA 721PA 1U81A 4PCLA 4TRNA 2P8JA 2I67A 5T4BA 2YMMA 2VAVA 1XU4A 3AP1A 2JI4A 4MJ7A 1GQRA 2CCKA 1E6CA 5CEFA 3ER9A 5KVVA 4CM4A 1ZHOA 4Y1FA 4CPDA 4RK5A 5EJ8A 4B44A 3CKMA 1V4NA 2MJLA 3Q3CA 1IAQA 4XLTA 3AUFA 1FMCA 1BDHA 3FSJX 3OKPA 1KP3A 5DX8A 3VR6D 1DB3A 1P61B 1DE0A 1NUTA 1CUIA 1DC6A 1QJCA 2P11A 2QG6A 3A6GA 4HXGA 5EINA 1CIJA 1NBIA 3D59A 3KNZA 2CLLB 2AMLA 1VYTA 3URKA 1J0BA 4X84A 1YQ9A 1GVNB 1V11A 2ID4A 2VBIA 3PNYA 3GRVA 2DUMA 3DXFA 1DAIA 3AI2A 3ENWA 3HU3A 3L6OO 1G18A 4IDEA 2H7VA 1R4ZA 2H54A 1JB9A 3R3JA 3NRCA 3ANNA 3MOGA 4H18A 1T1JA 3KJFA 5TNXA 1R0LA 3BIOA 3MT0A 1FSFA 3O9MA 4KBFA 1EM6A 4DCPA 5K4GA 1HNZB 2UXBB 3TQSA 3H2JA 1JFSA 3PR1A 2YVLA 1C7RA 1DG9A 1JIIA 4OU4A 3AB8A 4MEBA 4FYKA 1LW7A 1P2UA 5HE8A 1V48A 2XMPA 1A0OA 4IY1A 2J9GA 3OIFA 1FFCA 1I13A 3R3YA 4ZANA 4E2ZA 5FV4A 1YXMA 2AN9A 3PX2A 4JT8A 3EC1A 2B8EA 5DEOA 1UWCA 5AKGA 2LKCA 4B7XA 2CFCA 4PR3A 2B4KA 2ECKA 4JYZA 1CUBA 1KRHA 3IQFA 4L4XA 1K08A 2ZWOA 2NPFA 2HMYB 1AO0A 5LMCA 3KZNA 4IDBA 3GMDA 1O95C 3ZS8A 4EI2A 4PYMA 2YVKA 2R84A 3AM4A 1GZ3A 2ZIAA 4NS4A 4L6AA 4O2AA 5FULA 3C3EA 3UAGA 4IAOA 5JWRA 2C2MA 5U4QA 4CM5A 3CZ9A 4DUGD 1GTZA 3GJTA 2YHIB 3HWX1 4UAJA 4AJPA 3QNUA 2I1QA 1BMFA 1LKZA 1GKUB 5F4BA 4A0FA 4RNDB 1BFKA 2P0AA 3EFEA 2IH4A 5AVVA 1BJTA 2ZUFA 2XXAB 5EXEA 3TQHA 5EGNA 1RLOA 1ELOA 3HVRA 1MABB 3KJNA 1XD9A 5F3DA 1QQBA 4XIFA 2P90A 1PGNA 3PPYA 4BX9A 2JGEA 1ST2A 1XD8A 3QUQA 2QSYA 4MVJD 4R9NA 3W5UA 2KYRA 4NE2A 1OZ0A 3D3JA 3ZOKA 4BEVA 4R51A 2FP4B 2Z3VA 4FMBB 2ISQA 4NABA 2QL7A 1R3UA 3OZDA 4MVJH 5DLPA 1XR3A 4YUAA 3WLLA 1BEEA 4F84A 4CMCA 3AF6A 1GIAA 3KOOA 1JR3D 2OV1A 4BC0A 4CIWA 2NMVA 3RC1A 4A82A 3AUXA 4PNZA 1R12A 2ZAOA 3NIBA 1V1RA 4IDNA 1OI4A 5IUNC 4NYIR 3DAYA 3OOYA 4P3OA 2GDZA 1N2CB 5LQAA 4CQNA 2QZ4A 3W1EA 4BNDA 5FT9A 4DQ0A 3ZIDA 3F5MA 1NBEA 3E7PA 1U1IA 2PGXA 3ROQA 3RWMB 3AFHA 3O3OB 4WT7A 5E38A 3AOGA 2ZI3A 1H22A 2BGUA 2CLEB 1E94E 2JAHA 2QRHA 1ACJA 3D8UA 3GAFA 5HTKA 5CT4A 3LCVB 3QM1A 5A4MS 5A4IS 5JYBA 1Q0RA 2PM8A 2JFGA 2G36A 2BKLA 5HQ3B 1N9ZA 3SHWA 1OH8A 4O4LB 4B6EA 1SGWA 4XX0A 3ZE9A 1Z7WA 1SUDA 1XVTA 1Q22A 3KD2A 1JH9A 1M2JA 3W8RA 2B2NA 4I2NA 1KVUA 4AZTA 3I9FA 1W581 3CLTC 3UKDA 3AW8A 3WTBA 3BIJA 5ITWA 5JBIA 3DE0X 1HM5A 1PV1A 4E70A 3WLNA 2YJ3A 1NASA 2UYYA 3E81A 3F8WA 3OP4A 1GQQA 1U9CA 4FXOA 3DAGA 4IUYA 4NOLA 4O4HA 1XL0A 4I50B 4Y2SA 3RR2A 1OXXK 2FEWB 1JQDA 1NVVR 3E8XA 3VKUA 1NLYA 4LZOA 1KY3A 4LIPD 2LE0A 3T3OA 4FCCA 4RM3A 5G4LA 1T0IA 1COWA 1V11B 2AC7A 3VUEA 3LHDA 3F46A 1J0XO 5B7NA 3VSAA 4J9VA 3NVKI 4QGGA 2DX7A 3MRVA 1SZDA 1YD7A 2NNWB 1D2GA 1GG2A 1LI5A 2R1VB 4XD7A 4XEUA 1W44A 1ZN9A 5D7NA 1SIUA 3DMHA 4JNKA 3V7WA 5LPNA 4OQFA 1JXOA 3VDXA 5HFAA 4QWWA 3HDJA 4KREA 1VKHA 3AI1A 4YY3B 1JA9A 4FDAA 1WZ2A 2W2TA 5I45A 1R7RA 3EIOA 3ZDYB 4BO5A 5M29A 2W2LA 1ZUNA 3SF8B 5JYDA 3HB4X 3Q9SA 3SQXA 1W85B 3DD5A 4IIJB 1R6TA 3W6OA 4G84A 4FOPA 4BXOA 1SOWA 4GOMD 4F5DA 1TD1A 1G5TA 4YDHB 4G4IA 1P2BA 1TT5A 3HJRA 4L0DA 3M6IA 3NX4A 3NHFA 1KQOA 4FQ8A 3DOUA 4WN9A 1X7HA 2QU8A 1MR3F 1G2OA 1NV9A 2W8BA 2RBEA 4CR7A 5D01A 2IX3A 4TS3A 5JJLA 1ZRHA 1SCQA 1YMVA 2FQQA 4CZ2A 1PYOA 3AHDA 2PL1A 4R3UC 5MGNA 2NZ2A 2QMUA 1TT7A 1EB9A 1JHPA 1VSVA 2H17A 2X2PA 5AKEA 5TJHA 2FUG1 1NOIA 2EGGA 2IQIA 3NCHA 1WVMA 1YZUA 4HXFB 4ALMA 5JT1A 3V4PB 3KV1A 3R5XA 2UU9B 2RKWA 4Y2GA 5HZHA 1SBCA 5C1PA 5LUAA 2NTEA 4RPJA 3O26A 3M1YA 4ARCA 2QUIA 3HA7A 5T5QA 3AL0C 4MULA 5A3VA 3CLRD 3RV4A 3IIMA 2O06A 2YMQA 1STOA 2WHEA 4AG3A 1FW6A 5GGYA 2MWMA 3E8SA 2G3YA 2QAIA 1NC1A 1YHYA 3DF7A 3EEIA 3MSCA 1E1CA 4JCOA 1RXSA 2NO6A 2ACWA 2CVQA 5FXMA 5KMGA 4M46A 1P1HA 1IZ0A 3KKOA 2AUMA 4XEHA 3R41A 1QWSA 5SYAA 1YDHA 4IF4A 4MW9A 4CFSA 2DPMA 2OWDA 3NONA 4WKCA 5FOUA 3JTMA 2QVZX 4EFNA 1WV1A 2BEVA 4GR9A 4RPIA 4A0RA 3K09A 3N87A 3CV3A 1NVFA 1S96A 1CIPA 4KCGA 3F6RA 2GEFA 2ACEA 2UAGA 1VJ1A 4X8OA 1KOLA 3RFCA 4AG5A 2JATA 1CNEA 3AJEA 3KZMA 4K40A 4MRRA 5FHQA 3SJUA 4QVIA 1PGJA 4YFVA 2YXPX 2FW7A 4ND4A 1P44A 3AY6A 2XVMA 4JJIA 3VSEA 1MABA 2HJ9A 2VP5A 1RHKA 3KFLA 4R41A 4PLGA 3U3JA 1G8FA 1ZOLA 1KI1A 4TQGA 4DB2A 2OCKA 2EX1A 3PQ5A 4LI3X 2DH5A 1L5FA 3L4BC 4FN4A 3S29A 4Q3LA 3L77A 4MCIA 4WNYA 3BWBA 2CJYA 5H5JA 1LBEA 4E0BA 2GETA 2DULA 1J90A 1Z82A 3DE4X 1N6RA 3ZVMA 4N0MA 2LUOA 4ZWNA 2OILA 3ND5A 4C20A 2B36A 3ZI7A 3FHTA 4KRGA 1NXPA 2FCAA 1RT9A 2YV5A 3GJRA 4FNMA 3SK0A 4RVDA 2H7CA 3P52A 3SDZA 1J99A 3GRRA 1XFAA 2AFHE 5DHSA 5LD2C 3NS7A 3PI7A 3VNVA 1FE8A 3PFBA 1ZI6A 5K6TA 3FJYA 2EARA 2QG4A 1RRGA 4FZJA 3UAOA 2CE2X 3F67A 3FVVA 5GP1A 2FR8A 2WJWA 1H69A 4M0MA 3G8DA 1L6RA 2QAGB 4HZUA 2E5WA 3EG9B 2PUCA 4FZ3A 5KI6A 4MQEA 4LG1A 3HR7A 4FHDA 4X93A 3THSA 3NM5A 1OFTA 4RPHA 3VYTB 3CZQA 2FN4A 1JFVA 3WHLA 3QP9A 3U6KA 4ZRNA 2ARKA 1US8B 3J7TA 1V16A 5CX1A 1U0OC 4YIKA 3GPLA 2GM5A 4KXUA 1VLVA 2I0FA 2QLJA 4L16A 3X2FA 4X71A 4IO0A 2PS9A 3EVGA 3QKTA 3QUCA 5DGTA 1AY0A 1QZUA 4UBNA 4C6HA 3ETCA 2PJDA 4WASA 1MO2A 4XM2A 1SC6A 1JU9A 5A05A 1ZG3A 2X9GA 4NC9A 2OYCA 4KLCA 2AS0A 4M9ZA 4ENUA 2I5PO 1NU6A 1ONOA 2V3VA 5C1DA 3CE6A 1Q17A 4KLAA 1SG0A 2EAUA 4YJ2F 1K3UB 1N6NA 4P81A 2NXNA 3ADPA 3CH7A 4UFPA 1CJCA 1XRLA 2OAEA 1W5SA 5AW2A 5FBHA 3QI7A 5JLJA 2CC2A 3THRA 4R1MA 4ARIA 3E9MA 1SD5A 1X94A 1J8QA 1GFWA 2BTQB 1NE2A 5LP6A 2HF2A 1HUQA 2FVXA 3JQBA 4EHLA 2D8AA 1TLLA 4RMJA 4PC2A 1PV4A 1I2AA 1XLUA 5JZMA 5HBRA 2WWVD 1IY1A 1EMDA 1QFJA 4FCVA 4YJKA 3X1YA 2AXQA 3G0IA 1ZMOA 1ZJJA 5IKMA 4TYMA 3EF0A 3MJTA 3ESRA 3T06B 2Q1TA 1SU6A 4QDKA 2CXUA 2TMDA 2VQFB 2UXCB 1ONSA 3ON5A 2ODQA 2YN2A 4HAZA 4DSUA 3GLIB 1LPMA 1FX1A 4FYWA 3PWKA 4H15A 1TMKA 2RGGA 4JVLA 3ZUGA 5C8ZA 5JEDA 4EUNA 1T2FA 3W04A 1EINA 3R4VA 4D3ZA 2QBYA 3KR0A 1WDMA 2CZGA 3P5SA 1LLUA 3EMKA 5IXJA 1PSWA 3HFSA 3KBOA 4X3CA 3ZKWA 3IUYA 1ONBA 1EFLA 1KJ9A 2Q62A 1OAAA 3ICOA 4DMUB 2HRBA 4R1UA 4J91A 3T7RA 4IQ8A 1GQYA 1AQ6A 1YB1A 4QTZA 3VQTA 3UAWA 3PYXA 2VQSA 3G0GA 1NBMD 1NNI1 3PC2A 2WWTA 1KDYA 4B5KA 1O95D 1Z6YA 3GF4A 3H2IA 4BV2A 5HOEA 1ZY2A 3RNOA 2HU5A 2PYIA 5TARA 4EY7A 3HHPA 1P77A 4CIXA 4ENRA 3N0VA 2O20A 4S0ZA 3N39C 4C6RA 4EH1A 4KPEC 2QP9X 1RYEA 4TXLA 3CZAA 4XVUA 1N6LA 5C8YA 3SBXA 4MTLA 4FTWA 3ZD6A 4HNAA 3BL5A 3PE3A 5LYJB 1JEQA 5DX0A 1N0IA 1ZN7A 4KSYA 5KTPA 2FPIB 2CT8A 3SBEA 3KYBA 1OWPA 3BILA 4N1AA 5JZVA 4HNGA 1LS6A 2CN1A 2P6UA 1GKKA 2Z9BA 1BD3A 2QNIA 4RBNA 2R6HA 5GOZA 5KNBA 1VJ0A 2QBYB 4YMTA 1ADGA 1ETUA 3T4XA 3W77A 4ACBA 4HNTA 2HA0A 4CG0A 1FDTA 1PR9A 1ZK3A 2W6ID 4HDOB 4TTIA 5HFNA 4CT5A 4O0MA 3S68A 4NY1A 2WD9A 3MT9A 5MFZA 3ZXIA 2XMGA 3LTNC 3HTXA 3KSMA 3ZBTA 4MJXA 5HF6A 2GPYA 2BSQA 1EQUA 2XDWA 1SQ0A 1F8XA 3FJOA 4G4JA 4MWBA 4S35A 3K0CA 5E1BA 2LCQA 2JI9A 3PBKA 3WRWA 4EG5A 2VRWA 2P3OA 3EZLA 5JU6A 3BQMB 4E3WA 1FQOA 5AXDA 3UT5B 1QUEA 1OSNA 3OP1A 4ZDKA 5CUQA 2FEPA 4IXDA 4WBNA 4P2GA 3RVMA 4PHTA 2OV6A 1Z2EA 4GAEA 4JI5B 4BLPA 5JQWA 3HADA 1YT5A 1AXEA 2Q4BA 3KKEA 3TD9A 5JPIA 2R4TA 1HQKA 4WSOA 3QKSB 2R8ZA 4Z9AA 1U3VA 5AVKA 1F5SA 5K3CA 1Z6PA 3U81A 1MIHA 2QZSA 2FPXA 2Q3JA 4HMQA 5DYNA 3UWPA 2D59A 2AG6A 1Q1QA 1VBMA 3I83A 4YAIA 1LVHA 2R87A 4MPPA 4W8GA 1ULHA 2WYVA 5DN9A 2GCPA 3OE7D 1OLUA 2XGOA 3OE4A 1BHSA 1B8UA 4J03A 3HFGA 1BH2A 3ZZMA 4M86A 4TPKA 2PRKA 1M6VA 2G4CA 2HAEA 1JXQA 2B4RO 3ZX4A 1DWOA 1NTOA 2QTMA 1SB8A 2VYVA 2XRYA 2XUJA 3A37A 4HWSA 4GQAA 1YRWA 3TLZA 2D1RA 5ECYA 1Z07A 5D8DA 3VV3A 1XZNA 2IV2X 2ZTSA 3NTVA 3WL4A 3DLAA 4B32A 1RXVA 3O2NA 1QE0A 4PGFA 1XEWY 2V58A 1UJ4A 4ZYVA 3OZBA 4UMVA 4BNVA 3IILA 2C61A 2OK8A 4JVMA 5ARDA 5CAEB 2FFQA 5CTAA 1UCFA 2J32A 3DPIA 4XDGA 4DJFC 5JJCA 2IA5A 1ZD8A 2IOFA 3U62A 3KSDO 3CX7A 4LDQA 4I6JA 2D0DA 1VLZA 1S3GA 3WWPA 1QH1B 1D2MA 1X42A 1G55A 2CWDA 4IYJA 3H1FA 5G1OA 3T3EA 2QG9A 2BMAA 3LCCA 4HTFB 4F2HA 1M73E 4CEJB 1UBEA 2VHTA 3EG9A 3I2JA 4TT3D 4EJSC 2JLZA 4RZQA 1PZHA 2CZCA 4PV7A 3DVQX 1Y4AE 2WR8A 4U8HA 2ZPAA 3HPRA 3LUGA 2X5KO 2WM2A 4KXNA 2VN8A 4XFDA 2QGNA 8OHMA 2YFYA 3A31A 1QZTA 1WXWA 2AXNA 2I2XB 3HY6A 5CA0F 3QMVA 1M0SA 3WL6A 3HBLA 4UMFA 2ZJ4A 1EX1A 4ZCPA 1R6VA 4P35A 4R2MA 5DK6A 1JW9B 4U2EA 2P4HX 2QM0A 4F12A 1AQUA 4Y2HA 4FB4A 3RUFA 3C45A 2DUNA 3LPNA 1T4GA 1DJMA 5FD8A 4PX2A 3T7KA 3INNA 4G5OA 2J3JA 1O97D 5BPFA 2PFGA 3MWJA 1RLIA 1PRYA 1Y89A 1NONA 4ZRMA 5IC4A 1GKIA 5A4AA 3OM1A 1MFZA 2Y92A 4KEAA 4ZCIA 3SZ3A 2ZIZA 4EPVA 2P7IA 1A5ZA 1EWVA 4GQBA 4N03A 2XNHA 3PQCA 4BB6A 1AX9A 4ZCLA 2OXFA 1ZN8A 4LQDA 4W5JA 1RM3A 4X41A 5CM8B 1BDIA 4V24A 1QLWA 1MENA 4A92A 2RJ3A 1V47A 2Z57A 2WF5A 1FTYA 5I4KA 3VFDA 3PQ4A 4N0EA 4KYVA 3SHFA 4U2GA 1BWRA 5AKYA 1M10A 4M88A 1TXGA 2NTNA 3Q85A 4C76A 4OXIA 1DQZA 1UFVA 4C4YA 3JQ7B 2OPHA 4EVRA 5IN5A 4UHCA 6REQA 3PTLA 1IUKA 2BDTA 2DJIA 2ABWA 5BSMA 2OQRA 1GTG1 2Z4SA 2ZB3A 3RHSA 2C9OA 1XMIA 3FUVA 2HBZA 3V5NA 3AVWA 2ZPTX 2FDCA 1ECBA 1E3DA 1ID8A 2W6JD 4DR2B 3W2HA 1J0CA 1E58A 2TMGA 3BL8A 1IAVA 4TGLA 2J87A 2CLCX 4HGZA 2BGGA 2R2GA 2O7SA 4MYUA 1FL9A 2CBZA 1VC2A 2K4MA 2W22A 1DELA 2YZNA 1UBMS 2BKVA 2Q07A 3GMIA 3HB1A 5ES4B 4ER7A 2NTJA 3RW9A 4BKRA 3H65A 2ZS8A 4LXIA 5DRTA 4YCAA 2VJMA 3TOXA 5DW0A 4BNDB 4UBJA 3GLIA 1DTWA 1SCUA 2VAPA 3ZU4A 4B0PA 2PX6A 2PBRA 5CB8A 2C7VA 4MYSA 2R1VA 2ONYA 4BEWA 4WJLA 4I3FA 5DLYA 3QLEA 5J2TA 4WN9B 3R1IA 5HHTA 4LOHA 3IE1A 1TEZA 3ZWAA 5K09A 1THTA 4HMPA 2QX7A 1AK9A 4US1R 1DC4A 1X8LA 2SCUA 1KGDA 4GU5A 4EQ6A 3W79A 4PG8A 3O3CA 4Z7OB 5SV2A 3VPSA 1UAYA 1E1QA 1RWVA 3K8YA 4WHMA 5T8KA 3EFOA 3ZJ4A 1W4ZA 5CVDA 5CLQA 4EY3A 4CLRA 1J1IA 3VRHA 1PW5A 3MTDA 4V0MA 1QQ5A 5IARA 4BVJA 3P8ZA 4IZHA 2AGVA 4N40A 1QYWA 1VI5A 4R8MA 3OZVA 1PFQA 3UQZA 4W5RA 2QJTA 3WNQA 1RI3A 3SXUB 3RVJA 2VBFA 3Q7PA 3ROXA 1CNFA 4KVFA 5KJ6A 4RK1A 1YBMA 4YJ2B 3E2MA 2HWWA 4P82A 2VXOA 4ZVTA 3RJZA 1UANA 5LYYA 4CRWB 1HX7A 3BF7A 4PG7A 4AN0A 4W5OA 1I6KA 4CG1A 4CTMA 3R7SA 1ZDMA 1ZKDA 3ANTA 2VZ9A 2FKAA 3SQMA 4FIZA 5U9CA 4LXHA 3IR5A 1OW3B 2FPKA 3NP9A 2DHQA 1PFUA 4XB6B 1U0RA 4DJEC 1HG0A 4COKA 3OIUA 1T0PA 3KZVA 4Q24A 3F47A 4J29A 2B83A 2IWRA 2QW8A 3I8OA 5CCXA 4KQIA 3VDNB 4D4KA 1KQNA 4CDMA 1K8QA 2P6PA 4GMXA 1DTSA 3EZ7A 5AVTA 4D4JA 1QGAA 2CKDA 2NO9A 4YYZA 5DI9A 4CMEC 2XCTB 2ZAMA 1WP9A 4K9KA 1TCVA 4RIFA 4XX1A 5C7YA 4XSHA 4ZI5A 2OO5A 3Q7SA 4XR9A 1B1CA 3QV1A 2AUNA 2VQDA 4YP7A 3ZU3A 4BO7A 5CB4B 4FINA 3RJ5A 5K01A 3PUKA 3OCWA 4KQCA 3ILHA 1C5KA 1Z06A 3BSSA 4MCAA 1JLKA 5B3JA 3UENA 1Z73A 1Q6ZA 2UYGA 1WMFA 4L28A 5HIKA 1XL1A 2W2XA 5C8DA 3T7SA 1JIQA 2H9YA 3ITDA 2WF6A 3FZYA 5FTNA 5CFLA 5MGBA 5DM70 2H08A 3ZI0A 1OREA 4YBZA 4B7AA 3OX1A 4QRHA 3BHJA 4ZT5A 3AYZB 2HWXA 2CXQA 4OYRA 3RDPA 1DJLA 1HEYA 2EHJA 5CVVA 4G23A 1KAQA 2DH6A 3D6TB 4NEGA 3HLKA 3VZRA 1Q1BA 1RWKA 4ZQEA 4QD3A 2W4MA 4BAGA 1TKBA 1G9SA 1BQ3A 4JGGA 2EX4A 4Q3BA 4O2BB 3WIDA 5CDUA 3U5ZB 3OI7A 1HT2E 2PZGA 3C7TA 1GG5A 1O94A 1GUBA 1J24A 1T6NA 1IXSB 3L0ZA 2D6FA 4H35A 1TMOA 1DEXA 3PI6A 2RDMA 3BIXA 3N8DA 2YOFA 5TB5A 4RHTA 1MZVA 4JJEA 4MWTA 4CODB 2ZITA 3R2JA 4C5CA 4K87A 5AKXA 1RZRD 2X5XA 2OXRA 2VTKA 3RM3A 4E1VA 4WERA 2JZNA 4H9GA 4BFUA 3FD8A 1U65A 4REOA 1NMZA 3KWJA 4ZVOA 3OZGA 4AY2A 1Y9DA 4CMBA 1J0AA 2OCDA 2WA2A 5BW6B 1UBKS 3GWZA 3MW8A 3TQIA 5EEHA 4B46A 3S5JA 3F6CA 3KC2A 1EFPA 3GRKA 4Q1CA 4PZ0A 5HJ2A 2BJHA 1FZTA 1W6RA 3W4KA 4X64B 2I76A 1A95A 3AI3A 2OMEA 4EUHA 1KZ1A 1G66A 1UK9A 3NHLA 3OFNA 1GAJA 3FOWA 3V4OA 4HQKA 2RGDA 1KQ3A 3C7AA 3MQ2A 1UF9A 1Y7HA 3H8WA 4NYJQ 1IEXA 4EF4A 2J4DA 2VDVE 4OKSA 2QVGA 5IF9A 1KJQA 3RC2A 5I7HA 5LSAA 3HBAA 4CFYA 2Z6VA 3RF7A 1KYWA 1YZQA 1SCUB 4NBWA 5JQGB 1HMYA 3V9PA 3FY4A 1IK4A 2B0CA 4URYR 4EABA 3ZXYA 2Z5VA 3JV7A 3CKLA 2FFBA 1UMKA 4RZHA 5ALIA 1U0HC 2VH1A 3E48A 2O0MA 4RTSA 4GDFA 2E48A 1X7WA 2FVYA 2HDHA 4ZVLA 4HD8A 5EKXA 5H16A 5BXQC 5HS4A 2DBQA 4OBWA 1O57A 1KFBB 1NUHA 1N6OA 4JJZA 1MGPA 4IDHA 1TIBA 2HJHA 3MXTA 1GGKA 2JF0A 1USKA 3OCVA 4L72A 4RKYA 1KY5A 1VFNA 1GARA 3F9CA 4G0ZA 5KKAA 2VDWB 4UNNA 1ISPA 2X14A 4JIMA 4YMGA 3OOJA 4KWCA 5ITZB 1X6VA 1LF5A 1FFGA 3RTBA 2RHOA 1ZNQO 2IU4A 3LL4A 3S2IA 3KOUA 3A2KA 2NW6A 1M7BA 3X2EA 1C9KA 4Z53A 1YK1A 1CY6A 3EZFA 3G9XA 1E2EA 2JHCA 5AUNB 4QU9A 4MV5A 1C0IA 2YY7A 1WHSA 3AXSA 1P6XA 3I42A 3V33A 3NHZA 1WB9A 3L7CA 2QTAA 1NYTA 1YJBA 2IXAA 1DO8A 1WHTA 2ZAIA 1OFUX 3ZW7A 1NY6A 2PVPA 3OIWA 4OHZA 1U0JA 1WB4A 2HU8A 2JIBA 3WE7A 4KFRA 3HPQA 4QELA 3FTQA 4Q9JA 1DJNA 2Q3FA 2QROA 4DBLE 4ZCQA 4DGQA 2DBRA 3ABRB 3H5NA 3T7JA 1T5SA 1YIOA 4S05A 1XWIA 3EB9A 1P5FA 1G3IA 3D0OA 3K2IA 1ZR2A 4Q1EA 4Z8YA 3ZWVA 3MUNA 4CL2A 1R6XA 2EVWX 4K0RA 1JSXA 2M1ZA 2QR3A 5KYGA 2CYBA 4L9AA 1KU6A 1AUXA 1SXJC 2VLIA 2GO7A 2W37A 5EXSA 3WB2A 2EQ5A 3O0TA 5BY2A 3BJMA 3UUFA 5JC8A 1ZAYA 3KJIA 3DD1A 3RVDA 1N5DA 1E7WA 3MVEA 2CJWB 1E2NA 2EOAA 2YWEA 2XMDA 2YFKA 4NNPA 2G08A 1UC4B 2O1SA 2K6GA 1DAFA 1E2PA 1CP3A 3FCCA 3UMJA 1AOXA 2MINA 4JITA 4DEYA 5IJAA 4LPSA 3MCTA 3A6PC 4NV1A 5AXAA 3O38A 3U4HA 1M74A 1J2EA 2OT3B 2WB4A 2Z98A 1RCFA 4KL8S 3IAEA 3TDNA 4NCAA 2HLHA 1Z0KA 3QPAA 5D86A 2PMCA 2WIBA 3DEYX 5I4CA 3VDMA 1PJ2A 1OR8A 2WIGA 3BGWA 3LHIA 5C52B 2WQ6A 2I29A 2B82A 1JBEA 4PFJA 1PJ3A 3UAYA 3ADDA 1KC1A 1P3DA 4DDHA 1I94B 4R8RA 5KTSA 3TPZA 5IAOA 2J9FB 1V45E 2I4IA 4EG6A 1K4YA 1F3OA 3QQ5A 5CD9A 3PXEA 5IZCA 5JCPA 3R7DA 4JLSA 4DMRA 3EGVA 4QM6A 4OHVA 2I4NA 5BNWA 1PUJA 4DAEA 2X8WA 2HDWA 4FGSA 4MVXA 5TS2A 1R9JA 2VTBB 4HADA 2AVNA 4NSNA 2IPOA 4XIYA 2XR1A 1DWUA 2VF8A 3D6AA 3R3HA 3OIDA 3EPLA 3DBVO 4DBLC 5E7QA 2AJ8A 1DDOA 3H5VA 2IH5A 3IAM1 2GPSA 4WY8A 1T2VA 1YQWA 2WU3A 2P4UA 3OFSA 1EDEA 1NW5A 2IKQA 2O8VA 5LQSA 5TDHA 2NP6A 2SKEA 1G3QA 1GRQA 1VOTA 3DUFB 4GRDA 4MUGA 2C04A 5AT1A 2OSBA 1Z62A 3QEMB 1U9YA 4HWPA 1UT6A 1BX3A 4NMLA 3RTDA 2DBVO 3HCDA 3FH0A 4F86A 2XWQA 2CMHA 4MJLA 4OSPA 4R8KA 5HZKA 2WP8J 4GWKA 5DNVA 3UAZA 7REQB 4CV1A 2OY0A 2RI0A 3I73A 3RRXA 3DJFA 4IH1A 5C53B 4AS3A 1AQNA 2IYYA 2VHWA 1Q1EA 4TTQA 5DWQA 3ZWYA 1XF1A 1Z8HA 4RABA 1WTAA 2G07A 4ZCMA 1JB1A 1XKTA 2I3DA 2P68A 4REMA 5IDWA 3UJDA 2ECQA 1XDGA 3U3RA 5K3OA 2BGIA 2ZJBA 1J5XA 1RQRA 2H2FA 3K0AA 2OECA 4KE6A 2XF8A 3FPSA 3IBGA 1J25A 3GR6A 2EGHA 3AR3A 3I28A 4LGMA 1GFSA 4UVDA 4BGVA 1X2BA 1PDVA 3M5PA 4ZK2A 1UWVA 1WCIB 2A86A 2NADA 1L1FA 1E79A 2Q1XA 2MYPA 3HH8A 4H2DA 4KP7A 2E4UA 3NH6A 1E3WA 2B1IA 3MN1A 1ZW6A 3C3XA 4KXYA 4ZVNA 3PNLA 2OGWA 4KK4A 3OBBA 3OWHA 2QS9A 3I76A 1A88A 1NQOA 4PLYA 3UHAA 4HPWA 2FN9A 2ZTLA 3QUTA 2YZMA 4HAWA 2DLNA 3VKVA 3ZU5A 1M2FA 1V8FA 2XYGA 4P5DA 2HPZA 5ESRA 1IOWA 2Z2ZA 2AFIB 3KAPA 1R0ZA 1XZBA 5AK4A 2AX3A 1ZO8A 1SQGA 4BZQA 1KTVA 2DJ5A 2J30A 2WWXA 3D7RA 4PQEA 3K8ZA 1I4EB 4WGFA 3RUPA 5IC5A 1XV5A 3AONB 3TOCA 4YP5A 2DXIA 4HBGA 1UP6A 1YCHA 2GCNA 3FXAA 1I6WA 1SZPA 3QPBA 1DFIA 4JP5A 3BE4A 1SUSA 5AM0A 4A8JC 3WOHA 3NV9A 5AOCA 4F2DA 3U09A 2DR3A 3AZQA 3OQIA 1OT3A 2P9JA 4FMDB 4FYJA 4RKQA 1I2CA 4PY2A 1U2TA 1XZ8A 3NBAA 4K6OA 4R6WA 4MDEA 1D7AA 4TLBA 1R9GA 1X7YA 2CB0A 3DOJA 4HAYA 2P77A 2YWFA 2QRZA 2Q2QA 3CZCA 3LRTA 1PL7A 2QR2A 4HBZA 5A1JA 4OLAA 2XDQB 1P60A 1T8RA 1KU0A 4B3RB 1IJFA 1W73A 4B2IA 1M3SA 1J2TA 3LWBA 4I1OA 3U4QB 2H8GA 1QZZA 5KHAA 1U5BB 2WLSA 2W4IA 4PSVA 4INOA 3JQ6A 2J8ZA 3RAPR 1JI3A 3FFTA 4INAA 3E2PA 4YRTA 4B2LA 5CFRA 4DTCA 2BI7A 3EVDA 4A2WA 4AMZA 3HB7A 3LV8A 2QW1A 3TW8B 3NBXX 3WNBA 2YXDA 4B6OA 4LN1A 3EA4A 2A2ZA 3GRCA 4KVGA 3C1AA 1WMEA 4JP8A 3OUUA 1V8OA 2AF3C 5C3MA 5LCXA 4FJ0A 1JAHA 3K1TA 4IJUA 1TE2A 5A7FA 4UCWA 2PKYX 4X44A 2JANA 3DFMA 2Z2YA 3LA6A 4NEQA 4AWXA 4UUQA 3RUEA 5IVKA 1ZCBA 3CEMA 4X7RA 2DEUA 1Z5PA 4S04A 3L8ZA 4BC1A 1KYVA 1V2GA 1WNTA 4IM7A 5IU6A 1ZC3A 4L1KA 5BPHA 4A5SA 3KQNA 2R6ZA 1NFRA 3GQVA 1FRQA 2QPLA 1GN9A 4PCVA 2WSIA 1X9GA 4BN4A 3OOHA 1T9CA 5TY0A 4KNWA 3TMYA 1N2EA 3PHJA 5DO9A 5JCJA 5I7SA 4ZI7B 2P4SA 2O8FA 4CIYA 2PG3A 4PZYA 3DLIA 2DWOA 1GY8A 4CKBA 4ALNA 3CT4A 4J7UA 2BMVA 4G5FA 1S8OA 3DMFA 5DYIA 2BW0A 1T15A 1KMQA 3O4JA 1IJEA 3H6HA 4YJHB 3MTIA 4KI7A 5JNLA 4G5XA 1XDUA 4P86A 4CJXA 4K9NA 1ZD3A 1EUYA 5K20A 2F3UA 421PA 4KN6A 3AVXA 3NJRA 2V5VA 4J6EA 3GO4A 4EY8A 4X63A 5J9FA 1JPJA 3KZXA 4YPVA 3GVXA 1XTPA 3MTAA 1Z5WA 2K7FA 4ZVVA 2NO4A 4B85A 3OX4A 4RAQA 2YZ7A 4QYWA 1I8TA 2FMFA 4TQAA 3WJ7A 3UPUA 2OMKA 3IVMA 3ZLJA 1WZEA 4AKEA 2XNDA 2OGUA 2NAPA 4QEZA 1UJMA 1I0ZA 1X1BA 3ZD7A 1SD1A 1SULA 4JGBA 2CF6A 3DM9B 2XB6A 1G19A 2GXSA 2GJ4A 2V96A 4MQ5A 4U02A 3SE7A 3FTPA 3E23A 3TM5A 1GDTA 1K4KA 2X1MA 3TNDA 1M33A 4JT4A 1TX4B 1YR8A 2RK6A 5KTOA 1IXZA 2Y66A 3KJXA 4BJ5A 3TUZC 1IY8A 2X4DA 4Q1FA 4DJTA 2CD9A 4CCSA 4MYRA 2NZVG 1HYQA 3G0CA 3SQLA 2WDPA 3AR4A 2QEQA 1OQAA 3B85A 4Z3KA 4D25A 1DCTA 1ODKA 3PGMA 3PU6A 1DKNA 2GF2A 2WWYA 2H4FA 3PT9A 4TRRA 2XE8A 3OCJA 4O4IA 4XTCS 1UK7A 1HDRA 1Y37A 3Q6MA 4KQMA 5EZYF 3EY4A 4N6NA 3OTQA 4ND6A 1CW2B 1L4LA 2D13A 2WKSA 5FLXA 3LX4A 3DG9A 4R6XA 1VBKA 4RK6A 1RE0A 4NBSA 4FU0A 2C2ZA 3DMRA 3A2NA 1NW6A 5BOVA 4DDUA 1R0SA 2QXUA 4K1XA 2YCBA 3WIOA 1KZ6A 2DHEA 2VNKA 1UOOA 3LH5A 3PK0A 1FFAA 3DVSX 1N2IA 1BNCA 4I1YA 4LDNA 4URZR 5J4HA 4IG9A 1JJIA 1CIVA 4UM8B 4F5ZA 1VZ2A 1WCYA 2B1QA 4AX4A 3FB1A 3HC7A 2BGWA 5DXAA 1YF3A 4OGFA 1Z5UA 1LBTA 2HW8A 4UTNA 3NAMA 2P9FA 2Y1FA 3HS3A 3KVOA 4DMLA 1TU3A 5BUQA 1ZH2A 2XH8A 3R5SA 1RPTA 4MHSA 1U0TA 2FQ1A 2RONA 3K53A 4BGUA 1PTJC 2DFPA 1R6DA 1YL7A 2IF0A 2O5RA 3NIWA 5KCMA 3VNBA 1GQ2A 4NVRA 3H1GA 4GECA 2C07A 4AO8A 2B1RA 3GLFB 5JS1A 2R66A 1E9CA 1I7QB 2FMXA 2HHLA 3ONVA 1MIOA 2P2YA 4AWAA 2Q5FA 2WU4A 2XB2A 1Y80A 4UFOA 5FAXA 3F6BX 1C3EA 1VTKA 3GA7A 3C70A 3SIXA 3TLYA 1EUQA 2ZXEA 3RC9A 1DAHA 3ZZNA 1WHSB 1FNBA 2ZTMA 3AUJB 4M37A 1RAGA 2G0AA 4Q82A 3VU9A 4JHLA 2AA3A 3UATA 5DGXA 3WFZA 4CQLB 1KFCB 3KZOA 4QJBA 5BN3A 2VDUE 3I6BA 5GJWC 3U4QA 4LOLA 1XHLA 2HQRA 2GN0A 3C16C 5JFGA 1V8BA 3PHGA 3I2KA 3FYUA 3TYXA 4Z2AA 2NYUA 4P08A 1VGRA 4RPLA 4TL7A 2UZ1A 1GCOA 3BCRA 3QWAA 3QZUA 4D4IA 1CZKA 2EKPA 1V43A 2PPLA 3A3YA 3BXPA 3BN3A 3RRMA 3TBFA 4CM9A 1KEUA 2C8KA 3I12A 4GP9A 4Y8VA 3QEOA 4IIBA 1A2BA 1QG6A 4CNQA 4AQDA 3QY0A 3WA6A 1CR1A 3INRA 3TO5A 1ITZA 1O1YA 1XRJA 5H9WA 1V8ZA 4LF9B 1T43A 5H81A 4OEHA 1UOEA 4X8LA 3GPIA 2WLTA 1P7CA 5GV8A 1BAPA 3W90A 5CFZA 1W6UA 4XWAA 5KO2A 2O50A 5GIPE 5TE9A 2ONZA 4MYDA 2DFLA 3IP3A 1VL6A 4NXNB 1ZZEA 4N7JA 3EQ7A 4W5QA 1E3MA 3GQBB 2PQ6A 3ECAA 2QORA 2H65A 3PV0A 4EFKA 3SWWA 2X4IA 4DA4A 1UC9A 2WKPA 4Q00A 5E6RB 1DHRA 2J4CA 2EJUA 2EFGA 1HTWA 1MJHA 3NT2A 1F0NA 3OPVA 4J90A 1ZIYA 4MRMA 4F0JA 2HRQA 2LIVA 3I01M 2ADFA 2IU3A 4HVTA 4O25A 1DIGA 3TTYA 4D8VA 5BV1A 5KNCA 4OM7A 5FLYA 3HZHA 3C6BA 2ODBA 4P36A 4KUHA 1DIBA 3ESAA 2CXOA 2DQYA 2B30A 2D0IA 5DN6D 3IESA 1RYNA 4OFBA 2XUZA 3AIKA 3EDRA 3GD7A 1FQJA 4HAIA 1CXZA 1VKRA 3HGTA 2X76A 2ZIEA 3KLPX 1R0XA 2VAXA 3CO0S 4O4HB 3DBRA 4BB5A 2W8ZA 4Y2PA 3U16A 3L7MA 2Z1MA 1XMJA 5AO9A 1F0PA 5ESWA 1LW6E 4DEXA 1QPGA 3SVLA 3JQAD 4EAAA 1Q1ZA 4L75A 2VCYA 2FPGA 4I19A 2V3WA 1E2FA 3ZQUA 4ZXFA 1E5XA 3I2YX 1WVIA 3PUYA 1THZA 5JR3A 5JH7A 1C1HA 3M9WA 4M8KA 4YA6A 4XIGS 2C88A 2PUEA 1KYZA 4IWXA 5ELMA 5TF0A 2XCSB 1X38A 3S2SA 3GOQA 3X1JA 4RM2A 5SICE 5CLLA 1XU9A 1WZUA 4HQFA 2D5AA 3MS4A 3PRJA 1VIYA 4LYEA 3HVUA 4RF5A 4HV4A 3ZVKA 4NR0A 2V9CA 1C41A 4JY7A 1KO8A 4D92A 1ZIDA 4RZ2A 3IVXA 4MUBA 2WM3A 3DZFA 1UJ6A 3EGXA 3Q7EA 3W9UA 5IT0A 3A9TA 4DR3B 1UK8A 4X92A 3RK0A 4HLNA 2PU5A 5BT9A 3STUA 4PWZA 5I7VA 3AHEA 2PVCA 4ANFA 3PEWA 1KJWA 3FNIA 4LVNA 1G0NA 4QG7A 1RI4A 4JN6B 4L76A 1CPYA 1K7CA 4M76B 3A9UA 2QU7A 2ZKLA 4YMSA 2G28A 3ZW9A 5B1EA 3G5TA 4PGGA 3KALA 1B6GA 2QE7A 3CLSD 3OCXA 2PT6A 1N75A 2O2SA 4WN3A 2RGYA 1JN0A 2DM6A 4M9XA 1YZVA 1Q0HA 1OT5A 5LMNB 4GEGA 5EP4A 1MJGA 2FU5C 3HFRA 3O74A 3PGLA 1MAHA 2AK2A 3EGOA 3V3TA 3TZHA 4C9BA 2WAOA 4BBAA 1TZKA 2WJ4A 4PLHA 4WW0A 3RFXA 3R8XA 4DC9A 5J58A 2MSNA 4A8PA 4PM4A 4G41A 3NXKA 4LE2A 4BIIA 5CB6A 1NX6A 4HDSB 4URXR 1FUIA 1LPOA 2PGNA 4JBGA 3FMGA 4BJ6A 3ZQKA 1DZIA 1WCWA 1K0FA 2V45A 4TMXA 3BWYA 3TLJA 1E8DA 3FG9A 1OFVA 3HVHA 5KVSA 4L5YA 5HUHA 4DCSA 1DO2A 4OLFA 2HQSA 1KZ4A 4OXRA 4JBYA 3AQ4A 4D9HA 5GAJA 2NV0A 3L7IA 4TN5A 2I80A 3MSXA 4DQVA 3JQAA 3M4YA 2ZETA 3WLIA 2CLIB 2OZKA 1GV0A 3PQDA 3KPVA 5ALNA 3D7LA 2C3YA 1V35A 1JQKA 1XZJA 3IMGA 4W5TA 1AF4A 2CKMA 3WV4A 1PT9A 3JQPA 4BVLA 1WETA 1M8FA 1SUIA 2PGJA 3QX9A 1HE3A 2RSLA 2IYVA 1RRPA 3FHCB 1Z6TA 4U6NA 4ZOBA 4C3OB 3ZJUA 3S2FA 1H05A 3U49A 4JJ7A 1E4YA 4V3CA 2WB2A 3GEHA 3KAKA 2EL9A 1X7WB 1EK6A 4WZBB 2C2BA 3CJQA 1H8HA 4N65A 2BGJA 1DAOA 2PR7A 3X2SA 3CPJB 3AKZA 5ESXA 1KDVA 1YCGA 2QTHA 2H2WA 3Q3VA 4CDGA 1LSSA 4UVIA 4K46A 3WLFA 3OCZA 2XMZA 2P9CA 2W6ZA 4L7VA 2QKYA 4FIDA 4F11A 2WV9A 5JAUA 3U4MA 3QJ5A 4YMIA 1BMFD 4BNIA 3L4SO 5JJIA 1GZVA 5BR1A 2YJZA 4DM4A 4G37A 1TCUA 4OTZA 4D9FA 2NVUB 1T2UA 1Y8CA 3ECCA 1QRAA 2DETA 3T1QA 2MYNA 2QSZA 3KEMA 1UBUS 5LZ9A 2RI1A 2DERA 3BERA 2QE7D 4HXEB 1G9XA 4NOMA 4DE5A 3HNRA 2XVAA 4LSGA 4EB6A 3KTDA 4ER5A 3C6YA 3ZJVA 4FONA 2FMIA 3E3OA 2JFPA 1K8ZB 1N0WA 1QV7A 4LC0A 4EHFA 1SA0A 4J8PA 2GI4A 2H0QA 4RJTA 5I9LA 3OA0A 3WWOA 4J2HA 1QQAA 3VV2A 4Z8XA 3A28A 4IKPA 1CVRA 1A9RA 1XA3A 2NXJA 4Y9RA 2K7ZA 4WJZA 1QHXA 3USES 3ZY3A 1MEJA 4A8JA 4E5MA 2J08A 3ZE6A 1F2DA 1GL7A 2FEMA 2EERA 1RADA 2CHEA 2L17A 3LBFA 3PSAA 4P2BA 3RRFA 2JFYA 1KK3A 3TLMA 4JB0A 4HWKA 4KXXA 1ABEA 4MLZA 5L3SB 3RTEA 3EY9A 4WADA 5CYPA 1TK9A 4PQYA 3EULA 3I5XA 4OKIA 4XGKA 3BGVA 4BP1A 4I2VA 1T36A 5EZYA 4Z2YA 4DQXA 4RIGA 1J2JA 5FHRA 1Z6XA 1U80A 1Y7PA 3R3VA 4BNZA 1QPBA 2XA2A 4NBRA 5D84A 2PBLA 1ZUD1 1TVCA 3LX8A 3RIXA 1J2RA 3H1PA 5A9TA 3V4ZA 3DMTA 1MU0A 4KIGA 5JMTA 4KQFA 3OIGA 2I8AA 1FA9A 2PT5A 4LXUA 3IJRA 5GTDA 4OA8A 5CXSA 3RG2A 3WKCA 4RDHA 3V80A 4EFLA 2C2YA 1QLJA 4D97A 2B5OA 3MF4A 3COYA 4PRZA 1OBHA 1WB5A 4ZZIA 4RTQA 5CDGA 3S28A 5HXAA 1OAOC 4X6XA 4RHYA 4JI3B 2YVUA 5J63A 3UMSA 5B4UA 2KSQA 2AFRA 1NUAA 3CUTA 4KAJA 4N7RA 3GFBA 5AK6A 5KJ1A 1AV6A 5IXSA 4PNPA 4EUKA 5EJEA 2RIPA 5AJUA 3PGA1 4FYVA 1JVNA 4X3PA 1VA5A 3ILVA 5KQMA 3AB7A 1YUBA 2FE1A 5CH5A 1XPUA 1HT1E 1WAMA 1R5OA 5IDVA 2NSHA 3ROTA 2HMTA 4H59A 4YHHB 4PC3A 1IHYA 1LLFA 1N0VC 7MDHA 2O3TA 2LBPA 1VPVA 1PDWA 2C5EA 4UFNA 4AIIA 4E07A 2VQEB 1DL5A 1XZKA 4IO1A 2QTGA 3WGJA 4EDHA 3GLGE 3TS1A 1OXVA 4QQ8A 1Z5OA 5FOQA 2OXCA 3CLSC 3SZUA 5KCZA 3TAUA 2R5NA 4UEWA 2IVZA 2W2LD 1L4GA 3QBJA 4TSFA 3RC3A 1TAUA 1G2IA 3Q2KA 1NBOA 4LDZA 5T57A 4ZT6A 1Y1PA 2AB0A 2G1UA 4YRDA 4CL3A 3TFOA 1CWUA 1J97A 1QS0A 1Z0IA 2ZBPA 1VL8A 4BFYA 3JAWA 3B6IA 4OHBA 3RRJA 1IHXA 4FKMA 1Y4ZA 1PNTA 1T6ZA 4U6SA 3T5AA 5HQTA 1DMSA 4D9JA 1KOGA 4AKGA 1O6BA 2REOA 1KJIA 1Q77A 4V0QA 5EL0A 1FDSA 4QOSA 3BWXA 3BH7A 1WXDA 3E9EA 4JH0A 3W8NA 1JBQA 2HPHA 2O23A 3DW1X 1GZSA 4AT1A 1X0XA 4NZ9A 3SXUA 2WEKA 3JQGA 1IHDA 3EH2A 3FJ1A 5AQ1A 4CI9A 3CISA 1PEKE 5F2OA 5BNZA 2W2VA 2O6HA 4M22A 5KYUA 3K16A 3MGCA 3N7TA 4O2AB 4HKTA 2B35A 2J4FA 3CZPA 4RACA 3S40A 2B7BA 4L6CA 3IJPA 1PLJA 1SXPA 1JKXA 4JC4A 3FWZA 4HQ0A 4WX2B 3IEVA 4UC0A 1FUYB 2GZAA 2HF8A 5EWJB 2E5FA 4QIHA 3GJYA 1Q0ZA 2FPRA 4P0QB 1ZI8A 1UC5B 2GSWA 2ZT6A 2LGJA 2QQFA 5LDHA 3Q3HA 2OV4A 1H66A 1XP5A 4PIPA 1E2KA 2PZKA 1FY2A 1JUDA 1M54A 3RSGA 3EZGA 4C4TA 5B4TA 4MITA 1NF2A 1D1QA 4EGAA 3FB4A 2ZI7A 4MI3A 2NO0A 5E9QA 2JGIA 4D43A 2ZZMA 3AHCA 3EIHA 3K8OE 3PQ3A 4KFCA 4I0WB 4M0LA 1SELA 4Y6PA 1FS6A 2VUHB 1J4AA 3I04M 3DV0B 4RWZA 3DVRX 1YDWA 4U8GA 4Z4QA 4P38A 3KHSA 4O4HF 4PNHA 3CLUC 2GBCA 2K2QB 1RAIA 2ZB2A 1A8QA 4YJ3B 4ZVRA 1G7RA 1A9PA 1NPTO 3WS7A 5FL3A 3NTQA 5IKOA 3TLBA 3O31A 1ZJ6A 2CVOA 3N8NA 3JYOA 4DKJA 1NYLA 1B2LA 1RYMA 1XDWA 2O05A 2X0KA 5TXGA 1N36B 2HA3A 1XNRB 1JIXA 1UJ2A 4JHXA 5CDYA 6PFKA 1GKLA 1ENZA 2YFHA 3HK2A 4POOA 4E4YA 4HDMB 2Q3DA 5D5HA 1RWBA 3VISA 1QAOA 5K7SA 2FWMX 2GAAA 4KHZA 5H82A 3TLEA 4OFXA 4UUMA 3SZLA 5JUWA 2WTUA 1X39A 5CNKA 3MLAA 4CCWA 1NRXA 4E09A 1XZLA 3O7WA 1E5TA 1IONA 1XHFA 4JX9A 1C4XA 1CR0A 3LLUA 4NZMA 1QVWA 1YS4A 1YZGA 1EFVB 2JD2A 3P9CA 4GZMA 2OCLA 4WKNA 3TL3A 1E2IA 1U2ZA 2Q7XA 4LJ8A 4F38A 2Y27A 4IIVA 4HS9A 4AJ2A 4D45A 5J4YA 1RBMA 4AECA 1EIZA 5AW7A 1FTQA 1L4HA 3AUSA 1P17A 1EK1A 2BJWA 2JS7A 4NICA 4YI5A 1G6HA 3FDXA 1N92A 3VTAA 2UZ1B 3SP1A 5FNVB 4YRZA 4L57A 3WGYA 4XWWA 1KMCA 2D7DA 4XR4A 4FFMA 1C1XB 2BHLA 5TIIA 2FWIA 2X8JB 4ZT4A 4ZU3A 4CBVA 2JLWA 1JLSA 1RQNA 2FI1A 4WY5A 1Q11A 1XTTA 3P9SA 1GNQA 1E64A 1RJWA 2A5DA 1RS0A 2PS0A 1ZRMA 3FIUA 4P7JA 5IVPA 2BH2A 2NUTB 3EGXB 2DYKA 2G5PA 3MQ4A 4NYJR 4AMUA 2NVUA 3GAAA 4ZJYA 1J49A 4KDRA 4KBGA 2WTAA 4QJ5A 4NULA 4JI2B 4LPKA 3HKCB 3KL2A 4YCLA 3TGLA 5SYMA 3R4CA 4RPKA 2TECE 2G1PA 4MS4B 3PF8A 4HYYA 1JHXA 1I3CA 5B2ZA 3WQQA 1MW8X 3EDMA 3IRVA 4GWGA 1P33A 1WXEA 2XUQA 4BV9A 2IYSA 4EYGA 1M2KA 1T5BA 4PWYA 3QG5A 4F92B 1U02A 3EEYA 4I7EA 3TIFA 1ULUA 2M6KA 1WF3A 1U0EA 3DZDA 1KDRA 1EEXB 2SICE 1NDQA 1YWGO 4IR7A 4CN9A 5KTNA 1KAGA 1QIGA 2QMEA 1L3BA 4JKOA 5DI3A 2ZT7A 3LXXA 3THYB 3H75A 1QCDA 4MV3A 4ZHQA 4MS1B 2HA5A 1J06A 3D5EA 3VZDA 2LCFA 1NBHA 3T99A 3HB9A 2YJ6A 3WBJA 1XA4A 4D6PA 3CA8A 2JLSA 4Z86A 1K0UA 2OM2A 4BRWA 3PEFA 3WK9A 1FVHA 4XD2A 5E9AA 2JJ8A 4JEHA 1VI6A 5CG1A 3C2QA 2CXXA 4DSAA 2PS1A 3KFXA 4NU8X 1BQEA 5DXFA 4ATNA 1PX2A 4IHJF 5B5SA 4K88A 3EEOA 2QENA 4RY0A 1H65A 3H5TA 1M5RA 3RT7A 4KMOA 3VKHA 3JWIA 1PS8A 3PXCX 3ZNQA 2A9OA 5LP6F 3O92A 2B20A 2JHGA 4GBED 1AHHA 2R8XA 3WK6A 2GA8A 3DLPX 3WG9A 3U1VA 2Q3MA 2YVAA 1XZHA 3F7OA 4HEQA 1NVAA 2JBWA 2WQZA 4NRDA 1C1DA 2PUWA 3C3WA 3KUXA 4B33A 3LPMA 1FW8A 2P40A 1T3GA 4ND3A 1I7PA 2R6R1 2R7AA 3N0WA 1SPXA 1XZEA 2J67A 3E5HA 4BDTA 3F0TA 4S24A 5BQXA 1ZM7A 1OKKD 3A3PA 3BWEA 3L93A 4DHEA 4K9LA 2GNAA 4Z3DA 2JKVA 2A5LA 3LY8A 2NVBA 1OH7A 1NXSA 1REQA 3BDVA 2AOTB 1ODLA 2GD2A 3CJTA 4TWRA 1OFIA 10MHA 3N76A 1PG2A 1L9XA 3QVMA 2ADOA 2A94A 3P0IA 3IEMA 3NTXA 3T1TA 3HCRA 2IEBA 5K8TA 1AKEA 1I5OA 2W6IA 2Q6VA 5JSQA 2PKCA 2Q9AA 4LHZA 2FUCA 3O73A 1OZHA 1ADFA 2XUDA 3BS4A 5AHRA 3UJBA 3TZLA 4JLBA 4Z9BA 5KU7A 2BD0A 3D0KA 2GD1O 2OVFA 3IALA 4YVFA 3O8BA 1RJFA 1YVEI 5E4JA 2Z58A 2VHXA 4D8TA 3DL0A 2JCSA 4RGVA 3VR3D 3PCXA 1TJNA 3ONDA 3HKBA 3C8DA 1VE5A 4KTTE 4R1TA 5KWVA 5BQ3A 2YZGA 2XUAA 2HEIA 4QASA 2XZTA 3UUWA 1VBNA 2PJZA 4FE3A 1EP9A 4FD3A 1CVIA 2Z8XA 4GBMA 4PHFA 4I1VA 3A36A 4Z0HO 4BP8A 2GN6A 3JARA 3KQMA 3GK3A 1I1QB 3QWBA 3LUFA 3I4CA 4LRUA 4BMPB 5KJFA 4B2PA 2CFOA 2H4XA 3OM0A 5A06A 5CB0A 5A04A 2WUWE 1IPHA 5HF5A 3MMZA 3W5JA 3PDUA 5K0NA 3G9QA 4QLBA 4P31A 4G85A 4EBFA 2UV8A 3ZU6A 1IZYA 1T25A 2CDRA 2Q9UA 1FP6A 3B6ZA 2W58A 2W70A 2V7QA 1R0WA 5K2OA 4M60A 1E1LA 1G41A 3KO8A 3EXEA 2FK8A 3AB3A 4C2UA 3K72B 2CYCA 5THQA 3GCWA 2C9YA 4L74A 4W7IA 5EE1A 3NI2A 2QF7A 2HBQA 4UVEA 2OV3A 3VPAA 5JPDA 2ZJ7A 1TFRA 1YTLA 2GZRA 1IH8A 3SX4A 2OHGA 1SBTA 4I1SA 2HK7A 2X5OA 5ENDA 4BX8A 4D9GA 3CUUA 3I9KA 4M3NA 3C5CA 2HLDA 5ALXA 2ECFA 1PL0A 5EKTA 2ZCUA 2SECE 3JD0A 1GNLA 4B3TB 2AKAB 4OA5A 2AYYA 3PS9A 4QPPA 3FMFA 1DPFA 1Q7BA 3QVGA 5KB3A 2C7QA 3RT9A 4GPZA 3JVUA 3V4VB 1XTUA 4TRMA 1ZEJA 1OI3A 3C4JA 1M1YB 1JDSA 1M2NA 3NB0A 2PH7A 5DHAA 4K05A 4NNOA 1E0DA 1RABA 4LOIA 3VPXA 4QFBA 2Y93A 5REQB 1NIJA 1YIDA 3QRWA 4QXQA 3TXXA 3P4XA 1JJBA 4O4JB 3EVBA 4Z9FA 4LOAA 3FVRA 4JKYA 4BOYA 2C2OA 2G0NA 2P3QA 3LU1A 3L4KA 4IICA 3QU5A 2JFWA 4JBIA 2FSVA 2G40A 4OXQA 1G4AE 4BKMA 3EGDB 4C14A 1VL1A 1RC1A 3RIEA 2J3IA 5CEEA 3PB3A 2QX6A 3A11A 1H8ED 1ZQ9A 2GZSA 4LXYA 3B9QA 1L7XA 4CYMA 4RE6A 4CKEB 3FTCA 4UNPA 2REBA 3QK7A 4GO1A 3HN7A 4URVR 1DC7A 3KOWA 2OA0A 4WWHA 1RAAA 1KPIA 1XZDA 5I7WA 3SFVA 4NG5A 1J9ZA 3U40A 1NQTA 3KT0A 1ZVKA 4RJJA 2Y2UA 3P5BA 2NO1A 3QHQA 3OQ1A 5TEWA 4BO4A 4DMKA 2Y1KA 4Y98A 1XZAA 1EVQA 2IYPA 5JLAA 5K0EA 2BFPA 3PDCA 4N5NA 4EEKA 2Q6KA 2C4NA 1L4MA 4QQKA 4I4TA 1DCFA 3S4YA 4N82A 4B4DA 4IV0A 4RCVA 5B1DA 2ZUEA 1MB2A 4YUVA 2CL0X 4QBFA 3ESYA 3H05A 4ABYA 4XYLA 3D2CA 1V1JA 3F7TA 1ODTC 1IEQA 2HI0A 3NJ8A 5JBNA 1XRPA 3LWZA 5IYZA 4LYGA 4MGZR 1RC0A 4V0NA 3DOOA 1T5HX 4EKNB 3OICA 4RA6B 5LNK6 4R3NA 5JSKA 4HGOA 3SFTA 5ICEA 3NMUF 3OETA 3M33A 1MF7A 4N9QA 4A0GA 1OPXA 3IIKA 4N8EA 3EHEA 3NGMA 4ZKDA 3MJRA 2CDAA 3OX3A 4YMHA 5L45A 4ZAZA 4G0VA 4R98A 1V3UA 3C3KA 3L9XA 1E2LA 1KK2A 4HNHA 2ORYA 1JKIA 3O8NA 1AHPA 5BRNA 2AFVA 2JPDA 5DE3A 3FLBA 3LRPA 3V4LA 3BL6A 5JE8A 4YV1A 4I9UA 2ZDQA 1NVEA 3IPAA 5CFMA 4HN2A 4LFBB 1YKSA 4KACA 5KSOA 2GT1A 1DKUA 1QKJA 2E7ZA 3Q8XB 3K6SB 1WSAA 4MXDA 2WFZA 3DQQA 2QTWB 4G5SA 4RIIA 3UXHA 3AR9A 1JAIA 1GD1O 2HHJA 3WLMA 4F2WA 2VDOB 1OIWA 2QWXA 4GOND 3WR5A 4C78A 3V6LA 2WU1A 3VOAA 1W0CA 4HCJA 4KW7A 2JBHA 5EP2A 4Z1MA 3DEFA 1GA1A 4YUWA 2JA1A 3IDOA 4KO1S 3GGPA 3I8XA 4KKVA 3KR2A 5FYDA 3HCWA 4FHEA 1OA0A 2BGKA 3H9EO 1T13A 1QC5A 4JOSA 3L8MA 4QGFA 2W9XA 3HYCA 3IQHX 2XE6A 5FUYA 2Q8QA 2PQMA 4L08A 3L1KA 4LZPA 1VJDA 1GZ5A 2FMKA 2C5SA 2PGLA 5CBPA 3LOPA 2YQ4A 1XNGA 4KLNA 4G9BA 2D5IA 3ISVA 4HLDA 3R9XB 3RYIA 1SMKA 2E9SA 2D7JA 3KHUA 3FWHA 4FXPA 4WAUA 2XCRB 3EPKA 2F9LA 2ZI6A 1PFWA 1G59A 3QFHA 3OT1B 2BCJQ 4V0OA 4CETA 2J31A 2L69A 5C5IA 3ERCA 5BSEA 5MFPA 2OGZA 2O0HA 2GK6A 4RZUA 5C51B 2Q4OA 3HGQA 3OQPA 4QU5A 1NBME 5EKUA 3NPMA 1E60A 5G4KB 2GJSA 3OESA 3STVA 5I9NA 3OKFA 1Y3AA 4GOLD 1LZKA 3WLRA 4UDOA 2QPAA 1Z36A 5ULLA 5IW8A 13PKA 1IK6A 2VQ6A 3FYDA 4YNBA 4YLEA 4QRDA 4N49A 4CQMD 1ENOA 5J2UA 1Z45A